2QPZA

Naphthalene 1,2-dioxygenase rieske ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
b'TVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGREIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase system ferredoxin subunit
publication title Determining Rieske cluster reduction potentials.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qpzA00
2XSHA 3L71E 3TGUE 1O7NA 1NU1E 2FYNC 1O7HA 4NBHD 2YFJA 2Q3WA 4P1BH 1SQPE 2E4QA 2NVGA 1SQVE 4OGQD 3L74E 2QJYC 4QUPA 3CX5E 2NUKA 2NUMA 3N0QA 1RIEA 3GB4A 2FYUE 3VMID 1KB9E 1O7WA 1UUWA 4AAYB 2ZT9D 4QURA 2YIUC 4P1CH 4NB9D 1KYOE 3GTSA 3FOUA 2QPZA 3DQYA 2E4PA 3GZXA 1NTKE 2B24A 2BCCE 2I7FA 3EQQA 4HJLA 1SQQE 1SJGA 3H1IE 4AIVA 1EG9A 4HKVA 3VMGD 1VM9A 2HMNA 4HM1A 1PPJE 2A06E 1PP9E 1RFSA 3H1KE 4QDDA 2B1XA 2CKFA 4H44D 1P84E 2YFLA 2NVFA 1Q90C 3GKEA 4HM7A 2E74D 4EMJB 4NBCD 4NBDD 3VCPA 2E76D 2HMLA 4NB8D 2DE7D 3C0DA 1ULIA 3GL0A 4QCKA 2D2CD 4HM3A 3VCAA 2JO6A 1G8KB 2GBXA 3H1LE 2BMQA 4NBFD 1NTZE 1UUVA 4NBED 1O7GA 1SQXE 5CXMA 2GBWA 3L70E 1VF5D 2XSOA 4HM4A 4NBAD 1SQBE 4QUQA 2HMOA 1O7MA 1ULJA 5HL4A 4HM0A 5KLVE 2E75D 2NVEA 4NBBD 2HMKA 2XRXA 3GOBA 4HM8A 4PD4E 4QDFA 2XR8A 3D89A 3GZYA 4HM6A 2ZYLA 1L0NE 2QJKC 2IBZE 3H1HE 5KLIC 1FQTA 4NBGD 2DE6D 2QJPC 1WQLA 1NDOA 5AEUA 3CWBE 4H0LD 5AEWA 4U3FE 1NTME 1G8JB 2NWFA 1BCCE 2HMMA 3EN1A 1NYKA 3H1JE 4QDFB 2HMJA 2YVJB 3L73E 1BE3E 2DE5D 5BOKA 4HM2A 4H13D 1L0LE 1EZVE 3CXHE 2BMRA 1VCKA 3AZCA 4QDCA 3GL2A 3VMHD 1O7PA 2JZAA 4HM5A 1ZRTE 2BMOA 3L72E 4PV1D 3GTEA 1JM1A 2YFIA 3BCCE 3GCEA 3L75E 5KKZC
chains in the Genus database with same CATH superfamily
2XSHA 3L71E 3TGUE 1O7NA 1NU1E 2FYNC 1O7HA 4NBHD 2YFJA 2Q3WA 4P1BH 1SQPE 2E4QA 2NVGA 1SQVE 4OGQD 3L74E 2QJYC 4QUPA 3CX5E 2NUKA 2NUMA 3N0QA 1RIEA 3GB4A 2FYUE 3VMID 1KB9E 1O7WA 1UUWA 4AAYB 2ZT9D 4QURA 2YIUC 4P1CH 4NB9D 1KYOE 3GTSA 3FOUA 2QPZA 3DQYA 2E4PA 3GZXA 1NTKE 2B24A 2BCCE 2I7FA 3EQQA 4HJLA 1SQQE 1SJGA 3H1IE 4AIVA 1EG9A 4HKVA 3VMGD 1VM9A 2HMNA 4HM1A 1PPJE 2A06E 1PP9E 1RFSA 3H1KE 4QDDA 2B1XA 2CKFA 4H44D 1P84E 2YFLA 2NVFA 1Q90C 3GKEA 4HM7A 2E74D 4EMJB 4NBCD 4NBDD 3VCPA 2E76D 2HMLA 4NB8D 2DE7D 3C0DA 1ULIA 3GL0A 4QCKA 2D2CD 4HM3A 3VCAA 2JO6A 1G8KB 2GBXA 3H1LE 2BMQA 4NBFD 1NTZE 1UUVA 4NBED 1O7GA 1SQXE 5CXMA 2GBWA 3L70E 1VF5D 2XSOA 4HM4A 4NBAD 1SQBE 4QUQA 2HMOA 1O7MA 1ULJA 5HL4A 4HM0A 5KLVE 2E75D 2NVEA 4NBBD 2HMKA 2XRXA 3GOBA 4HM8A 4PD4E 4QDFA 2XR8A 3D89A 3GZYA 4HM6A 2ZYLA 1L0NE 2QJKC 2IBZE 3H1HE 5KLIC 1FQTA 4NBGD 2DE6D 2QJPC 1WQLA 1NDOA 5AEUA 3CWBE 4H0LD 5AEWA 4U3FE 1NTME 1G8JB 2NWFA 1BCCE 2HMMA 3EN1A 1NYKA 3H1JE 4QDFB 2HMJA 2YVJB 3L73E 1BE3E 2DE5D 5BOKA 4HM2A 4H13D 1L0LE 1EZVE 3CXHE 2BMRA 1VCKA 3AZCA 4QDCA 3GL2A 3VMHD 1O7PA 2JZAA 4HM5A 1ZRTE 2BMOA 3L72E 4PV1D 3GTEA 1JM1A 2YFIA 3BCCE 3GCEA 3L75E 5KKZC
chains in the Genus database with same CATH topology
2XSHA 3L71E 3TGUE 1O7NA 1NU1E 2FYNC 1O7HA 4NBHD 2YFJA 2Q3WA 4P1BH 1SQPE 2E4QA 2NVGA 1SQVE 4OGQD 3L74E 2QJYC 4QUPA 3CX5E 2NUKA 2NUMA 3N0QA 1RIEA 3GB4A 2FYUE 3VMID 1KB9E 1O7WA 1UUWA 4AAYB 2ZT9D 4QURA 2YIUC 4P1CH 4NB9D 1KYOE 3GTSA 3FOUA 2QPZA 3DQYA 2E4PA 3GZXA 1NTKE 2B24A 2BCCE 2I7FA 3EQQA 4HJLA 1SQQE 1SJGA 3H1IE 4AIVA 1EG9A 4HKVA 3VMGD 1VM9A 2HMNA 4HM1A 1PPJE 2A06E 1PP9E 1RFSA 3H1KE 4QDDA 2B1XA 2CKFA 4H44D 1P84E 2YFLA 2NVFA 1Q90C 3GKEA 4HM7A 2E74D 4EMJB 4NBCD 4NBDD 3VCPA 2E76D 2HMLA 4NB8D 2DE7D 3C0DA 1ULIA 3GL0A 4QCKA 2D2CD 4HM3A 3VCAA 2JO6A 1G8KB 2GBXA 3H1LE 2BMQA 4NBFD 1NTZE 1UUVA 4NBED 1O7GA 1SQXE 5CXMA 2GBWA 3L70E 1VF5D 2XSOA 4HM4A 4NBAD 1SQBE 4QUQA 2HMOA 1O7MA 1ULJA 5HL4A 4HM0A 5KLVE 2E75D 2NVEA 4NBBD 2HMKA 2XRXA 3GOBA 4HM8A 4PD4E 4QDFA 2XR8A 3D89A 3GZYA 4HM6A 2ZYLA 1L0NE 2QJKC 2IBZE 3H1HE 5KLIC 1FQTA 4NBGD 2DE6D 2QJPC 1WQLA 1NDOA 5AEUA 3CWBE 4H0LD 5AEWA 4U3FE 1NTME 1G8JB 2NWFA 1BCCE 2HMMA 3EN1A 1NYKA 3H1JE 4QDFB 2HMJA 2YVJB 3L73E 1BE3E 2DE5D 5BOKA 4HM2A 4H13D 1L0LE 1EZVE 3CXHE 2BMRA 1VCKA 3AZCA 4QDCA 3GL2A 3VMHD 1O7PA 2JZAA 4HM5A 1ZRTE 2BMOA 3L72E 4PV1D 3GTEA 1JM1A 2YFIA 3BCCE 3GCEA 3L75E 5KKZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSH A;  3L71 E;  3TGU E;  1O7N A;  1NU1 E;  2FYN C;  1O7H A;  4NBH D;  2YFJ A;  2Q3W A;  4P1B H;  1SQP E;  2E4Q A;  2NVG A;  1SQV E;  4OGQ D;  3L74 E;  2QJY C;  4QUP A;  3CX5 E;  2NUK A;  2NUM A;  3N0Q A;  1RIE A;  3GB4 A;  2FYU E;  3VMI D;  1KB9 E;  1O7W A;  1UUW A;  4AAY B;  2ZT9 D;  4QUR A;  2YIU C;  4P1C H;  4NB9 D;  1KYO E;  3GTS A;  3FOU A;  2QPZ A;  3DQY A;  2E4P A;  3GZX A;  1NTK E;  2B24 A;  2BCC E;  2I7F A;  3EQQ A;  4HJL A;  1SQQ E;  1SJG A;  3H1I E;  4AIV A;  1EG9 A;  4HKV A;  3VMG D;  1VM9 A;  2HMN A;  4HM1 A;  1PPJ E;  2A06 E;  1PP9 E;  1RFS A;  3H1K E;  4QDD A;  2B1X A;  2CKF A;  4H44 D;  1P84 E;  2YFL A;  2NVF A;  1Q90 C;  3GKE A;  4HM7 A;  2E74 D;  4EMJ B;  4NBC D;  4NBD D;  3VCP A;  2E76 D;  2HML A;  4NB8 D;  2DE7 D;  3C0D A;  1ULI A;  3GL0 A;  4QCK A;  2D2C D;  4HM3 A;  3VCA A;  2JO6 A;  1G8K B;  2GBX A;  3H1L E;  2BMQ A;  4NBF D;  1NTZ E;  1UUV A;  4NBE D;  1O7G A;  1SQX E;  5CXM A;  2GBW A;  3L70 E;  1VF5 D;  2XSO A;  4HM4 A;  4NBA D;  1SQB E;  4QUQ A;  2HMO A;  1O7M A;  1ULJ A;  5HL4 A;  4HM0 A;  5KLV E;  2E75 D;  2NVE A;  4NBB D;  2HMK A;  2XRX A;  3GOB A;  4HM8 A;  4PD4 E;  4QDF A;  2XR8 A;  3D89 A;  3GZY A;  4HM6 A;  2ZYL A;  1L0N E;  2QJK C;  2IBZ E;  3H1H E;  5KLI C;  1FQT A;  4NBG D;  2DE6 D;  2QJP C;  1WQL A;  1NDO A;  5AEU A;  3CWB E;  4H0L D;  5AEW A;  4U3F E;  1NTM E;  1G8J B;  2NWF A;  1BCC E;  2HMM A;  3EN1 A;  1NYK A;  3H1J E;  4QDF B;  2HMJ A;  2YVJ B;  3L73 E;  1BE3 E;  2DE5 D;  5BOK A;  4HM2 A;  4H13 D;  1L0L E;  1EZV E;  3CXH E;  2BMR A;  1VCK A;  3AZC A;  4QDC A;  3GL2 A;  3VMH D;  1O7P A;  2JZA A;  4HM5 A;  1ZRT E;  2BMO A;  3L72 E;  4PV1 D;  3GTE A;  1JM1 A;  2YFI A;  3BCC E;  3GCE A;  3L75 E;  5KKZ C; 
#chains in the Genus database with same CATH topology
 2XSH A;  3L71 E;  3TGU E;  1O7N A;  1NU1 E;  2FYN C;  1O7H A;  4NBH D;  2YFJ A;  2Q3W A;  4P1B H;  1SQP E;  2E4Q A;  2NVG A;  1SQV E;  4OGQ D;  3L74 E;  2QJY C;  4QUP A;  3CX5 E;  2NUK A;  2NUM A;  3N0Q A;  1RIE A;  3GB4 A;  2FYU E;  3VMI D;  1KB9 E;  1O7W A;  1UUW A;  4AAY B;  2ZT9 D;  4QUR A;  2YIU C;  4P1C H;  4NB9 D;  1KYO E;  3GTS A;  3FOU A;  2QPZ A;  3DQY A;  2E4P A;  3GZX A;  1NTK E;  2B24 A;  2BCC E;  2I7F A;  3EQQ A;  4HJL A;  1SQQ E;  1SJG A;  3H1I E;  4AIV A;  1EG9 A;  4HKV A;  3VMG D;  1VM9 A;  2HMN A;  4HM1 A;  1PPJ E;  2A06 E;  1PP9 E;  1RFS A;  3H1K E;  4QDD A;  2B1X A;  2CKF A;  4H44 D;  1P84 E;  2YFL A;  2NVF A;  1Q90 C;  3GKE A;  4HM7 A;  2E74 D;  4EMJ B;  4NBC D;  4NBD D;  3VCP A;  2E76 D;  2HML A;  4NB8 D;  2DE7 D;  3C0D A;  1ULI A;  3GL0 A;  4QCK A;  2D2C D;  4HM3 A;  3VCA A;  2JO6 A;  1G8K B;  2GBX A;  3H1L E;  2BMQ A;  4NBF D;  1NTZ E;  1UUV A;  4NBE D;  1O7G A;  1SQX E;  5CXM A;  2GBW A;  3L70 E;  1VF5 D;  2XSO A;  4HM4 A;  4NBA D;  1SQB E;  4QUQ A;  2HMO A;  1O7M A;  1ULJ A;  5HL4 A;  4HM0 A;  5KLV E;  2E75 D;  2NVE A;  4NBB D;  2HMK A;  2XRX A;  3GOB A;  4HM8 A;  4PD4 E;  4QDF A;  2XR8 A;  3D89 A;  3GZY A;  4HM6 A;  2ZYL A;  1L0N E;  2QJK C;  2IBZ E;  3H1H E;  5KLI C;  1FQT A;  4NBG D;  2DE6 D;  2QJP C;  1WQL A;  1NDO A;  5AEU A;  3CWB E;  4H0L D;  5AEW A;  4U3F E;  1NTM E;  1G8J B;  2NWF A;  1BCC E;  2HMM A;  3EN1 A;  1NYK A;  3H1J E;  4QDF B;  2HMJ A;  2YVJ B;  3L73 E;  1BE3 E;  2DE5 D;  5BOK A;  4HM2 A;  4H13 D;  1L0L E;  1EZV E;  3CXH E;  2BMR A;  1VCK A;  3AZC A;  4QDC A;  3GL2 A;  3VMH D;  1O7P A;  2JZA A;  4HM5 A;  1ZRT E;  2BMO A;  3L72 E;  4PV1 D;  3GTE A;  1JM1 A;  2YFI A;  3BCC E;  3GCE A;  3L75 E;  5KKZ C; 
#chains in the Genus database with same CATH homology
 2XSH A;  3L71 E;  3TGU E;  1O7N A;  1NU1 E;  2FYN C;  1O7H A;  4NBH D;  2YFJ A;  2Q3W A;  4P1B H;  1SQP E;  2E4Q A;  2NVG A;  1SQV E;  4OGQ D;  3L74 E;  2QJY C;  4QUP A;  3CX5 E;  2NUK A;  2NUM A;  3N0Q A;  1RIE A;  3GB4 A;  2FYU E;  3VMI D;  1KB9 E;  1O7W A;  1UUW A;  4AAY B;  2ZT9 D;  4QUR A;  2YIU C;  4P1C H;  4NB9 D;  1KYO E;  3GTS A;  3FOU A;  2QPZ A;  3DQY A;  2E4P A;  3GZX A;  1NTK E;  2B24 A;  2BCC E;  2I7F A;  3EQQ A;  4HJL A;  1SQQ E;  1SJG A;  3H1I E;  4AIV A;  1EG9 A;  4HKV A;  3VMG D;  1VM9 A;  2HMN A;  4HM1 A;  1PPJ E;  2A06 E;  1PP9 E;  1RFS A;  3H1K E;  4QDD A;  2B1X A;  2CKF A;  4H44 D;  1P84 E;  2YFL A;  2NVF A;  1Q90 C;  3GKE A;  4HM7 A;  2E74 D;  4EMJ B;  4NBC D;  4NBD D;  3VCP A;  2E76 D;  2HML A;  4NB8 D;  2DE7 D;  3C0D A;  1ULI A;  3GL0 A;  4QCK A;  2D2C D;  4HM3 A;  3VCA A;  2JO6 A;  1G8K B;  2GBX A;  3H1L E;  2BMQ A;  4NBF D;  1NTZ E;  1UUV A;  4NBE D;  1O7G A;  1SQX E;  5CXM A;  2GBW A;  3L70 E;  1VF5 D;  2XSO A;  4HM4 A;  4NBA D;  1SQB E;  4QUQ A;  2HMO A;  1O7M A;  1ULJ A;  5HL4 A;  4HM0 A;  5KLV E;  2E75 D;  2NVE A;  4NBB D;  2HMK A;  2XRX A;  3GOB A;  4HM8 A;  4PD4 E;  4QDF A;  2XR8 A;  3D89 A;  3GZY A;  4HM6 A;  2ZYL A;  1L0N E;  2QJK C;  2IBZ E;  3H1H E;  5KLI C;  1FQT A;  4NBG D;  2DE6 D;  2QJP C;  1WQL A;  1NDO A;  5AEU A;  3CWB E;  4H0L D;  5AEW A;  4U3F E;  1NTM E;  1G8J B;  2NWF A;  1BCC E;  2HMM A;  3EN1 A;  1NYK A;  3H1J E;  4QDF B;  2HMJ A;  2YVJ B;  3L73 E;  1BE3 E;  2DE5 D;  5BOK A;  4HM2 A;  4H13 D;  1L0L E;  1EZV E;  3CXH E;  2BMR A;  1VCK A;  3AZC A;  4QDC A;  3GL2 A;  3VMH D;  1O7P A;  2JZA A;  4HM5 A;  1ZRT E;  2BMO A;  3L72 E;  4PV1 D;  3GTE A;  1JM1 A;  2YFI A;  3BCC E;  3GCE A;  3L75 E;  5KKZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...