2QPZA

Naphthalene 1,2-dioxygenase rieske ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
TVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGREIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determining Rieske cluster reduction potentials.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
molecule keywords Naphthalene 1,2-dioxygenase system ferredoxin subunit
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qpzA00
4NBAD 3GTSA 2XR8A 1NU1E 4AIVA 2B1XA 3BCCE 2HMKA 1RIEA 1ZRTE 1O7HA 2BCCE 2XSHA 2YFJA 1NYKA 2HMNA 2YIUC 1NDOA 2NUMA 1O7NA 2BMOA 3H1HE 4EMJB 2XSOA 1P84E 3L71E 1ULJA 3EQQA 3GZYA 2I7FA 3GL2A 3TGUE 5CXMA 1O7PA 2ZT9D 4NBFD 2IBZE 3L75E 2HMLA 4U3FE 4HM7A 1SQQE 2QPZA 3FOUA 2QJKC 5AEUA 1SQVE 1PP9E 1VCKA 1RFSA 2A06E 4NBGD 3L72E 1PPJE 1WQLA 1NTKE 1UUWA 1VF5D 2YFLA 2E76D 4H13D 4HM3A 2NVFA 4NB8D 4QUQA 2E74D 1O7GA 3H1IE 4HM5A 3H1JE 1ULIA 1O7MA 4HKVA 2Q3WA 4NB9D 4NBBD 3N0QA 1EG9A 3VMHD 2NWFA 5KLIC 2QJYC 4H0LD 3AZCA 2QJPC 4P1CH 2DE5D 4P1BH 2JO6A 1KYOE 4NBCD 4QURA 2HMMA 3CX5E 3CWBE 5AEWA 4HM2A 2HMOA 1SQXE 2NVGA 2GBWA 2YVJB 2E4PA 1BCCE 4PD4E 4QDFA 4PV1D 4HM6A 1NTME 2JZAA 3L74E 5KKZC 1JM1A 2FYUE 1SQBE 3VMGD 1L0NE 4QUPA 2B24A 4HM1A 1G8KB 4QDCA 5BOKA 1KB9E 3GTEA 4H44D 4OGQD 1O7WA 3EN1A 2DE7D 1UUVA 2CKFA 3H1LE 1VM9A 1SJGA 3VCAA 4QDFB 2D2CD 3GOBA 3GZXA 4HM4A 4NBDD 2YFIA 2HMJA 3VMID 1BE3E 5HL4A 1Q90C 4HJLA 2NUKA 3GL0A 3GCEA 3GKEA 4NBHD 2E75D 2ZYLA 3L73E 4HM0A 2DE6D 3DQYA 1SQPE 4QCKA 1L0LE 2BMRA 2FYNC 5KLVE 3VCPA 4NBED 4HM8A 3GB4A 3C0DA 3D89A 1G8JB 2XRXA 3CXHE 3H1KE 2NVEA 3L70E 2GBXA 1EZVE 1FQTA 4QDDA 2BMQA 4AAYB 1NTZE 2E4QA
chains in the Genus database with same CATH superfamily
4NBAD 3GTSA 2XR8A 1NU1E 4AIVA 2B1XA 3BCCE 2HMKA 1RIEA 1ZRTE 1O7HA 2BCCE 2XSHA 2YFJA 1NYKA 2HMNA 2YIUC 1NDOA 2NUMA 1O7NA 2BMOA 3H1HE 4EMJB 2XSOA 1P84E 3L71E 1ULJA 3EQQA 3GZYA 2I7FA 3GL2A 3TGUE 5CXMA 1O7PA 2ZT9D 4NBFD 2IBZE 3L75E 2HMLA 4U3FE 4HM7A 1SQQE 2QPZA 3FOUA 2QJKC 5AEUA 1SQVE 1PP9E 1VCKA 1RFSA 2A06E 4NBGD 3L72E 1PPJE 1WQLA 1NTKE 1UUWA 1VF5D 2YFLA 2E76D 4H13D 4HM3A 2NVFA 4NB8D 4QUQA 2E74D 1O7GA 3H1IE 4HM5A 3H1JE 1ULIA 1O7MA 4HKVA 2Q3WA 4NB9D 4NBBD 3N0QA 1EG9A 3VMHD 2NWFA 5KLIC 2QJYC 4H0LD 3AZCA 2QJPC 4P1CH 2DE5D 4P1BH 2JO6A 1KYOE 4NBCD 4QURA 2HMMA 3CX5E 3CWBE 5AEWA 4HM2A 2HMOA 1SQXE 2NVGA 2GBWA 2YVJB 2E4PA 1BCCE 4PD4E 4QDFA 4PV1D 4HM6A 1NTME 2JZAA 3L74E 5KKZC 1JM1A 2FYUE 1SQBE 3VMGD 1L0NE 4QUPA 2B24A 4HM1A 1G8KB 4QDCA 5BOKA 1KB9E 3GTEA 4H44D 4OGQD 1O7WA 3EN1A 2DE7D 1UUVA 2CKFA 3H1LE 1VM9A 1SJGA 3VCAA 4QDFB 2D2CD 3GOBA 3GZXA 4HM4A 4NBDD 2YFIA 2HMJA 3VMID 1BE3E 5HL4A 1Q90C 4HJLA 2NUKA 3GL0A 3GCEA 3GKEA 4NBHD 2E75D 2ZYLA 3L73E 4HM0A 2DE6D 3DQYA 1SQPE 4QCKA 1L0LE 2BMRA 2FYNC 5KLVE 3VCPA 4NBED 4HM8A 3GB4A 3C0DA 3D89A 1G8JB 2XRXA 3CXHE 3H1KE 2NVEA 3L70E 2GBXA 1EZVE 1FQTA 4QDDA 2BMQA 4AAYB 1NTZE 2E4QA
chains in the Genus database with same CATH topology
4NBAD 3GTSA 2XR8A 1NU1E 4AIVA 2B1XA 3BCCE 2HMKA 1RIEA 1ZRTE 1O7HA 2BCCE 2XSHA 2YFJA 1NYKA 2HMNA 2YIUC 1NDOA 2NUMA 1O7NA 2BMOA 3H1HE 4EMJB 2XSOA 1P84E 3L71E 1ULJA 3EQQA 3GZYA 2I7FA 3GL2A 3TGUE 5CXMA 1O7PA 2ZT9D 4NBFD 2IBZE 3L75E 2HMLA 4U3FE 4HM7A 1SQQE 2QPZA 3FOUA 2QJKC 5AEUA 1SQVE 1PP9E 1VCKA 1RFSA 2A06E 4NBGD 3L72E 1PPJE 1WQLA 1NTKE 1UUWA 1VF5D 2YFLA 2E76D 4H13D 4HM3A 2NVFA 4NB8D 4QUQA 2E74D 1O7GA 3H1IE 4HM5A 3H1JE 1ULIA 1O7MA 4HKVA 2Q3WA 4NB9D 4NBBD 3N0QA 1EG9A 3VMHD 2NWFA 5KLIC 2QJYC 4H0LD 3AZCA 2QJPC 4P1CH 2DE5D 4P1BH 2JO6A 1KYOE 4NBCD 4QURA 2HMMA 3CX5E 3CWBE 5AEWA 4HM2A 2HMOA 1SQXE 2NVGA 2GBWA 2YVJB 2E4PA 1BCCE 4PD4E 4QDFA 4PV1D 4HM6A 1NTME 2JZAA 3L74E 5KKZC 1JM1A 2FYUE 1SQBE 3VMGD 1L0NE 4QUPA 2B24A 4HM1A 1G8KB 4QDCA 5BOKA 1KB9E 3GTEA 4H44D 4OGQD 1O7WA 3EN1A 2DE7D 1UUVA 2CKFA 3H1LE 1VM9A 1SJGA 3VCAA 4QDFB 2D2CD 3GOBA 3GZXA 4HM4A 4NBDD 2YFIA 2HMJA 3VMID 1BE3E 5HL4A 1Q90C 4HJLA 2NUKA 3GL0A 3GCEA 3GKEA 4NBHD 2E75D 2ZYLA 3L73E 4HM0A 2DE6D 3DQYA 1SQPE 4QCKA 1L0LE 2BMRA 2FYNC 5KLVE 3VCPA 4NBED 4HM8A 3GB4A 3C0DA 3D89A 1G8JB 2XRXA 3CXHE 3H1KE 2NVEA 3L70E 2GBXA 1EZVE 1FQTA 4QDDA 2BMQA 4AAYB 1NTZE 2E4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBA D;  3GTS A;  2XR8 A;  1NU1 E;  4AIV A;  2B1X A;  3BCC E;  2HMK A;  1RIE A;  1ZRT E;  1O7H A;  2BCC E;  2XSH A;  2YFJ A;  1NYK A;  2HMN A;  2YIU C;  1NDO A;  2NUM A;  1O7N A;  2BMO A;  3H1H E;  4EMJ B;  2XSO A;  1P84 E;  3L71 E;  1ULJ A;  3EQQ A;  3GZY A;  2I7F A;  3GL2 A;  3TGU E;  5CXM A;  1O7P A;  2ZT9 D;  4NBF D;  2IBZ E;  3L75 E;  2HML A;  4U3F E;  4HM7 A;  1SQQ E;  2QPZ A;  3FOU A;  2QJK C;  5AEU A;  1SQV E;  1PP9 E;  1VCK A;  1RFS A;  2A06 E;  4NBG D;  3L72 E;  1PPJ E;  1WQL A;  1NTK E;  1UUW A;  1VF5 D;  2YFL A;  2E76 D;  4H13 D;  4HM3 A;  2NVF A;  4NB8 D;  4QUQ A;  2E74 D;  1O7G A;  3H1I E;  4HM5 A;  3H1J E;  1ULI A;  1O7M A;  4HKV A;  2Q3W A;  4NB9 D;  4NBB D;  3N0Q A;  1EG9 A;  3VMH D;  2NWF A;  5KLI C;  2QJY C;  4H0L D;  3AZC A;  2QJP C;  4P1C H;  2DE5 D;  4P1B H;  2JO6 A;  1KYO E;  4NBC D;  4QUR A;  2HMM A;  3CX5 E;  3CWB E;  5AEW A;  4HM2 A;  2HMO A;  1SQX E;  2NVG A;  2GBW A;  2YVJ B;  2E4P A;  1BCC E;  4PD4 E;  4QDF A;  4PV1 D;  4HM6 A;  1NTM E;  2JZA A;  3L74 E;  5KKZ C;  1JM1 A;  2FYU E;  1SQB E;  3VMG D;  1L0N E;  4QUP A;  2B24 A;  4HM1 A;  1G8K B;  4QDC A;  5BOK A;  1KB9 E;  3GTE A;  4H44 D;  4OGQ D;  1O7W A;  3EN1 A;  2DE7 D;  1UUV A;  2CKF A;  3H1L E;  1VM9 A;  1SJG A;  3VCA A;  4QDF B;  2D2C D;  3GOB A;  3GZX A;  4HM4 A;  4NBD D;  2YFI A;  2HMJ A;  3VMI D;  1BE3 E;  5HL4 A;  1Q90 C;  4HJL A;  2NUK A;  3GL0 A;  3GCE A;  3GKE A;  4NBH D;  2E75 D;  2ZYL A;  3L73 E;  4HM0 A;  2DE6 D;  3DQY A;  1SQP E;  4QCK A;  1L0L E;  2BMR A;  2FYN C;  5KLV E;  3VCP A;  4NBE D;  4HM8 A;  3GB4 A;  3C0D A;  3D89 A;  1G8J B;  2XRX A;  3CXH E;  3H1K E;  2NVE A;  3L70 E;  2GBX A;  1EZV E;  1FQT A;  4QDD A;  2BMQ A;  4AAY B;  1NTZ E;  2E4Q A; 
#chains in the Genus database with same CATH topology
 4NBA D;  3GTS A;  2XR8 A;  1NU1 E;  4AIV A;  2B1X A;  3BCC E;  2HMK A;  1RIE A;  1ZRT E;  1O7H A;  2BCC E;  2XSH A;  2YFJ A;  1NYK A;  2HMN A;  2YIU C;  1NDO A;  2NUM A;  1O7N A;  2BMO A;  3H1H E;  4EMJ B;  2XSO A;  1P84 E;  3L71 E;  1ULJ A;  3EQQ A;  3GZY A;  2I7F A;  3GL2 A;  3TGU E;  5CXM A;  1O7P A;  2ZT9 D;  4NBF D;  2IBZ E;  3L75 E;  2HML A;  4U3F E;  4HM7 A;  1SQQ E;  2QPZ A;  3FOU A;  2QJK C;  5AEU A;  1SQV E;  1PP9 E;  1VCK A;  1RFS A;  2A06 E;  4NBG D;  3L72 E;  1PPJ E;  1WQL A;  1NTK E;  1UUW A;  1VF5 D;  2YFL A;  2E76 D;  4H13 D;  4HM3 A;  2NVF A;  4NB8 D;  4QUQ A;  2E74 D;  1O7G A;  3H1I E;  4HM5 A;  3H1J E;  1ULI A;  1O7M A;  4HKV A;  2Q3W A;  4NB9 D;  4NBB D;  3N0Q A;  1EG9 A;  3VMH D;  2NWF A;  5KLI C;  2QJY C;  4H0L D;  3AZC A;  2QJP C;  4P1C H;  2DE5 D;  4P1B H;  2JO6 A;  1KYO E;  4NBC D;  4QUR A;  2HMM A;  3CX5 E;  3CWB E;  5AEW A;  4HM2 A;  2HMO A;  1SQX E;  2NVG A;  2GBW A;  2YVJ B;  2E4P A;  1BCC E;  4PD4 E;  4QDF A;  4PV1 D;  4HM6 A;  1NTM E;  2JZA A;  3L74 E;  5KKZ C;  1JM1 A;  2FYU E;  1SQB E;  3VMG D;  1L0N E;  4QUP A;  2B24 A;  4HM1 A;  1G8K B;  4QDC A;  5BOK A;  1KB9 E;  3GTE A;  4H44 D;  4OGQ D;  1O7W A;  3EN1 A;  2DE7 D;  1UUV A;  2CKF A;  3H1L E;  1VM9 A;  1SJG A;  3VCA A;  4QDF B;  2D2C D;  3GOB A;  3GZX A;  4HM4 A;  4NBD D;  2YFI A;  2HMJ A;  3VMI D;  1BE3 E;  5HL4 A;  1Q90 C;  4HJL A;  2NUK A;  3GL0 A;  3GCE A;  3GKE A;  4NBH D;  2E75 D;  2ZYL A;  3L73 E;  4HM0 A;  2DE6 D;  3DQY A;  1SQP E;  4QCK A;  1L0L E;  2BMR A;  2FYN C;  5KLV E;  3VCP A;  4NBE D;  4HM8 A;  3GB4 A;  3C0D A;  3D89 A;  1G8J B;  2XRX A;  3CXH E;  3H1K E;  2NVE A;  3L70 E;  2GBX A;  1EZV E;  1FQT A;  4QDD A;  2BMQ A;  4AAY B;  1NTZ E;  2E4Q A; 
#chains in the Genus database with same CATH homology
 4NBA D;  3GTS A;  2XR8 A;  1NU1 E;  4AIV A;  2B1X A;  3BCC E;  2HMK A;  1RIE A;  1ZRT E;  1O7H A;  2BCC E;  2XSH A;  2YFJ A;  1NYK A;  2HMN A;  2YIU C;  1NDO A;  2NUM A;  1O7N A;  2BMO A;  3H1H E;  4EMJ B;  2XSO A;  1P84 E;  3L71 E;  1ULJ A;  3EQQ A;  3GZY A;  2I7F A;  3GL2 A;  3TGU E;  5CXM A;  1O7P A;  2ZT9 D;  4NBF D;  2IBZ E;  3L75 E;  2HML A;  4U3F E;  4HM7 A;  1SQQ E;  2QPZ A;  3FOU A;  2QJK C;  5AEU A;  1SQV E;  1PP9 E;  1VCK A;  1RFS A;  2A06 E;  4NBG D;  3L72 E;  1PPJ E;  1WQL A;  1NTK E;  1UUW A;  1VF5 D;  2YFL A;  2E76 D;  4H13 D;  4HM3 A;  2NVF A;  4NB8 D;  4QUQ A;  2E74 D;  1O7G A;  3H1I E;  4HM5 A;  3H1J E;  1ULI A;  1O7M A;  4HKV A;  2Q3W A;  4NB9 D;  4NBB D;  3N0Q A;  1EG9 A;  3VMH D;  2NWF A;  5KLI C;  2QJY C;  4H0L D;  3AZC A;  2QJP C;  4P1C H;  2DE5 D;  4P1B H;  2JO6 A;  1KYO E;  4NBC D;  4QUR A;  2HMM A;  3CX5 E;  3CWB E;  5AEW A;  4HM2 A;  2HMO A;  1SQX E;  2NVG A;  2GBW A;  2YVJ B;  2E4P A;  1BCC E;  4PD4 E;  4QDF A;  4PV1 D;  4HM6 A;  1NTM E;  2JZA A;  3L74 E;  5KKZ C;  1JM1 A;  2FYU E;  1SQB E;  3VMG D;  1L0N E;  4QUP A;  2B24 A;  4HM1 A;  1G8K B;  4QDC A;  5BOK A;  1KB9 E;  3GTE A;  4H44 D;  4OGQ D;  1O7W A;  3EN1 A;  2DE7 D;  1UUV A;  2CKF A;  3H1L E;  1VM9 A;  1SJG A;  3VCA A;  4QDF B;  2D2C D;  3GOB A;  3GZX A;  4HM4 A;  4NBD D;  2YFI A;  2HMJ A;  3VMI D;  1BE3 E;  5HL4 A;  1Q90 C;  4HJL A;  2NUK A;  3GL0 A;  3GCE A;  3GKE A;  4NBH D;  2E75 D;  2ZYL A;  3L73 E;  4HM0 A;  2DE6 D;  3DQY A;  1SQP E;  4QCK A;  1L0L E;  2BMR A;  2FYN C;  5KLV E;  3VCP A;  4NBE D;  4HM8 A;  3GB4 A;  3C0D A;  3D89 A;  1G8J B;  2XRX A;  3CXH E;  3H1K E;  2NVE A;  3L70 E;  2GBX A;  1EZV E;  1FQT A;  4QDD A;  2BMQ A;  4AAY B;  1NTZ E;  2E4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...