2QPZA

Naphthalene 1,2-dioxygenase rieske ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
TVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGREIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Naphthalene 1,2-dioxygenase system ferredoxin subunit
publication title Determining Rieske cluster reduction potentials.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qpzA00
3GOBA 3FOUA 2NVEA 4HM7A 3CX5E 4QUPA 3GZYA 1VF5D 4AAYB 1SJGA 2CKFA 2NVGA 2BCCE 3L75E 1L0LE 2XSOA 1NDOA 3EQQA 4H44D 4P1CH 3H1IE 4NBED 2D2CD 2JO6A 4P1BH 4HM5A 5CXMA 2YVJB 4NB9D 1VM9A 5HL4A 2HMJA 1O7MA 1VCKA 1RFSA 2DE6D 4QDCA 4OGQD 3VCAA 3N0QA 2Q3WA 4HM2A 2DE5D 1RIEA 1UUWA 4AIVA 3H1JE 1O7GA 2B1XA 1NYKA 1PPJE 2DE7D 3BCCE 1EZVE 2E74D 4HKVA 2GBWA 2QJPC 2QJKC 5BOKA 1KB9E 4QUQA 1JM1A 3H1HE 2E76D 2YFLA 1KYOE 3GL0A 4NB8D 4PV1D 4QDFA 3L70E 3VMHD 2NUMA 3L71E 3VMID 4NBDD 1NTME 1O7NA 4NBFD 3GCEA 4QDFB 2XSHA 2QPZA 1FQTA 4EMJB 2GBXA 2IBZE 2NVFA 3L72E 5KLIC 2BMQA 3L73E 4NBGD 2FYNC 3GTSA 3GZXA 2HMLA 2E4PA 1EG9A 1UUVA 3TGUE 1O7WA 2XR8A 1O7HA 1NTKE 1Q90C 2NWFA 3CWBE 3VCPA 5AEWA 1SQXE 4H0LD 4QDDA 4HM3A 2A06E 3AZCA 4HM6A 2HMNA 3CXHE 3GKEA 1BCCE 5KKZC 4HM4A 4HM0A 3VMGD 4U3FE 1G8KB 1L0NE 2FYUE 2ZYLA 2B24A 4NBBD 2YIUC 3C0DA 1WQLA 3D89A 2BMOA 4QCKA 2HMOA 4NBAD 2YFIA 3H1KE 3EN1A 3GB4A 1PP9E 1P84E 5AEUA 4H13D 3H1LE 3GL2A 4HM8A 4HM1A 1SQVE 2JZAA 1BE3E 3DQYA 4QURA 2I7FA 1ULIA 1SQBE 1SQQE 2XRXA 2BMRA 4NBHD 3L74E 1NTZE 2ZT9D 2QJYC 1NU1E 4NBCD 1SQPE 4PD4E 1ULJA 2YFJA 1G8JB 2E4QA 3GTEA 2HMMA 2E75D 2NUKA 5KLVE 2HMKA 1O7PA 1ZRTE 4HJLA
chains in the Genus database with same CATH superfamily
3GOBA 3FOUA 2NVEA 4HM7A 3CX5E 4QUPA 3GZYA 1VF5D 4AAYB 1SJGA 2CKFA 2NVGA 2BCCE 3L75E 1L0LE 2XSOA 1NDOA 3EQQA 4H44D 4P1CH 3H1IE 4NBED 2D2CD 2JO6A 4P1BH 4HM5A 5CXMA 2YVJB 4NB9D 1VM9A 5HL4A 2HMJA 1O7MA 1VCKA 1RFSA 2DE6D 4QDCA 4OGQD 3VCAA 3N0QA 2Q3WA 4HM2A 2DE5D 1RIEA 1UUWA 4AIVA 3H1JE 1O7GA 2B1XA 1NYKA 1PPJE 2DE7D 3BCCE 1EZVE 2E74D 4HKVA 2GBWA 2QJPC 2QJKC 5BOKA 1KB9E 4QUQA 1JM1A 3H1HE 2E76D 2YFLA 1KYOE 3GL0A 4NB8D 4PV1D 4QDFA 3L70E 3VMHD 2NUMA 3L71E 3VMID 4NBDD 1NTME 1O7NA 4NBFD 3GCEA 4QDFB 2XSHA 2QPZA 1FQTA 4EMJB 2GBXA 2IBZE 2NVFA 3L72E 5KLIC 2BMQA 3L73E 4NBGD 2FYNC 3GTSA 3GZXA 2HMLA 2E4PA 1EG9A 1UUVA 3TGUE 1O7WA 2XR8A 1O7HA 1NTKE 1Q90C 2NWFA 3CWBE 3VCPA 5AEWA 1SQXE 4H0LD 4QDDA 4HM3A 2A06E 3AZCA 4HM6A 2HMNA 3CXHE 3GKEA 1BCCE 5KKZC 4HM4A 4HM0A 3VMGD 4U3FE 1G8KB 1L0NE 2FYUE 2ZYLA 2B24A 4NBBD 2YIUC 3C0DA 1WQLA 3D89A 2BMOA 4QCKA 2HMOA 4NBAD 2YFIA 3H1KE 3EN1A 3GB4A 1PP9E 1P84E 5AEUA 4H13D 3H1LE 3GL2A 4HM8A 4HM1A 1SQVE 2JZAA 1BE3E 3DQYA 4QURA 2I7FA 1ULIA 1SQBE 1SQQE 2XRXA 2BMRA 4NBHD 3L74E 1NTZE 2ZT9D 2QJYC 1NU1E 4NBCD 1SQPE 4PD4E 1ULJA 2YFJA 1G8JB 2E4QA 3GTEA 2HMMA 2E75D 2NUKA 5KLVE 2HMKA 1O7PA 1ZRTE 4HJLA
chains in the Genus database with same CATH topology
3GOBA 3FOUA 2NVEA 4HM7A 3CX5E 4QUPA 3GZYA 1VF5D 4AAYB 1SJGA 2CKFA 2NVGA 2BCCE 3L75E 1L0LE 2XSOA 1NDOA 3EQQA 4H44D 4P1CH 3H1IE 4NBED 2D2CD 2JO6A 4P1BH 4HM5A 5CXMA 2YVJB 4NB9D 1VM9A 5HL4A 2HMJA 1O7MA 1VCKA 1RFSA 2DE6D 4QDCA 4OGQD 3VCAA 3N0QA 2Q3WA 4HM2A 2DE5D 1RIEA 1UUWA 4AIVA 3H1JE 1O7GA 2B1XA 1NYKA 1PPJE 2DE7D 3BCCE 1EZVE 2E74D 4HKVA 2GBWA 2QJPC 2QJKC 5BOKA 1KB9E 4QUQA 1JM1A 3H1HE 2E76D 2YFLA 1KYOE 3GL0A 4NB8D 4PV1D 4QDFA 3L70E 3VMHD 2NUMA 3L71E 3VMID 4NBDD 1NTME 1O7NA 4NBFD 3GCEA 4QDFB 2XSHA 2QPZA 1FQTA 4EMJB 2GBXA 2IBZE 2NVFA 3L72E 5KLIC 2BMQA 3L73E 4NBGD 2FYNC 3GTSA 3GZXA 2HMLA 2E4PA 1EG9A 1UUVA 3TGUE 1O7WA 2XR8A 1O7HA 1NTKE 1Q90C 2NWFA 3CWBE 3VCPA 5AEWA 1SQXE 4H0LD 4QDDA 4HM3A 2A06E 3AZCA 4HM6A 2HMNA 3CXHE 3GKEA 1BCCE 5KKZC 4HM4A 4HM0A 3VMGD 4U3FE 1G8KB 1L0NE 2FYUE 2ZYLA 2B24A 4NBBD 2YIUC 3C0DA 1WQLA 3D89A 2BMOA 4QCKA 2HMOA 4NBAD 2YFIA 3H1KE 3EN1A 3GB4A 1PP9E 1P84E 5AEUA 4H13D 3H1LE 3GL2A 4HM8A 4HM1A 1SQVE 2JZAA 1BE3E 3DQYA 4QURA 2I7FA 1ULIA 1SQBE 1SQQE 2XRXA 2BMRA 4NBHD 3L74E 1NTZE 2ZT9D 2QJYC 1NU1E 4NBCD 1SQPE 4PD4E 1ULJA 2YFJA 1G8JB 2E4QA 3GTEA 2HMMA 2E75D 2NUKA 5KLVE 2HMKA 1O7PA 1ZRTE 4HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GOB A;  3FOU A;  2NVE A;  4HM7 A;  3CX5 E;  4QUP A;  3GZY A;  1VF5 D;  4AAY B;  1SJG A;  2CKF A;  2NVG A;  2BCC E;  3L75 E;  1L0L E;  2XSO A;  1NDO A;  3EQQ A;  4H44 D;  4P1C H;  3H1I E;  4NBE D;  2D2C D;  2JO6 A;  4P1B H;  4HM5 A;  5CXM A;  2YVJ B;  4NB9 D;  1VM9 A;  5HL4 A;  2HMJ A;  1O7M A;  1VCK A;  1RFS A;  2DE6 D;  4QDC A;  4OGQ D;  3VCA A;  3N0Q A;  2Q3W A;  4HM2 A;  2DE5 D;  1RIE A;  1UUW A;  4AIV A;  3H1J E;  1O7G A;  2B1X A;  1NYK A;  1PPJ E;  2DE7 D;  3BCC E;  1EZV E;  2E74 D;  4HKV A;  2GBW A;  2QJP C;  2QJK C;  5BOK A;  1KB9 E;  4QUQ A;  1JM1 A;  3H1H E;  2E76 D;  2YFL A;  1KYO E;  3GL0 A;  4NB8 D;  4PV1 D;  4QDF A;  3L70 E;  3VMH D;  2NUM A;  3L71 E;  3VMI D;  4NBD D;  1NTM E;  1O7N A;  4NBF D;  3GCE A;  4QDF B;  2XSH A;  2QPZ A;  1FQT A;  4EMJ B;  2GBX A;  2IBZ E;  2NVF A;  3L72 E;  5KLI C;  2BMQ A;  3L73 E;  4NBG D;  2FYN C;  3GTS A;  3GZX A;  2HML A;  2E4P A;  1EG9 A;  1UUV A;  3TGU E;  1O7W A;  2XR8 A;  1O7H A;  1NTK E;  1Q90 C;  2NWF A;  3CWB E;  3VCP A;  5AEW A;  1SQX E;  4H0L D;  4QDD A;  4HM3 A;  2A06 E;  3AZC A;  4HM6 A;  2HMN A;  3CXH E;  3GKE A;  1BCC E;  5KKZ C;  4HM4 A;  4HM0 A;  3VMG D;  4U3F E;  1G8K B;  1L0N E;  2FYU E;  2ZYL A;  2B24 A;  4NBB D;  2YIU C;  3C0D A;  1WQL A;  3D89 A;  2BMO A;  4QCK A;  2HMO A;  4NBA D;  2YFI A;  3H1K E;  3EN1 A;  3GB4 A;  1PP9 E;  1P84 E;  5AEU A;  4H13 D;  3H1L E;  3GL2 A;  4HM8 A;  4HM1 A;  1SQV E;  2JZA A;  1BE3 E;  3DQY A;  4QUR A;  2I7F A;  1ULI A;  1SQB E;  1SQQ E;  2XRX A;  2BMR A;  4NBH D;  3L74 E;  1NTZ E;  2ZT9 D;  2QJY C;  1NU1 E;  4NBC D;  1SQP E;  4PD4 E;  1ULJ A;  2YFJ A;  1G8J B;  2E4Q A;  3GTE A;  2HMM A;  2E75 D;  2NUK A;  5KLV E;  2HMK A;  1O7P A;  1ZRT E;  4HJL A; 
#chains in the Genus database with same CATH topology
 3GOB A;  3FOU A;  2NVE A;  4HM7 A;  3CX5 E;  4QUP A;  3GZY A;  1VF5 D;  4AAY B;  1SJG A;  2CKF A;  2NVG A;  2BCC E;  3L75 E;  1L0L E;  2XSO A;  1NDO A;  3EQQ A;  4H44 D;  4P1C H;  3H1I E;  4NBE D;  2D2C D;  2JO6 A;  4P1B H;  4HM5 A;  5CXM A;  2YVJ B;  4NB9 D;  1VM9 A;  5HL4 A;  2HMJ A;  1O7M A;  1VCK A;  1RFS A;  2DE6 D;  4QDC A;  4OGQ D;  3VCA A;  3N0Q A;  2Q3W A;  4HM2 A;  2DE5 D;  1RIE A;  1UUW A;  4AIV A;  3H1J E;  1O7G A;  2B1X A;  1NYK A;  1PPJ E;  2DE7 D;  3BCC E;  1EZV E;  2E74 D;  4HKV A;  2GBW A;  2QJP C;  2QJK C;  5BOK A;  1KB9 E;  4QUQ A;  1JM1 A;  3H1H E;  2E76 D;  2YFL A;  1KYO E;  3GL0 A;  4NB8 D;  4PV1 D;  4QDF A;  3L70 E;  3VMH D;  2NUM A;  3L71 E;  3VMI D;  4NBD D;  1NTM E;  1O7N A;  4NBF D;  3GCE A;  4QDF B;  2XSH A;  2QPZ A;  1FQT A;  4EMJ B;  2GBX A;  2IBZ E;  2NVF A;  3L72 E;  5KLI C;  2BMQ A;  3L73 E;  4NBG D;  2FYN C;  3GTS A;  3GZX A;  2HML A;  2E4P A;  1EG9 A;  1UUV A;  3TGU E;  1O7W A;  2XR8 A;  1O7H A;  1NTK E;  1Q90 C;  2NWF A;  3CWB E;  3VCP A;  5AEW A;  1SQX E;  4H0L D;  4QDD A;  4HM3 A;  2A06 E;  3AZC A;  4HM6 A;  2HMN A;  3CXH E;  3GKE A;  1BCC E;  5KKZ C;  4HM4 A;  4HM0 A;  3VMG D;  4U3F E;  1G8K B;  1L0N E;  2FYU E;  2ZYL A;  2B24 A;  4NBB D;  2YIU C;  3C0D A;  1WQL A;  3D89 A;  2BMO A;  4QCK A;  2HMO A;  4NBA D;  2YFI A;  3H1K E;  3EN1 A;  3GB4 A;  1PP9 E;  1P84 E;  5AEU A;  4H13 D;  3H1L E;  3GL2 A;  4HM8 A;  4HM1 A;  1SQV E;  2JZA A;  1BE3 E;  3DQY A;  4QUR A;  2I7F A;  1ULI A;  1SQB E;  1SQQ E;  2XRX A;  2BMR A;  4NBH D;  3L74 E;  1NTZ E;  2ZT9 D;  2QJY C;  1NU1 E;  4NBC D;  1SQP E;  4PD4 E;  1ULJ A;  2YFJ A;  1G8J B;  2E4Q A;  3GTE A;  2HMM A;  2E75 D;  2NUK A;  5KLV E;  2HMK A;  1O7P A;  1ZRT E;  4HJL A; 
#chains in the Genus database with same CATH homology
 3GOB A;  3FOU A;  2NVE A;  4HM7 A;  3CX5 E;  4QUP A;  3GZY A;  1VF5 D;  4AAY B;  1SJG A;  2CKF A;  2NVG A;  2BCC E;  3L75 E;  1L0L E;  2XSO A;  1NDO A;  3EQQ A;  4H44 D;  4P1C H;  3H1I E;  4NBE D;  2D2C D;  2JO6 A;  4P1B H;  4HM5 A;  5CXM A;  2YVJ B;  4NB9 D;  1VM9 A;  5HL4 A;  2HMJ A;  1O7M A;  1VCK A;  1RFS A;  2DE6 D;  4QDC A;  4OGQ D;  3VCA A;  3N0Q A;  2Q3W A;  4HM2 A;  2DE5 D;  1RIE A;  1UUW A;  4AIV A;  3H1J E;  1O7G A;  2B1X A;  1NYK A;  1PPJ E;  2DE7 D;  3BCC E;  1EZV E;  2E74 D;  4HKV A;  2GBW A;  2QJP C;  2QJK C;  5BOK A;  1KB9 E;  4QUQ A;  1JM1 A;  3H1H E;  2E76 D;  2YFL A;  1KYO E;  3GL0 A;  4NB8 D;  4PV1 D;  4QDF A;  3L70 E;  3VMH D;  2NUM A;  3L71 E;  3VMI D;  4NBD D;  1NTM E;  1O7N A;  4NBF D;  3GCE A;  4QDF B;  2XSH A;  2QPZ A;  1FQT A;  4EMJ B;  2GBX A;  2IBZ E;  2NVF A;  3L72 E;  5KLI C;  2BMQ A;  3L73 E;  4NBG D;  2FYN C;  3GTS A;  3GZX A;  2HML A;  2E4P A;  1EG9 A;  1UUV A;  3TGU E;  1O7W A;  2XR8 A;  1O7H A;  1NTK E;  1Q90 C;  2NWF A;  3CWB E;  3VCP A;  5AEW A;  1SQX E;  4H0L D;  4QDD A;  4HM3 A;  2A06 E;  3AZC A;  4HM6 A;  2HMN A;  3CXH E;  3GKE A;  1BCC E;  5KKZ C;  4HM4 A;  4HM0 A;  3VMG D;  4U3F E;  1G8K B;  1L0N E;  2FYU E;  2ZYL A;  2B24 A;  4NBB D;  2YIU C;  3C0D A;  1WQL A;  3D89 A;  2BMO A;  4QCK A;  2HMO A;  4NBA D;  2YFI A;  3H1K E;  3EN1 A;  3GB4 A;  1PP9 E;  1P84 E;  5AEU A;  4H13 D;  3H1L E;  3GL2 A;  4HM8 A;  4HM1 A;  1SQV E;  2JZA A;  1BE3 E;  3DQY A;  4QUR A;  2I7F A;  1ULI A;  1SQB E;  1SQQ E;  2XRX A;  2BMR A;  4NBH D;  3L74 E;  1NTZ E;  2ZT9 D;  2QJY C;  1NU1 E;  4NBC D;  1SQP E;  4PD4 E;  1ULJ A;  2YFJ A;  1G8J B;  2E4Q A;  3GTE A;  2HMM A;  2E75 D;  2NUK A;  5KLV E;  2HMK A;  1O7P A;  1ZRT E;  4HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...