2QPZA

Naphthalene 1,2-dioxygenase rieske ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
TVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGREIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase system ferredoxin subunit
publication title Determining Rieske cluster reduction potentials.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Metal binding protein
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2qpzA00
4QDCA 1KB9E 2YFLA 4NBED 1SQXE 1BCCE 1O7MA 3H1JE 3N0QA 4NBAD 4NBBD 3TGUE 3GZXA 1ULIA 4QDFA 1FQTA 1WQLA 3L70E 2BCCE 2IBZE 1NTZE 1O7WA 2DE5D 1O7GA 2JO6A 4NBGD 3VMID 2E74D 2E76D 3D89A 1O7HA 2NWFA 1Q90C 1NTKE 2NVFA 3GTEA 3H1HE 1JM1A 3FOUA 4HKVA 4NBCD 4QUQA 2QJYC 5KKZC 2JZAA 2CKFA 4PD4E 5AEUA 2DE7D 2NVEA 5CXMA 3CWBE 2YIUC 3VMHD 1G8KB 3L75E 1O7PA 4OGQD 4HM3A 4H13D 1RFSA 3DQYA 2E4QA 1VCKA 2FYNC 2YVJB 2QPZA 4P1BH 1SQBE 1L0LE 4HM1A 4HM2A 1O7NA 5BOKA 2BMRA 1SQQE 2B24A 2NVGA 3L71E 4NBFD 2XR8A 2D2CD 2HMMA 2XSOA 4PV1D 1SQVE 3GZYA 2ZT9D 1L0NE 3GTSA 3VCPA 2BMQA 4NBDD 2GBWA 4HM0A 3EQQA 1ULJA 1UUWA 2B1XA 3GKEA 2E75D 4AIVA 1KYOE 3AZCA 4NB8D 3H1IE 4QCKA 1NU1E 1UUVA 4HM4A 4QUPA 4U3FE 4HM7A 4NB9D 2QJKC 2YFJA 2YFIA 2NUKA 1SJGA 4HJLA 4NBHD 2Q3WA 1NYKA 1BE3E 2DE6D 1VF5D 2E4PA 1NDOA 2HMJA 2ZYLA 1EG9A 4QURA 2HMLA 1RIEA 4H44D 1G8JB 3GB4A 1NTME 2A06E 3H1LE 4HM5A 3C0DA 2XSHA 2XRXA 2GBXA 3L72E 2NUMA 4QDDA 3GL0A 2FYUE 1ZRTE 4H0LD 5KLIC 3BCCE 1VM9A 4HM8A 2I7FA 4AAYB 3GCEA 1P84E 3VCAA 4EMJB 3L74E 3L73E 4QDFB 3EN1A 3H1KE 2QJPC 3CXHE 3GOBA 2BMOA 3GL2A 1PPJE 1SQPE 5AEWA 2HMOA 1EZVE 1PP9E 3CX5E 4HM6A 3VMGD 5HL4A 2HMKA 4P1CH 5KLVE 2HMNA
chains in the Genus database with same CATH superfamily
4QDCA 1KB9E 2YFLA 4NBED 1SQXE 1BCCE 1O7MA 3H1JE 3N0QA 4NBAD 4NBBD 3TGUE 3GZXA 1ULIA 4QDFA 1FQTA 1WQLA 3L70E 2BCCE 2IBZE 1NTZE 1O7WA 2DE5D 1O7GA 2JO6A 4NBGD 3VMID 2E74D 2E76D 3D89A 1O7HA 2NWFA 1Q90C 1NTKE 2NVFA 3GTEA 3H1HE 1JM1A 3FOUA 4HKVA 4NBCD 4QUQA 2QJYC 5KKZC 2JZAA 2CKFA 4PD4E 5AEUA 2DE7D 2NVEA 5CXMA 3CWBE 2YIUC 3VMHD 1G8KB 3L75E 1O7PA 4OGQD 4HM3A 4H13D 1RFSA 3DQYA 2E4QA 1VCKA 2FYNC 2YVJB 2QPZA 4P1BH 1SQBE 1L0LE 4HM1A 4HM2A 1O7NA 5BOKA 2BMRA 1SQQE 2B24A 2NVGA 3L71E 4NBFD 2XR8A 2D2CD 2HMMA 2XSOA 4PV1D 1SQVE 3GZYA 2ZT9D 1L0NE 3GTSA 3VCPA 2BMQA 4NBDD 2GBWA 4HM0A 3EQQA 1ULJA 1UUWA 2B1XA 3GKEA 2E75D 4AIVA 1KYOE 3AZCA 4NB8D 3H1IE 4QCKA 1NU1E 1UUVA 4HM4A 4QUPA 4U3FE 4HM7A 4NB9D 2QJKC 2YFJA 2YFIA 2NUKA 1SJGA 4HJLA 4NBHD 2Q3WA 1NYKA 1BE3E 2DE6D 1VF5D 2E4PA 1NDOA 2HMJA 2ZYLA 1EG9A 4QURA 2HMLA 1RIEA 4H44D 1G8JB 3GB4A 1NTME 2A06E 3H1LE 4HM5A 3C0DA 2XSHA 2XRXA 2GBXA 3L72E 2NUMA 4QDDA 3GL0A 2FYUE 1ZRTE 4H0LD 5KLIC 3BCCE 1VM9A 4HM8A 2I7FA 4AAYB 3GCEA 1P84E 3VCAA 4EMJB 3L74E 3L73E 4QDFB 3EN1A 3H1KE 2QJPC 3CXHE 3GOBA 2BMOA 3GL2A 1PPJE 1SQPE 5AEWA 2HMOA 1EZVE 1PP9E 3CX5E 4HM6A 3VMGD 5HL4A 2HMKA 4P1CH 5KLVE 2HMNA
chains in the Genus database with same CATH topology
4QDCA 1KB9E 2YFLA 4NBED 1SQXE 1BCCE 1O7MA 3H1JE 3N0QA 4NBAD 4NBBD 3TGUE 3GZXA 1ULIA 4QDFA 1FQTA 1WQLA 3L70E 2BCCE 2IBZE 1NTZE 1O7WA 2DE5D 1O7GA 2JO6A 4NBGD 3VMID 2E74D 2E76D 3D89A 1O7HA 2NWFA 1Q90C 1NTKE 2NVFA 3GTEA 3H1HE 1JM1A 3FOUA 4HKVA 4NBCD 4QUQA 2QJYC 5KKZC 2JZAA 2CKFA 4PD4E 5AEUA 2DE7D 2NVEA 5CXMA 3CWBE 2YIUC 3VMHD 1G8KB 3L75E 1O7PA 4OGQD 4HM3A 4H13D 1RFSA 3DQYA 2E4QA 1VCKA 2FYNC 2YVJB 2QPZA 4P1BH 1SQBE 1L0LE 4HM1A 4HM2A 1O7NA 5BOKA 2BMRA 1SQQE 2B24A 2NVGA 3L71E 4NBFD 2XR8A 2D2CD 2HMMA 2XSOA 4PV1D 1SQVE 3GZYA 2ZT9D 1L0NE 3GTSA 3VCPA 2BMQA 4NBDD 2GBWA 4HM0A 3EQQA 1ULJA 1UUWA 2B1XA 3GKEA 2E75D 4AIVA 1KYOE 3AZCA 4NB8D 3H1IE 4QCKA 1NU1E 1UUVA 4HM4A 4QUPA 4U3FE 4HM7A 4NB9D 2QJKC 2YFJA 2YFIA 2NUKA 1SJGA 4HJLA 4NBHD 2Q3WA 1NYKA 1BE3E 2DE6D 1VF5D 2E4PA 1NDOA 2HMJA 2ZYLA 1EG9A 4QURA 2HMLA 1RIEA 4H44D 1G8JB 3GB4A 1NTME 2A06E 3H1LE 4HM5A 3C0DA 2XSHA 2XRXA 2GBXA 3L72E 2NUMA 4QDDA 3GL0A 2FYUE 1ZRTE 4H0LD 5KLIC 3BCCE 1VM9A 4HM8A 2I7FA 4AAYB 3GCEA 1P84E 3VCAA 4EMJB 3L74E 3L73E 4QDFB 3EN1A 3H1KE 2QJPC 3CXHE 3GOBA 2BMOA 3GL2A 1PPJE 1SQPE 5AEWA 2HMOA 1EZVE 1PP9E 3CX5E 4HM6A 3VMGD 5HL4A 2HMKA 4P1CH 5KLVE 2HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDC A;  1KB9 E;  2YFL A;  4NBE D;  1SQX E;  1BCC E;  1O7M A;  3H1J E;  3N0Q A;  4NBA D;  4NBB D;  3TGU E;  3GZX A;  1ULI A;  4QDF A;  1FQT A;  1WQL A;  3L70 E;  2BCC E;  2IBZ E;  1NTZ E;  1O7W A;  2DE5 D;  1O7G A;  2JO6 A;  4NBG D;  3VMI D;  2E74 D;  2E76 D;  3D89 A;  1O7H A;  2NWF A;  1Q90 C;  1NTK E;  2NVF A;  3GTE A;  3H1H E;  1JM1 A;  3FOU A;  4HKV A;  4NBC D;  4QUQ A;  2QJY C;  5KKZ C;  2JZA A;  2CKF A;  4PD4 E;  5AEU A;  2DE7 D;  2NVE A;  5CXM A;  3CWB E;  2YIU C;  3VMH D;  1G8K B;  3L75 E;  1O7P A;  4OGQ D;  4HM3 A;  4H13 D;  1RFS A;  3DQY A;  2E4Q A;  1VCK A;  2FYN C;  2YVJ B;  2QPZ A;  4P1B H;  1SQB E;  1L0L E;  4HM1 A;  4HM2 A;  1O7N A;  5BOK A;  2BMR A;  1SQQ E;  2B24 A;  2NVG A;  3L71 E;  4NBF D;  2XR8 A;  2D2C D;  2HMM A;  2XSO A;  4PV1 D;  1SQV E;  3GZY A;  2ZT9 D;  1L0N E;  3GTS A;  3VCP A;  2BMQ A;  4NBD D;  2GBW A;  4HM0 A;  3EQQ A;  1ULJ A;  1UUW A;  2B1X A;  3GKE A;  2E75 D;  4AIV A;  1KYO E;  3AZC A;  4NB8 D;  3H1I E;  4QCK A;  1NU1 E;  1UUV A;  4HM4 A;  4QUP A;  4U3F E;  4HM7 A;  4NB9 D;  2QJK C;  2YFJ A;  2YFI A;  2NUK A;  1SJG A;  4HJL A;  4NBH D;  2Q3W A;  1NYK A;  1BE3 E;  2DE6 D;  1VF5 D;  2E4P A;  1NDO A;  2HMJ A;  2ZYL A;  1EG9 A;  4QUR A;  2HML A;  1RIE A;  4H44 D;  1G8J B;  3GB4 A;  1NTM E;  2A06 E;  3H1L E;  4HM5 A;  3C0D A;  2XSH A;  2XRX A;  2GBX A;  3L72 E;  2NUM A;  4QDD A;  3GL0 A;  2FYU E;  1ZRT E;  4H0L D;  5KLI C;  3BCC E;  1VM9 A;  4HM8 A;  2I7F A;  4AAY B;  3GCE A;  1P84 E;  3VCA A;  4EMJ B;  3L74 E;  3L73 E;  4QDF B;  3EN1 A;  3H1K E;  2QJP C;  3CXH E;  3GOB A;  2BMO A;  3GL2 A;  1PPJ E;  1SQP E;  5AEW A;  2HMO A;  1EZV E;  1PP9 E;  3CX5 E;  4HM6 A;  3VMG D;  5HL4 A;  2HMK A;  4P1C H;  5KLV E;  2HMN A; 
#chains in the Genus database with same CATH topology
 4QDC A;  1KB9 E;  2YFL A;  4NBE D;  1SQX E;  1BCC E;  1O7M A;  3H1J E;  3N0Q A;  4NBA D;  4NBB D;  3TGU E;  3GZX A;  1ULI A;  4QDF A;  1FQT A;  1WQL A;  3L70 E;  2BCC E;  2IBZ E;  1NTZ E;  1O7W A;  2DE5 D;  1O7G A;  2JO6 A;  4NBG D;  3VMI D;  2E74 D;  2E76 D;  3D89 A;  1O7H A;  2NWF A;  1Q90 C;  1NTK E;  2NVF A;  3GTE A;  3H1H E;  1JM1 A;  3FOU A;  4HKV A;  4NBC D;  4QUQ A;  2QJY C;  5KKZ C;  2JZA A;  2CKF A;  4PD4 E;  5AEU A;  2DE7 D;  2NVE A;  5CXM A;  3CWB E;  2YIU C;  3VMH D;  1G8K B;  3L75 E;  1O7P A;  4OGQ D;  4HM3 A;  4H13 D;  1RFS A;  3DQY A;  2E4Q A;  1VCK A;  2FYN C;  2YVJ B;  2QPZ A;  4P1B H;  1SQB E;  1L0L E;  4HM1 A;  4HM2 A;  1O7N A;  5BOK A;  2BMR A;  1SQQ E;  2B24 A;  2NVG A;  3L71 E;  4NBF D;  2XR8 A;  2D2C D;  2HMM A;  2XSO A;  4PV1 D;  1SQV E;  3GZY A;  2ZT9 D;  1L0N E;  3GTS A;  3VCP A;  2BMQ A;  4NBD D;  2GBW A;  4HM0 A;  3EQQ A;  1ULJ A;  1UUW A;  2B1X A;  3GKE A;  2E75 D;  4AIV A;  1KYO E;  3AZC A;  4NB8 D;  3H1I E;  4QCK A;  1NU1 E;  1UUV A;  4HM4 A;  4QUP A;  4U3F E;  4HM7 A;  4NB9 D;  2QJK C;  2YFJ A;  2YFI A;  2NUK A;  1SJG A;  4HJL A;  4NBH D;  2Q3W A;  1NYK A;  1BE3 E;  2DE6 D;  1VF5 D;  2E4P A;  1NDO A;  2HMJ A;  2ZYL A;  1EG9 A;  4QUR A;  2HML A;  1RIE A;  4H44 D;  1G8J B;  3GB4 A;  1NTM E;  2A06 E;  3H1L E;  4HM5 A;  3C0D A;  2XSH A;  2XRX A;  2GBX A;  3L72 E;  2NUM A;  4QDD A;  3GL0 A;  2FYU E;  1ZRT E;  4H0L D;  5KLI C;  3BCC E;  1VM9 A;  4HM8 A;  2I7F A;  4AAY B;  3GCE A;  1P84 E;  3VCA A;  4EMJ B;  3L74 E;  3L73 E;  4QDF B;  3EN1 A;  3H1K E;  2QJP C;  3CXH E;  3GOB A;  2BMO A;  3GL2 A;  1PPJ E;  1SQP E;  5AEW A;  2HMO A;  1EZV E;  1PP9 E;  3CX5 E;  4HM6 A;  3VMG D;  5HL4 A;  2HMK A;  4P1C H;  5KLV E;  2HMN A; 
#chains in the Genus database with same CATH homology
 4QDC A;  1KB9 E;  2YFL A;  4NBE D;  1SQX E;  1BCC E;  1O7M A;  3H1J E;  3N0Q A;  4NBA D;  4NBB D;  3TGU E;  3GZX A;  1ULI A;  4QDF A;  1FQT A;  1WQL A;  3L70 E;  2BCC E;  2IBZ E;  1NTZ E;  1O7W A;  2DE5 D;  1O7G A;  2JO6 A;  4NBG D;  3VMI D;  2E74 D;  2E76 D;  3D89 A;  1O7H A;  2NWF A;  1Q90 C;  1NTK E;  2NVF A;  3GTE A;  3H1H E;  1JM1 A;  3FOU A;  4HKV A;  4NBC D;  4QUQ A;  2QJY C;  5KKZ C;  2JZA A;  2CKF A;  4PD4 E;  5AEU A;  2DE7 D;  2NVE A;  5CXM A;  3CWB E;  2YIU C;  3VMH D;  1G8K B;  3L75 E;  1O7P A;  4OGQ D;  4HM3 A;  4H13 D;  1RFS A;  3DQY A;  2E4Q A;  1VCK A;  2FYN C;  2YVJ B;  2QPZ A;  4P1B H;  1SQB E;  1L0L E;  4HM1 A;  4HM2 A;  1O7N A;  5BOK A;  2BMR A;  1SQQ E;  2B24 A;  2NVG A;  3L71 E;  4NBF D;  2XR8 A;  2D2C D;  2HMM A;  2XSO A;  4PV1 D;  1SQV E;  3GZY A;  2ZT9 D;  1L0N E;  3GTS A;  3VCP A;  2BMQ A;  4NBD D;  2GBW A;  4HM0 A;  3EQQ A;  1ULJ A;  1UUW A;  2B1X A;  3GKE A;  2E75 D;  4AIV A;  1KYO E;  3AZC A;  4NB8 D;  3H1I E;  4QCK A;  1NU1 E;  1UUV A;  4HM4 A;  4QUP A;  4U3F E;  4HM7 A;  4NB9 D;  2QJK C;  2YFJ A;  2YFI A;  2NUK A;  1SJG A;  4HJL A;  4NBH D;  2Q3W A;  1NYK A;  1BE3 E;  2DE6 D;  1VF5 D;  2E4P A;  1NDO A;  2HMJ A;  2ZYL A;  1EG9 A;  4QUR A;  2HML A;  1RIE A;  4H44 D;  1G8J B;  3GB4 A;  1NTM E;  2A06 E;  3H1L E;  4HM5 A;  3C0D A;  2XSH A;  2XRX A;  2GBX A;  3L72 E;  2NUM A;  4QDD A;  3GL0 A;  2FYU E;  1ZRT E;  4H0L D;  5KLI C;  3BCC E;  1VM9 A;  4HM8 A;  2I7F A;  4AAY B;  3GCE A;  1P84 E;  3VCA A;  4EMJ B;  3L74 E;  3L73 E;  4QDF B;  3EN1 A;  3H1K E;  2QJP C;  3CXH E;  3GOB A;  2BMO A;  3GL2 A;  1PPJ E;  1SQP E;  5AEW A;  2HMO A;  1EZV E;  1PP9 E;  3CX5 E;  4HM6 A;  3VMG D;  5HL4 A;  2HMK A;  4P1C H;  5KLV E;  2HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...