1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
2GBXA 3EN1A 1VF5D 3AZCA 1BGYE 1VM9A 3H1HE 4NB8D 3GZXA 4HM7A 1SQXE 3VMHD 3GKEA 5CXMA 4HM5A 1L0LE 3GOBA 4QCKA 2YFJA 3H1KE 4NBED 1UUVA 1P84E 2BMOA 5BOKA 2YFIA 1O7MA 2E76D 2XRXA 1L0NE 4HM8A 3N0QA 3L73E 2HMLA 4AIVA 3GB4A 5AEWA 2HMNA 4NBGD 1G8JB 4NB9D 2E4QA 1BE3E 2HMKA 4HJLA 1UUWA 1NDOA 4HM0A 2GBWA 5KKZC 3VCAA 2D2CD 5AEUA 3TGUE 4EMJB 3GCEA 3VCPA 1KB9E 4NBBD 2FYNC 4H44D 4NBHD 1BCCE 4H0LD 4HM1A 2NWFA 4P1CH 4OGQD 1NTME 4PD4E 2HMOA 2JO6A 4HM4A 1NTZE 3CX5E 2CKFA 2NVEA 1VCKA 4NBAD 1O7WA 1RIEA 4NBDD 4QURA 2YVJB 4P1BH 4HM2A 2XSHA 1PP9E 4D6TE 2YFLA 2I7FA 4HKVA 2HMJA 4H13D 3CXHE 2B1XA 5HL4A 4U3FE 3L75E 5KLVE 2ZT9D 1SQPE 2E4PA 1ZRTE 1SQQE 1KYOE 3L70E 1JM1A 3L72E 1NYKA 2ZYLA 4HM6A 1G8KB 1O7GA 2DE7D 3GTEA 3H1LE 3H1IE 3VMGD 2A06E 3C0DA 3L71E 4NBFD 1SQVE 2B24A 3D89A 2JZAA 1ULIA 1PPJE 1EZVE 2QJKC 3DQYA 4AAYB 2BMQA 5KLIC 2QPZA 2QJPC 3GL0A 3H1JE 2NUKA 2NVGA 1O7NA 2XR8A 2XSOA 1Q90C 3FOUA 3GL2A 4QUPA 2NVFA 2Q3WA 3VMID 1O7PA 3GZYA 3L74E 1SQBE 2DE6D 2E75D 2NUMA 4PV1D 1EG9A 4QDCA 3EQQA 4HM3A 4QUQA 1WQLA 1NU1E 3GTSA 1NTKE 1ULJA 1O7HA 2E74D 1RFSA 3CWBE 2DE5D 2IBZE 2FYUE 2BCCE 2BMRA 2HMMA 2YIUC 4NBCD 4QDFA 4QDDA 3BCCE 4QDFB 1SJGA 2QJYC 1FQTA
chains in the Genus database with same CATH superfamily
1X22A 2FFDA 1LTJC 2QE7H 2HG5D 2IFMA 1QGKB 1K04A 1VQ5P 1N7SA 2QM7A 3E7KA 1JY3O 2O01J 3G3ZA 2YFJA 4LLHA 3SWFA 1UIIA 1NTMK 2OTLP 2E76D 3GB4A 1AVOA 2HMNA 1OFCX 1OZHA 2E4QA 4WY4A 5KKZC 1JCDA 1LT9C 3NTNA 2ZYDA 2QVAA 2JO6A 1P84H 1FZGA 2FBWC 3H1KJ 4UB8E 2Y0CA 1MFTA 5EFWB 1VQLP 3A0HE 3IN6A 1DD3A 2Z5IA 2LR2A 3SFEC 3TNUA 1ZRTD 3H1LE 4KHXA 1VF5B 3RL0B 2AXTE 1EDJA 1SS1A 2QPZA 1NTZD 1JUNA 1SFCA 2M0BA 2B87B 2E75D 3IR9A 3EQQA 3CMEP 5KLVD 1GU4A 4OGQC 1ULJA 2E74D 1OVRA 3AE8C 3EFFK 1VQNP 5E79H 2M3BA 5H2FE 4OVNF 2P10A 1NTKG 5APQA 2O1KA 1SLQA 1JMMA 1L0LK 2N1TA 4DOJA 3Q5SA 1DEBA 3CC4P 3S9OA 3H1KD 3PLNA 3AEBC 1NKZB 1JM0A 1FE6A 4GOEA 3NXSA 4N78D 1ZR4A 1T6AA 2QRXA 4WVZA 2W6AA 1E79H 1HTLC 4BWNA 4OGQD 3RK3D 4UB6H 1IK9A 4K3AA 4ASWA 1NO4A 4RKUJ 1BDCA 2IFNA 3M0DC 1GU5A 1KILB 1JM1A 1LGHB 4D6TG 2R44A 1ZN5A 1BCCJ 1VL2A 3B5NA 1SQVK 2IBZI 3CL3D 2NZ2A 2XR8A 1YTZI 1Q2NA 1O7NA 1ZW0A 1FZEA 4IL6X 3MUDA 1FOSF 3V4QA 2POHA 1EG9A 5AVSB 4HM3A 4QUQA 2JR8A 1NTKE 2FFDC 3FWNA 4RJTA 2W6BA 1KTMA 1EC5A 2BASA 1RQUA 1JEKA 1VQ7P 4QDFB 1JTHB 3SWYA 5CBOA 1NWQA 4PJ0H 5AW0B 2B9BA 1YYCA 4WY4C 1QX8A 1UIXA 5KTBA 1SQXG 2L5GB 4WB4A 1KFMA 1KZUB 2Q9IA 4H0LB 3GG2A 4M3LA 2Y9YA 3LIDA 1CSBA 2DW3A 3VMYA 3TK1A 3T97B 1AFOA 1ZXGA 2HODB 3KXDA 3Q5PA 1RE4C 4B86A 2M5AB 1NU1J 1N7SD 2YVJB 4D6TE 2YFLA 1YTZT 2V7QH 4HKVA 4RESB 4IFFA 1G1IA 2YMYA 1PIXA 1R5SA 1KILE 2AEFA 1NYKA 1FU1A 4L76A 4YPCA 1H8AA 1S5LH 2IPPA 1SFCC 2QJKC 4L74A 2KXPB 1T8ZA 4BRYB 2FYNB 1U7JA 3CX5D 1IO4A 2NVGA 2ZT9C 3OAKA 1PPJD 1EZVG 1S5LX 2HLOA 1RE3C 1YJ9P 1EXJA 1SVFA 3OJAB 1OVVA 1KN7A 1RF0C 1SQPG 1NGMB 3H1LJ 2YIUC 3OA7A 2I1JA 3M9HA 1LTSC 1EDIA 1MUUA 2FKWB 3HD7B 3QH9A 1BDDA 1VQ4P 1JY2N 2OYIB 1SQXE 2BCCG 3GOBA 4L75A 4JF7A 1P84E 1RY3A 3GHGB 2MKVA 1NU1D 5BU8B 1SQBG 2WSEJ 5AVZB 4EMJB 3CWBG 3VP8A 1L0NG 1JY2P 1GL2A 4Y28J 2WQYC 4N6JA 3AE4C 4QURA 3CCLP 4CPGA 3JCUE 2HFED 2N1TD 2XNXA 2PRRA 1MFZA 2JKVA 1L4AC 1M57D 5KAFH 3G71P 3B5NC 4GODA 2YXQB 2WWWA 1JO5A 3TSIA 1BE3G 3D70A 1IK7A 3MUDC 5CBNA 1EZVE 1JTHA 1M90Q 2OGUA 2WPRA 4HJGH 1Q90C 2ZFCA 1FS0E 2A06G 5APXA 3L71G 2C0XA 3BRTB 3CXHD 4NPDA 2R32A 1MKMA 2SPZA 1LTBC 2Y0DA 5M1BA 1KYOD 2BCCE 3M0AA 1CZQA 2JWAA 3RK2B 1VM9A 3SSUA 4XFJA 3Q3DA 3GZXA 5AW9B 3VMHD 3T97A 4HM5A 1FDMA 3PH0A 1OMIA 4XE5B 2RH0A 2M5AA 3L70J 3CI9A 1L0NE 1NTKJ 3FGAD 1VF5C 2Q1KA 3RL0C 2P2UA 4HM0A 2P7JA 5TJHA 4IL6E 5KJ7C 2W8ZA 1KC8Q 1A02F 2YO2A 4DT0A 1YHQP 4PD4E 3CCQP 1KQFB 4NBDD 3MP7B 4BRYA 1TU3F 2I7FA 1N86A 3G6EP 2XKMA 4GT1A 2J58A 2XDJA 3M91A 5CCGA 5TISH 3P8CE 3JC22 1G8KB 1LJ2A 1ZP0C 1KB9D 2A06E 2NRGA 3L71E 1AVYA 3DQYA 3HD7A 2OYIA 4D6TJ 1ZLLA 2WPQA 2AEJA 4PJ0E 2A45G 1LTAC 5AW1B 3GHGA 5B66H 1A02J 3WMM0 1YBKA 3L70D 2BMRA 3FXEA 1NTKD 3GF7A 1PZQA 2KLVA 5AVWB 1SJGA 5KAIH 3PJSK 1VQ8P 3GMAA 4C7NB 1NOHA 2YKOA 1J2JB 2WSFJ 1L0LE 4L73A 3NMDA 3H1JD 2WSSH 1KV4A 3BCCG 3VMAA 2RN0A 2BMOA 3CCSP 3LW5J 3H1HG 1KILC 1L4AB 3V2QA 3CX5I 1OXZA 1QL2A 3D6ZA 2GM4A 1M8OB 3L73G 4HB1A 1SQXJ 1S5LE 2KSEA 3D6YA 2NVEA 3TF5A 1VCKA 3I56P 1WRGA 5B5EH 1LTGC 2KYVA 2KI7B 1QEXA 5GTIH 4QMAA 3PP5A 2G3AA 2ZYLA 2QA4P 1SQVE 3VTPC 4JQ0D 4AAYB 1GL2D 3KPEA 2E5TA 3FOUA 4YTPC 2NVFA 1RE4A 1JY3N 3HE5B 3CCJP 3H1IG 2O01H 3F89A 2HPCB 4U3FD 5CMZA 5AVTB 5L8RJ 1S9KD 4H0LC 1Q82Q 1RH5B 3HUSB 1RFSA 3L72D 3NFQA 1OW6A 3BCCE 2WT7B 2JO1A 1BGYE 3H1HE 3N4XA 2G8YA 3I55P 1JY3P 2YKQA 3OW2O 2ZVOB 1GK6A 3AE6C 1SQPJ 3E1RA 4H13B 4MN4C 3L73E 3AEGC 3CCVP 2BCCJ 1RHZB 1RE3A 1KQSO 3CXHI 5KAFE 1RF0A 1X0TA 2FYNC 2KP8A 3H6PA 4N3YB 1KYOI 4H0LD 3HTKB 1SQBJ 2HMOA 3USSA 3TGUG 5CCGC 4HKZH 3CWBJ 3CCEP 1L0NJ 4PV1B 5HL4A 3KZIE 3L75E 3PTZA 1AQTA 1JMBA 1FJKA 2WITA 1DD4A 4AUWA 4W80A 3HD7C 1YITP 2OYIC 3H1IE 2O01N 4R4MA 1SQQG 1L2PA 3JSVC 4IFMA 4C7NA 1Y9BA 3GL0A 2NUKA 3GHGC 1Q81Q 1EZVD 5AVVB 1BE3J 1FDIA 2E76B 4NPEA 1RQVA 1SQPD 1LWUB 1NU1K 1L4AA 1GW3A 2IBZE 3W68A 2KZJA 3L71J 3EN1A 5APWA 1VQPP 3MIWA 1KB9I 2IZ0A 5KLIB 1SQBD 1H89A 1HWTC 1ZOYC 4NBGD 3V5BA 1QL1A 3CWBD 1G8JB 1CW5A 1L0ND 2HMKA 2YO3A 5AW2B 1JB0J 3TGUE 5AW8B 5TISE 2XV5A 2O1JA 1SP4A 2YNYA 4NBHD 3L74J 2WPVB 1FBMA 1Z56A 2QJYB 4HM4A 2R5BA 4C7RA 5GTHE 2YKPA 2ZYAA 1WMKA 1OVUA 2H43A 2QEXP 4PD4D 2E75B 1ZR2A 1U57A 3HE5A 5AW4B 1VQ9P 1XTCC 2HPCA 1NTZG 2E74B 2E4PA 1SQQE 1BE3D 3HUSA 3F5HA 3RK2C 5B66E 5KLVG 5CCHA 3CX5H 5KJ7A 1CI6B 1BCCD 4HYTB 2A06D 3L71D 3CCMP 5AVQB 2B87A 1PV3A 3AE9C 1LTIC 1GMJA 2KLUA 1URQB 2H89C 2O3JA 1NAFA 1IFNA 1N73B 2P58A 4WY4D 1S1CX 3ITKA 2XRXA 1FZCB 1VQ6P 4BXLA 4NB8D 3AECC 3BRVB 3RK3B 2FYUG 3N7NA 3HTKA 1VQMP 2FXPA 3L74D 1O7MA 2ZAEB 3O6QB 1EDKA 5B5EE 1KORA 1UUWA 3BCCJ 4C46A 3H1HJ 3M9QA 1NTZE 4UB8H 3PHLA 1SFCD 4LC1A 2HYNA 3L73J 3A0HH 3MTUE 2OTJP 1EXIA 5KLVE 2ZT9D 1NTMG 5AVYB 1KILA 1EDLA 5CJ4A 1NKNA 1LWUA 2WSCJ 1K9MQ 1USEA 1LP1B 3U1CA 2DE7D 1YJWP 2KUBA 1NTKK 2M8RA 2AXTH 2NPSC 1MZ9A 1S3JA 1ULIA 4EIJA 1X8YA 3FWLA 3CXHH 2WVRA 1VQOP 1AA0A 3V2RA 2Q3IA 2DE6D 1KYOH 3A3YB 5APSA 1DX7A 2XU6A 2C0WA 4TT3H 3PRJA 1OWAA 1NJIQ 2FYUE 2LXCB 4N78E 1FZFA 5E79E 2WSEH 3H1IJ 4QDFA 3H1LD 1M1JB 1FAVA 5H2FH 2E42A 1M7LA 4HM7A 3VMZA 2QSIA 3BCCD 2K3RA 3RK3E 3M06A 3I5CA 3H1HD 3BATA 3LIEA 3R2PA 3U59A 3RGUA 2ZVNB 1EZVI 3L73D 1L4AD 2WMMA 2GBWA 2BEQD 2GA1A 3B5ND 2HODA 2QG4A 3WUUA 3VYIA 1NTME 4UB6E 2CKFA 3MHVA 4EDFA 1N7LA 1L0LG 1Y47A 3WUVA 3HUSC 1QVFO 1Q90D 2E5YA 4KT0J 5CCHC 3AE3C 3CLQA 3S1KA 2KB7P 1URQA 2Q6QA 3TGUJ 1KB9H 1DEEG 2Q7CA 3Q5RA 1GDTA 3VMGD 2ZXEB 2KOGA 1EQ7A 3S4RA 1FZCA 4H13C 2Z4EA 1T2KC 1GD2E 4W7ZA 1O7PA 2C9NY 1SQXK 1SQQJ 2P1JA 4GKGA 3KHUA 4PD4I 3O6QA 1NYHA 4WBAA 2L91A 1NAYA 1VF5D 2Y0EA 2KZIA 3RL0D 1FJPA 2HR3A 1VDFA 5KJ7D 2RKLA 4PV1C 3WUTA 4I6MC 1J1EB 1SQVG 4RO0A 2N1TB 3RBZA 1GTWA 1JCCA 5AW3B 2JP3A 1W2EA 2HMLA 2W27A 3TDKA 3AEFC 3BASA 5AVRB 1R8EA 1HJ0A 4HJLA 1GK4A 1Q7YQ 5BU5A 1PGQA 3IFMA 3TGUD 2NPSB 4HM1A 1IFMA 4JYCA 3GLMA 3CX5E 2E76C 1BGYG 4NBAD 1RIEA 1OIPA 1LWUC 2HMJA 3VN0A 1K73Q 3FXDA 2FXOA 1IFPA 1SQPK 1QLED 1AV1A 2Z5HA 1Y8AA 2H7HA 4O9BA 1SQQD 2QIWA 4I7ZB 3KQGA 1D7MA 1M1JA 2JZAA 1S2EA 5KLIC 3P32A 5AVUB 1VPCA 1FOSE 2WSFH 3H32B 4D6TD 2M3EA 5KLVJ 1SQBK 3E1IA 3LW5H 1NU1E 1NVOA 1O7HA 1IC2A 4OH8B 3L75G 1U7MA 3CC2P 5AW7B 3CPWO 2IYOA 2BEZF 1KILD 2HMMA 4U7JA 1L0NK 1DH3A 3KYQA 4NBCD 3A2AA 1HJBA 2LXBA 2OARA 2GUSA 1LTTC 2QJYC 1S4XA 4I2LC 2H88C 3M9BA 3SFDC 2I8DA 2E75C 4QCKA 4DZOA 3CCRP 1T3UA 4R4LA 3HE4B 2E74C 2YFIA 2H8PD 1ZMEC 4HM8A 2D2CB 2A45I 3WU2H 2FYUJ 2N9YB 4H44B 2MJZA 2UWJE 3AE1C 2IBZG 2PFXA 4KJMA 2Q3EA 3CC7P 2VRSA 3D71A 3IAOA 1SQXD 1BSHA 3JCUH 4HM2A 1URQC 3O8ZA 3L37A 1P84D 3A0BH 4Y99B 3CXHE 2B1XA 1N73C 3EFGA 3P7KA 4IOIH 1KYOE 1FZCC 2PGDA 1PP9G 3RK3C 1NH4A 5AW5B 2OQQA 1YJNP 4NBFD 1NTMJ 1MV8A 2WPSA 2B24A 3L70G 1HGZA 1PGPA 2QJPC 3GL2A 2OYHB 3QWOC 3V2NA 2NUMA 3RL0g 3H1JG 3AEAC 3VP9A 1URQD 2JWDA 5APTA 1FQTA 4DCKA 2FYUD 1PGOA 1Q86Q 2XZRA 1HGVA 2K88A 1AJYA 2KK7A 2NPSA 1G1JA 2LKMA 1IFJA 2R3CA 1OW8A 1RF1C 1X9VA 1HH0A 1FZAA 5CCGD 2FY8A 2CPSA 4NB9D 4ZKUA 1J1DB 2BCCD 3VCAA 1GZLA 4IL6H 1KB9E 3ZDMA 1GL2B 4P1CH 3BVHA 5DJTB 2K9JB 3HD7D 4PD4H 2OYOA 1LTJB 1T3JA 3L4FA 4P1BH 1PP9E 3A5TA 1LT1A 1NTMD 2W90A 4WWIA 4JBZA 3H32A 3AE2C 3L70E 4OWFA 1M1JC 1WT6A 2K1AA 5CJ0A 3H25A 3GTEA 1L0LJ 4U3FG 2Q5UA 3V6IA 1N7SC 5KKZB 1LT9B 3L72G 1R5LA 3AE7C 3H1JE 1IJDB 2V7QJ 3CCUP 3GZYA 3G9RA 3HE4A 4EOTA 1WQLA 1ZV8A 3B8EB 4ASVA 2KSJA 3P8CD 2J59M 5APVA 2WT7A 4AQRD 5KAIE 2GBXA 3G4SP 1HVVA 3AZCA 2ZXXA 1LNQA 1IFIA 3RBXA 3GF3A 1UUVA 3C8VA 5BOKA 1M1KQ 2E43A 3VMXA 2KNCB 2ZYGA 5APUA 3UIAA 1SQVJ 3H1KG 5AEUA 3GW6A 2YMKA 4OGQB 2B89A 2R5DA 1PFIA 3TYYA 4NBBD 2Y9ZA 1M56D 1JY2O 3HRNA 1H0TB 2W83C 2NWFA 3RK2D 2QJPB 1L0LD 3K5BA 3U1AA 2J5UA 4YXDC 1YIJP 2AXCA 2RMZA 3IF4A 1G2CB 4U3FE 2OYHA 3MGNA 3Q1MA 1S9KE 5DJUB 5GTIE 4GOFA 1FZBA 1ZRTE 2AEMA 1BGYJ 2I1KA 3L72E 4AYCA 4HM6A 1HF9A 1FC2C 1IFDA 3C0DA 1J1EC 2A45H 4HH2A 2N1TC 4TLFA 2BMQA 4LGDE 2IDBA 2Q3WA 1IZNB 4GIFA 2B88A 2CK3H 1RF1B 1USDA 1W2BO 1P84I 3W67A 1OX3A 2KS1B 3WU2E 1W5CE 3II6A 1S72P 2OTKE 3B4SA 1SQVD 2KIKA 3GKEA 1AQ5A 5CXMA 3L75J 2K9JA 2IYPA 1HBWA 1YI2P 3H1KE 1PL5A 4NBED 1LTJA 1XTGB 4JYBA 3VOPA 3N0QA 3A0BE 1E5WA 3B71A 4I7ZC 4ZMDA 2FFDB 1KQLA 2WSCH 1SQQK 1KQGB 1N7SB 2IZ1A 1BGYD 3R4YA 2IX7C 3CD6P 1LT9A 1O7WA 1X79B 2NPSD 3EWKA 2XSHA 2GUVA 3C1LA 1BCCG 1GW4A 3KZIH 1SQPE 4DJGA 1KMIZ 4WY4B 2YXRB 3V4WA 3V2PA 3AE5C 3MD0A 1HUCA 3SWKA 5BVZA 1N8RQ 1CI6A 2WZ7A 1NHLA 3D89A 3ABVC 4JPZB 2XSOA 5CHXA 1PP9J 2D2CC 3VMID 2K37A 1SQBE 2CPBA 2ZJSE 2QM8A 4IFDK 4QDCA 4H44C 1PPJG 3L75D 3TNUB 5C39A 1N73A 2R3SA 3CWBE 2KNCA 4EYYQ 3L74G 4QDDA 1FDOA 3H1ID 4A7PA 2XNDH 1N2DC 4YXWH 3CMAP 3H1JJ 1H0TA 2JDIH 4Y99C 1SFCB 3AEDC 5AW6B 1KD1Q 1K05A 2JJLA 2QJKB 3EQ2A 1NTZK 2PAJA 2ZT9B 2N9BA 4AIVA 1G2CA 3FX0A 5AEWA 5K5GB 1BE3E 2IBZD 1NU1G 1NDOA 5KLVK 4K35A 2D2CD 3L35A 3GCEA 5CCHD 4I1LA 3VCPA 1K8AQ 2C9LY 4H44D 2YIUB 1BCCE 4EI2A 1YQ3C 2OYHC 3KDPB 1JOCA 3AEEC 5GTHH 2JEEA 4W7YA 1JNMA 1BSNA 4H13D 1T2KD 1PGJA 4GDOA 1YQ4C 1PP9D 1RF1A 4ZKPA 1LP1A 2K9YA 3P8MC 4XA4A 1O7GA 2V4HA 3C9IA 2KS1A 2FYUK 3M0DA 3MZWB 3Q2YA 1PPJE 4ZNCA 1QVGO 1DIPA 5APYA 2WTYA 4QUPA 3H1LG 2ITAA 4Z1MH 2W6JH 4U3FJ 3L74E 1KFNA 2PP6A 3A7OA 4PV1D 1J1DC 3GTSA 3L72J 4NPFX 1OW7A 5AVXB 2P67A 2DE5D 2FXMA 1GL2C 1VQKP 1NTZJ 2FYZA 3L36A 3B5NB 1H88A
chains in the Genus database with same CATH topology
2GBXA 3EN1A 1VF5D 3AZCA 1BGYE 1VM9A 3H1HE 4NB8D 3GZXA 4HM7A 1SQXE 3VMHD 3GKEA 5CXMA 4HM5A 1L0LE 3GOBA 4QCKA 2YFJA 3H1KE 4NBED 1UUVA 1P84E 2BMOA 5BOKA 2YFIA 1O7MA 2E76D 2XRXA 1L0NE 4HM8A 3N0QA 3L73E 2HMLA 4AIVA 3GB4A 5AEWA 2HMNA 4NBGD 1G8JB 4NB9D 2E4QA 1BE3E 2HMKA 4HJLA 1UUWA 1NDOA 4HM0A 2GBWA 5KKZC 3VCAA 2D2CD 5AEUA 3TGUE 4EMJB 3GCEA 3VCPA 1KB9E 4NBBD 2FYNC 4H44D 4NBHD 1BCCE 4H0LD 4HM1A 2NWFA 4P1CH 4OGQD 1NTME 4PD4E 2HMOA 2JO6A 4HM4A 1NTZE 3CX5E 2CKFA 2NVEA 1VCKA 4NBAD 1O7WA 1RIEA 4NBDD 4QURA 2YVJB 4P1BH 4HM2A 2XSHA 1PP9E 4D6TE 2YFLA 2I7FA 4HKVA 2HMJA 4H13D 3CXHE 2B1XA 5HL4A 4U3FE 3L75E 5KLVE 2ZT9D 1SQPE 2E4PA 1ZRTE 1SQQE 1KYOE 3L70E 1JM1A 3L72E 1NYKA 2ZYLA 4HM6A 1G8KB 1O7GA 2DE7D 3GTEA 3H1LE 3H1IE 3VMGD 2A06E 3C0DA 3L71E 4NBFD 1SQVE 2B24A 3D89A 2JZAA 1ULIA 1PPJE 1EZVE 2QJKC 3DQYA 4AAYB 2BMQA 5KLIC 2QPZA 2QJPC 3GL0A 3H1JE 2NUKA 2NVGA 1O7NA 2XR8A 2XSOA 1Q90C 3FOUA 3GL2A 4QUPA 2NVFA 2Q3WA 3VMID 1O7PA 3GZYA 3L74E 1SQBE 2DE6D 2E75D 2NUMA 4PV1D 1EG9A 4QDCA 3EQQA 4HM3A 4QUQA 1WQLA 1NU1E 3GTSA 1NTKE 1ULJA 1O7HA 2E74D 1RFSA 3CWBE 2DE5D 2IBZE 2FYUE 2BCCE 2BMRA 2HMMA 2YIUC 4NBCD 4QDFA 4QDDA 3BCCE 4QDFB 1SJGA 2QJYC 1FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBX A;  3EN1 A;  1VF5 D;  3AZC A;  1BGY E;  1VM9 A;  3H1H E;  4NB8 D;  3GZX A;  4HM7 A;  1SQX E;  3VMH D;  3GKE A;  5CXM A;  4HM5 A;  1L0L E;  3GOB A;  4QCK A;  2YFJ A;  3H1K E;  4NBE D;  1UUV A;  1P84 E;  2BMO A;  5BOK A;  2YFI A;  1O7M A;  2E76 D;  2XRX A;  1L0N E;  4HM8 A;  3N0Q A;  3L73 E;  2HML A;  4AIV A;  3GB4 A;  5AEW A;  2HMN A;  4NBG D;  1G8J B;  4NB9 D;  2E4Q A;  1BE3 E;  2HMK A;  4HJL A;  1UUW A;  1NDO A;  4HM0 A;  2GBW A;  5KKZ C;  3VCA A;  2D2C D;  5AEU A;  3TGU E;  4EMJ B;  3GCE A;  3VCP A;  1KB9 E;  4NBB D;  2FYN C;  4H44 D;  4NBH D;  1BCC E;  4H0L D;  4HM1 A;  2NWF A;  4P1C H;  4OGQ D;  1NTM E;  4PD4 E;  2HMO A;  2JO6 A;  4HM4 A;  1NTZ E;  3CX5 E;  2CKF A;  2NVE A;  1VCK A;  4NBA D;  1O7W A;  1RIE A;  4NBD D;  4QUR A;  2YVJ B;  4P1B H;  4HM2 A;  2XSH A;  1PP9 E;  4D6T E;  2YFL A;  2I7F A;  4HKV A;  2HMJ A;  4H13 D;  3CXH E;  2B1X A;  5HL4 A;  4U3F E;  3L75 E;  5KLV E;  2ZT9 D;  1SQP E;  2E4P A;  1ZRT E;  1SQQ E;  1KYO E;  3L70 E;  1JM1 A;  3L72 E;  1NYK A;  2ZYL A;  4HM6 A;  1G8K B;  1O7G A;  2DE7 D;  3GTE A;  3H1L E;  3H1I E;  3VMG D;  2A06 E;  3C0D A;  3L71 E;  4NBF D;  1SQV E;  2B24 A;  3D89 A;  2JZA A;  1ULI A;  1PPJ E;  1EZV E;  2QJK C;  3DQY A;  4AAY B;  2BMQ A;  5KLI C;  2QPZ A;  2QJP C;  3GL0 A;  3H1J E;  2NUK A;  2NVG A;  1O7N A;  2XR8 A;  2XSO A;  1Q90 C;  3FOU A;  3GL2 A;  4QUP A;  2NVF A;  2Q3W A;  3VMI D;  1O7P A;  3GZY A;  3L74 E;  1SQB E;  2DE6 D;  2E75 D;  2NUM A;  4PV1 D;  1EG9 A;  4QDC A;  3EQQ A;  4HM3 A;  4QUQ A;  1WQL A;  1NU1 E;  3GTS A;  1NTK E;  1ULJ A;  1O7H A;  2E74 D;  1RFS A;  3CWB E;  2DE5 D;  2IBZ E;  2FYU E;  2BCC E;  2BMR A;  2HMM A;  2YIU C;  4NBC D;  4QDF A;  4QDD A;  3BCC E;  4QDF B;  1SJG A;  2QJY C;  1FQT A; 
#chains in the Genus database with same CATH topology
 1X22 A;  2FFD A;  1LTJ C;  2QE7 H;  2HG5 D;  2IFM A;  1QGK B;  1K04 A;  1VQ5 P;  1N7S A;  2QM7 A;  3E7K A;  1JY3 O;  2O01 J;  3G3Z A;  2YFJ A;  4LLH A;  3SWF A;  1UII A;  1NTM K;  2OTL P;  2E76 D;  3GB4 A;  1AVO A;  2HMN A;  1OFC X;  1OZH A;  2E4Q A;  4WY4 A;  5KKZ C;  1JCD A;  1LT9 C;  3NTN A;  2ZYD A;  2QVA A;  2JO6 A;  1P84 H;  1FZG A;  2FBW C;  3H1K J;  4UB8 E;  2Y0C A;  1MFT A;  5EFW B;  1VQL P;  3A0H E;  3IN6 A;  1DD3 A;  2Z5I A;  2LR2 A;  3SFE C;  3TNU A;  1ZRT D;  3H1L E;  4KHX A;  1VF5 B;  3RL0 B;  2AXT E;  1EDJ A;  1SS1 A;  2QPZ A;  1NTZ D;  1JUN A;  1SFC A;  2M0B A;  2B87 B;  2E75 D;  3IR9 A;  3EQQ A;  3CME P;  5KLV D;  1GU4 A;  4OGQ C;  1ULJ A;  2E74 D;  1OVR A;  3AE8 C;  3EFF K;  1VQN P;  5E79 H;  2M3B A;  5H2F E;  4OVN F;  2P10 A;  1NTK G;  5APQ A;  2O1K A;  1SLQ A;  1JMM A;  1L0L K;  2N1T A;  4DOJ A;  3Q5S A;  1DEB A;  3CC4 P;  3S9O A;  3H1K D;  3PLN A;  3AEB C;  1NKZ B;  1JM0 A;  1FE6 A;  4GOE A;  3NXS A;  4N78 D;  1ZR4 A;  1T6A A;  2QRX A;  4WVZ A;  2W6A A;  1E79 H;  1HTL C;  4BWN A;  4OGQ D;  3RK3 D;  4UB6 H;  1IK9 A;  4K3A A;  4ASW A;  1NO4 A;  4RKU J;  1BDC A;  2IFN A;  3M0D C;  1GU5 A;  1KIL B;  1JM1 A;  1LGH B;  4D6T G;  2R44 A;  1ZN5 A;  1BCC J;  1VL2 A;  3B5N A;  1SQV K;  2IBZ I;  3CL3 D;  2NZ2 A;  2XR8 A;  1YTZ I;  1Q2N A;  1O7N A;  1ZW0 A;  1FZE A;  4IL6 X;  3MUD A;  1FOS F;  3V4Q A;  2POH A;  1EG9 A;  5AVS B;  4HM3 A;  4QUQ A;  2JR8 A;  1NTK E;  2FFD C;  3FWN A;  4RJT A;  2W6B A;  1KTM A;  1EC5 A;  2BAS A;  1RQU A;  1JEK A;  1VQ7 P;  4QDF B;  1JTH B;  3SWY A;  5CBO A;  1NWQ A;  4PJ0 H;  5AW0 B;  2B9B A;  1YYC A;  4WY4 C;  1QX8 A;  1UIX A;  5KTB A;  1SQX G;  2L5G B;  4WB4 A;  1KFM A;  1KZU B;  2Q9I A;  4H0L B;  3GG2 A;  4M3L A;  2Y9Y A;  3LID A;  1CSB A;  2DW3 A;  3VMY A;  3TK1 A;  3T97 B;  1AFO A;  1ZXG A;  2HOD B;  3KXD A;  3Q5P A;  1RE4 C;  4B86 A;  2M5A B;  1NU1 J;  1N7S D;  2YVJ B;  4D6T E;  2YFL A;  1YTZ T;  2V7Q H;  4HKV A;  4RES B;  4IFF A;  1G1I A;  2YMY A;  1PIX A;  1R5S A;  1KIL E;  2AEF A;  1NYK A;  1FU1 A;  4L76 A;  4YPC A;  1H8A A;  1S5L H;  2IPP A;  1SFC C;  2QJK C;  4L74 A;  2KXP B;  1T8Z A;  4BRY B;  2FYN B;  1U7J A;  3CX5 D;  1IO4 A;  2NVG A;  2ZT9 C;  3OAK A;  1PPJ D;  1EZV G;  1S5L X;  2HLO A;  1RE3 C;  1YJ9 P;  1EXJ A;  1SVF A;  3OJA B;  1OVV A;  1KN7 A;  1RF0 C;  1SQP G;  1NGM B;  3H1L J;  2YIU C;  3OA7 A;  2I1J A;  3M9H A;  1LTS C;  1EDI A;  1MUU A;  2FKW B;  3HD7 B;  3QH9 A;  1BDD A;  1VQ4 P;  1JY2 N;  2OYI B;  1SQX E;  2BCC G;  3GOB A;  4L75 A;  4JF7 A;  1P84 E;  1RY3 A;  3GHG B;  2MKV A;  1NU1 D;  5BU8 B;  1SQB G;  2WSE J;  5AVZ B;  4EMJ B;  3CWB G;  3VP8 A;  1L0N G;  1JY2 P;  1GL2 A;  4Y28 J;  2WQY C;  4N6J A;  3AE4 C;  4QUR A;  3CCL P;  4CPG A;  3JCU E;  2HFE D;  2N1T D;  2XNX A;  2PRR A;  1MFZ A;  2JKV A;  1L4A C;  1M57 D;  5KAF H;  3G71 P;  3B5N C;  4GOD A;  2YXQ B;  2WWW A;  1JO5 A;  3TSI A;  1BE3 G;  3D70 A;  1IK7 A;  3MUD C;  5CBN A;  1EZV E;  1JTH A;  1M90 Q;  2OGU A;  2WPR A;  4HJG H;  1Q90 C;  2ZFC A;  1FS0 E;  2A06 G;  5APX A;  3L71 G;  2C0X A;  3BRT B;  3CXH D;  4NPD A;  2R32 A;  1MKM A;  2SPZ A;  1LTB C;  2Y0D A;  5M1B A;  1KYO D;  2BCC E;  3M0A A;  1CZQ A;  2JWA A;  3RK2 B;  1VM9 A;  3SSU A;  4XFJ A;  3Q3D A;  3GZX A;  5AW9 B;  3VMH D;  3T97 A;  4HM5 A;  1FDM A;  3PH0 A;  1OMI A;  4XE5 B;  2RH0 A;  2M5A A;  3L70 J;  3CI9 A;  1L0N E;  1NTK J;  3FGA D;  1VF5 C;  2Q1K A;  3RL0 C;  2P2U A;  4HM0 A;  2P7J A;  5TJH A;  4IL6 E;  5KJ7 C;  2W8Z A;  1KC8 Q;  1A02 F;  2YO2 A;  4DT0 A;  1YHQ P;  4PD4 E;  3CCQ P;  1KQF B;  4NBD D;  3MP7 B;  4BRY A;  1TU3 F;  2I7F A;  1N86 A;  3G6E P;  2XKM A;  4GT1 A;  2J58 A;  2XDJ A;  3M91 A;  5CCG A;  5TIS H;  3P8C E;  3JC2 2;  1G8K B;  1LJ2 A;  1ZP0 C;  1KB9 D;  2A06 E;  2NRG A;  3L71 E;  1AVY A;  3DQY A;  3HD7 A;  2OYI A;  4D6T J;  1ZLL A;  2WPQ A;  2AEJ A;  4PJ0 E;  2A45 G;  1LTA C;  5AW1 B;  3GHG A;  5B66 H;  1A02 J;  3WMM 0;  1YBK A;  3L70 D;  2BMR A;  3FXE A;  1NTK D;  3GF7 A;  1PZQ A;  2KLV A;  5AVW B;  1SJG A;  5KAI H;  3PJS K;  1VQ8 P;  3GMA A;  4C7N B;  1NOH A;  2YKO A;  1J2J B;  2WSF J;  1L0L E;  4L73 A;  3NMD A;  3H1J D;  2WSS H;  1KV4 A;  3BCC G;  3VMA A;  2RN0 A;  2BMO A;  3CCS P;  3LW5 J;  3H1H G;  1KIL C;  1L4A B;  3V2Q A;  3CX5 I;  1OXZ A;  1QL2 A;  3D6Z A;  2GM4 A;  1M8O B;  3L73 G;  4HB1 A;  1SQX J;  1S5L E;  2KSE A;  3D6Y A;  2NVE A;  3TF5 A;  1VCK A;  3I56 P;  1WRG A;  5B5E H;  1LTG C;  2KYV A;  2KI7 B;  1QEX A;  5GTI H;  4QMA A;  3PP5 A;  2G3A A;  2ZYL A;  2QA4 P;  1SQV E;  3VTP C;  4JQ0 D;  4AAY B;  1GL2 D;  3KPE A;  2E5T A;  3FOU A;  4YTP C;  2NVF A;  1RE4 A;  1JY3 N;  3HE5 B;  3CCJ P;  3H1I G;  2O01 H;  3F89 A;  2HPC B;  4U3F D;  5CMZ A;  5AVT B;  5L8R J;  1S9K D;  4H0L C;  1Q82 Q;  1RH5 B;  3HUS B;  1RFS A;  3L72 D;  3NFQ A;  1OW6 A;  3BCC E;  2WT7 B;  2JO1 A;  1BGY E;  3H1H E;  3N4X A;  2G8Y A;  3I55 P;  1JY3 P;  2YKQ A;  3OW2 O;  2ZVO B;  1GK6 A;  3AE6 C;  1SQP J;  3E1R A;  4H13 B;  4MN4 C;  3L73 E;  3AEG C;  3CCV P;  2BCC J;  1RHZ B;  1RE3 A;  1KQS O;  3CXH I;  5KAF E;  1RF0 A;  1X0T A;  2FYN C;  2KP8 A;  3H6P A;  4N3Y B;  1KYO I;  4H0L D;  3HTK B;  1SQB J;  2HMO A;  3USS A;  3TGU G;  5CCG C;  4HKZ H;  3CWB J;  3CCE P;  1L0N J;  4PV1 B;  5HL4 A;  3KZI E;  3L75 E;  3PTZ A;  1AQT A;  1JMB A;  1FJK A;  2WIT A;  1DD4 A;  4AUW A;  4W80 A;  3HD7 C;  1YIT P;  2OYI C;  3H1I E;  2O01 N;  4R4M A;  1SQQ G;  1L2P A;  3JSV C;  4IFM A;  4C7N A;  1Y9B A;  3GL0 A;  2NUK A;  3GHG C;  1Q81 Q;  1EZV D;  5AVV B;  1BE3 J;  1FDI A;  2E76 B;  4NPE A;  1RQV A;  1SQP D;  1LWU B;  1NU1 K;  1L4A A;  1GW3 A;  2IBZ E;  3W68 A;  2KZJ A;  3L71 J;  3EN1 A;  5APW A;  1VQP P;  3MIW A;  1KB9 I;  2IZ0 A;  5KLI B;  1SQB D;  1H89 A;  1HWT C;  1ZOY C;  4NBG D;  3V5B A;  1QL1 A;  3CWB D;  1G8J B;  1CW5 A;  1L0N D;  2HMK A;  2YO3 A;  5AW2 B;  1JB0 J;  3TGU E;  5AW8 B;  5TIS E;  2XV5 A;  2O1J A;  1SP4 A;  2YNY A;  4NBH D;  3L74 J;  2WPV B;  1FBM A;  1Z56 A;  2QJY B;  4HM4 A;  2R5B A;  4C7R A;  5GTH E;  2YKP A;  2ZYA A;  1WMK A;  1OVU A;  2H43 A;  2QEX P;  4PD4 D;  2E75 B;  1ZR2 A;  1U57 A;  3HE5 A;  5AW4 B;  1VQ9 P;  1XTC C;  2HPC A;  1NTZ G;  2E74 B;  2E4P A;  1SQQ E;  1BE3 D;  3HUS A;  3F5H A;  3RK2 C;  5B66 E;  5KLV G;  5CCH A;  3CX5 H;  5KJ7 A;  1CI6 B;  1BCC D;  4HYT B;  2A06 D;  3L71 D;  3CCM P;  5AVQ B;  2B87 A;  1PV3 A;  3AE9 C;  1LTI C;  1GMJ A;  2KLU A;  1URQ B;  2H89 C;  2O3J A;  1NAF A;  1IFN A;  1N73 B;  2P58 A;  4WY4 D;  1S1C X;  3ITK A;  2XRX A;  1FZC B;  1VQ6 P;  4BXL A;  4NB8 D;  3AEC C;  3BRV B;  3RK3 B;  2FYU G;  3N7N A;  3HTK A;  1VQM P;  2FXP A;  3L74 D;  1O7M A;  2ZAE B;  3O6Q B;  1EDK A;  5B5E E;  1KOR A;  1UUW A;  3BCC J;  4C46 A;  3H1H J;  3M9Q A;  1NTZ E;  4UB8 H;  3PHL A;  1SFC D;  4LC1 A;  2HYN A;  3L73 J;  3A0H H;  3MTU E;  2OTJ P;  1EXI A;  5KLV E;  2ZT9 D;  1NTM G;  5AVY B;  1KIL A;  1EDL A;  5CJ4 A;  1NKN A;  1LWU A;  2WSC J;  1K9M Q;  1USE A;  1LP1 B;  3U1C A;  2DE7 D;  1YJW P;  2KUB A;  1NTK K;  2M8R A;  2AXT H;  2NPS C;  1MZ9 A;  1S3J A;  1ULI A;  4EIJ A;  1X8Y A;  3FWL A;  3CXH H;  2WVR A;  1VQO P;  1AA0 A;  3V2R A;  2Q3I A;  2DE6 D;  1KYO H;  3A3Y B;  5APS A;  1DX7 A;  2XU6 A;  2C0W A;  4TT3 H;  3PRJ A;  1OWA A;  1NJI Q;  2FYU E;  2LXC B;  4N78 E;  1FZF A;  5E79 E;  2WSE H;  3H1I J;  4QDF A;  3H1L D;  1M1J B;  1FAV A;  5H2F H;  2E42 A;  1M7L A;  4HM7 A;  3VMZ A;  2QSI A;  3BCC D;  2K3R A;  3RK3 E;  3M06 A;  3I5C A;  3H1H D;  3BAT A;  3LIE A;  3R2P A;  3U59 A;  3RGU A;  2ZVN B;  1EZV I;  3L73 D;  1L4A D;  2WMM A;  2GBW A;  2BEQ D;  2GA1 A;  3B5N D;  2HOD A;  2QG4 A;  3WUU A;  3VYI A;  1NTM E;  4UB6 E;  2CKF A;  3MHV A;  4EDF A;  1N7L A;  1L0L G;  1Y47 A;  3WUV A;  3HUS C;  1QVF O;  1Q90 D;  2E5Y A;  4KT0 J;  5CCH C;  3AE3 C;  3CLQ A;  3S1K A;  2KB7 P;  1URQ A;  2Q6Q A;  3TGU J;  1KB9 H;  1DEE G;  2Q7C A;  3Q5R A;  1GDT A;  3VMG D;  2ZXE B;  2KOG A;  1EQ7 A;  3S4R A;  1FZC A;  4H13 C;  2Z4E A;  1T2K C;  1GD2 E;  4W7Z A;  1O7P A;  2C9N Y;  1SQX K;  1SQQ J;  2P1J A;  4GKG A;  3KHU A;  4PD4 I;  3O6Q A;  1NYH A;  4WBA A;  2L91 A;  1NAY A;  1VF5 D;  2Y0E A;  2KZI A;  3RL0 D;  1FJP A;  2HR3 A;  1VDF A;  5KJ7 D;  2RKL A;  4PV1 C;  3WUT A;  4I6M C;  1J1E B;  1SQV G;  4RO0 A;  2N1T B;  3RBZ A;  1GTW A;  1JCC A;  5AW3 B;  2JP3 A;  1W2E A;  2HML A;  2W27 A;  3TDK A;  3AEF C;  3BAS A;  5AVR B;  1R8E A;  1HJ0 A;  4HJL A;  1GK4 A;  1Q7Y Q;  5BU5 A;  1PGQ A;  3IFM A;  3TGU D;  2NPS B;  4HM1 A;  1IFM A;  4JYC A;  3GLM A;  3CX5 E;  2E76 C;  1BGY G;  4NBA D;  1RIE A;  1OIP A;  1LWU C;  2HMJ A;  3VN0 A;  1K73 Q;  3FXD A;  2FXO A;  1IFP A;  1SQP K;  1QLE D;  1AV1 A;  2Z5H A;  1Y8A A;  2H7H A;  4O9B A;  1SQQ D;  2QIW A;  4I7Z B;  3KQG A;  1D7M A;  1M1J A;  2JZA A;  1S2E A;  5KLI C;  3P32 A;  5AVU B;  1VPC A;  1FOS E;  2WSF H;  3H32 B;  4D6T D;  2M3E A;  5KLV J;  1SQB K;  3E1I A;  3LW5 H;  1NU1 E;  1NVO A;  1O7H A;  1IC2 A;  4OH8 B;  3L75 G;  1U7M A;  3CC2 P;  5AW7 B;  3CPW O;  2IYO A;  2BEZ F;  1KIL D;  2HMM A;  4U7J A;  1L0N K;  1DH3 A;  3KYQ A;  4NBC D;  3A2A A;  1HJB A;  2LXB A;  2OAR A;  2GUS A;  1LTT C;  2QJY C;  1S4X A;  4I2L C;  2H88 C;  3M9B A;  3SFD C;  2I8D A;  2E75 C;  4QCK A;  4DZO A;  3CCR P;  1T3U A;  4R4L A;  3HE4 B;  2E74 C;  2YFI A;  2H8P D;  1ZME C;  4HM8 A;  2D2C B;  2A45 I;  3WU2 H;  2FYU J;  2N9Y B;  4H44 B;  2MJZ A;  2UWJ E;  3AE1 C;  2IBZ G;  2PFX A;  4KJM A;  2Q3E A;  3CC7 P;  2VRS A;  3D71 A;  3IAO A;  1SQX D;  1BSH A;  3JCU H;  4HM2 A;  1URQ C;  3O8Z A;  3L37 A;  1P84 D;  3A0B H;  4Y99 B;  3CXH E;  2B1X A;  1N73 C;  3EFG A;  3P7K A;  4IOI H;  1KYO E;  1FZC C;  2PGD A;  1PP9 G;  3RK3 C;  1NH4 A;  5AW5 B;  2OQQ A;  1YJN P;  4NBF D;  1NTM J;  1MV8 A;  2WPS A;  2B24 A;  3L70 G;  1HGZ A;  1PGP A;  2QJP C;  3GL2 A;  2OYH B;  3QWO C;  3V2N A;  2NUM A;  3RL0 g;  3H1J G;  3AEA C;  3VP9 A;  1URQ D;  2JWD A;  5APT A;  1FQT A;  4DCK A;  2FYU D;  1PGO A;  1Q86 Q;  2XZR A;  1HGV A;  2K88 A;  1AJY A;  2KK7 A;  2NPS A;  1G1J A;  2LKM A;  1IFJ A;  2R3C A;  1OW8 A;  1RF1 C;  1X9V A;  1HH0 A;  1FZA A;  5CCG D;  2FY8 A;  2CPS A;  4NB9 D;  4ZKU A;  1J1D B;  2BCC D;  3VCA A;  1GZL A;  4IL6 H;  1KB9 E;  3ZDM A;  1GL2 B;  4P1C H;  3BVH A;  5DJT B;  2K9J B;  3HD7 D;  4PD4 H;  2OYO A;  1LTJ B;  1T3J A;  3L4F A;  4P1B H;  1PP9 E;  3A5T A;  1LT1 A;  1NTM D;  2W90 A;  4WWI A;  4JBZ A;  3H32 A;  3AE2 C;  3L70 E;  4OWF A;  1M1J C;  1WT6 A;  2K1A A;  5CJ0 A;  3H25 A;  3GTE A;  1L0L J;  4U3F G;  2Q5U A;  3V6I A;  1N7S C;  5KKZ B;  1LT9 B;  3L72 G;  1R5L A;  3AE7 C;  3H1J E;  1IJD B;  2V7Q J;  3CCU P;  3GZY A;  3G9R A;  3HE4 A;  4EOT A;  1WQL A;  1ZV8 A;  3B8E B;  4ASV A;  2KSJ A;  3P8C D;  2J59 M;  5APV A;  2WT7 A;  4AQR D;  5KAI E;  2GBX A;  3G4S P;  1HVV A;  3AZC A;  2ZXX A;  1LNQ A;  1IFI A;  3RBX A;  3GF3 A;  1UUV A;  3C8V A;  5BOK A;  1M1K Q;  2E43 A;  3VMX A;  2KNC B;  2ZYG A;  5APU A;  3UIA A;  1SQV J;  3H1K G;  5AEU A;  3GW6 A;  2YMK A;  4OGQ B;  2B89 A;  2R5D A;  1PFI A;  3TYY A;  4NBB D;  2Y9Z A;  1M56 D;  1JY2 O;  3HRN A;  1H0T B;  2W83 C;  2NWF A;  3RK2 D;  2QJP B;  1L0L D;  3K5B A;  3U1A A;  2J5U A;  4YXD C;  1YIJ P;  2AXC A;  2RMZ A;  3IF4 A;  1G2C B;  4U3F E;  2OYH A;  3MGN A;  3Q1M A;  1S9K E;  5DJU B;  5GTI E;  4GOF A;  1FZB A;  1ZRT E;  2AEM A;  1BGY J;  2I1K A;  3L72 E;  4AYC A;  4HM6 A;  1HF9 A;  1FC2 C;  1IFD A;  3C0D A;  1J1E C;  2A45 H;  4HH2 A;  2N1T C;  4TLF A;  2BMQ A;  4LGD E;  2IDB A;  2Q3W A;  1IZN B;  4GIF A;  2B88 A;  2CK3 H;  1RF1 B;  1USD A;  1W2B O;  1P84 I;  3W67 A;  1OX3 A;  2KS1 B;  3WU2 E;  1W5C E;  3II6 A;  1S72 P;  2OTK E;  3B4S A;  1SQV D;  2KIK A;  3GKE A;  1AQ5 A;  5CXM A;  3L75 J;  2K9J A;  2IYP A;  1HBW A;  1YI2 P;  3H1K E;  1PL5 A;  4NBE D;  1LTJ A;  1XTG B;  4JYB A;  3VOP A;  3N0Q A;  3A0B E;  1E5W A;  3B71 A;  4I7Z C;  4ZMD A;  2FFD B;  1KQL A;  2WSC H;  1SQQ K;  1KQG B;  1N7S B;  2IZ1 A;  1BGY D;  3R4Y A;  2IX7 C;  3CD6 P;  1LT9 A;  1O7W A;  1X79 B;  2NPS D;  3EWK A;  2XSH A;  2GUV A;  3C1L A;  1BCC G;  1GW4 A;  3KZI H;  1SQP E;  4DJG A;  1KMI Z;  4WY4 B;  2YXR B;  3V4W A;  3V2P A;  3AE5 C;  3MD0 A;  1HUC A;  3SWK A;  5BVZ A;  1N8R Q;  1CI6 A;  2WZ7 A;  1NHL A;  3D89 A;  3ABV C;  4JPZ B;  2XSO A;  5CHX A;  1PP9 J;  2D2C C;  3VMI D;  2K37 A;  1SQB E;  2CPB A;  2ZJS E;  2QM8 A;  4IFD K;  4QDC A;  4H44 C;  1PPJ G;  3L75 D;  3TNU B;  5C39 A;  1N73 A;  2R3S A;  3CWB E;  2KNC A;  4EYY Q;  3L74 G;  4QDD A;  1FDO A;  3H1I D;  4A7P A;  2XND H;  1N2D C;  4YXW H;  3CMA P;  3H1J J;  1H0T A;  2JDI H;  4Y99 C;  1SFC B;  3AED C;  5AW6 B;  1KD1 Q;  1K05 A;  2JJL A;  2QJK B;  3EQ2 A;  1NTZ K;  2PAJ A;  2ZT9 B;  2N9B A;  4AIV A;  1G2C A;  3FX0 A;  5AEW A;  5K5G B;  1BE3 E;  2IBZ D;  1NU1 G;  1NDO A;  5KLV K;  4K35 A;  2D2C D;  3L35 A;  3GCE A;  5CCH D;  4I1L A;  3VCP A;  1K8A Q;  2C9L Y;  4H44 D;  2YIU B;  1BCC E;  4EI2 A;  1YQ3 C;  2OYH C;  3KDP B;  1JOC A;  3AEE C;  5GTH H;  2JEE A;  4W7Y A;  1JNM A;  1BSN A;  4H13 D;  1T2K D;  1PGJ A;  4GDO A;  1YQ4 C;  1PP9 D;  1RF1 A;  4ZKP A;  1LP1 A;  2K9Y A;  3P8M C;  4XA4 A;  1O7G A;  2V4H A;  3C9I A;  2KS1 A;  2FYU K;  3M0D A;  3MZW B;  3Q2Y A;  1PPJ E;  4ZNC A;  1QVG O;  1DIP A;  5APY A;  2WTY A;  4QUP A;  3H1L G;  2ITA A;  4Z1M H;  2W6J H;  4U3F J;  3L74 E;  1KFN A;  2PP6 A;  3A7O A;  4PV1 D;  1J1D C;  3GTS A;  3L72 J;  4NPF X;  1OW7 A;  5AVX B;  2P67 A;  2DE5 D;  2FXM A;  1GL2 C;  1VQK P;  1NTZ J;  2FYZ A;  3L36 A;  3B5N B;  1H88 A; 
#chains in the Genus database with same CATH homology
 2GBX A;  3EN1 A;  1VF5 D;  3AZC A;  1BGY E;  1VM9 A;  3H1H E;  4NB8 D;  3GZX A;  4HM7 A;  1SQX E;  3VMH D;  3GKE A;  5CXM A;  4HM5 A;  1L0L E;  3GOB A;  4QCK A;  2YFJ A;  3H1K E;  4NBE D;  1UUV A;  1P84 E;  2BMO A;  5BOK A;  2YFI A;  1O7M A;  2E76 D;  2XRX A;  1L0N E;  4HM8 A;  3N0Q A;  3L73 E;  2HML A;  4AIV A;  3GB4 A;  5AEW A;  2HMN A;  4NBG D;  1G8J B;  4NB9 D;  2E4Q A;  1BE3 E;  2HMK A;  4HJL A;  1UUW A;  1NDO A;  4HM0 A;  2GBW A;  5KKZ C;  3VCA A;  2D2C D;  5AEU A;  3TGU E;  4EMJ B;  3GCE A;  3VCP A;  1KB9 E;  4NBB D;  2FYN C;  4H44 D;  4NBH D;  1BCC E;  4H0L D;  4HM1 A;  2NWF A;  4P1C H;  4OGQ D;  1NTM E;  4PD4 E;  2HMO A;  2JO6 A;  4HM4 A;  1NTZ E;  3CX5 E;  2CKF A;  2NVE A;  1VCK A;  4NBA D;  1O7W A;  1RIE A;  4NBD D;  4QUR A;  2YVJ B;  4P1B H;  4HM2 A;  2XSH A;  1PP9 E;  4D6T E;  2YFL A;  2I7F A;  4HKV A;  2HMJ A;  4H13 D;  3CXH E;  2B1X A;  5HL4 A;  4U3F E;  3L75 E;  5KLV E;  2ZT9 D;  1SQP E;  2E4P A;  1ZRT E;  1SQQ E;  1KYO E;  3L70 E;  1JM1 A;  3L72 E;  1NYK A;  2ZYL A;  4HM6 A;  1G8K B;  1O7G A;  2DE7 D;  3GTE A;  3H1L E;  3H1I E;  3VMG D;  2A06 E;  3C0D A;  3L71 E;  4NBF D;  1SQV E;  2B24 A;  3D89 A;  2JZA A;  1ULI A;  1PPJ E;  1EZV E;  2QJK C;  3DQY A;  4AAY B;  2BMQ A;  5KLI C;  2QPZ A;  2QJP C;  3GL0 A;  3H1J E;  2NUK A;  2NVG A;  1O7N A;  2XR8 A;  2XSO A;  1Q90 C;  3FOU A;  3GL2 A;  4QUP A;  2NVF A;  2Q3W A;  3VMI D;  1O7P A;  3GZY A;  3L74 E;  1SQB E;  2DE6 D;  2E75 D;  2NUM A;  4PV1 D;  1EG9 A;  4QDC A;  3EQQ A;  4HM3 A;  4QUQ A;  1WQL A;  1NU1 E;  3GTS A;  1NTK E;  1ULJ A;  1O7H A;  2E74 D;  1RFS A;  3CWB E;  2DE5 D;  2IBZ E;  2FYU E;  2BCC E;  2BMR A;  2HMM A;  2YIU C;  4NBC D;  4QDF A;  4QDD A;  3BCC E;  4QDF B;  1SJG A;  2QJY C;  1FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...