1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
2HMNA 2QJPC 2FYNC 3BCCE 2NUMA 2I7FA 2GBWA 2QPZA 1Q90C 4NBHD 3GTSA 2E4PA 2ZYLA 2JZAA 2XRXA 1ULJA 4HM6A 2NUKA 3GL0A 1O7HA 3L72E 1PP9E 1RIEA 1SQXE 3L71E 1UUWA 2DE5D 3GOBA 2NWFA 3FOUA 3VCAA 2FYUE 2DE6D 2Q3WA 1KYOE 5KKZC 4QUQA 1NTZE 2YFIA 3L70E 2QJKC 2BMQA 4HM7A 4P1CH 2D2CD 4QUPA 1NYKA 3GZXA 3N0QA 2YFJA 1VCKA 2BMRA 2GBXA 4QURA 4OGQD 3VMID 1BCCE 2HMMA 4HM4A 4EMJB 3CWBE 3TGUE 5BOKA 3GZYA 2E74D 3GL2A 1NTME 5KLVE 3H1LE 1UUVA 2YFLA 3GB4A 4NBAD 3VMGD 4PD4E 4HM3A 2JO6A 3H1IE 4HKVA 1L0NE 4HM1A 1BE3E 4HM2A 2IBZE 1O7PA 4QDFB 3CXHE 4HM8A 4NBFD 2HMJA 4NBDD 1EG9A 3H1HE 2HMOA 1SQPE 4QDCA 1ULIA 1FQTA 3VCPA 1SQVE 4AIVA 5AEUA 1O7NA 3L75E 3C0DA 1PPJE 2HMLA 2B1XA 3L73E 4HJLA 4D6TE 1G8JB 4HM5A 5KLIC 4HM0A 1NU1E 2E4QA 2BCCE 2A06E 4NBBD 4AAYB 1SQQE 4QDFA 2BMOA 2XR8A 3H1KE 1ZRTE 3EQQA 4NBCD 1WQLA 5HL4A 3CX5E 3L74E 1EZVE 1VM9A 3GKEA 4P1BH 2E76D 1BGYE 2NVFA 2E75D 4NBED 2CKFA 2ZT9D 2YVJB 1O7MA 1L0LE 4H44D 3EN1A 4PV1D 2YIUC 2HMKA 4H0LD 5AEWA 3H1JE 1O7WA 4QDDA 4NB9D 4QCKA 2NVGA 4U3FE 4H13D 1NTKE 3VMHD 1JM1A 5CXMA 1KB9E 1G8KB 3DQYA 3GCEA 1O7GA 1SQBE 1VF5D 2DE7D 3D89A 1NDOA 4NBGD 1SJGA 1RFSA 3AZCA 2NVEA 2B24A 4NB8D 3GTEA 2XSOA 2QJYC 2XSHA 1P84E
chains in the Genus database with same CATH superfamily
5AVYB 2OYIB 5AVUB 2O01J 1VQKP 2E4PA 3CX5H 5CCHC 2RMZA 5KLVK 4OWFA 1YI2P 2WSFJ 3H1LG 4Z1MH 3FXEA 3L70E 1L0LJ 2GA1A 1KYOD 3GZXA 1PZQA 2AEMA 4PD4I 1SQQJ 3B5ND 3KZIH 1VQ6P 2KI7B 2HG5D 2E74D 3CC4P 1KZUB 2K1AA 3M0AA 3CC2P 2QJKB 3IF4A 1VF5C 1CW5A 1GL2A 1JOCA 3L70D 3P32A 2M3EA 4K35A 4QDCA 1JMBA 5H2FE 1EXIA 1NTMD 3AE9C 3OA7A 2G8YA 3RK3B 4NBBD 1RE4C 4B86A 2B89A 1SQVJ 1OXZA 1VQ5P 1KB9D 1L0LE 3H1LJ 3O6QA 1S4XA 4WVZA 2YKPA 2AXTE 4U3FG 1FZAA 1USDA 3AE6C 3A0HH 4H13D 1P84H 3M91A 1GL2B 4N3YB 2DE7D 2NVEA 2XKMA 1T8ZA 1SLQA 2PAJA 3WU2E 1NYHA 1MV8A 2Y0DA 1HBWA 3H1HD 3U1AA 2W27A 3V4QA 2OYIA 3L70G 3RK3D 5KJ7A 2NUKA 1HH0A 2Q1KA 3H32B 2PRRA 2JJLA 3L36A 5KKZC 1JNMA 2YFJA 1VCKA 1MUUA 2K3RA 1BDCA 3VTPC 1LJ2A 1DEEG 2O3JA 2ZYGA 1QVFO 4UB8E 3GHGA 3H1LE 2K9YA 4HM3A 1KQLA 1URQC 5E79E 5CCGA 1O7PA 2JR8A 1KD1Q 4NBFD 2AXCA 3H1KG 1BCCD 1FS0E 4H0LB 2ZYAA 5KAIH 3TK1A 2Q3EA 2FXOA 4H13C 1SQBG 2ZJSE 1NTZJ 1KQSO 3GF3A 4QDFA 1LWUC 1ZMEC 5HL4A 1KILC 3GKEA 4P1BH 5K5GB 2E75D 4NBED 3CMEP 2KSJA 4PD4H 3VMYA 3AECC 1NTZG 3WU2H 3L37A 2WVRA 1J1DB 1K8AQ 1PP9G 4BWNA 4WB4A 3B4SA 3RK2D 2IBZD 4IL6X 2IPPA 2IYPA 1WT6A 1TU3F 5CJ4A 2N1TA 4RKUJ 1O7GA 3CD6P 4DCKA 1SJGA 5CBOA 2P10A 3D71A 1AFOA 1SQVD 5APVA 2E75B 2Y9ZA 5C39A 1JCDA 4JYCA 2OYOA 1HTLC 1JY3P 3M9QA 3L72E 1VQOP 3S9OA 2W6BA 2L5GB 1OZHA 1UIIA 2QJKC 3O6QB 1SFCD 2OTJP 5KLVD 1CI6A 2HMMA 1SQVK 3TGUE 1S5LX 1DEBA 4ASWA 2WZ7A 2N1TD 3OAKA 1NTZD 1IZNB 2XU6A 5CCGD 2ZT9B 3H1HE 1PGPA 3AEEC 1FQTA 1YQ3C 4K3AA 5AW1B 3Q2YA 2HMLA 3HD7C 1L0NJ 1G8JB 4GIFA 4HM0A 1NTKK 3CWBD 3T97B 2O1JA 5B66E 2KNCA 1IO4A 1SS1A 5DJUB 1VDFA 4JBZA 5TISE 1U7JA 1U57A 1JUNA 3CCEP 1OVVA 1VQMP 2K9JA 1LT9C 2ZXEB 1VQ9P 1KB9E 3DQYA 4JYBA 1YHQP 3TGUD 4NB8D 3GTEA 3H1KD 3IR9A 3L72G 2GBWA 3RL0g 2V4HA 3CX5I 3VMZA 2OGUA 1SQXE 2M5AB 1KFNA 3P8CE 2FYUE 3LIDA 1KYOE 3D6ZA 2YFIA 2XZRA 4NPDA 4P1CH 4QUPA 1NU1J 3CXHH 1HGVA 5KLIB 2NPSC 1EQ7A 1H88A 3CCUP 1IFJA 1L4AD 4ZKUA 3G6EP 3AE3C 4KHXA 1K73Q 1PIXA 2KOGA 4NBAD 2YO2A 3CI9A 2IFMA 4DJGA 4EI2A 1FE6A 2FFDA 4AIVA 1UIXA 4Y28J 1IJDB 4ZMDA 1N7SC 1HJ0A 1YBKA 1NTKG 1W2EA 2H7HA 1NTMG 2E4QA 2YMYA 3H1KE 4NBCD 1Q82Q 1SQXJ 1VL2A 2E75C 1P84D 3MTUE 4IL6E 2WQYC 3L71G 1IK7A 1HWTC 3V2PA 4O9BA 3BATA 2A45H 4LLHA 4UB6E 2WSCJ 2W90A 1QL1A 3Q3DA 3L71J 2M5AA 2KS1A 4WY4C 3VP9A 1N86A 2XSOA 1SQPG 2QJPC 1RF0C 2NUMA 2PGDA 2QPZA 3II6A 1GMJA 2L91A 3EFFK 4AQRD 2JZAA 4HM6A 1M57D 1O7HA 2QE7H 1NTZE 3HUSA 3MGNA 1FDIA 4PV1C 2KUBA 1OVRA 3LIEA 1ZR2A 3FWLA 2JO6A 1EC5A 2CPSA 3TDKA 3JCUH 4H13B 2IZ0A 4HM2A 3H25A 3B5NA 3B5NB 2OYHC 1RQVA 2QEXP 3NXSA 4D6TG 3CPWO 1H89A 5APUA 1PV3A 3KHUA 3GG2A 2N9YB 2B87B 1XTGB 5AW5B 2KS1B 3CXHI 3L72J 3L71D 2E43A 2YXQB 2YVJB 4HKZH 4JQ0D 3TSIA 1N8RQ 2QIWA 3CCJP 5AW6B 1K04A 3PHLA 5AVXB 3H6PA 3KXDA 1W5CE 1NJIQ 3MIWA 2HYNA 3VMHD 2HR3A 1NWQA 2IDBA 1NDOA 1RH5B 1SQBD 3TNUA 1H0TA 3R2PA 4GKGA 3V6IA 5GTIH 1YITP 1AQTA 1JY2P 1M1JA 3LW5H 2LR2A 1KILA 2PP6A 4D6TD 1LWUA 1PGJA 1NYKA 2WSCH 5AW3B 2LXBA 3D6YA 4QURA 5GTHH 1JB0J 1N2DC 1BDDA 2HPCA 1N7SB 3KDPB 3CCQP 4IFFA 1L4AC 3GLMA 3CLQA 1OW7A 4PD4D 3RK3E 2I8DA 1P84I 3MUDA 3FWNA 4MN4C 1QVGO 3C0DA 2E42A 5APTA 4EOTA 1J2JB 2FXPA 3L75D 2BCCE 2Z5HA 2E5TA 4XE5B 3HTKB 1KC8Q 4GOFA 1GD2E 5APSA 1WQLA 1FAVA 2QG4A 2Q3IA 3BRVB 2CKFA 2ZT9D 2SPZA 1W2BO 3EWKA 2WSEH 2OYIC 3AE4C 1HF9A 2KIKA 1JY3N 2OTKE 1SQXG 4N78E 1L0LK 2BASA 3HD7B 3E1RA 4U3FE 1G8KB 1GU5A 1NU1D 4A7PA 3L70J 3L74G 3ABVC 5AW8B 4PV1B 5CMZA 2B88A 4Y99C 5TJHA 1ZW0A 4H44C 5AVSB 5TISH 4IOIH 1J1DC 4W7YA 1L0LD 3MD0A 2QJYB 1VF5B 2FFDC 1KILD 2JKVA 4L74A 3H1ID 4KT0J 5B66H 1IK9A 5KAFE 3RK3C 2KNCB 3H1KJ 5KAFH 4WY4A 2A06G 3SWYA 2M8RA 1NTME 1EDIA 2P2UA 3LW5J 3ZDMA 2WPSA 3VOPA 2J5UA 1SQXD 3GHGC 1KN7A 1NOHA 2E74B 2CPBA 4JPZB 1JTHA 1PPJE 2B1XA 2K9JB 1L0ND 2UWJE 1RQUA 3CWBG 1NU1E 3WUTA 2BMOA 4I7ZB 1ZN5A 1EDJA 1BCCJ 1N7SA 2IZ1A 1M56D 5AVVB 2FY8A 1BGYD 3QWOC 1RF1A 5CCHA 3T97A 1SQXK 1KTMA 2KP8A 1LTBC 4PV1D 1LT9A 4C7NA 3V4WA 4QDDA 1X9VA 2H89C 1S5LH 5B5EH 3CL3D 2QA4P 3FXDA 4I7ZC 5GTIE 1NTKD 1RFSA 3AEGC 3PP5A 1LT1A 2I1JA 1A02F 1IC2A 3NFQA 4KJMA 2BCCG 1LT9B 4DZOA 1UUWA 3ITKA 2DE5D 3RBXA 1RHZB 3VCAA 3H1JD 3L4FA 4BXLA 2KZJA 3R4YA 2LXCB 3HD7D 2FKWB 5DJTB 1AVYA 1BCCE 1T2KD 1ZLLA 4EMJB 3A3YB 3GZYA 1OW6A 2N1TB 1PP9D 2YKQA 5KAIE 4HKVA 1G1IA 1SQPD 2W83C 1SQBK 1X22A 4HM8A 3L35A 2YXRB 1ULIA 2O1KA 1N73A 1H0TB 3UIAA 1X0TA 1MZ9A 1ZP0C 1USEA 2WWWA 1RF1B 4HJLA 4UB8H 1FZFA 1NKNA 1M1JB 2JWAA 3EFGA 3HD7A 2YIUB 3GF7A 3JSVC 2YMKA 1YJWP 1OFCX 4EYYQ 2B87A 3H1JE 2KXPB 1QX8A 2QRXA 3VP8A 3C1LA 2Z5IA 1KMIZ 2GM4A 2KLVA 2FYZA 1URQA 3I55P 1SQBE 1Q2NA 4U7JA 3IN6A 2QJYC 2ZAEB 2AEJA 1P84E 2HMNA 1LTJC 4YXDC 3BCCE 2AXTH 1IFNA 3F89A 1FZCA 3H32A 1KILB 3WUUA 1FOSE 3CCVP 3FOUA 1K9MQ 3IAOA 4PJ0E 3SSUA 3AEBC 2D2CD 5KJ7C 1XTCC 1DIPA 4CPGA 1IFMA 3FGAD 2E74C 3BCCD 5KJ7D 1PPJD 1RE3C 4PD4E 2C0XA 3H1IE 1L0NE 1BE3E 3RK2B 2HODB 2WSFH 2IBZE 3HE4A 1YTZI 4M3LA 2HMJA 2HMOA 1PL5A 1SQBJ 2Y0EA 2C9LY 2NPSA 3HUSB 1H8AA 4XA4A 1MFTA 3CMAP 2Q5UA 3A2AA 1ZRTE 2LKMA 3CX5E 1LTGC 2ZVNB 5AEWA 1EDKA 4QCKA 4U3FD 2NPSB 4GOEA 2Q7CA 3A0BH 3I56P 4TLFA 5AVTB 1PPJG 4LGDE 4Y99B 1GK4A 3L73J 4TT3H 3KYQA 1ZOYC 3H1HG 1HGZA 3S4RA 3H1HJ 2ZYLA 5BU8B 2JP3A 4RO0A 3CWBJ 1NO4A 5AVRB 1PP9E 1VQ4P 1NVOA 3GOBA 4I1LA 2BEZF 2Q3WA 5EFWB 1GL2D 1G2CA 2GBXA 2JWDA 3BCCG 3V2RA 2N1TC 1AJYA 1T2KC 1BE3G 1SQQG 1AA0A 1NU1G 4ASVA 3M9BA 3N7NA 3HE5A 4H44B 1FDMA 1BCCG 1NTMK 2H8PD 1BGYJ 5CJ0A 1S3JA 1G2CB 2JEEA 2QVAA 2WSEJ 3PJSK 3H1IG 2J59M 1OMIA 3NTNA 3M0DA 1ZXGA 1M7LA 3MZWB 2QM7A 2IYOA 1SQPJ 3L74E 1NTKJ 1BGYE 5APWA 1JY2O 2W6JH 2W6AA 2I1KA 4N6JA 2QJPB 1GL2C 2BCCJ 1VQLP 2P67A 2YO3A 2IBZG 1SQPK 5GTHE 3C9IA 5APXA 1NTKE 1JM1A 1VQ8P 1JMMA 2O01N 1VF5D 1KYOH 1Q7YQ 4YXWH 2KK7A 1HVVA 4RJTA 3E7KA 2D2CB 1EXJA 1E5WA 2CK3H 2Y9YA 2M0BA 1LTSC 2XRXA 1ULJA 3NMDA 3L75J 3B5NC 3L71E 1FBMA 2QM8A 1AV1A 1CI6B 2POHA 1SQQD 1OVUA 2WPQA 1GU4A 1NU1K 3L74J 2FXMA 4OH8B 1S9KD 1RF1C 1KFMA 2ZYDA 1JM0A 5BOKA 3SFDC 1S2EA 3Q1MA 3GL2A 5CCGC 1YTZT 5KLVE 3L73G 2IFNA 5BVZA 4IFDK 2KYVA 3H1JJ 5AW9B 3SWKA 2WPRA 2Q9IA 2C9NY 4NBDD 3KPEA 1NKZB 3M9HA 1FOSF 2KSEA 3V2NA 1Z56A 2R3CA 1WMKA 1RY3A 3USSA 1L0NG 1SFCC 1M90Q 4D6TE 2P7JA 3HE5B 1J1EB 2WT7A 1VM9A 2NRGA 3K5BA 5AVZB 1IFDA 1FZCC 3W67A 1O7WA 4YPCA 3FX0A 2C0WA 3G3ZA 5CHXA 1OW8A 4ZNCA 2FBWC 3H1IJ 1FC2C 2ZXXA 1M1JC 2B24A 3RL0D 5AVQB 3TGUG 3VYIA 3V2QA 1T3JA 2IBZI 2G3AA 5KTBA 1S1CX 1YJNP 4EIJA 3GTSA 5CBNA 3O8ZA 1AQ5A 4H0LC 4I2LC 1LP1A 3CC7P 2YKOA 4WY4B 1RE4A 3GL0A 3MHVA 2BEQD 1NAYA 1FJKA 3WUVA 4D6TJ 3CCRP 1QEXA 4HM7A 2BMQA 3CCSP 2BMRA 4UB6H 3RBZA 1JY2N 3L73D 4HM4A 1NHLA 2YFLA 4HM1A 1KYOI 4IFMA 3V5BA 4QMAA 2B9BA 1FJPA 3QH9A 1X79B 1L2PA 1YYCA 3EQ2A 3VCPA 1L0NK 1VPCA 1O7NA 3S1KA 1DD3A 1PGOA 2H88C 1QGKB 3L73E 3MUDC 3BRTB 2ZFCA 2HFED 4N78D 2OARA 3A0HE 4HYTB 3RK2C 2E76D 1L0LG 5AW0B 2NZ2A 1BSHA 2XNDH 2HPCB 2RN0A 2A06D 2GUSA 2HLOA 4C7NB 1NTZK 1EDLA 3PTZA 2HODA 3AZCA 1NAFA 1ZRTD 1DX7A 5APQA 3AEDC 1D7MA 5APYA 3P7KA 4JF7A 3AE7C 4OGQC 3Q5PA 3TNUB 1QL2A 3Q5SA 2KLUA 1LP1B 1OWAA 3Q5RA 2E76C 1VQNP 3HRNA 3GHGB 2R44A 3VMID 4ZKPA 2WSSH 3GB4A 3W68A 3RL0C 2P58A 1YIJP 2K37A 1T3UA 1LTIC 1N7SD 2Q6QA 1SQVG 3CXHE 2OQQA 3KQGA 1OIPA 1KORA 1SFCB 1SQVE 1NTMJ 2W8ZA 1PP9J 1J1EC 1BSNA 4HB1A 1KB9H 3AE1C 2MJZA 1VQPP 2A45G 1BE3D 1CZQA 1SVFA 4GODA 2V7QH 2D2CC 2WPVB 1Y8AA 2ZT9C 2NPSD 1O7MA 3EN1A 2XDJA 1MKMA 2J58A 3OJAB 5AW7B 2HMKA 4H0LD 1LTAC 3A0BE 2RH0A 1HJBA 3D89A 3JC22 3I5CA 1PFIA 1Y9BA 1RE3A 1QLED 1AVOA 1Q90C 3OW2O 4NBHD 4W7ZA 3CXHD 1RIEA 2NWFA 1KILE 2R5DA 1EZVD 2XV5A 3VMXA 2E5YA 1LWUB 1X8YA 2N9BA 2WITA 3U1CA 3GW6A 2DW3A 1LTJA 4OVNF 4L73A 3VMGD 1S72P 2R5BA 4EDFA 2FYUK 2V7QJ 1Q86Q 1NGMB 4R4LA 1GZLA 1L4AB 4GDOA 2H43A 1MFZA 3TYYA 4NPFX 1CSBA 1YJ9P 3BASA 2Z4EA 1JTHB 3L75E 4LC1A 3L75G 5KLIC 4C46A 1U7MA 2A06E 2GUVA 4BRYA 2FYUD 1GDTA 2M3BA 4PJ0H 1Q81Q 4I6MC 3RGUA 3M06A 3BCCJ 1G1JA 1JCCA 3PLNA 2R32A 3GCEA 1FDOA 1M8OB 3GMAA 4NPEA 3AEFC 1KQGB 3L74D 5CCHD 2E76B 2WT7B 2QSIA 2OYHA 1Q90D 5BU5A 1URQB 1R5LA 1FZBA 3CCMP 2P1JA 2KZIA 3B71A 2WTYA 2DE6D 3M0DC 2RKLA 4QUQA 1S9KE 1IFIA 3VMAA 3N0QA 2Y0CA 4GT1A 3G9RA 3C8VA 4OGQD 3G4SP 2WMMA 3JCUE 1SP4A 3BVHA 5E79H 3U59A 3E1IA 2FYUG 2JO1A 3HUSC 3P8MC 2R3SA 1UUVA 5AVWB 3TF5A 5L8RJ 2A45I 4IL6H 1WRGA 1LGHB 1JEKA 1R8EA 1KQFB 1ZV8A 3A5TA 3MP7B 1RF0A 5KLVJ 1EZVI 2IX7C 4HM5A 2MKVA 5H2FH 3HE4B 3HTKA 1EZVE 4YTPC 1GW4A 3SWFA 1KV4A 1NH4A 1GK6A 2OYHB 4DOJA 1BGYG 4WWIA 4H44D 1EZVG 3VN0A 4WBAA 2YIUC 3AE8C 2OTLP 3AE2C 2NVGA 3SFEC 3KZIE 2XNXA 1E79H 3PRJA 1M1KQ 3A7OA 5CXMA 4NBGD 2FYUJ 5AW4B 4DT0A 1BE3J 4OGQB 2YNYA 1FZCB 4WY4D 2XSHA 1S5LE 5B5EE 1L4AA 2FYNC 2I7FA 2BCCD 1JO5A 5M1BA 4L76A 3G71P 1R5SA 4HH2A 2VRSA 3H1JG 1URQD 1HUCA 1SQQK 1LTJB 3B8EB 5KLVG 1K05A 1T6AA 3P8CD 1LNQA 3PH0A 3RL0B 1FU1A 3CX5D 1FZGA 3D70A 3CWBE 4RESB 4U3FJ 1N7LA 2ZVOB 4AYCA 1N73C 1JY3O 1LTTC 2JDIH 3CCLP 5AW2B 2KB7P 1FZEA 5KKZB 4QDFB 1OX3A 3AEAC 2FYNB 3N4XA 2O01H 1EG9A 1SQPE 1IFPA 3IFMA 3H1LD 2ITAA 4C7RA 1PGQA 5AEUA 1N73B 3F5HA 4AAYB 1SQQE 4HJGH 2XR8A 1KB9I 1SFCA 4AUWA 1A02J 3EQQA 4L75A 2NVFA 3TGUJ 1GW3A 1Y47A 4XFJA 2FFDB 1DD4A 4R4MA 2PFXA 4NB9D 1YQ4C 4BRYB 3AE5C 1VQ7P 1DH3A 1GTWA 3WMM0 4W80A 3L72D 2K88A 2AEFA 1ZR4A
chains in the Genus database with same CATH topology
2HMNA 2QJPC 2FYNC 3BCCE 2NUMA 2I7FA 2GBWA 2QPZA 1Q90C 4NBHD 3GTSA 2E4PA 2ZYLA 2JZAA 2XRXA 1ULJA 4HM6A 2NUKA 3GL0A 1O7HA 3L72E 1PP9E 1RIEA 1SQXE 3L71E 1UUWA 2DE5D 3GOBA 2NWFA 3FOUA 3VCAA 2FYUE 2DE6D 2Q3WA 1KYOE 5KKZC 4QUQA 1NTZE 2YFIA 3L70E 2QJKC 2BMQA 4HM7A 4P1CH 2D2CD 4QUPA 1NYKA 3GZXA 3N0QA 2YFJA 1VCKA 2BMRA 2GBXA 4QURA 4OGQD 3VMID 1BCCE 2HMMA 4HM4A 4EMJB 3CWBE 3TGUE 5BOKA 3GZYA 2E74D 3GL2A 1NTME 5KLVE 3H1LE 1UUVA 2YFLA 3GB4A 4NBAD 3VMGD 4PD4E 4HM3A 2JO6A 3H1IE 4HKVA 1L0NE 4HM1A 1BE3E 4HM2A 2IBZE 1O7PA 4QDFB 3CXHE 4HM8A 4NBFD 2HMJA 4NBDD 1EG9A 3H1HE 2HMOA 1SQPE 4QDCA 1ULIA 1FQTA 3VCPA 1SQVE 4AIVA 5AEUA 1O7NA 3L75E 3C0DA 1PPJE 2HMLA 2B1XA 3L73E 4HJLA 4D6TE 1G8JB 4HM5A 5KLIC 4HM0A 1NU1E 2E4QA 2BCCE 2A06E 4NBBD 4AAYB 1SQQE 4QDFA 2BMOA 2XR8A 3H1KE 1ZRTE 3EQQA 4NBCD 1WQLA 5HL4A 3CX5E 3L74E 1EZVE 1VM9A 3GKEA 4P1BH 2E76D 1BGYE 2NVFA 2E75D 4NBED 2CKFA 2ZT9D 2YVJB 1O7MA 1L0LE 4H44D 3EN1A 4PV1D 2YIUC 2HMKA 4H0LD 5AEWA 3H1JE 1O7WA 4QDDA 4NB9D 4QCKA 2NVGA 4U3FE 4H13D 1NTKE 3VMHD 1JM1A 5CXMA 1KB9E 1G8KB 3DQYA 3GCEA 1O7GA 1SQBE 1VF5D 2DE7D 3D89A 1NDOA 4NBGD 1SJGA 1RFSA 3AZCA 2NVEA 2B24A 4NB8D 3GTEA 2XSOA 2QJYC 2XSHA 1P84E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN A;  2QJP C;  2FYN C;  3BCC E;  2NUM A;  2I7F A;  2GBW A;  2QPZ A;  1Q90 C;  4NBH D;  3GTS A;  2E4P A;  2ZYL A;  2JZA A;  2XRX A;  1ULJ A;  4HM6 A;  2NUK A;  3GL0 A;  1O7H A;  3L72 E;  1PP9 E;  1RIE A;  1SQX E;  3L71 E;  1UUW A;  2DE5 D;  3GOB A;  2NWF A;  3FOU A;  3VCA A;  2FYU E;  2DE6 D;  2Q3W A;  1KYO E;  5KKZ C;  4QUQ A;  1NTZ E;  2YFI A;  3L70 E;  2QJK C;  2BMQ A;  4HM7 A;  4P1C H;  2D2C D;  4QUP A;  1NYK A;  3GZX A;  3N0Q A;  2YFJ A;  1VCK A;  2BMR A;  2GBX A;  4QUR A;  4OGQ D;  3VMI D;  1BCC E;  2HMM A;  4HM4 A;  4EMJ B;  3CWB E;  3TGU E;  5BOK A;  3GZY A;  2E74 D;  3GL2 A;  1NTM E;  5KLV E;  3H1L E;  1UUV A;  2YFL A;  3GB4 A;  4NBA D;  3VMG D;  4PD4 E;  4HM3 A;  2JO6 A;  3H1I E;  4HKV A;  1L0N E;  4HM1 A;  1BE3 E;  4HM2 A;  2IBZ E;  1O7P A;  4QDF B;  3CXH E;  4HM8 A;  4NBF D;  2HMJ A;  4NBD D;  1EG9 A;  3H1H E;  2HMO A;  1SQP E;  4QDC A;  1ULI A;  1FQT A;  3VCP A;  1SQV E;  4AIV A;  5AEU A;  1O7N A;  3L75 E;  3C0D A;  1PPJ E;  2HML A;  2B1X A;  3L73 E;  4HJL A;  4D6T E;  1G8J B;  4HM5 A;  5KLI C;  4HM0 A;  1NU1 E;  2E4Q A;  2BCC E;  2A06 E;  4NBB D;  4AAY B;  1SQQ E;  4QDF A;  2BMO A;  2XR8 A;  3H1K E;  1ZRT E;  3EQQ A;  4NBC D;  1WQL A;  5HL4 A;  3CX5 E;  3L74 E;  1EZV E;  1VM9 A;  3GKE A;  4P1B H;  2E76 D;  1BGY E;  2NVF A;  2E75 D;  4NBE D;  2CKF A;  2ZT9 D;  2YVJ B;  1O7M A;  1L0L E;  4H44 D;  3EN1 A;  4PV1 D;  2YIU C;  2HMK A;  4H0L D;  5AEW A;  3H1J E;  1O7W A;  4QDD A;  4NB9 D;  4QCK A;  2NVG A;  4U3F E;  4H13 D;  1NTK E;  3VMH D;  1JM1 A;  5CXM A;  1KB9 E;  1G8K B;  3DQY A;  3GCE A;  1O7G A;  1SQB E;  1VF5 D;  2DE7 D;  3D89 A;  1NDO A;  4NBG D;  1SJG A;  1RFS A;  3AZC A;  2NVE A;  2B24 A;  4NB8 D;  3GTE A;  2XSO A;  2QJY C;  2XSH A;  1P84 E; 
#chains in the Genus database with same CATH topology
 5AVY B;  2OYI B;  5AVU B;  2O01 J;  1VQK P;  2E4P A;  3CX5 H;  5CCH C;  2RMZ A;  5KLV K;  4OWF A;  1YI2 P;  2WSF J;  3H1L G;  4Z1M H;  3FXE A;  3L70 E;  1L0L J;  2GA1 A;  1KYO D;  3GZX A;  1PZQ A;  2AEM A;  4PD4 I;  1SQQ J;  3B5N D;  3KZI H;  1VQ6 P;  2KI7 B;  2HG5 D;  2E74 D;  3CC4 P;  1KZU B;  2K1A A;  3M0A A;  3CC2 P;  2QJK B;  3IF4 A;  1VF5 C;  1CW5 A;  1GL2 A;  1JOC A;  3L70 D;  3P32 A;  2M3E A;  4K35 A;  4QDC A;  1JMB A;  5H2F E;  1EXI A;  1NTM D;  3AE9 C;  3OA7 A;  2G8Y A;  3RK3 B;  4NBB D;  1RE4 C;  4B86 A;  2B89 A;  1SQV J;  1OXZ A;  1VQ5 P;  1KB9 D;  1L0L E;  3H1L J;  3O6Q A;  1S4X A;  4WVZ A;  2YKP A;  2AXT E;  4U3F G;  1FZA A;  1USD A;  3AE6 C;  3A0H H;  4H13 D;  1P84 H;  3M91 A;  1GL2 B;  4N3Y B;  2DE7 D;  2NVE A;  2XKM A;  1T8Z A;  1SLQ A;  2PAJ A;  3WU2 E;  1NYH A;  1MV8 A;  2Y0D A;  1HBW A;  3H1H D;  3U1A A;  2W27 A;  3V4Q A;  2OYI A;  3L70 G;  3RK3 D;  5KJ7 A;  2NUK A;  1HH0 A;  2Q1K A;  3H32 B;  2PRR A;  2JJL A;  3L36 A;  5KKZ C;  1JNM A;  2YFJ A;  1VCK A;  1MUU A;  2K3R A;  1BDC A;  3VTP C;  1LJ2 A;  1DEE G;  2O3J A;  2ZYG A;  1QVF O;  4UB8 E;  3GHG A;  3H1L E;  2K9Y A;  4HM3 A;  1KQL A;  1URQ C;  5E79 E;  5CCG A;  1O7P A;  2JR8 A;  1KD1 Q;  4NBF D;  2AXC A;  3H1K G;  1BCC D;  1FS0 E;  4H0L B;  2ZYA A;  5KAI H;  3TK1 A;  2Q3E A;  2FXO A;  4H13 C;  1SQB G;  2ZJS E;  1NTZ J;  1KQS O;  3GF3 A;  4QDF A;  1LWU C;  1ZME C;  5HL4 A;  1KIL C;  3GKE A;  4P1B H;  5K5G B;  2E75 D;  4NBE D;  3CME P;  2KSJ A;  4PD4 H;  3VMY A;  3AEC C;  1NTZ G;  3WU2 H;  3L37 A;  2WVR A;  1J1D B;  1K8A Q;  1PP9 G;  4BWN A;  4WB4 A;  3B4S A;  3RK2 D;  2IBZ D;  4IL6 X;  2IPP A;  2IYP A;  1WT6 A;  1TU3 F;  5CJ4 A;  2N1T A;  4RKU J;  1O7G A;  3CD6 P;  4DCK A;  1SJG A;  5CBO A;  2P10 A;  3D71 A;  1AFO A;  1SQV D;  5APV A;  2E75 B;  2Y9Z A;  5C39 A;  1JCD A;  4JYC A;  2OYO A;  1HTL C;  1JY3 P;  3M9Q A;  3L72 E;  1VQO P;  3S9O A;  2W6B A;  2L5G B;  1OZH A;  1UII A;  2QJK C;  3O6Q B;  1SFC D;  2OTJ P;  5KLV D;  1CI6 A;  2HMM A;  1SQV K;  3TGU E;  1S5L X;  1DEB A;  4ASW A;  2WZ7 A;  2N1T D;  3OAK A;  1NTZ D;  1IZN B;  2XU6 A;  5CCG D;  2ZT9 B;  3H1H E;  1PGP A;  3AEE C;  1FQT A;  1YQ3 C;  4K3A A;  5AW1 B;  3Q2Y A;  2HML A;  3HD7 C;  1L0N J;  1G8J B;  4GIF A;  4HM0 A;  1NTK K;  3CWB D;  3T97 B;  2O1J A;  5B66 E;  2KNC A;  1IO4 A;  1SS1 A;  5DJU B;  1VDF A;  4JBZ A;  5TIS E;  1U7J A;  1U57 A;  1JUN A;  3CCE P;  1OVV A;  1VQM P;  2K9J A;  1LT9 C;  2ZXE B;  1VQ9 P;  1KB9 E;  3DQY A;  4JYB A;  1YHQ P;  3TGU D;  4NB8 D;  3GTE A;  3H1K D;  3IR9 A;  3L72 G;  2GBW A;  3RL0 g;  2V4H A;  3CX5 I;  3VMZ A;  2OGU A;  1SQX E;  2M5A B;  1KFN A;  3P8C E;  2FYU E;  3LID A;  1KYO E;  3D6Z A;  2YFI A;  2XZR A;  4NPD A;  4P1C H;  4QUP A;  1NU1 J;  3CXH H;  1HGV A;  5KLI B;  2NPS C;  1EQ7 A;  1H88 A;  3CCU P;  1IFJ A;  1L4A D;  4ZKU A;  3G6E P;  3AE3 C;  4KHX A;  1K73 Q;  1PIX A;  2KOG A;  4NBA D;  2YO2 A;  3CI9 A;  2IFM A;  4DJG A;  4EI2 A;  1FE6 A;  2FFD A;  4AIV A;  1UIX A;  4Y28 J;  1IJD B;  4ZMD A;  1N7S C;  1HJ0 A;  1YBK A;  1NTK G;  1W2E A;  2H7H A;  1NTM G;  2E4Q A;  2YMY A;  3H1K E;  4NBC D;  1Q82 Q;  1SQX J;  1VL2 A;  2E75 C;  1P84 D;  3MTU E;  4IL6 E;  2WQY C;  3L71 G;  1IK7 A;  1HWT C;  3V2P A;  4O9B A;  3BAT A;  2A45 H;  4LLH A;  4UB6 E;  2WSC J;  2W90 A;  1QL1 A;  3Q3D A;  3L71 J;  2M5A A;  2KS1 A;  4WY4 C;  3VP9 A;  1N86 A;  2XSO A;  1SQP G;  2QJP C;  1RF0 C;  2NUM A;  2PGD A;  2QPZ A;  3II6 A;  1GMJ A;  2L91 A;  3EFF K;  4AQR D;  2JZA A;  4HM6 A;  1M57 D;  1O7H A;  2QE7 H;  1NTZ E;  3HUS A;  3MGN A;  1FDI A;  4PV1 C;  2KUB A;  1OVR A;  3LIE A;  1ZR2 A;  3FWL A;  2JO6 A;  1EC5 A;  2CPS A;  3TDK A;  3JCU H;  4H13 B;  2IZ0 A;  4HM2 A;  3H25 A;  3B5N A;  3B5N B;  2OYH C;  1RQV A;  2QEX P;  3NXS A;  4D6T G;  3CPW O;  1H89 A;  5APU A;  1PV3 A;  3KHU A;  3GG2 A;  2N9Y B;  2B87 B;  1XTG B;  5AW5 B;  2KS1 B;  3CXH I;  3L72 J;  3L71 D;  2E43 A;  2YXQ B;  2YVJ B;  4HKZ H;  4JQ0 D;  3TSI A;  1N8R Q;  2QIW A;  3CCJ P;  5AW6 B;  1K04 A;  3PHL A;  5AVX B;  3H6P A;  3KXD A;  1W5C E;  1NJI Q;  3MIW A;  2HYN A;  3VMH D;  2HR3 A;  1NWQ A;  2IDB A;  1NDO A;  1RH5 B;  1SQB D;  3TNU A;  1H0T A;  3R2P A;  4GKG A;  3V6I A;  5GTI H;  1YIT P;  1AQT A;  1JY2 P;  1M1J A;  3LW5 H;  2LR2 A;  1KIL A;  2PP6 A;  4D6T D;  1LWU A;  1PGJ A;  1NYK A;  2WSC H;  5AW3 B;  2LXB A;  3D6Y A;  4QUR A;  5GTH H;  1JB0 J;  1N2D C;  1BDD A;  2HPC A;  1N7S B;  3KDP B;  3CCQ P;  4IFF A;  1L4A C;  3GLM A;  3CLQ A;  1OW7 A;  4PD4 D;  3RK3 E;  2I8D A;  1P84 I;  3MUD A;  3FWN A;  4MN4 C;  1QVG O;  3C0D A;  2E42 A;  5APT A;  4EOT A;  1J2J B;  2FXP A;  3L75 D;  2BCC E;  2Z5H A;  2E5T A;  4XE5 B;  3HTK B;  1KC8 Q;  4GOF A;  1GD2 E;  5APS A;  1WQL A;  1FAV A;  2QG4 A;  2Q3I A;  3BRV B;  2CKF A;  2ZT9 D;  2SPZ A;  1W2B O;  3EWK A;  2WSE H;  2OYI C;  3AE4 C;  1HF9 A;  2KIK A;  1JY3 N;  2OTK E;  1SQX G;  4N78 E;  1L0L K;  2BAS A;  3HD7 B;  3E1R A;  4U3F E;  1G8K B;  1GU5 A;  1NU1 D;  4A7P A;  3L70 J;  3L74 G;  3ABV C;  5AW8 B;  4PV1 B;  5CMZ A;  2B88 A;  4Y99 C;  5TJH A;  1ZW0 A;  4H44 C;  5AVS B;  5TIS H;  4IOI H;  1J1D C;  4W7Y A;  1L0L D;  3MD0 A;  2QJY B;  1VF5 B;  2FFD C;  1KIL D;  2JKV A;  4L74 A;  3H1I D;  4KT0 J;  5B66 H;  1IK9 A;  5KAF E;  3RK3 C;  2KNC B;  3H1K J;  5KAF H;  4WY4 A;  2A06 G;  3SWY A;  2M8R A;  1NTM E;  1EDI A;  2P2U A;  3LW5 J;  3ZDM A;  2WPS A;  3VOP A;  2J5U A;  1SQX D;  3GHG C;  1KN7 A;  1NOH A;  2E74 B;  2CPB A;  4JPZ B;  1JTH A;  1PPJ E;  2B1X A;  2K9J B;  1L0N D;  2UWJ E;  1RQU A;  3CWB G;  1NU1 E;  3WUT A;  2BMO A;  4I7Z B;  1ZN5 A;  1EDJ A;  1BCC J;  1N7S A;  2IZ1 A;  1M56 D;  5AVV B;  2FY8 A;  1BGY D;  3QWO C;  1RF1 A;  5CCH A;  3T97 A;  1SQX K;  1KTM A;  2KP8 A;  1LTB C;  4PV1 D;  1LT9 A;  4C7N A;  3V4W A;  4QDD A;  1X9V A;  2H89 C;  1S5L H;  5B5E H;  3CL3 D;  2QA4 P;  3FXD A;  4I7Z C;  5GTI E;  1NTK D;  1RFS A;  3AEG C;  3PP5 A;  1LT1 A;  2I1J A;  1A02 F;  1IC2 A;  3NFQ A;  4KJM A;  2BCC G;  1LT9 B;  4DZO A;  1UUW A;  3ITK A;  2DE5 D;  3RBX A;  1RHZ B;  3VCA A;  3H1J D;  3L4F A;  4BXL A;  2KZJ A;  3R4Y A;  2LXC B;  3HD7 D;  2FKW B;  5DJT B;  1AVY A;  1BCC E;  1T2K D;  1ZLL A;  4EMJ B;  3A3Y B;  3GZY A;  1OW6 A;  2N1T B;  1PP9 D;  2YKQ A;  5KAI E;  4HKV A;  1G1I A;  1SQP D;  2W83 C;  1SQB K;  1X22 A;  4HM8 A;  3L35 A;  2YXR B;  1ULI A;  2O1K A;  1N73 A;  1H0T B;  3UIA A;  1X0T A;  1MZ9 A;  1ZP0 C;  1USE A;  2WWW A;  1RF1 B;  4HJL A;  4UB8 H;  1FZF A;  1NKN A;  1M1J B;  2JWA A;  3EFG A;  3HD7 A;  2YIU B;  3GF7 A;  3JSV C;  2YMK A;  1YJW P;  1OFC X;  4EYY Q;  2B87 A;  3H1J E;  2KXP B;  1QX8 A;  2QRX A;  3VP8 A;  3C1L A;  2Z5I A;  1KMI Z;  2GM4 A;  2KLV A;  2FYZ A;  1URQ A;  3I55 P;  1SQB E;  1Q2N A;  4U7J A;  3IN6 A;  2QJY C;  2ZAE B;  2AEJ A;  1P84 E;  2HMN A;  1LTJ C;  4YXD C;  3BCC E;  2AXT H;  1IFN A;  3F89 A;  1FZC A;  3H32 A;  1KIL B;  3WUU A;  1FOS E;  3CCV P;  3FOU A;  1K9M Q;  3IAO A;  4PJ0 E;  3SSU A;  3AEB C;  2D2C D;  5KJ7 C;  1XTC C;  1DIP A;  4CPG A;  1IFM A;  3FGA D;  2E74 C;  3BCC D;  5KJ7 D;  1PPJ D;  1RE3 C;  4PD4 E;  2C0X A;  3H1I E;  1L0N E;  1BE3 E;  3RK2 B;  2HOD B;  2WSF H;  2IBZ E;  3HE4 A;  1YTZ I;  4M3L A;  2HMJ A;  2HMO A;  1PL5 A;  1SQB J;  2Y0E A;  2C9L Y;  2NPS A;  3HUS B;  1H8A A;  4XA4 A;  1MFT A;  3CMA P;  2Q5U A;  3A2A A;  1ZRT E;  2LKM A;  3CX5 E;  1LTG C;  2ZVN B;  5AEW A;  1EDK A;  4QCK A;  4U3F D;  2NPS B;  4GOE A;  2Q7C A;  3A0B H;  3I56 P;  4TLF A;  5AVT B;  1PPJ G;  4LGD E;  4Y99 B;  1GK4 A;  3L73 J;  4TT3 H;  3KYQ A;  1ZOY C;  3H1H G;  1HGZ A;  3S4R A;  3H1H J;  2ZYL A;  5BU8 B;  2JP3 A;  4RO0 A;  3CWB J;  1NO4 A;  5AVR B;  1PP9 E;  1VQ4 P;  1NVO A;  3GOB A;  4I1L A;  2BEZ F;  2Q3W A;  5EFW B;  1GL2 D;  1G2C A;  2GBX A;  2JWD A;  3BCC G;  3V2R A;  2N1T C;  1AJY A;  1T2K C;  1BE3 G;  1SQQ G;  1AA0 A;  1NU1 G;  4ASV A;  3M9B A;  3N7N A;  3HE5 A;  4H44 B;  1FDM A;  1BCC G;  1NTM K;  2H8P D;  1BGY J;  5CJ0 A;  1S3J A;  1G2C B;  2JEE A;  2QVA A;  2WSE J;  3PJS K;  3H1I G;  2J59 M;  1OMI A;  3NTN A;  3M0D A;  1ZXG A;  1M7L A;  3MZW B;  2QM7 A;  2IYO A;  1SQP J;  3L74 E;  1NTK J;  1BGY E;  5APW A;  1JY2 O;  2W6J H;  2W6A A;  2I1K A;  4N6J A;  2QJP B;  1GL2 C;  2BCC J;  1VQL P;  2P67 A;  2YO3 A;  2IBZ G;  1SQP K;  5GTH E;  3C9I A;  5APX A;  1NTK E;  1JM1 A;  1VQ8 P;  1JMM A;  2O01 N;  1VF5 D;  1KYO H;  1Q7Y Q;  4YXW H;  2KK7 A;  1HVV A;  4RJT A;  3E7K A;  2D2C B;  1EXJ A;  1E5W A;  2CK3 H;  2Y9Y A;  2M0B A;  1LTS C;  2XRX A;  1ULJ A;  3NMD A;  3L75 J;  3B5N C;  3L71 E;  1FBM A;  2QM8 A;  1AV1 A;  1CI6 B;  2POH A;  1SQQ D;  1OVU A;  2WPQ A;  1GU4 A;  1NU1 K;  3L74 J;  2FXM A;  4OH8 B;  1S9K D;  1RF1 C;  1KFM A;  2ZYD A;  1JM0 A;  5BOK A;  3SFD C;  1S2E A;  3Q1M A;  3GL2 A;  5CCG C;  1YTZ T;  5KLV E;  3L73 G;  2IFN A;  5BVZ A;  4IFD K;  2KYV A;  3H1J J;  5AW9 B;  3SWK A;  2WPR A;  2Q9I A;  2C9N Y;  4NBD D;  3KPE A;  1NKZ B;  3M9H A;  1FOS F;  2KSE A;  3V2N A;  1Z56 A;  2R3C A;  1WMK A;  1RY3 A;  3USS A;  1L0N G;  1SFC C;  1M90 Q;  4D6T E;  2P7J A;  3HE5 B;  1J1E B;  2WT7 A;  1VM9 A;  2NRG A;  3K5B A;  5AVZ B;  1IFD A;  1FZC C;  3W67 A;  1O7W A;  4YPC A;  3FX0 A;  2C0W A;  3G3Z A;  5CHX A;  1OW8 A;  4ZNC A;  2FBW C;  3H1I J;  1FC2 C;  2ZXX A;  1M1J C;  2B24 A;  3RL0 D;  5AVQ B;  3TGU G;  3VYI A;  3V2Q A;  1T3J A;  2IBZ I;  2G3A A;  5KTB A;  1S1C X;  1YJN P;  4EIJ A;  3GTS A;  5CBN A;  3O8Z A;  1AQ5 A;  4H0L C;  4I2L C;  1LP1 A;  3CC7 P;  2YKO A;  4WY4 B;  1RE4 A;  3GL0 A;  3MHV A;  2BEQ D;  1NAY A;  1FJK A;  3WUV A;  4D6T J;  3CCR P;  1QEX A;  4HM7 A;  2BMQ A;  3CCS P;  2BMR A;  4UB6 H;  3RBZ A;  1JY2 N;  3L73 D;  4HM4 A;  1NHL A;  2YFL A;  4HM1 A;  1KYO I;  4IFM A;  3V5B A;  4QMA A;  2B9B A;  1FJP A;  3QH9 A;  1X79 B;  1L2P A;  1YYC A;  3EQ2 A;  3VCP A;  1L0N K;  1VPC A;  1O7N A;  3S1K A;  1DD3 A;  1PGO A;  2H88 C;  1QGK B;  3L73 E;  3MUD C;  3BRT B;  2ZFC A;  2HFE D;  4N78 D;  2OAR A;  3A0H E;  4HYT B;  3RK2 C;  2E76 D;  1L0L G;  5AW0 B;  2NZ2 A;  1BSH A;  2XND H;  2HPC B;  2RN0 A;  2A06 D;  2GUS A;  2HLO A;  4C7N B;  1NTZ K;  1EDL A;  3PTZ A;  2HOD A;  3AZC A;  1NAF A;  1ZRT D;  1DX7 A;  5APQ A;  3AED C;  1D7M A;  5APY A;  3P7K A;  4JF7 A;  3AE7 C;  4OGQ C;  3Q5P A;  3TNU B;  1QL2 A;  3Q5S A;  2KLU A;  1LP1 B;  1OWA A;  3Q5R A;  2E76 C;  1VQN P;  3HRN A;  3GHG B;  2R44 A;  3VMI D;  4ZKP A;  2WSS H;  3GB4 A;  3W68 A;  3RL0 C;  2P58 A;  1YIJ P;  2K37 A;  1T3U A;  1LTI C;  1N7S D;  2Q6Q A;  1SQV G;  3CXH E;  2OQQ A;  3KQG A;  1OIP A;  1KOR A;  1SFC B;  1SQV E;  1NTM J;  2W8Z A;  1PP9 J;  1J1E C;  1BSN A;  4HB1 A;  1KB9 H;  3AE1 C;  2MJZ A;  1VQP P;  2A45 G;  1BE3 D;  1CZQ A;  1SVF A;  4GOD A;  2V7Q H;  2D2C C;  2WPV B;  1Y8A A;  2ZT9 C;  2NPS D;  1O7M A;  3EN1 A;  2XDJ A;  1MKM A;  2J58 A;  3OJA B;  5AW7 B;  2HMK A;  4H0L D;  1LTA C;  3A0B E;  2RH0 A;  1HJB A;  3D89 A;  3JC2 2;  3I5C A;  1PFI A;  1Y9B A;  1RE3 A;  1QLE D;  1AVO A;  1Q90 C;  3OW2 O;  4NBH D;  4W7Z A;  3CXH D;  1RIE A;  2NWF A;  1KIL E;  2R5D A;  1EZV D;  2XV5 A;  3VMX A;  2E5Y A;  1LWU B;  1X8Y A;  2N9B A;  2WIT A;  3U1C A;  3GW6 A;  2DW3 A;  1LTJ A;  4OVN F;  4L73 A;  3VMG D;  1S72 P;  2R5B A;  4EDF A;  2FYU K;  2V7Q J;  1Q86 Q;  1NGM B;  4R4L A;  1GZL A;  1L4A B;  4GDO A;  2H43 A;  1MFZ A;  3TYY A;  4NPF X;  1CSB A;  1YJ9 P;  3BAS A;  2Z4E A;  1JTH B;  3L75 E;  4LC1 A;  3L75 G;  5KLI C;  4C46 A;  1U7M A;  2A06 E;  2GUV A;  4BRY A;  2FYU D;  1GDT A;  2M3B A;  4PJ0 H;  1Q81 Q;  4I6M C;  3RGU A;  3M06 A;  3BCC J;  1G1J A;  1JCC A;  3PLN A;  2R32 A;  3GCE A;  1FDO A;  1M8O B;  3GMA A;  4NPE A;  3AEF C;  1KQG B;  3L74 D;  5CCH D;  2E76 B;  2WT7 B;  2QSI A;  2OYH A;  1Q90 D;  5BU5 A;  1URQ B;  1R5L A;  1FZB A;  3CCM P;  2P1J A;  2KZI A;  3B71 A;  2WTY A;  2DE6 D;  3M0D C;  2RKL A;  4QUQ A;  1S9K E;  1IFI A;  3VMA A;  3N0Q A;  2Y0C A;  4GT1 A;  3G9R A;  3C8V A;  4OGQ D;  3G4S P;  2WMM A;  3JCU E;  1SP4 A;  3BVH A;  5E79 H;  3U59 A;  3E1I A;  2FYU G;  2JO1 A;  3HUS C;  3P8M C;  2R3S A;  1UUV A;  5AVW B;  3TF5 A;  5L8R J;  2A45 I;  4IL6 H;  1WRG A;  1LGH B;  1JEK A;  1R8E A;  1KQF B;  1ZV8 A;  3A5T A;  3MP7 B;  1RF0 A;  5KLV J;  1EZV I;  2IX7 C;  4HM5 A;  2MKV A;  5H2F H;  3HE4 B;  3HTK A;  1EZV E;  4YTP C;  1GW4 A;  3SWF A;  1KV4 A;  1NH4 A;  1GK6 A;  2OYH B;  4DOJ A;  1BGY G;  4WWI A;  4H44 D;  1EZV G;  3VN0 A;  4WBA A;  2YIU C;  3AE8 C;  2OTL P;  3AE2 C;  2NVG A;  3SFE C;  3KZI E;  2XNX A;  1E79 H;  3PRJ A;  1M1K Q;  3A7O A;  5CXM A;  4NBG D;  2FYU J;  5AW4 B;  4DT0 A;  1BE3 J;  4OGQ B;  2YNY A;  1FZC B;  4WY4 D;  2XSH A;  1S5L E;  5B5E E;  1L4A A;  2FYN C;  2I7F A;  2BCC D;  1JO5 A;  5M1B A;  4L76 A;  3G71 P;  1R5S A;  4HH2 A;  2VRS A;  3H1J G;  1URQ D;  1HUC A;  1SQQ K;  1LTJ B;  3B8E B;  5KLV G;  1K05 A;  1T6A A;  3P8C D;  1LNQ A;  3PH0 A;  3RL0 B;  1FU1 A;  3CX5 D;  1FZG A;  3D70 A;  3CWB E;  4RES B;  4U3F J;  1N7L A;  2ZVO B;  4AYC A;  1N73 C;  1JY3 O;  1LTT C;  2JDI H;  3CCL P;  5AW2 B;  2KB7 P;  1FZE A;  5KKZ B;  4QDF B;  1OX3 A;  3AEA C;  2FYN B;  3N4X A;  2O01 H;  1EG9 A;  1SQP E;  1IFP A;  3IFM A;  3H1L D;  2ITA A;  4C7R A;  1PGQ A;  5AEU A;  1N73 B;  3F5H A;  4AAY B;  1SQQ E;  4HJG H;  2XR8 A;  1KB9 I;  1SFC A;  4AUW A;  1A02 J;  3EQQ A;  4L75 A;  2NVF A;  3TGU J;  1GW3 A;  1Y47 A;  4XFJ A;  2FFD B;  1DD4 A;  4R4M A;  2PFX A;  4NB9 D;  1YQ4 C;  4BRY B;  3AE5 C;  1VQ7 P;  1DH3 A;  1GTW A;  3WMM 0;  4W80 A;  3L72 D;  2K88 A;  2AEF A;  1ZR4 A; 
#chains in the Genus database with same CATH homology
 2HMN A;  2QJP C;  2FYN C;  3BCC E;  2NUM A;  2I7F A;  2GBW A;  2QPZ A;  1Q90 C;  4NBH D;  3GTS A;  2E4P A;  2ZYL A;  2JZA A;  2XRX A;  1ULJ A;  4HM6 A;  2NUK A;  3GL0 A;  1O7H A;  3L72 E;  1PP9 E;  1RIE A;  1SQX E;  3L71 E;  1UUW A;  2DE5 D;  3GOB A;  2NWF A;  3FOU A;  3VCA A;  2FYU E;  2DE6 D;  2Q3W A;  1KYO E;  5KKZ C;  4QUQ A;  1NTZ E;  2YFI A;  3L70 E;  2QJK C;  2BMQ A;  4HM7 A;  4P1C H;  2D2C D;  4QUP A;  1NYK A;  3GZX A;  3N0Q A;  2YFJ A;  1VCK A;  2BMR A;  2GBX A;  4QUR A;  4OGQ D;  3VMI D;  1BCC E;  2HMM A;  4HM4 A;  4EMJ B;  3CWB E;  3TGU E;  5BOK A;  3GZY A;  2E74 D;  3GL2 A;  1NTM E;  5KLV E;  3H1L E;  1UUV A;  2YFL A;  3GB4 A;  4NBA D;  3VMG D;  4PD4 E;  4HM3 A;  2JO6 A;  3H1I E;  4HKV A;  1L0N E;  4HM1 A;  1BE3 E;  4HM2 A;  2IBZ E;  1O7P A;  4QDF B;  3CXH E;  4HM8 A;  4NBF D;  2HMJ A;  4NBD D;  1EG9 A;  3H1H E;  2HMO A;  1SQP E;  4QDC A;  1ULI A;  1FQT A;  3VCP A;  1SQV E;  4AIV A;  5AEU A;  1O7N A;  3L75 E;  3C0D A;  1PPJ E;  2HML A;  2B1X A;  3L73 E;  4HJL A;  4D6T E;  1G8J B;  4HM5 A;  5KLI C;  4HM0 A;  1NU1 E;  2E4Q A;  2BCC E;  2A06 E;  4NBB D;  4AAY B;  1SQQ E;  4QDF A;  2BMO A;  2XR8 A;  3H1K E;  1ZRT E;  3EQQ A;  4NBC D;  1WQL A;  5HL4 A;  3CX5 E;  3L74 E;  1EZV E;  1VM9 A;  3GKE A;  4P1B H;  2E76 D;  1BGY E;  2NVF A;  2E75 D;  4NBE D;  2CKF A;  2ZT9 D;  2YVJ B;  1O7M A;  1L0L E;  4H44 D;  3EN1 A;  4PV1 D;  2YIU C;  2HMK A;  4H0L D;  5AEW A;  3H1J E;  1O7W A;  4QDD A;  4NB9 D;  4QCK A;  2NVG A;  4U3F E;  4H13 D;  1NTK E;  3VMH D;  1JM1 A;  5CXM A;  1KB9 E;  1G8K B;  3DQY A;  3GCE A;  1O7G A;  1SQB E;  1VF5 D;  2DE7 D;  3D89 A;  1NDO A;  4NBG D;  1SJG A;  1RFS A;  3AZC A;  2NVE A;  2B24 A;  4NB8 D;  3GTE A;  2XSO A;  2QJY C;  2XSH A;  1P84 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...