1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
2Q3WA 4QDFB 3H1JE 1O7PA 2E75D 2JO6A 2ZT9D 3GCEA 3EN1A 4QDDA 4QUQA 2NWFA 4HM1A 1WQLA 1EZVE 4PD4E 1FQTA 2YFLA 1O7MA 2QJYC 1L0NE 2HMLA 3AZCA 4OGQD 4H13D 4HM7A 1ULJA 2CKFA 2NUKA 5KLVE 2E4QA 2B1XA 2A06E 1BGYE 1SQPE 2GBWA 1VF5D 2BMQA 3GB4A 3TGUE 3L72E 5CXMA 1NTKE 4HM0A 4NBHD 2YFJA 2YIUC 3H1KE 2DE7D 4QURA 4NBDD 2XRXA 3VCPA 3H1LE 1VCKA 1G8JB 1ULIA 4NBFD 5HL4A 3L75E 3GOBA 3DQYA 2HMKA 3VCAA 2YFIA 1KYOE 1SQQE 5AEUA 2DE5D 1BCCE 1SQBE 4NB8D 1SJGA 4EMJB 1RFSA 2BMRA 2QPZA 2HMMA 3CXHE 2D2CD 4NBBD 1UUVA 2FYNC 2FYUE 2ZYLA 3VMID 4HM8A 4D6TE 4HM3A 3CX5E 3GL0A 1O7GA 2NVGA 2XSHA 4QCKA 3VMHD 3CWBE 4H0LD 1VM9A 1Q90C 3BCCE 2XR8A 3GL2A 4QUPA 2HMOA 3GTSA 5KLIC 3H1HE 3GZXA 1ZRTE 1P84E 3L70E 1RIEA 1BE3E 4QDCA 3GKEA 4P1CH 3L74E 1NDOA 4QDFA 1SQXE 3GTEA 4NBED 4NBGD 1SQVE 5BOKA 2E74D 2E76D 2NVEA 4NB9D 4AAYB 1KB9E 1PPJE 2B24A 3EQQA 2NVFA 1G8KB 3C0DA 3N0QA 1PP9E 1JM1A 5KKZC 1O7WA 2E4PA 1NTME 1NYKA 1EG9A 2NUMA 3VMGD 4HM5A 4PV1D 3H1IE 4U3FE 1UUWA 4HJLA 2YVJB 4H44D 4NBCD 4AIVA 2QJKC 3D89A 4HM6A 2IBZE 4P1BH 2GBXA 4HKVA 2HMJA 1NU1E 4HM2A 3L73E 1L0LE 3FOUA 4NBAD 2HMNA 2I7FA 1O7NA 2XSOA 2BCCE 2BMOA 3L71E 3GZYA 2DE6D 4HM4A 2JZAA 1NTZE 5AEWA 2QJPC 1O7HA
chains in the Genus database with same CATH superfamily
2Q3WA 2N1TC 3H1JE 1P84H 3CCMP 4BXLA 1FZFA 2A45G 4I7ZB 5APTA 2KLVA 4AYCA 1IJDB 4N78D 1OVRA 1QX8A 2E5YA 4HM0A 4LC1A 2OYIA 1Q7YQ 3A0BE 4GODA 1EZVG 2M5AA 3O6QA 3FXEA 4IFFA 1SQXK 1SQVK 3WU2H 2WMMA 1FBMA 2QRXA 1VF5B 1SQXJ 3SWKA 1SQVJ 1NTMK 1O7GA 1T3JA 4NPDA 1RHZB 2KIKA 1XTGB 2WT7A 1ZLLA 1IFPA 1EDJA 1URQA 2NPSD 1E79H 3L70E 2IYPA 3FGAD 1NDOA 1T6AA 2E75C 2IZ0A 2K88A 4IFDK 4OH8B 3T97B 1VQLP 4U3FD 2GM4A 5E79E 1O7WA 2P10A 4HM5A 3EWKA 3MGNA 3H1KJ 2XNDH 1L0LD 1BSNA 2YMKA 1HF9A 4PJ0H 2JO1A 2KS1A 2Y9YA 3LW5J 1EC5A 4L76A 4WY4D 1DH3A 1O7NA 3U59A 4CPGA 3KXDA 3NMDA 1PGPA 2P7JA 1NTKK 2W83C 3H32B 1T2KD 1BDDA 1A02F 3KHUA 2QJPC 1O7HA 5CCGD 1EZVD 1NTKJ 2KXPB 2C0WA 3PJSK 1L0NE 5KLVE 1SQPE 1H88A 3L75D 3CCQP 1PP9J 1J1DC 1VCKA 1J1EB 5KAFE 5B5EH 4O9BA 3N4XA 3R2PA 1BE3J 3CXHE 1AQTA 3M9HA 1LTAC 3SWFA 2FYNC 2NPSA 2BCCJ 2OYHC 5AW3B 1R5SA 2Q5UA 2Y9ZA 1JY2O 1OW7A 3G6EP 4IL6H 4ZNCA 4RJTA 1VQPP 2I1KA 5AVYB 1RIEA 4QDCA 3L74E 4C7NA 1NO4A 1MFZA 3RK2B 3TGUG 1G8KB 3N0QA 2QSIA 2QIWA 3PHLA 1NTZK 1FDMA 3VMGD 4WY4A 1PGJA 1G1JA 1NTZJ 3HE5A 3MUDC 3CX5I 2GBXA 3A7OA 2CPBA 1JUNA 2AXTE 5CCGA 1M56D 1SQBJ 1G2CB 2XSOA 3L71E 1FZAA 4D6TG 3CX5H 3CI9A 1X8YA 2JWAA 2G3AA 1OIPA 1RF1B 4B86A 3TNUA 3CD6P 1GK6A 4W7YA 1JNMA 1SQQK 4ZKUA 1FQTA 3AZCA 4H44C 2WPSA 2LXCB 4HH2A 5TISH 1VF5D 4KJMA 3MD0A 2YIUC 3B5NC 2DE7D 4IL6X 2B87B 1L4AC 2W90A 2GA1A 2WSCJ 1U7MA 2QPZA 3GW6A 1U57A 2C9NY 5BVZA 1NAFA 1NAYA 4DJGA 2XU6A 1KFNA 3VMHD 1K8AQ 2RKLA 3W68A 5AVQB 1LT1A 3AECC 4R4MA 4NBED 2HG5D 1YHQP 2NVEA 2N1TB 3VMAA 3IR9A 3NXSA 3V6IA 3JCUE 1VQ9P 3H1KG 3HTKB 2IBZD 3OW2O 1CW5A 3AE9C 2YMYA 4WWIA 3RK3C 4JPZB 4NBAD 2JKVA 1PFIA 4DZOA 1IFIA 3AE2C 2SPZA 1S72P 1Q90D 2YNYA 1AV1A 1CZQA 1LTJB 4QDFB 2IFMA 2KOGA 4KHXA 1Q81Q 4HM1A 1FDIA 4H0LC 4EOTA 4UB8E 2YO3A 1JTHB 3HE4A 3H1LD 1Z56A 2YKOA 1VQ8P 4BRYB 5EFWB 2OQQA 2V7QH 4EYYQ 1YJWP 2E75B 3T97A 4U3FJ 2HLOA 2RN0A 1LTSC 1J2JB 1L0LJ 1OW6A 3G4SP 2BCCG 3RK2D 1OVVA 2IFNA 1H0TA 5CCHC 3QWOC 4YXDC 3CCUP 1AVOA 1VM9A 2MKVA 1JMBA 3SSUA 3BCCE 1ZV8A 1JMMA 3OJAB 3PLNA 1M90Q 3FX0A 1SQXE 1SQVE 2QJPB 3PH0A 3L35A 2JR8A 3CX5D 3BATA 1QVGO 1N8RQ 2FYZA 2QG4A 1NTME 1S2EA 2WSFJ 2YXRB 1N7LA 4HJLA 3WMM0 1VL2A 2QJKC 4P1BH 1QL1A 5CJ4A 4HM2A 5KJ7A 1GL2C 3D6ZA 3TSIA 1LTGC 2FYUG 5BU8B 1M1JA 2KNCB 3VMXA 4JYCA 4L75A 4HM4A 1UIIA 3KDPB 3H1IG 1KZUB 2R5BA 1KILA 3M0AA 3SFDC 2ZYAA 2JO6A 1S9KE 4K3AA 2NWFA 1BGYD 2OYHB 3P8CD 1KC8Q 1QGKB 3A3YB 2A06E 1GW3A 2K1AA 2BMQA 1AA0A 3M91A 1NTKE 2ZXEB 2R3SA 2ZT9B 2R44A 2JDIH 3V2RA 1VQOP 4GOFA 3L73G 4I1LA 1KYOE 5AVRB 1KQLA 1QL2A 3V2PA 2N1TD 1IO4A 1EZVI 3CWBD 3CPWO 3EFFK 3RL0g 4HM3A 1IFJA 1FE6A 3CXHI 5KAFH 1G2CA 3CMAP 2QEXP 5KLIC 2XV5A 4GKGA 2I8DA 3GHGC 3MTUE 1BE3E 4P1CH 3I5CA 3CXHH 1RF1A 1LT9C 5B66H 1S5LE 2B88A 4NB9D 5CBOA 3VOPA 1ZXGA 1IFMA 2B24A 3H1ID 4WBAA 4H44B 1IC2A 1RF0C 2ZFCA 2FXOA 4AIVA 1NU1D 4HM6A 1OWAA 3L70G 1MKMA 2WPVB 2YIUB 2B87A 5DJUB 2ZVNB 3H1JD 2YKPA 2Q7CA 2WSEJ 1NTZE 5AVWB 1FZCC 2E75D 3OAKA 3H1HG 1K9MQ 3L73D 3GCEA 3USSA 3B8EB 3H25A 5AVTB 3AEDC 3CCSP 2RMZA 4U3FG 4D6TJ 2N1TA 4TT3H 1EXIA 3DQYA 2XZRA 1HJ0A 2LKMA 1L0LG 1SQQE 4PV1C 3HTKA 1WMKA 3S4RA 1H8AA 1VDFA 2BMRA 4Z1MH 2QM8A 3LIDA 2CK3H 3RK3B 1FAVA 3L70D 1A02J 2Q3EA 1HBWA 3E1RA 4C7RA 1ZRTE 1LTJA 2C0XA 3VMYA 4QDFA 2JWDA 1KB9E 3D71A 3HUSC 3AE5C 4KT0J 2OYIC 1EG9A 3H1HD 4H0LB 1UUWA 3L75G 3JSVC 4GT1A 3Q1MA 3KZIE 5H2FH 3A2AA 3PP5A 2WPRA 2J5UA 5AW0B 4UB6H 1FC2C 2QA4P 1K04A 3IN6A 2YKQA 2WSEH 1DD3A 4AQRD 2JZAA 1MV8A 4XA4A 1KQGB 2VRSA 1W5CE 2ZT9D 1L0ND 1Y9BA 1URQC 1HH0A 2HFED 3IAOA 5KLVD 1SQPD 4PD4E 1OZHA 4Y99C 2AEJA 2BEQD 5M1BA 2IBZI 2L5GB 1RH5B 3CLQA 4NPFX 3L72E 4GIFA 1NGMB 2AEMA 1LP1A 2HPCB 1HWTC 3CXHD 1DEEG 2DE5D 2W8ZA 2QJKB 2H43A 5L8RJ 5AVVB 2O1JA 2XSHA 1GL2B 2P2UA 5C39A 3L74D 1GTWA 2KNCA 3TF5A 3WUUA 1JY3N 5KKZB 3GKEA 2E74D 1GMJA 3AE4C 3F89A 1NYKA 2NUMA 1PGOA 2N9YB 1YIJP 3RL0D 1ZN5A 2KZIA 3L71D 2DW3A 2NPSC 5BU5A 3R4YA 3V2NA 2WVRA 5GTIH 2WQYC 1MUUA 1VQKP 5KAIE 2QJYB 1H89A 3CWBJ 4JBZA 1WQLA 2MJZA 5CJ0A 1SQBK 5APSA 2NUKA 4HB1A 3ITKA 3AE7C 2B1XA 1FJPA 2FYUK 4EIJA 2LXBA 4A7PA 2FYUJ 3GHGB 2P58A 3ABVC 3MP7B 4QURA 1ZMEC 3H1IJ 1LT9B 4K35A 2IBZG 3LIEA 1EXJA 5CCGC 1BCCE 5CHXA 2KK7A 3VP8A 1EDLA 2ZYLA 1KV4A 4HM8A 5APXA 3GL0A 4L74A 1KQSO 3B71A 4H0LD 1OX3A 2FFDB 3TK1A 1USEA 1RE3A 4ZKPA 1X9VA 1RY3A 2V7QJ 2FXMA 3RK3E 2XKMA 1BSHA 1P84E 3L73J 3FXDA 4AAYB 2P1JA 1FZCB 2IDBA 3H1LG 1YI2P 3H6PA 3AEBC 3AE6C 2ZVOB 3SFEC 1KN7A 2LR2A 3Q3DA 3FOUA 3RBZA 3HD7C 2E76B 3WU2E 1GK4A 1GU4A 2NRGA 4RO0A 1HTLC 3G71P 5APYA 2KYVA 1NH4A 4PV1B 1MFTA 3EN1A 2V4HA 3HRNA 1JCCA 1GU5A 3GLMA 4YXWH 3L70J 4HM7A 2AEFA 4DT0A 3BVHA 4MN4C 3TGUE 4I7ZC 1N7SC 1GL2D 1FOSE 1PL5A 2RH0A 2ZXXA 1Q82Q 3P8MC 1EDIA 3HUSB 2NZ2A 3H1HJ 5AEUA 4JF7A 1W2EA 4ASWA 3O6QB 4D6TE 3BCCD 1Y8AA 3GF7A 3Q2YA 3GL2A 1S5LX 2QM7A 3SWYA 3U1CA 3GZXA 1SQVD 1SVFA 3EQ2A 1L0LK 1BGYG 1L0NJ 3GMAA 1SFCC 1NTMD 5KLVJ 3EQQA 1SQPJ 1HJBA 2NVFA 4N3YB 3A0BH 3JC22 2B9BA 4Y99B 2YVJB 4JYBA 1T3UA 1G1IA 1CSBA 2R32A 3H32A 4HKVA 5B5EE 1S1CX 3CCJP 2GUVA 5AW9B 5KTBA 2GUSA 1KILE 2OTKE 1QLED 1S9KD 3CWBG 2WPQA 5AEWA 5GTHE 1VPCA 2D2CC 3GG2A 2A06D 3L75J 3O8ZA 1GW4A 5CMZA 2Y0EA 2BEZF 4IL6E 2CKFA 1KD1Q 1NTKD 3L74J 1J1DB 5E79H 5AVXB 3CCRP 1OW8A 1YQ4C 3H1KE 2R5DA 4NBFD 2I1JA 1GD2E 5KJ7C 1NU1G 3OA7A 2FYNB 2IX7C 2J58A 1J1EC 1QVFO 1RE4A 1M1JC 2HMMA 4NBBD 3L71J 1KILC 3CX5E 5APQA 3I56P 3H1JG 2L91A 1BE3D 1N73C 2KUBA 3MHVA 2K3RA 1NVOA 2J59M 4NBGD 3KQGA 5BOKA 2E76D 5TISE 3M0DA 1PP9E 5AW1B 4OGQC 1JEKA 4H13C 3M9BA 1NKZB 5AW7B 4PV1D 1NYHA 3RK2C 4C7NB 4IOIH 1Y47A 1LT9A 3K5BA 2BCCE 2K9JB 2Z4EA 3HE5B 4I2LC 3C1LA 1JY2N 1E5WA 2XDJA 1SLQA 1N2DC 4QDDA 4QUQA 4QMAA 3CC2P 1LTIC 5APWA 2FFDA 1YJNP 3B5NB 2IZ1A 1ZW0A 4NPEA 1OFCX 3GB4A 3FWLA 3CMEP 3M9QA 5APUA 1L4AB 4L73A 1N86A 3Q5SA 3VCPA 3AE8C 2W6BA 2H7HA 1SQQD 3GF3A 3VCAA 2AXTH 1SQBE 1VQ4P 4EMJB 1LTBC 1UUVA 2FYUE 1Q86Q 3II6A 5AW4B 3G9RA 4U7JA 3HD7B 2O01N 4HJGH 4LLHA 1IK7A 1M1KQ 1L0NG 1GDTA 1HUCA 1KB9D 5KLVG 4WVZA 2R3CA 1SQPG 4YTPC 2JP3A 4AUWA 2KZJA 3RBXA 4EI2A 1PPJE 2Y0DA 3C0DA 1JM1A 2JEEA 4JQ0D 1LWUC 2KLUA 2H88C 3D89A 3TYYA 3CC7P 2O01H 3W67A 3RGUA 5APVA 3L73E 1N7SB 2ZAEB 3L4FA 3HUSA 1GZLA 4PD4D 1AJYA 2PP6A 5AW5B 1JTHA 1X79B 3H1LJ 1LTJC 3BCCJ 3D70A 5TJHA 1O7MA 2HMLA 3L74G 4BRYA 1CI6B 3L72D 2GBWA 3VMZA 3JCUH 2H8PD 2HODB 4N78E 1FOSF 1S3JA 1NTMJ 1HGVA 1G8JB 1ZR2A 3HE4B 1SFCB 3GOBA 2KB7P 2HMKA 1PZQA 2XNXA 1JM0A 2Q3IA 1M8OB 3L71G 2W6AA 3VMID 1JOCA 2PFXA 1U7JA 2WWWA 1NWQA 2W27A 2KI7B 3H1HE 3VP9A 1BCCG 1FZBA 3Q5RA 1H0TB 2Q9IA 4UB8H 2AXCA 3I55P 2PAJA 2D2CB 1YJ9P 2Z5HA 1IFDA 2BASA 3C9IA 1W2BO 4U3FE 4W80A 3L36A 4H44D 4ZMDA 1JY3P 5CBNA 4W7ZA 1VQ5P 1L0LE 2PRRA 3B5ND 3BRVB 1BGYJ 3GZYA 2OYHA 3NTNA 1L4AD 4ASVA 4RESB 3KYQA 1LGHB 1PGQA 1ZR4A 1O7PA 3S9OA 3ZDMA 1M1JB 3AEGC 1EZVE 1KILB 3G3ZA 3A0HE 1FU1A 2O1KA 2YXQB 3A5TA 5B66E 5K5GB 3AE1C 1AVYA 1N73B 5GTHH 2G8YA 5CXMA 3HD7D 1BCCD 3L75E 1LJ2A 5DJTB 3MUDA 3FWNA 4OGQB 4H13B 2ZT9C 1SJGA 1AQ5A 4M3LA 1VQMP 1KFMA 5KLIB 3IFMA 2FY8A 2M3BA 4WY4C 4QCKA 3RK3D 2FKWB 1BDCA 1P84D 3LW5H 2K9JA 1T2KC 5AW8B 1NU1K 1DIPA 1N7SD 3GTEA 1NU1J 4LGDE 3WUTA 5AW6B 1KYOI 1NJIQ 4Y28J 3V4QA 2ZJSE 4GOEA 3N7NA 2P67A 1ZOYC 4EDFA 1SS1A 3B5NA 1FZEA 3NFQA 3H1JJ 1KYOH 1KMIZ 2JJLA 2YO2A 2HMJA 1L4AA 2N9BA 1SQQJ 1TU3F 2I7FA 2HR3A 2DE6D 2Y0CA 4RKUJ 3Q5PA 2E74C 3V2QA 4N6JA 1RE3C 3TDKA 3BCCG 5AVZB 2C9LY 2OTJP 1XTCC 4IFMA 1SFCD 1M7LA 1OMIA 1WRGA 1SQXG 1SQVG 1S5LH 1KQFB 3TGUD 3HD7A 5CCHD 3RL0C 2O3JA 4OVNF 1NTMG 3U1AA 1ULIA 2WZ7A 2YFIA 5H2FE 1FZGA 3AE3C 2E42A 1LWUB 1OXZA 1HGZA 1RFSA 4D6TD 1PIXA 4UB6E 2D2CD 3CL3D 1VQNP 3AEFC 2E43A 1LNQA 3VTPC 2KP8A 1N7SA 3P32A 1YBKA 1R5LA 2E5TA 2IPPA 2HMOA 3GTSA 1S4XA 2OARA 1L2PA 1DX7A 4PJ0E 2WTYA 2A06G 2OYIB 3IF4A 2KSJA 2K9YA 1QEXA 2M5AB 1NTKG 1JO5A 4R4LA 5KJ7D 1CI6A 3L72J 2IYOA 3CCEP 4NBCD 1VF5C 2OYOA 2Q6QA 4DCKA 2IBZE 1PV3A 1SQXD 1L0NK 1KILD 2HODA 2W6JH 5KLVK 1NOHA 1X22A 1SQPK 1YTZI 5AVUB 1SFCA 1PP9G 2UWJE 1SP4A 2WT7B 1VQ6P 4XFJA 3VYIA 1URQB 4I6MC 2K37A 1FS0E 1UIXA 3S1KA 5CCHA 1KB9I 2QVAA 3PTZA 1WT6A 2M8RA 2WSCH 3PRJA 2YFLA 1BE3G 4OGQD 4H13D 2M3EA 1ULJA 2OGUA 1KB9H 4HYTB 3BRTB 3H1KD 3E7KA 1JY3O 2HPCA 2KS1B 4NBHD 2YFJA 4NBDD 2XRXA 3H1LE 1FDOA 3KZIH 3KPEA 1D7MA 1DEBA 2Z5IA 1GL2A 1R8EA 2WITA 1IFNA 2OTLP 3MIWA 4PD4I 1LP1B 2FBWC 1IK9A 1T8ZA 3UIAA 1NTZG 1EQ7A 5GTIE 1NHLA 3VN0A 1KORA 3D6YA 1Q90C 1KYOD 2QE7H 4PD4H 3B4SA 1YYCA 3V4WA 1SQBG 1KTMA 1FJKA 1LTTC 1PP9D 2KSEA 5KKZC 1EDKA 2PGDA 3E1IA 1NKNA 5AW2B 2H89C 1OVUA 3WUVA 1HVVA 4XE5B 1JCDA 1Q2NA 3BASA 1N73A 1IZNB 2NPSB 1RQVA 1SQQG 2BCCD 2Q1KA 1RE4C 2POHA 1BCCJ 1PPJG 2B89A 4GDOA 4OWFA 1USDA 4DOJA 2A45I 1VQ7P 1DD4A 2WSSH 1X0TA 2ZYGA 2QJYC 2A45H 3GHGA 2O01J 4WY4B 2E4QA 1JY2P 1BGYE 1YITP 3M0DC 1AFOA 1NTZD 3P8CE 1MZ9A 3AEAC 3EFGA 4TLFA 3C8VA 3MZWB 1K05A 4C46A 4WB4A 1K73Q 1M57D 1RF0A 5HL4A 1SQBD 3CCLP 3A0HH 1YTZT 2FYUD 4NB8D 1RF1C 3F5HA 2ZYDA 3CC4P 4YPCA 3TNUB 2WSFH 4HKZH 5KAIH 2NVGA 1ZP0C 2FXPA 3M06A 3CWBE 2CPSA 2XR8A 4QUPA 1FZCA 2HYNA 4BWNA 1PPJD 2FFDC 5AVSB 2E74B 1RQUA 3L72G 1JB0J 1URQD 2E4PA 3TGUJ 3H1IE 1ZRTD 3L37A 3V5BA 3CCVP 3RL0B 1NU1E 2M0BA 2HMNA 2ITAA 2BMOA 1P84I 1YQ3C 3AEEC 3P7KA 3QH9A 2E76C 1LWUA
chains in the Genus database with same CATH topology
2Q3WA 4QDFB 3H1JE 1O7PA 2E75D 2JO6A 2ZT9D 3GCEA 3EN1A 4QDDA 4QUQA 2NWFA 4HM1A 1WQLA 1EZVE 4PD4E 1FQTA 2YFLA 1O7MA 2QJYC 1L0NE 2HMLA 3AZCA 4OGQD 4H13D 4HM7A 1ULJA 2CKFA 2NUKA 5KLVE 2E4QA 2B1XA 2A06E 1BGYE 1SQPE 2GBWA 1VF5D 2BMQA 3GB4A 3TGUE 3L72E 5CXMA 1NTKE 4HM0A 4NBHD 2YFJA 2YIUC 3H1KE 2DE7D 4QURA 4NBDD 2XRXA 3VCPA 3H1LE 1VCKA 1G8JB 1ULIA 4NBFD 5HL4A 3L75E 3GOBA 3DQYA 2HMKA 3VCAA 2YFIA 1KYOE 1SQQE 5AEUA 2DE5D 1BCCE 1SQBE 4NB8D 1SJGA 4EMJB 1RFSA 2BMRA 2QPZA 2HMMA 3CXHE 2D2CD 4NBBD 1UUVA 2FYNC 2FYUE 2ZYLA 3VMID 4HM8A 4D6TE 4HM3A 3CX5E 3GL0A 1O7GA 2NVGA 2XSHA 4QCKA 3VMHD 3CWBE 4H0LD 1VM9A 1Q90C 3BCCE 2XR8A 3GL2A 4QUPA 2HMOA 3GTSA 5KLIC 3H1HE 3GZXA 1ZRTE 1P84E 3L70E 1RIEA 1BE3E 4QDCA 3GKEA 4P1CH 3L74E 1NDOA 4QDFA 1SQXE 3GTEA 4NBED 4NBGD 1SQVE 5BOKA 2E74D 2E76D 2NVEA 4NB9D 4AAYB 1KB9E 1PPJE 2B24A 3EQQA 2NVFA 1G8KB 3C0DA 3N0QA 1PP9E 1JM1A 5KKZC 1O7WA 2E4PA 1NTME 1NYKA 1EG9A 2NUMA 3VMGD 4HM5A 4PV1D 3H1IE 4U3FE 1UUWA 4HJLA 2YVJB 4H44D 4NBCD 4AIVA 2QJKC 3D89A 4HM6A 2IBZE 4P1BH 2GBXA 4HKVA 2HMJA 1NU1E 4HM2A 3L73E 1L0LE 3FOUA 4NBAD 2HMNA 2I7FA 1O7NA 2XSOA 2BCCE 2BMOA 3L71E 3GZYA 2DE6D 4HM4A 2JZAA 1NTZE 5AEWA 2QJPC 1O7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3W A;  4QDF B;  3H1J E;  1O7P A;  2E75 D;  2JO6 A;  2ZT9 D;  3GCE A;  3EN1 A;  4QDD A;  4QUQ A;  2NWF A;  4HM1 A;  1WQL A;  1EZV E;  4PD4 E;  1FQT A;  2YFL A;  1O7M A;  2QJY C;  1L0N E;  2HML A;  3AZC A;  4OGQ D;  4H13 D;  4HM7 A;  1ULJ A;  2CKF A;  2NUK A;  5KLV E;  2E4Q A;  2B1X A;  2A06 E;  1BGY E;  1SQP E;  2GBW A;  1VF5 D;  2BMQ A;  3GB4 A;  3TGU E;  3L72 E;  5CXM A;  1NTK E;  4HM0 A;  4NBH D;  2YFJ A;  2YIU C;  3H1K E;  2DE7 D;  4QUR A;  4NBD D;  2XRX A;  3VCP A;  3H1L E;  1VCK A;  1G8J B;  1ULI A;  4NBF D;  5HL4 A;  3L75 E;  3GOB A;  3DQY A;  2HMK A;  3VCA A;  2YFI A;  1KYO E;  1SQQ E;  5AEU A;  2DE5 D;  1BCC E;  1SQB E;  4NB8 D;  1SJG A;  4EMJ B;  1RFS A;  2BMR A;  2QPZ A;  2HMM A;  3CXH E;  2D2C D;  4NBB D;  1UUV A;  2FYN C;  2FYU E;  2ZYL A;  3VMI D;  4HM8 A;  4D6T E;  4HM3 A;  3CX5 E;  3GL0 A;  1O7G A;  2NVG A;  2XSH A;  4QCK A;  3VMH D;  3CWB E;  4H0L D;  1VM9 A;  1Q90 C;  3BCC E;  2XR8 A;  3GL2 A;  4QUP A;  2HMO A;  3GTS A;  5KLI C;  3H1H E;  3GZX A;  1ZRT E;  1P84 E;  3L70 E;  1RIE A;  1BE3 E;  4QDC A;  3GKE A;  4P1C H;  3L74 E;  1NDO A;  4QDF A;  1SQX E;  3GTE A;  4NBE D;  4NBG D;  1SQV E;  5BOK A;  2E74 D;  2E76 D;  2NVE A;  4NB9 D;  4AAY B;  1KB9 E;  1PPJ E;  2B24 A;  3EQQ A;  2NVF A;  1G8K B;  3C0D A;  3N0Q A;  1PP9 E;  1JM1 A;  5KKZ C;  1O7W A;  2E4P A;  1NTM E;  1NYK A;  1EG9 A;  2NUM A;  3VMG D;  4HM5 A;  4PV1 D;  3H1I E;  4U3F E;  1UUW A;  4HJL A;  2YVJ B;  4H44 D;  4NBC D;  4AIV A;  2QJK C;  3D89 A;  4HM6 A;  2IBZ E;  4P1B H;  2GBX A;  4HKV A;  2HMJ A;  1NU1 E;  4HM2 A;  3L73 E;  1L0L E;  3FOU A;  4NBA D;  2HMN A;  2I7F A;  1O7N A;  2XSO A;  2BCC E;  2BMO A;  3L71 E;  3GZY A;  2DE6 D;  4HM4 A;  2JZA A;  1NTZ E;  5AEW A;  2QJP C;  1O7H A; 
#chains in the Genus database with same CATH topology
 2Q3W A;  2N1T C;  3H1J E;  1P84 H;  3CCM P;  4BXL A;  1FZF A;  2A45 G;  4I7Z B;  5APT A;  2KLV A;  4AYC A;  1IJD B;  4N78 D;  1OVR A;  1QX8 A;  2E5Y A;  4HM0 A;  4LC1 A;  2OYI A;  1Q7Y Q;  3A0B E;  4GOD A;  1EZV G;  2M5A A;  3O6Q A;  3FXE A;  4IFF A;  1SQX K;  1SQV K;  3WU2 H;  2WMM A;  1FBM A;  2QRX A;  1VF5 B;  1SQX J;  3SWK A;  1SQV J;  1NTM K;  1O7G A;  1T3J A;  4NPD A;  1RHZ B;  2KIK A;  1XTG B;  2WT7 A;  1ZLL A;  1IFP A;  1EDJ A;  1URQ A;  2NPS D;  1E79 H;  3L70 E;  2IYP A;  3FGA D;  1NDO A;  1T6A A;  2E75 C;  2IZ0 A;  2K88 A;  4IFD K;  4OH8 B;  3T97 B;  1VQL P;  4U3F D;  2GM4 A;  5E79 E;  1O7W A;  2P10 A;  4HM5 A;  3EWK A;  3MGN A;  3H1K J;  2XND H;  1L0L D;  1BSN A;  2YMK A;  1HF9 A;  4PJ0 H;  2JO1 A;  2KS1 A;  2Y9Y A;  3LW5 J;  1EC5 A;  4L76 A;  4WY4 D;  1DH3 A;  1O7N A;  3U59 A;  4CPG A;  3KXD A;  3NMD A;  1PGP A;  2P7J A;  1NTK K;  2W83 C;  3H32 B;  1T2K D;  1BDD A;  1A02 F;  3KHU A;  2QJP C;  1O7H A;  5CCG D;  1EZV D;  1NTK J;  2KXP B;  2C0W A;  3PJS K;  1L0N E;  5KLV E;  1SQP E;  1H88 A;  3L75 D;  3CCQ P;  1PP9 J;  1J1D C;  1VCK A;  1J1E B;  5KAF E;  5B5E H;  4O9B A;  3N4X A;  3R2P A;  1BE3 J;  3CXH E;  1AQT A;  3M9H A;  1LTA C;  3SWF A;  2FYN C;  2NPS A;  2BCC J;  2OYH C;  5AW3 B;  1R5S A;  2Q5U A;  2Y9Z A;  1JY2 O;  1OW7 A;  3G6E P;  4IL6 H;  4ZNC A;  4RJT A;  1VQP P;  2I1K A;  5AVY B;  1RIE A;  4QDC A;  3L74 E;  4C7N A;  1NO4 A;  1MFZ A;  3RK2 B;  3TGU G;  1G8K B;  3N0Q A;  2QSI A;  2QIW A;  3PHL A;  1NTZ K;  1FDM A;  3VMG D;  4WY4 A;  1PGJ A;  1G1J A;  1NTZ J;  3HE5 A;  3MUD C;  3CX5 I;  2GBX A;  3A7O A;  2CPB A;  1JUN A;  2AXT E;  5CCG A;  1M56 D;  1SQB J;  1G2C B;  2XSO A;  3L71 E;  1FZA A;  4D6T G;  3CX5 H;  3CI9 A;  1X8Y A;  2JWA A;  2G3A A;  1OIP A;  1RF1 B;  4B86 A;  3TNU A;  3CD6 P;  1GK6 A;  4W7Y A;  1JNM A;  1SQQ K;  4ZKU A;  1FQT A;  3AZC A;  4H44 C;  2WPS A;  2LXC B;  4HH2 A;  5TIS H;  1VF5 D;  4KJM A;  3MD0 A;  2YIU C;  3B5N C;  2DE7 D;  4IL6 X;  2B87 B;  1L4A C;  2W90 A;  2GA1 A;  2WSC J;  1U7M A;  2QPZ A;  3GW6 A;  1U57 A;  2C9N Y;  5BVZ A;  1NAF A;  1NAY A;  4DJG A;  2XU6 A;  1KFN A;  3VMH D;  1K8A Q;  2RKL A;  3W68 A;  5AVQ B;  1LT1 A;  3AEC C;  4R4M A;  4NBE D;  2HG5 D;  1YHQ P;  2NVE A;  2N1T B;  3VMA A;  3IR9 A;  3NXS A;  3V6I A;  3JCU E;  1VQ9 P;  3H1K G;  3HTK B;  2IBZ D;  3OW2 O;  1CW5 A;  3AE9 C;  2YMY A;  4WWI A;  3RK3 C;  4JPZ B;  4NBA D;  2JKV A;  1PFI A;  4DZO A;  1IFI A;  3AE2 C;  2SPZ A;  1S72 P;  1Q90 D;  2YNY A;  1AV1 A;  1CZQ A;  1LTJ B;  4QDF B;  2IFM A;  2KOG A;  4KHX A;  1Q81 Q;  4HM1 A;  1FDI A;  4H0L C;  4EOT A;  4UB8 E;  2YO3 A;  1JTH B;  3HE4 A;  3H1L D;  1Z56 A;  2YKO A;  1VQ8 P;  4BRY B;  5EFW B;  2OQQ A;  2V7Q H;  4EYY Q;  1YJW P;  2E75 B;  3T97 A;  4U3F J;  2HLO A;  2RN0 A;  1LTS C;  1J2J B;  1L0L J;  1OW6 A;  3G4S P;  2BCC G;  3RK2 D;  1OVV A;  2IFN A;  1H0T A;  5CCH C;  3QWO C;  4YXD C;  3CCU P;  1AVO A;  1VM9 A;  2MKV A;  1JMB A;  3SSU A;  3BCC E;  1ZV8 A;  1JMM A;  3OJA B;  3PLN A;  1M90 Q;  3FX0 A;  1SQX E;  1SQV E;  2QJP B;  3PH0 A;  3L35 A;  2JR8 A;  3CX5 D;  3BAT A;  1QVG O;  1N8R Q;  2FYZ A;  2QG4 A;  1NTM E;  1S2E A;  2WSF J;  2YXR B;  1N7L A;  4HJL A;  3WMM 0;  1VL2 A;  2QJK C;  4P1B H;  1QL1 A;  5CJ4 A;  4HM2 A;  5KJ7 A;  1GL2 C;  3D6Z A;  3TSI A;  1LTG C;  2FYU G;  5BU8 B;  1M1J A;  2KNC B;  3VMX A;  4JYC A;  4L75 A;  4HM4 A;  1UII A;  3KDP B;  3H1I G;  1KZU B;  2R5B A;  1KIL A;  3M0A A;  3SFD C;  2ZYA A;  2JO6 A;  1S9K E;  4K3A A;  2NWF A;  1BGY D;  2OYH B;  3P8C D;  1KC8 Q;  1QGK B;  3A3Y B;  2A06 E;  1GW3 A;  2K1A A;  2BMQ A;  1AA0 A;  3M91 A;  1NTK E;  2ZXE B;  2R3S A;  2ZT9 B;  2R44 A;  2JDI H;  3V2R A;  1VQO P;  4GOF A;  3L73 G;  4I1L A;  1KYO E;  5AVR B;  1KQL A;  1QL2 A;  3V2P A;  2N1T D;  1IO4 A;  1EZV I;  3CWB D;  3CPW O;  3EFF K;  3RL0 g;  4HM3 A;  1IFJ A;  1FE6 A;  3CXH I;  5KAF H;  1G2C A;  3CMA P;  2QEX P;  5KLI C;  2XV5 A;  4GKG A;  2I8D A;  3GHG C;  3MTU E;  1BE3 E;  4P1C H;  3I5C A;  3CXH H;  1RF1 A;  1LT9 C;  5B66 H;  1S5L E;  2B88 A;  4NB9 D;  5CBO A;  3VOP A;  1ZXG A;  1IFM A;  2B24 A;  3H1I D;  4WBA A;  4H44 B;  1IC2 A;  1RF0 C;  2ZFC A;  2FXO A;  4AIV A;  1NU1 D;  4HM6 A;  1OWA A;  3L70 G;  1MKM A;  2WPV B;  2YIU B;  2B87 A;  5DJU B;  2ZVN B;  3H1J D;  2YKP A;  2Q7C A;  2WSE J;  1NTZ E;  5AVW B;  1FZC C;  2E75 D;  3OAK A;  3H1H G;  1K9M Q;  3L73 D;  3GCE A;  3USS A;  3B8E B;  3H25 A;  5AVT B;  3AED C;  3CCS P;  2RMZ A;  4U3F G;  4D6T J;  2N1T A;  4TT3 H;  1EXI A;  3DQY A;  2XZR A;  1HJ0 A;  2LKM A;  1L0L G;  1SQQ E;  4PV1 C;  3HTK A;  1WMK A;  3S4R A;  1H8A A;  1VDF A;  2BMR A;  4Z1M H;  2QM8 A;  3LID A;  2CK3 H;  3RK3 B;  1FAV A;  3L70 D;  1A02 J;  2Q3E A;  1HBW A;  3E1R A;  4C7R A;  1ZRT E;  1LTJ A;  2C0X A;  3VMY A;  4QDF A;  2JWD A;  1KB9 E;  3D71 A;  3HUS C;  3AE5 C;  4KT0 J;  2OYI C;  1EG9 A;  3H1H D;  4H0L B;  1UUW A;  3L75 G;  3JSV C;  4GT1 A;  3Q1M A;  3KZI E;  5H2F H;  3A2A A;  3PP5 A;  2WPR A;  2J5U A;  5AW0 B;  4UB6 H;  1FC2 C;  2QA4 P;  1K04 A;  3IN6 A;  2YKQ A;  2WSE H;  1DD3 A;  4AQR D;  2JZA A;  1MV8 A;  4XA4 A;  1KQG B;  2VRS A;  1W5C E;  2ZT9 D;  1L0N D;  1Y9B A;  1URQ C;  1HH0 A;  2HFE D;  3IAO A;  5KLV D;  1SQP D;  4PD4 E;  1OZH A;  4Y99 C;  2AEJ A;  2BEQ D;  5M1B A;  2IBZ I;  2L5G B;  1RH5 B;  3CLQ A;  4NPF X;  3L72 E;  4GIF A;  1NGM B;  2AEM A;  1LP1 A;  2HPC B;  1HWT C;  3CXH D;  1DEE G;  2DE5 D;  2W8Z A;  2QJK B;  2H43 A;  5L8R J;  5AVV B;  2O1J A;  2XSH A;  1GL2 B;  2P2U A;  5C39 A;  3L74 D;  1GTW A;  2KNC A;  3TF5 A;  3WUU A;  1JY3 N;  5KKZ B;  3GKE A;  2E74 D;  1GMJ A;  3AE4 C;  3F89 A;  1NYK A;  2NUM A;  1PGO A;  2N9Y B;  1YIJ P;  3RL0 D;  1ZN5 A;  2KZI A;  3L71 D;  2DW3 A;  2NPS C;  5BU5 A;  3R4Y A;  3V2N A;  2WVR A;  5GTI H;  2WQY C;  1MUU A;  1VQK P;  5KAI E;  2QJY B;  1H89 A;  3CWB J;  4JBZ A;  1WQL A;  2MJZ A;  5CJ0 A;  1SQB K;  5APS A;  2NUK A;  4HB1 A;  3ITK A;  3AE7 C;  2B1X A;  1FJP A;  2FYU K;  4EIJ A;  2LXB A;  4A7P A;  2FYU J;  3GHG B;  2P58 A;  3ABV C;  3MP7 B;  4QUR A;  1ZME C;  3H1I J;  1LT9 B;  4K35 A;  2IBZ G;  3LIE A;  1EXJ A;  5CCG C;  1BCC E;  5CHX A;  2KK7 A;  3VP8 A;  1EDL A;  2ZYL A;  1KV4 A;  4HM8 A;  5APX A;  3GL0 A;  4L74 A;  1KQS O;  3B71 A;  4H0L D;  1OX3 A;  2FFD B;  3TK1 A;  1USE A;  1RE3 A;  4ZKP A;  1X9V A;  1RY3 A;  2V7Q J;  2FXM A;  3RK3 E;  2XKM A;  1BSH A;  1P84 E;  3L73 J;  3FXD A;  4AAY B;  2P1J A;  1FZC B;  2IDB A;  3H1L G;  1YI2 P;  3H6P A;  3AEB C;  3AE6 C;  2ZVO B;  3SFE C;  1KN7 A;  2LR2 A;  3Q3D A;  3FOU A;  3RBZ A;  3HD7 C;  2E76 B;  3WU2 E;  1GK4 A;  1GU4 A;  2NRG A;  4RO0 A;  1HTL C;  3G71 P;  5APY A;  2KYV A;  1NH4 A;  4PV1 B;  1MFT A;  3EN1 A;  2V4H A;  3HRN A;  1JCC A;  1GU5 A;  3GLM A;  4YXW H;  3L70 J;  4HM7 A;  2AEF A;  4DT0 A;  3BVH A;  4MN4 C;  3TGU E;  4I7Z C;  1N7S C;  1GL2 D;  1FOS E;  1PL5 A;  2RH0 A;  2ZXX A;  1Q82 Q;  3P8M C;  1EDI A;  3HUS B;  2NZ2 A;  3H1H J;  5AEU A;  4JF7 A;  1W2E A;  4ASW A;  3O6Q B;  4D6T E;  3BCC D;  1Y8A A;  3GF7 A;  3Q2Y A;  3GL2 A;  1S5L X;  2QM7 A;  3SWY A;  3U1C A;  3GZX A;  1SQV D;  1SVF A;  3EQ2 A;  1L0L K;  1BGY G;  1L0N J;  3GMA A;  1SFC C;  1NTM D;  5KLV J;  3EQQ A;  1SQP J;  1HJB A;  2NVF A;  4N3Y B;  3A0B H;  3JC2 2;  2B9B A;  4Y99 B;  2YVJ B;  4JYB A;  1T3U A;  1G1I A;  1CSB A;  2R32 A;  3H32 A;  4HKV A;  5B5E E;  1S1C X;  3CCJ P;  2GUV A;  5AW9 B;  5KTB A;  2GUS A;  1KIL E;  2OTK E;  1QLE D;  1S9K D;  3CWB G;  2WPQ A;  5AEW A;  5GTH E;  1VPC A;  2D2C C;  3GG2 A;  2A06 D;  3L75 J;  3O8Z A;  1GW4 A;  5CMZ A;  2Y0E A;  2BEZ F;  4IL6 E;  2CKF A;  1KD1 Q;  1NTK D;  3L74 J;  1J1D B;  5E79 H;  5AVX B;  3CCR P;  1OW8 A;  1YQ4 C;  3H1K E;  2R5D A;  4NBF D;  2I1J A;  1GD2 E;  5KJ7 C;  1NU1 G;  3OA7 A;  2FYN B;  2IX7 C;  2J58 A;  1J1E C;  1QVF O;  1RE4 A;  1M1J C;  2HMM A;  4NBB D;  3L71 J;  1KIL C;  3CX5 E;  5APQ A;  3I56 P;  3H1J G;  2L91 A;  1BE3 D;  1N73 C;  2KUB A;  3MHV A;  2K3R A;  1NVO A;  2J59 M;  4NBG D;  3KQG A;  5BOK A;  2E76 D;  5TIS E;  3M0D A;  1PP9 E;  5AW1 B;  4OGQ C;  1JEK A;  4H13 C;  3M9B A;  1NKZ B;  5AW7 B;  4PV1 D;  1NYH A;  3RK2 C;  4C7N B;  4IOI H;  1Y47 A;  1LT9 A;  3K5B A;  2BCC E;  2K9J B;  2Z4E A;  3HE5 B;  4I2L C;  3C1L A;  1JY2 N;  1E5W A;  2XDJ A;  1SLQ A;  1N2D C;  4QDD A;  4QUQ A;  4QMA A;  3CC2 P;  1LTI C;  5APW A;  2FFD A;  1YJN P;  3B5N B;  2IZ1 A;  1ZW0 A;  4NPE A;  1OFC X;  3GB4 A;  3FWL A;  3CME P;  3M9Q A;  5APU A;  1L4A B;  4L73 A;  1N86 A;  3Q5S A;  3VCP A;  3AE8 C;  2W6B A;  2H7H A;  1SQQ D;  3GF3 A;  3VCA A;  2AXT H;  1SQB E;  1VQ4 P;  4EMJ B;  1LTB C;  1UUV A;  2FYU E;  1Q86 Q;  3II6 A;  5AW4 B;  3G9R A;  4U7J A;  3HD7 B;  2O01 N;  4HJG H;  4LLH A;  1IK7 A;  1M1K Q;  1L0N G;  1GDT A;  1HUC A;  1KB9 D;  5KLV G;  4WVZ A;  2R3C A;  1SQP G;  4YTP C;  2JP3 A;  4AUW A;  2KZJ A;  3RBX A;  4EI2 A;  1PPJ E;  2Y0D A;  3C0D A;  1JM1 A;  2JEE A;  4JQ0 D;  1LWU C;  2KLU A;  2H88 C;  3D89 A;  3TYY A;  3CC7 P;  2O01 H;  3W67 A;  3RGU A;  5APV A;  3L73 E;  1N7S B;  2ZAE B;  3L4F A;  3HUS A;  1GZL A;  4PD4 D;  1AJY A;  2PP6 A;  5AW5 B;  1JTH A;  1X79 B;  3H1L J;  1LTJ C;  3BCC J;  3D70 A;  5TJH A;  1O7M A;  2HML A;  3L74 G;  4BRY A;  1CI6 B;  3L72 D;  2GBW A;  3VMZ A;  3JCU H;  2H8P D;  2HOD B;  4N78 E;  1FOS F;  1S3J A;  1NTM J;  1HGV A;  1G8J B;  1ZR2 A;  3HE4 B;  1SFC B;  3GOB A;  2KB7 P;  2HMK A;  1PZQ A;  2XNX A;  1JM0 A;  2Q3I A;  1M8O B;  3L71 G;  2W6A A;  3VMI D;  1JOC A;  2PFX A;  1U7J A;  2WWW A;  1NWQ A;  2W27 A;  2KI7 B;  3H1H E;  3VP9 A;  1BCC G;  1FZB A;  3Q5R A;  1H0T B;  2Q9I A;  4UB8 H;  2AXC A;  3I55 P;  2PAJ A;  2D2C B;  1YJ9 P;  2Z5H A;  1IFD A;  2BAS A;  3C9I A;  1W2B O;  4U3F E;  4W80 A;  3L36 A;  4H44 D;  4ZMD A;  1JY3 P;  5CBN A;  4W7Z A;  1VQ5 P;  1L0L E;  2PRR A;  3B5N D;  3BRV B;  1BGY J;  3GZY A;  2OYH A;  3NTN A;  1L4A D;  4ASV A;  4RES B;  3KYQ A;  1LGH B;  1PGQ A;  1ZR4 A;  1O7P A;  3S9O A;  3ZDM A;  1M1J B;  3AEG C;  1EZV E;  1KIL B;  3G3Z A;  3A0H E;  1FU1 A;  2O1K A;  2YXQ B;  3A5T A;  5B66 E;  5K5G B;  3AE1 C;  1AVY A;  1N73 B;  5GTH H;  2G8Y A;  5CXM A;  3HD7 D;  1BCC D;  3L75 E;  1LJ2 A;  5DJT B;  3MUD A;  3FWN A;  4OGQ B;  4H13 B;  2ZT9 C;  1SJG A;  1AQ5 A;  4M3L A;  1VQM P;  1KFM A;  5KLI B;  3IFM A;  2FY8 A;  2M3B A;  4WY4 C;  4QCK A;  3RK3 D;  2FKW B;  1BDC A;  1P84 D;  3LW5 H;  2K9J A;  1T2K C;  5AW8 B;  1NU1 K;  1DIP A;  1N7S D;  3GTE A;  1NU1 J;  4LGD E;  3WUT A;  5AW6 B;  1KYO I;  1NJI Q;  4Y28 J;  3V4Q A;  2ZJS E;  4GOE A;  3N7N A;  2P67 A;  1ZOY C;  4EDF A;  1SS1 A;  3B5N A;  1FZE A;  3NFQ A;  3H1J J;  1KYO H;  1KMI Z;  2JJL A;  2YO2 A;  2HMJ A;  1L4A A;  2N9B A;  1SQQ J;  1TU3 F;  2I7F A;  2HR3 A;  2DE6 D;  2Y0C A;  4RKU J;  3Q5P A;  2E74 C;  3V2Q A;  4N6J A;  1RE3 C;  3TDK A;  3BCC G;  5AVZ B;  2C9L Y;  2OTJ P;  1XTC C;  4IFM A;  1SFC D;  1M7L A;  1OMI A;  1WRG A;  1SQX G;  1SQV G;  1S5L H;  1KQF B;  3TGU D;  3HD7 A;  5CCH D;  3RL0 C;  2O3J A;  4OVN F;  1NTM G;  3U1A A;  1ULI A;  2WZ7 A;  2YFI A;  5H2F E;  1FZG A;  3AE3 C;  2E42 A;  1LWU B;  1OXZ A;  1HGZ A;  1RFS A;  4D6T D;  1PIX A;  4UB6 E;  2D2C D;  3CL3 D;  1VQN P;  3AEF C;  2E43 A;  1LNQ A;  3VTP C;  2KP8 A;  1N7S A;  3P32 A;  1YBK A;  1R5L A;  2E5T A;  2IPP A;  2HMO A;  3GTS A;  1S4X A;  2OAR A;  1L2P A;  1DX7 A;  4PJ0 E;  2WTY A;  2A06 G;  2OYI B;  3IF4 A;  2KSJ A;  2K9Y A;  1QEX A;  2M5A B;  1NTK G;  1JO5 A;  4R4L A;  5KJ7 D;  1CI6 A;  3L72 J;  2IYO A;  3CCE P;  4NBC D;  1VF5 C;  2OYO A;  2Q6Q A;  4DCK A;  2IBZ E;  1PV3 A;  1SQX D;  1L0N K;  1KIL D;  2HOD A;  2W6J H;  5KLV K;  1NOH A;  1X22 A;  1SQP K;  1YTZ I;  5AVU B;  1SFC A;  1PP9 G;  2UWJ E;  1SP4 A;  2WT7 B;  1VQ6 P;  4XFJ A;  3VYI A;  1URQ B;  4I6M C;  2K37 A;  1FS0 E;  1UIX A;  3S1K A;  5CCH A;  1KB9 I;  2QVA A;  3PTZ A;  1WT6 A;  2M8R A;  2WSC H;  3PRJ A;  2YFL A;  1BE3 G;  4OGQ D;  4H13 D;  2M3E A;  1ULJ A;  2OGU A;  1KB9 H;  4HYT B;  3BRT B;  3H1K D;  3E7K A;  1JY3 O;  2HPC A;  2KS1 B;  4NBH D;  2YFJ A;  4NBD D;  2XRX A;  3H1L E;  1FDO A;  3KZI H;  3KPE A;  1D7M A;  1DEB A;  2Z5I A;  1GL2 A;  1R8E A;  2WIT A;  1IFN A;  2OTL P;  3MIW A;  4PD4 I;  1LP1 B;  2FBW C;  1IK9 A;  1T8Z A;  3UIA A;  1NTZ G;  1EQ7 A;  5GTI E;  1NHL A;  3VN0 A;  1KOR A;  3D6Y A;  1Q90 C;  1KYO D;  2QE7 H;  4PD4 H;  3B4S A;  1YYC A;  3V4W A;  1SQB G;  1KTM A;  1FJK A;  1LTT C;  1PP9 D;  2KSE A;  5KKZ C;  1EDK A;  2PGD A;  3E1I A;  1NKN A;  5AW2 B;  2H89 C;  1OVU A;  3WUV A;  1HVV A;  4XE5 B;  1JCD A;  1Q2N A;  3BAS A;  1N73 A;  1IZN B;  2NPS B;  1RQV A;  1SQQ G;  2BCC D;  2Q1K A;  1RE4 C;  2POH A;  1BCC J;  1PPJ G;  2B89 A;  4GDO A;  4OWF A;  1USD A;  4DOJ A;  2A45 I;  1VQ7 P;  1DD4 A;  2WSS H;  1X0T A;  2ZYG A;  2QJY C;  2A45 H;  3GHG A;  2O01 J;  4WY4 B;  2E4Q A;  1JY2 P;  1BGY E;  1YIT P;  3M0D C;  1AFO A;  1NTZ D;  3P8C E;  1MZ9 A;  3AEA C;  3EFG A;  4TLF A;  3C8V A;  3MZW B;  1K05 A;  4C46 A;  4WB4 A;  1K73 Q;  1M57 D;  1RF0 A;  5HL4 A;  1SQB D;  3CCL P;  3A0H H;  1YTZ T;  2FYU D;  4NB8 D;  1RF1 C;  3F5H A;  2ZYD A;  3CC4 P;  4YPC A;  3TNU B;  2WSF H;  4HKZ H;  5KAI H;  2NVG A;  1ZP0 C;  2FXP A;  3M06 A;  3CWB E;  2CPS A;  2XR8 A;  4QUP A;  1FZC A;  2HYN A;  4BWN A;  1PPJ D;  2FFD C;  5AVS B;  2E74 B;  1RQU A;  3L72 G;  1JB0 J;  1URQ D;  2E4P A;  3TGU J;  3H1I E;  1ZRT D;  3L37 A;  3V5B A;  3CCV P;  3RL0 B;  1NU1 E;  2M0B A;  2HMN A;  2ITA A;  2BMO A;  1P84 I;  1YQ3 C;  3AEE C;  3P7K A;  3QH9 A;  2E76 C;  1LWU A; 
#chains in the Genus database with same CATH homology
 2Q3W A;  4QDF B;  3H1J E;  1O7P A;  2E75 D;  2JO6 A;  2ZT9 D;  3GCE A;  3EN1 A;  4QDD A;  4QUQ A;  2NWF A;  4HM1 A;  1WQL A;  1EZV E;  4PD4 E;  1FQT A;  2YFL A;  1O7M A;  2QJY C;  1L0N E;  2HML A;  3AZC A;  4OGQ D;  4H13 D;  4HM7 A;  1ULJ A;  2CKF A;  2NUK A;  5KLV E;  2E4Q A;  2B1X A;  2A06 E;  1BGY E;  1SQP E;  2GBW A;  1VF5 D;  2BMQ A;  3GB4 A;  3TGU E;  3L72 E;  5CXM A;  1NTK E;  4HM0 A;  4NBH D;  2YFJ A;  2YIU C;  3H1K E;  2DE7 D;  4QUR A;  4NBD D;  2XRX A;  3VCP A;  3H1L E;  1VCK A;  1G8J B;  1ULI A;  4NBF D;  5HL4 A;  3L75 E;  3GOB A;  3DQY A;  2HMK A;  3VCA A;  2YFI A;  1KYO E;  1SQQ E;  5AEU A;  2DE5 D;  1BCC E;  1SQB E;  4NB8 D;  1SJG A;  4EMJ B;  1RFS A;  2BMR A;  2QPZ A;  2HMM A;  3CXH E;  2D2C D;  4NBB D;  1UUV A;  2FYN C;  2FYU E;  2ZYL A;  3VMI D;  4HM8 A;  4D6T E;  4HM3 A;  3CX5 E;  3GL0 A;  1O7G A;  2NVG A;  2XSH A;  4QCK A;  3VMH D;  3CWB E;  4H0L D;  1VM9 A;  1Q90 C;  3BCC E;  2XR8 A;  3GL2 A;  4QUP A;  2HMO A;  3GTS A;  5KLI C;  3H1H E;  3GZX A;  1ZRT E;  1P84 E;  3L70 E;  1RIE A;  1BE3 E;  4QDC A;  3GKE A;  4P1C H;  3L74 E;  1NDO A;  4QDF A;  1SQX E;  3GTE A;  4NBE D;  4NBG D;  1SQV E;  5BOK A;  2E74 D;  2E76 D;  2NVE A;  4NB9 D;  4AAY B;  1KB9 E;  1PPJ E;  2B24 A;  3EQQ A;  2NVF A;  1G8K B;  3C0D A;  3N0Q A;  1PP9 E;  1JM1 A;  5KKZ C;  1O7W A;  2E4P A;  1NTM E;  1NYK A;  1EG9 A;  2NUM A;  3VMG D;  4HM5 A;  4PV1 D;  3H1I E;  4U3F E;  1UUW A;  4HJL A;  2YVJ B;  4H44 D;  4NBC D;  4AIV A;  2QJK C;  3D89 A;  4HM6 A;  2IBZ E;  4P1B H;  2GBX A;  4HKV A;  2HMJ A;  1NU1 E;  4HM2 A;  3L73 E;  1L0L E;  3FOU A;  4NBA D;  2HMN A;  2I7F A;  1O7N A;  2XSO A;  2BCC E;  2BMO A;  3L71 E;  3GZY A;  2DE6 D;  4HM4 A;  2JZA A;  1NTZ E;  5AEW A;  2QJP C;  1O7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...