1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
1EZVE 3GTEA 1RFSA 4HM0A 4QUPA 4HM2A 4P1CH 2XSOA 4QDFA 1G8KB 2BCCE 2YFJA 3L71E 4AIVA 1O7NA 2HMMA 4HKVA 4EMJB 2QJKC 4NBGD 3GL2A 2QJYC 4H0LD 1NTME 4NBAD 1BE3E 2FYNC 1NTKE 1RIEA 3GZXA 2YVJB 1ULJA 3L74E 1ZRTE 3EN1A 5CXMA 3CXHE 1PP9E 3L72E 3H1IE 4NBCD 4NBDD 1JM1A 1UUVA 2D2CD 2NVEA 1O7PA 2YFIA 2GBXA 4QUQA 2JZAA 2CKFA 3EQQA 4NBED 3VMGD 3N0QA 4QDFB 1SQPE 1O7MA 2E4PA 4U3FE 2GBWA 4NBHD 3VMID 4QDDA 2E76D 2NWFA 3H1KE 1NTZE 1VM9A 2BMOA 1SQXE 1O7HA 1O7WA 2XSHA 4HM1A 3FOUA 3TGUE 1P84E 1SJGA 5AEUA 1KB9E 1PPJE 2DE6D 3GL0A 4QURA 2IBZE 2E74D 4HM7A 3GZYA 5HL4A 1SQVE 2YFLA 3GTSA 5KLVE 3L73E 1ULIA 2NUMA 3H1HE 3D89A 1SQQE 5AEWA 1EG9A 2HMNA 4PV1D 4NBBD 2HMOA 3VMHD 1SQBE 1KYOE 4P1BH 2B24A 4NB8D 2NUKA 1L0NE 2JO6A 2ZT9D 4PD4E 1BCCE 1NU1E 2I7FA 1BGYE 3AZCA 2DE7D 2HMKA 4QDCA 2FYUE 4H44D 4HM8A 4HJLA 5KKZC 2QPZA 2HMJA 2BMRA 2NVFA 4QCKA 3GOBA 3VCAA 2XR8A 4HM3A 3C0DA 2E75D 1FQTA 4NB9D 4D6TE 2NVGA 1WQLA 4OGQD 1VCKA 3VCPA 4HM4A 5BOKA 2Q3WA 4HM6A 3H1JE 1L0LE 2HMLA 4H13D 3DQYA 2BMQA 4AAYB 1NDOA 1G8JB 1O7GA 3GCEA 4HM5A 3L70E 2ZYLA 2B1XA 2DE5D 3CWBE 4NBFD 1UUWA 1VF5D 3GKEA 1Q90C 2QJPC 2YIUC 3L75E 3CX5E 1NYKA 3H1LE 2XRXA 2A06E 3BCCE 5KLIC 2E4QA 3GB4A
chains in the Genus database with same CATH superfamily
2QE7H 3H6PA 3RL0B 1BDDA 1G8KB 1E5WA 1VF5C 4W80A 1NTKK 2NPSB 3PH0A 4GT1A 1NKNA 4PJ0H 2OYIC 2H89C 2YO2A 1R8EA 3CCVP 1VPCA 2O01H 2JWAA 1NTZK 1ZN5A 1UUVA 1SQXK 1KILB 5GTIE 1JOCA 1X22A 4QUQA 1YQ3C 2YXQB 3H32A 3IFMA 2WSSH 1IFPA 5CCHD 2XSHA 4WY4B 3BASA 2BCCG 3L73D 3R4YA 2Q9IA 2JWDA 1SQVE 4XFJA 1ULIA 4N78D 1GW4A 4TLFA 1J1DB 5AVUB 2WVRA 1N73B 2ZAEB 1JB0J 2N1TD 1NU1E 1S3JA 3CXHI 5E79E 2H7HA 2FFDA 3E1IA 1LWUC 3M0DA 4BWNA 2BEZF 5CJ0A 3LW5J 3H1KG 3VCPA 3A3YB 1EQ7A 3AECC 1JM0A 3A2AA 1KB9I 2HODB 1KQFB 1S5LE 1VF5D 3GKEA 2RMZA 1HH0A 1JUNA 2AEMA 2OTJP 3H1HG 1L0LK 3V2RA 2KXPB 1NYKA 2HR3A 3H1LE 3CL3D 3A5TA 5AEUA 3L4FA 1EZVE 1HJ0A 1QLED 2PRRA 1ZW0A 5APXA 3CMEP 1DX7A 4AUWA 2YKPA 3D70A 2WSEJ 2M5AA 3KQGA 5AW9B 4LLHA 2AXTE 5M1BA 3HD7C 2WSCH 2GM4A 3KPEA 4WBAA 4R4LA 1YJ9P 4TT3H 3M9BA 4GIFA 4JF7A 1O7HA 3MUDC 3FOUA 3C8VA 1LTSC 1FJKA 3FXEA 3WUTA 2E74D 2NPSA 3I5CA 1BSNA 3GZYA 2BCCJ 3AEBC 2R44A 3WU2H 5KAFH 1OWAA 1YIJP 1NTMG 3MIWA 3O6QA 1SQBE 1KYOE 4P1BH 5CHXA 1M1KQ 3H1IG 5CCGA 3AZCA 2FYUE 1T3JA 4HM8A 1KILA 1ZOYC 4UB6H 1X0TA 1YITP 4U3FG 5KAIH 2ZT9C 3ABVC 1BGYG 2WITA 1KMIZ 2N1TB 2OARA 4RESB 4GDOA 3Q1MA 3H1KJ 1O7GA 1GDTA 4ASVA 1VQ8P 2Z5HA 3TK1A 3HTKB 4NBFD 1PZQA 5KLVG 1T6AA 3TF5A 2QJPB 2JR8A 2KNCB 5KLIC 2E4QA 1OVRA 3GMAA 3HUSC 3A0BE 1GZLA 3F89A 1N73A 3VP9A 2POHA 1VF5B 3HD7D 1O7NA 1NGMB 2C9NY 1QX8A 2B88A 1JY3O 1AVYA 2B87A 2OYIB 1EZVI 3B71A 1HBWA 3CXHD 3BVHA 1DIPA 1PP9E 3B5NC 3NTNA 2HODA 3EQQA 2P2UA 4YPCA 3CCMP 3U1CA 1SQVK 1KB9D 3HE5B 1HVVA 2IBZD 4C7NA 1LTIC 1SJGA 5KKZB 4IFDK 1NOHA 1SP4A 1NU1K 2LXCB 3CCSP 2NUMA 4K35A 1VQ5P 1N7SC 5B5EH 3CXHH 1BGYD 2PP6A 1KFMA 1OX3A 2ZT9D 2E74B 4ZKUA 1IC2A 1PIXA 2HMKA 5CMZA 2WQYC 1LT1A 2M0BA 3AE9C 1LWUB 1RHZB 1GK4A 1KYOI 1KB9H 4HM6A 4U3FJ 3DQYA 3P7KA 1BGYJ 1JO5A 2OYHB 5C39A 3S9OA 3CWBE 2ZYDA 2YKOA 3VYIA 3KDPB 4OWFA 1VQOP 5CCHA 2K9JB 3CCUP 1EC5A 1VQ9P 2E43A 2JO1A 1FE6A 1FZBA 3B5ND 4CPGA 3RBZA 2XV5A 3L74E 1GMJA 2N1TA 3HD7B 2R3CA 3Q5SA 3KHUA 2YFIA 3HTKA 4H0LC 1O7MA 2A06G 3TGUD 5KJ7C 1LT9C 2UWJE 1N7SD 2E42A 1PPJE 1SQBK 2R5DA 2MJZA 4U7JA 4DZOA 1FZEA 3SFEC 2FYUK 2OYIA 1L0ND 5BU5A 2J5UA 2W90A 3TGUJ 3MZWB 1JTHB 3GHGC 3LIDA 1MUUA 2C9LY 1URQC 1VCKA 2ZT9B 4I6MC 2I1JA 1P84I 3TDKA 1GTWA 2ZYLA 1PGPA 3BCCD 1S5LH 3RK3E 4XA4A 5KLIB 3HUSB 5AVSB 2O1JA 4IL6H 2BCCE 5AW0B 3PP5A 3FGAD 2W27A 4EMJB 3PRJA 3HE4A 2FY8A 1OMIA 1LWUA 4H0LD 2K3RA 2W6BA 3D71A 2FKWB 3PTZA 5KJ7D 5TISE 4I1LA 3B5NB 2Z5IA 4QDFB 3WUVA 3VMID 2WPRA 4K3AA 3H1KE 3I56P 1VQ6P 2D2CC 2M3EA 2HPCB 3II6A 2H88C 3CCLP 3GL0A 2FXPA 1ZP0C 3M0AA 5DJTB 1HGZA 1AQ5A 3H1HE 3WUUA 1FU1A 2WT7B 1ZMEC 3S1KA 1BCCD 4PV1D 1N7SB 2KSEA 2IFMA 1URQD 4JYBA 2KSJA 3HD7A 5B66E 1NJIQ 1OW6A 1KYOH 1RE4C 1HGVA 4BXLA 5AW2B 3L70D 3V2QA 3MUDA 2XNDH 3L75D 1DEBA 4IFFA 1K9MQ 3CI9A 2DE5D 1UIXA 3L73G 2K1AA 4OGQC 2KZIA 3MP7B 3CX5E 1SQQG 2CPBA 3AE4C 1VQ7P 1LTAC 2IZ1A 3GB4A 1S72P 3GTEA 1RFSA 4HM0A 3L71D 3AE1C 1KV4A 3D6ZA 4WWIA 5AVYB 3L70J 3A0BH 4HKVA 3CC4P 2P58A 2Z4EA 1BE3D 3L75J 1NTME 1FS0E 2KK7A 1SFCC 1ZRTE 5CXMA 2KS1B 3H1IE 2QA4P 1VQ4P 1JM1A 1YTZI 2RKLA 2D2CD 2O01J 4H0LB 3VMGD 4U3FE 1P84D 4QDDA 3SWKA 1ZR2A 2KLVA 1VM9A 1LT9B 1M90Q 1IO4A 2XZRA 3KXDA 5APQA 3HUSA 2Q6QA 1NHLA 3VMXA 1N8RQ 4HM7A 3IR9A 4C7RA 3GTSA 3V2NA 1GL2C 5KLVE 2H43A 3M91A 2V7QH 4HKZH 3KYQA 3BRVB 1PL5A 4RO0A 2JP3A 3UIAA 1R5LA 3D6YA 3AEAC 1IFNA 1RF1C 1X8YA 4EIJA 5KKZC 3B5NA 2HLOA 3GHGB 4KHXA 3U59A 1J2JB 4PV1B 3H1JD 1SQQD 1CW5A 3M9HA 1YJNP 1URQB 1P84H 2LXBA 4OGQD 1Q2NA 3P8CD 2YMYA 2HPCA 3PJSK 4Y99C 2E74C 1VDFA 1Q90C 1QEXA 2P10A 2XRXA 3AEDC 3JCUH 2WPSA 3L73J 1HF9A 1H0TB 3H1JJ 1JCCA 1SQQJ 3SWYA 1SFCD 1Q7YQ 4PD4I 3T97B 2OYHC 2ZJSE 1NTKD 3IF4A 1RY3A 4IL6X 3L72D 1PV3A 5AW7B 1L0LG 2CPSA 1VQLP 5AVTB 2ZYGA 1S9KE 3TNUA 1NAYA 1LTTC 2OYOA 1JMMA 2CKFA 1NTZD 3EFFK 2FBWC 3VMZA 1SQXD 4NBHD 2WSCJ 1GL2D 3GW6A 2BMOA 1NTKJ 1AFOA 2W8ZA 2D2CB 2QRXA 2G3AA 1SQPK 1KFNA 3OJAB 1X9VA 3GF7A 2QEXP 3D89A 2XNXA 5CJ4A 1NTZJ 4GOEA 1IK7A 2KS1A 1S2EA 1VQMP 4RKUJ 4D6TD 3ZDMA 5AVZB 3CCRP 1VQKP 4JBZA 1DD4A 1Q90D 2M8RA 1WQLA 1IFIA 2V4HA 1X79B 4IFMA 1D7MA 1LT9A 5KJ7A 4H44C 3OW2O 1IK9A 2Y9ZA 4HM5A 2IBZG 2E75C 3W67A 3TSIA 1KORA 1QL1A 3EQ2A 1OFCX 1IJDB 5APTA 4OGQB 2A06E 2I8DA 1KQLA 1QVGO 1NAFA 1L0LD 2LKMA 1M8OB 1W2EA 2PAJA 1NTMK 3FWLA 1RE3C 4WY4A 3CMAP 3GHGA 4NBGD 3GL2A 1OZHA 1KILE 3BRTB 1URQA 1SFCB 2DW3A 1ULJA 1L0LJ 1FDMA 1PGOA 1SQPD 4NBED 1FOSE 1GW3A 2C0XA 1W5CE 2NZ2A 5KLVK 2E5TA 1H0TA 2R5BA 2Y0EA 3KZIE 1KZUB 4ASWA 1GU4A 2WPQA 1VQPP 1GL2B 4PD4D 5K5GB 5H2FE 1CI6B 3M9QA 2DE7D 2PGDA 4H44D 2XU6A 1RF1B 5CBOA 3AE2C 1Q82Q 2NVFA 1NYHA 3G71P 3AEGC 2E75D 4I7ZB 5AW5B 2NVGA 2IPPA 2HMLA 3TGUG 1RF0C 3CLQA 4Y99B 2P7JA 2VRSA 3A0HH 5AVVB 4GOFA 4PD4H 1BDCA 5APVA 1U57A 3K5BA 1IFDA 4KJMA 1L0NG 1FZCB 4N3YB 1MFZA 4EOTA 1M57D 3H1LG 2QJKC 1OIPA 3GF3A 4NPDA 3VTPC 4EYYQ 2OTLP 1JY2O 3FXDA 1RE4A 1AJYA 4EDFA 4NBDD 2B89A 3P8MC 2L5GB 2O1KA 3CCJP 3W68A 3EWKA 4YTPC 3BCCG 3MHVA 2E76D 3AEEC 4WVZA 2J59M 4XE5B 1EDIA 4ZMDA 3SSUA 1SQVD 4DJGA 2PFXA 2W6JH 3U1AA 1IFJA 4B86A 2ZVOB 3VOPA 3QH9A 3L73E 1G2CB 1SQQE 2HMNA 3H25A 1A02J 1NU1D 3EFGA 4N78E 4BRYB 5GTIH 3OA7A 1SFCA 4JQ0D 2KNCA 2JKVA 4DCKA 2K88A 1K8AQ 4AQRD 3PHLA 2IDBA 3AE7C 2ZXXA 1H88A 3NFQA 4IOIH 2IYPA 3TYYA 4DOJA 5APYA 5AVRB 2KIKA 5TJHA 1JY3N 2Q3WA 2A45G 1NU1J 3LIEA 4H44B 3H1LD 1RH5B 3IAOA 2E75B 1EZVD 2WZ7A 5CCGC 5BVZA 1GL2A 4PV1C 2IZ0A 5E79H 3S4RA 1EDJA 4O9BA 4KT0J 3P32A 2LR2A 1BCCG 2AXCA 4RJTA 3CC2P 1USEA 1CI6A 3HE5A 1L0NJ 1PGQA 1JCDA 2OQQA 4R4MA 2I1KA 3H1LJ 1LTBC 3WU2E 3G9RA 3GZXA 1UIIA 2BASA 1YQ4C 3VP8A 4L74A 3L70G 1O7PA 2JJLA 1L4AC 3L75G 1PP9G 1LP1B 4UB6E 2YMKA 5KAIE 2IX7C 3BCCJ 3L71G 3RL0g 1NO4A 1DH3A 3Q5RA 2YFLA 2AXTH 2CK3H 1J1EC 1SQBD 1KYOD 2OYHA 5AEWA 1BE3G 1Q86Q 3VMHD 2FYUD 3SWFA 2NUKA 2YNYA 3H32B 2I7FA 2K9JA 2FXOA 1NH4A 3L36A 2YO3A 2L91A 3VCAA 1FBMA 1FDOA 4GODA 1PGJA 5CCGD 2C0WA 1AVOA 1L0LE 4LC1A 2YIUC 2OTKE 4YXWH 4OVNF 2JDIH 4UB8E 2QVAA 2HMMA 1BCCJ 1VL2A 2KLUA 2J58A 1FJPA 2P1JA 2QJKB 3AE8C 1PP9D 1WRGA 2H8PD 4L76A 3N4XA 1BSHA 1L4AD 3H1JG 3B4SA 1T3UA 5AW6B 3CXHE 2WSFH 2GBXA 1NVOA 2WWWA 2ITAA 1MFTA 1ZXGA 1M1JC 3N0QA 3L74G 5AW1B 3Q2YA 1JTHA 2FXMA 4EI2A 1GK6A 2M3BA 3A7OA 2QSIA 1O7WA 1PP9J 1EXIA 2M5AB 1KB9E 2DE6D 4QURA 1JMBA 2N9BA 2IBZE 1RE3A 3L71J 1FOSF 1M56D 1NTKG 3HRNA 4MN4C 2W6AA 3L72G 3M06A 1BE3J 4NPFX 1BGYE 2KUBA 5H2FH 1NKZB 2V7QJ 4HJLA 2KOGA 4QCKA 1YTZT 4GKGA 1Y9BA 1KTMA 3MD0A 2O01N 1NTZG 2WTYA 5BOKA 1LP1A 1SQXG 3CWBD 4AAYB 3E1RA 1USDA 3O6QB 2Y0CA 3F5HA 2WMMA 4H13C 1EDKA 4I7ZC 2AEFA 1TU3F 2QM7A 2XSOA 4QDFA 3AE6C 3O8ZA 5AW3B 3RK3C 2YFJA 1ZLLA 5GTHE 1N2DC 2R32A 3CWBJ 1LNQA 3L74D 1HUCA 4D6TG 2YVJB 2WT7A 1N7SA 3USSA 5BU8B 4HB1A 1FZCC 1RF0A 2FYZA 1OVVA 3WMM0 1S5LX 1L4AB 3CX5I 1FZFA 1PPJD 3L74J 1S4XA 2ZXEB 3TGUE 2B87B 2YXRB 3QWOC 2HFED 1LJ2A 1OXZA 2GA1A 1VQNP 1J1EB 2XKMA 4NBBD 2B24A 1L0NE 4N6JA 2JO6A 2IBZI 2KB7P 3LW5H 3RGUA 3GLMA 3L72J 3VMAA 4IL6E 2HMJA 2XR8A 1YYCA 4C7NB 1SQPG 2K37A 4NB9D 3V2PA 4LGDE 2RH0A 4H13D 1HWTC 3I55P 3CC7P 3Q3DA 1SQXJ 1KQGB 4HH2A 1MKMA 3RK3D 2ZYAA 2YIUB 3BCCE 1WMKA 2BCCD 4DT0A 2WSEH 1H89A 1LTJC 3JC22 4W7YA 2FYNC 4QMAA 2RN0A 3EN1A 4D6TJ 2YKQA 4Y28J 5AVQB 3MGNA 1OW7A 2GUSA 3H1KD 2Q5UA 2JEEA 1M1JB 4A7PA 5AVWB 3AEFC 1YJWP 1GU5A 1HJBA 1AA0A 1DD3A 4HM1A 3ITKA 1XTGB 3H1HD 1R5SA 5AW4B 1H8AA 1EG9A 1E79H 5APWA 1JY3P 1CSBA 3MTUE 5TISH 1U7JA 1BCCE 2Q1KA 1OVUA 2BMRA 3GOBA 3NXSA 2K9YA 3H1HJ 3T97A 1EDLA 1FAVA 2Q3IA 1L4AA 2P67A 2E76C 1AQTA 1SQPJ 1NDOA 1G8JB 3L70E 3CX5D 1FC2C 3C9IA 1XTCC 3VN0A 1SQVG 3L75E 2QG4A 1M7LA 2W83C 4H13B 1SLQA 5B66H 2ZFCA 3C1LA 4P1CH 4PJ0E 1NU1G 4HYTB 2KZJA 3L71E 3RK3B 3VMYA 4AIVA 4UB8H 1NTMD 1LGHB 2N9YB 1ZRTD 2G8YA 3IN6A 1ZV8A 1EXJA 2QJYC 1N86A 3H1ID 4WB4A 1BE3E 2QM8A 5AW8B 1RIEA 1T8ZA 4NBCD 1G1IA 1Y8AA 2FFDC 1FZGA 3CX5H 2O3JA 2SPZA 1MZ9A 4U3FD 5DJUB 1KQSO 5CBNA 3M0DC 3RK2C 3JSVC 2GBWA 1NTMJ 2NWFA 1EZVG 1AV1A 2OGUA 2KP8A 1JY2P 2XDJA 3FWNA 3H1IJ 1QVFO 1P84E 3G3ZA 5KLVD 3HE4B 5EFWB 1L0NK 5HL4A 1JNMA 1KD1Q 1K73Q 1DEEG 2A45I 2Q7CA 1OW8A 4OH8B 4M3LA 3OAKA 3JCUE 5APSA 1YHQP 4JYCA 3V6IA 4W7ZA 3CPWO 5KLVJ 1YI2P 1M1JA 4HM4A 1FDIA 1CZQA 3H1JE 3G4SP 1NWQA 3P8CE 1MV8A 1QL2A 1IFMA 1SVFA 3GG2A 4ZNCA 1PFIA 2Y9YA 4ZKPA 3FX0A 1SQVJ 1Z56A 3RL0C 1SQBG 4HM2A 2NPSC 2Q3EA 2ZVNB 2FYUG 1LTJB 1GD2E 4JPZB 5GTHH 2B9BA 3RK2D 1KC8Q 1S9KD 4C46A 1NTKE 2FYNB 3NMDA 3L72E 3CCEP 1KILC 2NVEA 2HG5D 2AEJA 1S1CX 2KI7B 2JZAA 2IFNA 3V5BA 1IZNB 1HTLC 1RQVA 3BATA 1RF1A 4NPEA 1A02F 1NTZE 1L2PA 4WY4C 1SQXE 1Y47A 1G1JA 3N7NA 5KAFE 3V4QA 4YXDC 1T2KC 3B8EB 5L8RJ 1J1DC 2IYOA 2MKVA 1N73C 2HMOA 1U7MA 1ZR4A 1K04A 3CCQP 1QGKB 2QPZA 5AVXB 1FZCA 5KTBA 1FQTA 4D6TE 4L75A 2E76B 3RBXA 1Q81Q 3RL0D 1JY2N 3GCEA 2B1XA 2A06D 2NPSD 1UUWA 2QIWA 1LTGC 2Y0DA 4QUPA 1W2BO 1SQBJ 4I2LC 2WPVB 1KILD 2FYUJ 2KYVA 4NBAD 2QJYB 4Z1MH 3CD6P 1N7LA 1G2CA 2NRGA 1JEKA 4WY4D 3L37A 3AE5C 4HJGH 2FFDB 4BRYA 3E7KA 3CWBG 1RQUA 2E5YA 3RK2B 2HYNA 1SQPE 2E4PA 1T2KD 2BEQD 3PLNA 1K05A 2WSFJ 1YBKA 1FZAA 4AYCA 2A45H 5B5EE 1WT6A 1LTJA 5APUA 5CCHC 3R2PA 3TNUB 3SFDC 3A0HE 4NB8D 3V4WA 4PD4E 3L35A 4QDCA 2GUVA 1SQQK 3AE3C 4HM3A 1SS1A 3C0DA 4L73A 3G6EP 2N1TC 3KZIH 1KN7A 2BMQA 3Q5PA 2R3SA 1PPJG 2QJPC
chains in the Genus database with same CATH topology
1EZVE 3GTEA 1RFSA 4HM0A 4QUPA 4HM2A 4P1CH 2XSOA 4QDFA 1G8KB 2BCCE 2YFJA 3L71E 4AIVA 1O7NA 2HMMA 4HKVA 4EMJB 2QJKC 4NBGD 3GL2A 2QJYC 4H0LD 1NTME 4NBAD 1BE3E 2FYNC 1NTKE 1RIEA 3GZXA 2YVJB 1ULJA 3L74E 1ZRTE 3EN1A 5CXMA 3CXHE 1PP9E 3L72E 3H1IE 4NBCD 4NBDD 1JM1A 1UUVA 2D2CD 2NVEA 1O7PA 2YFIA 2GBXA 4QUQA 2JZAA 2CKFA 3EQQA 4NBED 3VMGD 3N0QA 4QDFB 1SQPE 1O7MA 2E4PA 4U3FE 2GBWA 4NBHD 3VMID 4QDDA 2E76D 2NWFA 3H1KE 1NTZE 1VM9A 2BMOA 1SQXE 1O7HA 1O7WA 2XSHA 4HM1A 3FOUA 3TGUE 1P84E 1SJGA 5AEUA 1KB9E 1PPJE 2DE6D 3GL0A 4QURA 2IBZE 2E74D 4HM7A 3GZYA 5HL4A 1SQVE 2YFLA 3GTSA 5KLVE 3L73E 1ULIA 2NUMA 3H1HE 3D89A 1SQQE 5AEWA 1EG9A 2HMNA 4PV1D 4NBBD 2HMOA 3VMHD 1SQBE 1KYOE 4P1BH 2B24A 4NB8D 2NUKA 1L0NE 2JO6A 2ZT9D 4PD4E 1BCCE 1NU1E 2I7FA 1BGYE 3AZCA 2DE7D 2HMKA 4QDCA 2FYUE 4H44D 4HM8A 4HJLA 5KKZC 2QPZA 2HMJA 2BMRA 2NVFA 4QCKA 3GOBA 3VCAA 2XR8A 4HM3A 3C0DA 2E75D 1FQTA 4NB9D 4D6TE 2NVGA 1WQLA 4OGQD 1VCKA 3VCPA 4HM4A 5BOKA 2Q3WA 4HM6A 3H1JE 1L0LE 2HMLA 4H13D 3DQYA 2BMQA 4AAYB 1NDOA 1G8JB 1O7GA 3GCEA 4HM5A 3L70E 2ZYLA 2B1XA 2DE5D 3CWBE 4NBFD 1UUWA 1VF5D 3GKEA 1Q90C 2QJPC 2YIUC 3L75E 3CX5E 1NYKA 3H1LE 2XRXA 2A06E 3BCCE 5KLIC 2E4QA 3GB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV E;  3GTE A;  1RFS A;  4HM0 A;  4QUP A;  4HM2 A;  4P1C H;  2XSO A;  4QDF A;  1G8K B;  2BCC E;  2YFJ A;  3L71 E;  4AIV A;  1O7N A;  2HMM A;  4HKV A;  4EMJ B;  2QJK C;  4NBG D;  3GL2 A;  2QJY C;  4H0L D;  1NTM E;  4NBA D;  1BE3 E;  2FYN C;  1NTK E;  1RIE A;  3GZX A;  2YVJ B;  1ULJ A;  3L74 E;  1ZRT E;  3EN1 A;  5CXM A;  3CXH E;  1PP9 E;  3L72 E;  3H1I E;  4NBC D;  4NBD D;  1JM1 A;  1UUV A;  2D2C D;  2NVE A;  1O7P A;  2YFI A;  2GBX A;  4QUQ A;  2JZA A;  2CKF A;  3EQQ A;  4NBE D;  3VMG D;  3N0Q A;  4QDF B;  1SQP E;  1O7M A;  2E4P A;  4U3F E;  2GBW A;  4NBH D;  3VMI D;  4QDD A;  2E76 D;  2NWF A;  3H1K E;  1NTZ E;  1VM9 A;  2BMO A;  1SQX E;  1O7H A;  1O7W A;  2XSH A;  4HM1 A;  3FOU A;  3TGU E;  1P84 E;  1SJG A;  5AEU A;  1KB9 E;  1PPJ E;  2DE6 D;  3GL0 A;  4QUR A;  2IBZ E;  2E74 D;  4HM7 A;  3GZY A;  5HL4 A;  1SQV E;  2YFL A;  3GTS A;  5KLV E;  3L73 E;  1ULI A;  2NUM A;  3H1H E;  3D89 A;  1SQQ E;  5AEW A;  1EG9 A;  2HMN A;  4PV1 D;  4NBB D;  2HMO A;  3VMH D;  1SQB E;  1KYO E;  4P1B H;  2B24 A;  4NB8 D;  2NUK A;  1L0N E;  2JO6 A;  2ZT9 D;  4PD4 E;  1BCC E;  1NU1 E;  2I7F A;  1BGY E;  3AZC A;  2DE7 D;  2HMK A;  4QDC A;  2FYU E;  4H44 D;  4HM8 A;  4HJL A;  5KKZ C;  2QPZ A;  2HMJ A;  2BMR A;  2NVF A;  4QCK A;  3GOB A;  3VCA A;  2XR8 A;  4HM3 A;  3C0D A;  2E75 D;  1FQT A;  4NB9 D;  4D6T E;  2NVG A;  1WQL A;  4OGQ D;  1VCK A;  3VCP A;  4HM4 A;  5BOK A;  2Q3W A;  4HM6 A;  3H1J E;  1L0L E;  2HML A;  4H13 D;  3DQY A;  2BMQ A;  4AAY B;  1NDO A;  1G8J B;  1O7G A;  3GCE A;  4HM5 A;  3L70 E;  2ZYL A;  2B1X A;  2DE5 D;  3CWB E;  4NBF D;  1UUW A;  1VF5 D;  3GKE A;  1Q90 C;  2QJP C;  2YIU C;  3L75 E;  3CX5 E;  1NYK A;  3H1L E;  2XRX A;  2A06 E;  3BCC E;  5KLI C;  2E4Q A;  3GB4 A; 
#chains in the Genus database with same CATH topology
 2QE7 H;  3H6P A;  3RL0 B;  1BDD A;  1G8K B;  1E5W A;  1VF5 C;  4W80 A;  1NTK K;  2NPS B;  3PH0 A;  4GT1 A;  1NKN A;  4PJ0 H;  2OYI C;  2H89 C;  2YO2 A;  1R8E A;  3CCV P;  1VPC A;  2O01 H;  2JWA A;  1NTZ K;  1ZN5 A;  1UUV A;  1SQX K;  1KIL B;  5GTI E;  1JOC A;  1X22 A;  4QUQ A;  1YQ3 C;  2YXQ B;  3H32 A;  3IFM A;  2WSS H;  1IFP A;  5CCH D;  2XSH A;  4WY4 B;  3BAS A;  2BCC G;  3L73 D;  3R4Y A;  2Q9I A;  2JWD A;  1SQV E;  4XFJ A;  1ULI A;  4N78 D;  1GW4 A;  4TLF A;  1J1D B;  5AVU B;  2WVR A;  1N73 B;  2ZAE B;  1JB0 J;  2N1T D;  1NU1 E;  1S3J A;  3CXH I;  5E79 E;  2H7H A;  2FFD A;  3E1I A;  1LWU C;  3M0D A;  4BWN A;  2BEZ F;  5CJ0 A;  3LW5 J;  3H1K G;  3VCP A;  3A3Y B;  1EQ7 A;  3AEC C;  1JM0 A;  3A2A A;  1KB9 I;  2HOD B;  1KQF B;  1S5L E;  1VF5 D;  3GKE A;  2RMZ A;  1HH0 A;  1JUN A;  2AEM A;  2OTJ P;  3H1H G;  1L0L K;  3V2R A;  2KXP B;  1NYK A;  2HR3 A;  3H1L E;  3CL3 D;  3A5T A;  5AEU A;  3L4F A;  1EZV E;  1HJ0 A;  1QLE D;  2PRR A;  1ZW0 A;  5APX A;  3CME P;  1DX7 A;  4AUW A;  2YKP A;  3D70 A;  2WSE J;  2M5A A;  3KQG A;  5AW9 B;  4LLH A;  2AXT E;  5M1B A;  3HD7 C;  2WSC H;  2GM4 A;  3KPE A;  4WBA A;  4R4L A;  1YJ9 P;  4TT3 H;  3M9B A;  4GIF A;  4JF7 A;  1O7H A;  3MUD C;  3FOU A;  3C8V A;  1LTS C;  1FJK A;  3FXE A;  3WUT A;  2E74 D;  2NPS A;  3I5C A;  1BSN A;  3GZY A;  2BCC J;  3AEB C;  2R44 A;  3WU2 H;  5KAF H;  1OWA A;  1YIJ P;  1NTM G;  3MIW A;  3O6Q A;  1SQB E;  1KYO E;  4P1B H;  5CHX A;  1M1K Q;  3H1I G;  5CCG A;  3AZC A;  2FYU E;  1T3J A;  4HM8 A;  1KIL A;  1ZOY C;  4UB6 H;  1X0T A;  1YIT P;  4U3F G;  5KAI H;  2ZT9 C;  3ABV C;  1BGY G;  2WIT A;  1KMI Z;  2N1T B;  2OAR A;  4RES B;  4GDO A;  3Q1M A;  3H1K J;  1O7G A;  1GDT A;  4ASV A;  1VQ8 P;  2Z5H A;  3TK1 A;  3HTK B;  4NBF D;  1PZQ A;  5KLV G;  1T6A A;  3TF5 A;  2QJP B;  2JR8 A;  2KNC B;  5KLI C;  2E4Q A;  1OVR A;  3GMA A;  3HUS C;  3A0B E;  1GZL A;  3F89 A;  1N73 A;  3VP9 A;  2POH A;  1VF5 B;  3HD7 D;  1O7N A;  1NGM B;  2C9N Y;  1QX8 A;  2B88 A;  1JY3 O;  1AVY A;  2B87 A;  2OYI B;  1EZV I;  3B71 A;  1HBW A;  3CXH D;  3BVH A;  1DIP A;  1PP9 E;  3B5N C;  3NTN A;  2HOD A;  3EQQ A;  2P2U A;  4YPC A;  3CCM P;  3U1C A;  1SQV K;  1KB9 D;  3HE5 B;  1HVV A;  2IBZ D;  4C7N A;  1LTI C;  1SJG A;  5KKZ B;  4IFD K;  1NOH A;  1SP4 A;  1NU1 K;  2LXC B;  3CCS P;  2NUM A;  4K35 A;  1VQ5 P;  1N7S C;  5B5E H;  3CXH H;  1BGY D;  2PP6 A;  1KFM A;  1OX3 A;  2ZT9 D;  2E74 B;  4ZKU A;  1IC2 A;  1PIX A;  2HMK A;  5CMZ A;  2WQY C;  1LT1 A;  2M0B A;  3AE9 C;  1LWU B;  1RHZ B;  1GK4 A;  1KYO I;  1KB9 H;  4HM6 A;  4U3F J;  3DQY A;  3P7K A;  1BGY J;  1JO5 A;  2OYH B;  5C39 A;  3S9O A;  3CWB E;  2ZYD A;  2YKO A;  3VYI A;  3KDP B;  4OWF A;  1VQO P;  5CCH A;  2K9J B;  3CCU P;  1EC5 A;  1VQ9 P;  2E43 A;  2JO1 A;  1FE6 A;  1FZB A;  3B5N D;  4CPG A;  3RBZ A;  2XV5 A;  3L74 E;  1GMJ A;  2N1T A;  3HD7 B;  2R3C A;  3Q5S A;  3KHU A;  2YFI A;  3HTK A;  4H0L C;  1O7M A;  2A06 G;  3TGU D;  5KJ7 C;  1LT9 C;  2UWJ E;  1N7S D;  2E42 A;  1PPJ E;  1SQB K;  2R5D A;  2MJZ A;  4U7J A;  4DZO A;  1FZE A;  3SFE C;  2FYU K;  2OYI A;  1L0N D;  5BU5 A;  2J5U A;  2W90 A;  3TGU J;  3MZW B;  1JTH B;  3GHG C;  3LID A;  1MUU A;  2C9L Y;  1URQ C;  1VCK A;  2ZT9 B;  4I6M C;  2I1J A;  1P84 I;  3TDK A;  1GTW A;  2ZYL A;  1PGP A;  3BCC D;  1S5L H;  3RK3 E;  4XA4 A;  5KLI B;  3HUS B;  5AVS B;  2O1J A;  4IL6 H;  2BCC E;  5AW0 B;  3PP5 A;  3FGA D;  2W27 A;  4EMJ B;  3PRJ A;  3HE4 A;  2FY8 A;  1OMI A;  1LWU A;  4H0L D;  2K3R A;  2W6B A;  3D71 A;  2FKW B;  3PTZ A;  5KJ7 D;  5TIS E;  4I1L A;  3B5N B;  2Z5I A;  4QDF B;  3WUV A;  3VMI D;  2WPR A;  4K3A A;  3H1K E;  3I56 P;  1VQ6 P;  2D2C C;  2M3E A;  2HPC B;  3II6 A;  2H88 C;  3CCL P;  3GL0 A;  2FXP A;  1ZP0 C;  3M0A A;  5DJT B;  1HGZ A;  1AQ5 A;  3H1H E;  3WUU A;  1FU1 A;  2WT7 B;  1ZME C;  3S1K A;  1BCC D;  4PV1 D;  1N7S B;  2KSE A;  2IFM A;  1URQ D;  4JYB A;  2KSJ A;  3HD7 A;  5B66 E;  1NJI Q;  1OW6 A;  1KYO H;  1RE4 C;  1HGV A;  4BXL A;  5AW2 B;  3L70 D;  3V2Q A;  3MUD A;  2XND H;  3L75 D;  1DEB A;  4IFF A;  1K9M Q;  3CI9 A;  2DE5 D;  1UIX A;  3L73 G;  2K1A A;  4OGQ C;  2KZI A;  3MP7 B;  3CX5 E;  1SQQ G;  2CPB A;  3AE4 C;  1VQ7 P;  1LTA C;  2IZ1 A;  3GB4 A;  1S72 P;  3GTE A;  1RFS A;  4HM0 A;  3L71 D;  3AE1 C;  1KV4 A;  3D6Z A;  4WWI A;  5AVY B;  3L70 J;  3A0B H;  4HKV A;  3CC4 P;  2P58 A;  2Z4E A;  1BE3 D;  3L75 J;  1NTM E;  1FS0 E;  2KK7 A;  1SFC C;  1ZRT E;  5CXM A;  2KS1 B;  3H1I E;  2QA4 P;  1VQ4 P;  1JM1 A;  1YTZ I;  2RKL A;  2D2C D;  2O01 J;  4H0L B;  3VMG D;  4U3F E;  1P84 D;  4QDD A;  3SWK A;  1ZR2 A;  2KLV A;  1VM9 A;  1LT9 B;  1M90 Q;  1IO4 A;  2XZR A;  3KXD A;  5APQ A;  3HUS A;  2Q6Q A;  1NHL A;  3VMX A;  1N8R Q;  4HM7 A;  3IR9 A;  4C7R A;  3GTS A;  3V2N A;  1GL2 C;  5KLV E;  2H43 A;  3M91 A;  2V7Q H;  4HKZ H;  3KYQ A;  3BRV B;  1PL5 A;  4RO0 A;  2JP3 A;  3UIA A;  1R5L A;  3D6Y A;  3AEA C;  1IFN A;  1RF1 C;  1X8Y A;  4EIJ A;  5KKZ C;  3B5N A;  2HLO A;  3GHG B;  4KHX A;  3U59 A;  1J2J B;  4PV1 B;  3H1J D;  1SQQ D;  1CW5 A;  3M9H A;  1YJN P;  1URQ B;  1P84 H;  2LXB A;  4OGQ D;  1Q2N A;  3P8C D;  2YMY A;  2HPC A;  3PJS K;  4Y99 C;  2E74 C;  1VDF A;  1Q90 C;  1QEX A;  2P10 A;  2XRX A;  3AED C;  3JCU H;  2WPS A;  3L73 J;  1HF9 A;  1H0T B;  3H1J J;  1JCC A;  1SQQ J;  3SWY A;  1SFC D;  1Q7Y Q;  4PD4 I;  3T97 B;  2OYH C;  2ZJS E;  1NTK D;  3IF4 A;  1RY3 A;  4IL6 X;  3L72 D;  1PV3 A;  5AW7 B;  1L0L G;  2CPS A;  1VQL P;  5AVT B;  2ZYG A;  1S9K E;  3TNU A;  1NAY A;  1LTT C;  2OYO A;  1JMM A;  2CKF A;  1NTZ D;  3EFF K;  2FBW C;  3VMZ A;  1SQX D;  4NBH D;  2WSC J;  1GL2 D;  3GW6 A;  2BMO A;  1NTK J;  1AFO A;  2W8Z A;  2D2C B;  2QRX A;  2G3A A;  1SQP K;  1KFN A;  3OJA B;  1X9V A;  3GF7 A;  2QEX P;  3D89 A;  2XNX A;  5CJ4 A;  1NTZ J;  4GOE A;  1IK7 A;  2KS1 A;  1S2E A;  1VQM P;  4RKU J;  4D6T D;  3ZDM A;  5AVZ B;  3CCR P;  1VQK P;  4JBZ A;  1DD4 A;  1Q90 D;  2M8R A;  1WQL A;  1IFI A;  2V4H A;  1X79 B;  4IFM A;  1D7M A;  1LT9 A;  5KJ7 A;  4H44 C;  3OW2 O;  1IK9 A;  2Y9Z A;  4HM5 A;  2IBZ G;  2E75 C;  3W67 A;  3TSI A;  1KOR A;  1QL1 A;  3EQ2 A;  1OFC X;  1IJD B;  5APT A;  4OGQ B;  2A06 E;  2I8D A;  1KQL A;  1QVG O;  1NAF A;  1L0L D;  2LKM A;  1M8O B;  1W2E A;  2PAJ A;  1NTM K;  3FWL A;  1RE3 C;  4WY4 A;  3CMA P;  3GHG A;  4NBG D;  3GL2 A;  1OZH A;  1KIL E;  3BRT B;  1URQ A;  1SFC B;  2DW3 A;  1ULJ A;  1L0L J;  1FDM A;  1PGO A;  1SQP D;  4NBE D;  1FOS E;  1GW3 A;  2C0X A;  1W5C E;  2NZ2 A;  5KLV K;  2E5T A;  1H0T A;  2R5B A;  2Y0E A;  3KZI E;  1KZU B;  4ASW A;  1GU4 A;  2WPQ A;  1VQP P;  1GL2 B;  4PD4 D;  5K5G B;  5H2F E;  1CI6 B;  3M9Q A;  2DE7 D;  2PGD A;  4H44 D;  2XU6 A;  1RF1 B;  5CBO A;  3AE2 C;  1Q82 Q;  2NVF A;  1NYH A;  3G71 P;  3AEG C;  2E75 D;  4I7Z B;  5AW5 B;  2NVG A;  2IPP A;  2HML A;  3TGU G;  1RF0 C;  3CLQ A;  4Y99 B;  2P7J A;  2VRS A;  3A0H H;  5AVV B;  4GOF A;  4PD4 H;  1BDC A;  5APV A;  1U57 A;  3K5B A;  1IFD A;  4KJM A;  1L0N G;  1FZC B;  4N3Y B;  1MFZ A;  4EOT A;  1M57 D;  3H1L G;  2QJK C;  1OIP A;  3GF3 A;  4NPD A;  3VTP C;  4EYY Q;  2OTL P;  1JY2 O;  3FXD A;  1RE4 A;  1AJY A;  4EDF A;  4NBD D;  2B89 A;  3P8M C;  2L5G B;  2O1K A;  3CCJ P;  3W68 A;  3EWK A;  4YTP C;  3BCC G;  3MHV A;  2E76 D;  3AEE C;  4WVZ A;  2J59 M;  4XE5 B;  1EDI A;  4ZMD A;  3SSU A;  1SQV D;  4DJG A;  2PFX A;  2W6J H;  3U1A A;  1IFJ A;  4B86 A;  2ZVO B;  3VOP A;  3QH9 A;  3L73 E;  1G2C B;  1SQQ E;  2HMN A;  3H25 A;  1A02 J;  1NU1 D;  3EFG A;  4N78 E;  4BRY B;  5GTI H;  3OA7 A;  1SFC A;  4JQ0 D;  2KNC A;  2JKV A;  4DCK A;  2K88 A;  1K8A Q;  4AQR D;  3PHL A;  2IDB A;  3AE7 C;  2ZXX A;  1H88 A;  3NFQ A;  4IOI H;  2IYP A;  3TYY A;  4DOJ A;  5APY A;  5AVR B;  2KIK A;  5TJH A;  1JY3 N;  2Q3W A;  2A45 G;  1NU1 J;  3LIE A;  4H44 B;  3H1L D;  1RH5 B;  3IAO A;  2E75 B;  1EZV D;  2WZ7 A;  5CCG C;  5BVZ A;  1GL2 A;  4PV1 C;  2IZ0 A;  5E79 H;  3S4R A;  1EDJ A;  4O9B A;  4KT0 J;  3P32 A;  2LR2 A;  1BCC G;  2AXC A;  4RJT A;  3CC2 P;  1USE A;  1CI6 A;  3HE5 A;  1L0N J;  1PGQ A;  1JCD A;  2OQQ A;  4R4M A;  2I1K A;  3H1L J;  1LTB C;  3WU2 E;  3G9R A;  3GZX A;  1UII A;  2BAS A;  1YQ4 C;  3VP8 A;  4L74 A;  3L70 G;  1O7P A;  2JJL A;  1L4A C;  3L75 G;  1PP9 G;  1LP1 B;  4UB6 E;  2YMK A;  5KAI E;  2IX7 C;  3BCC J;  3L71 G;  3RL0 g;  1NO4 A;  1DH3 A;  3Q5R A;  2YFL A;  2AXT H;  2CK3 H;  1J1E C;  1SQB D;  1KYO D;  2OYH A;  5AEW A;  1BE3 G;  1Q86 Q;  3VMH D;  2FYU D;  3SWF A;  2NUK A;  2YNY A;  3H32 B;  2I7F A;  2K9J A;  2FXO A;  1NH4 A;  3L36 A;  2YO3 A;  2L91 A;  3VCA A;  1FBM A;  1FDO A;  4GOD A;  1PGJ A;  5CCG D;  2C0W A;  1AVO A;  1L0L E;  4LC1 A;  2YIU C;  2OTK E;  4YXW H;  4OVN F;  2JDI H;  4UB8 E;  2QVA A;  2HMM A;  1BCC J;  1VL2 A;  2KLU A;  2J58 A;  1FJP A;  2P1J A;  2QJK B;  3AE8 C;  1PP9 D;  1WRG A;  2H8P D;  4L76 A;  3N4X A;  1BSH A;  1L4A D;  3H1J G;  3B4S A;  1T3U A;  5AW6 B;  3CXH E;  2WSF H;  2GBX A;  1NVO A;  2WWW A;  2ITA A;  1MFT A;  1ZXG A;  1M1J C;  3N0Q A;  3L74 G;  5AW1 B;  3Q2Y A;  1JTH A;  2FXM A;  4EI2 A;  1GK6 A;  2M3B A;  3A7O A;  2QSI A;  1O7W A;  1PP9 J;  1EXI A;  2M5A B;  1KB9 E;  2DE6 D;  4QUR A;  1JMB A;  2N9B A;  2IBZ E;  1RE3 A;  3L71 J;  1FOS F;  1M56 D;  1NTK G;  3HRN A;  4MN4 C;  2W6A A;  3L72 G;  3M06 A;  1BE3 J;  4NPF X;  1BGY E;  2KUB A;  5H2F H;  1NKZ B;  2V7Q J;  4HJL A;  2KOG A;  4QCK A;  1YTZ T;  4GKG A;  1Y9B A;  1KTM A;  3MD0 A;  2O01 N;  1NTZ G;  2WTY A;  5BOK A;  1LP1 A;  1SQX G;  3CWB D;  4AAY B;  3E1R A;  1USD A;  3O6Q B;  2Y0C A;  3F5H A;  2WMM A;  4H13 C;  1EDK A;  4I7Z C;  2AEF A;  1TU3 F;  2QM7 A;  2XSO A;  4QDF A;  3AE6 C;  3O8Z A;  5AW3 B;  3RK3 C;  2YFJ A;  1ZLL A;  5GTH E;  1N2D C;  2R32 A;  3CWB J;  1LNQ A;  3L74 D;  1HUC A;  4D6T G;  2YVJ B;  2WT7 A;  1N7S A;  3USS A;  5BU8 B;  4HB1 A;  1FZC C;  1RF0 A;  2FYZ A;  1OVV A;  3WMM 0;  1S5L X;  1L4A B;  3CX5 I;  1FZF A;  1PPJ D;  3L74 J;  1S4X A;  2ZXE B;  3TGU E;  2B87 B;  2YXR B;  3QWO C;  2HFE D;  1LJ2 A;  1OXZ A;  2GA1 A;  1VQN P;  1J1E B;  2XKM A;  4NBB D;  2B24 A;  1L0N E;  4N6J A;  2JO6 A;  2IBZ I;  2KB7 P;  3LW5 H;  3RGU A;  3GLM A;  3L72 J;  3VMA A;  4IL6 E;  2HMJ A;  2XR8 A;  1YYC A;  4C7N B;  1SQP G;  2K37 A;  4NB9 D;  3V2P A;  4LGD E;  2RH0 A;  4H13 D;  1HWT C;  3I55 P;  3CC7 P;  3Q3D A;  1SQX J;  1KQG B;  4HH2 A;  1MKM A;  3RK3 D;  2ZYA A;  2YIU B;  3BCC E;  1WMK A;  2BCC D;  4DT0 A;  2WSE H;  1H89 A;  1LTJ C;  3JC2 2;  4W7Y A;  2FYN C;  4QMA A;  2RN0 A;  3EN1 A;  4D6T J;  2YKQ A;  4Y28 J;  5AVQ B;  3MGN A;  1OW7 A;  2GUS A;  3H1K D;  2Q5U A;  2JEE A;  1M1J B;  4A7P A;  5AVW B;  3AEF C;  1YJW P;  1GU5 A;  1HJB A;  1AA0 A;  1DD3 A;  4HM1 A;  3ITK A;  1XTG B;  3H1H D;  1R5S A;  5AW4 B;  1H8A A;  1EG9 A;  1E79 H;  5APW A;  1JY3 P;  1CSB A;  3MTU E;  5TIS H;  1U7J A;  1BCC E;  2Q1K A;  1OVU A;  2BMR A;  3GOB A;  3NXS A;  2K9Y A;  3H1H J;  3T97 A;  1EDL A;  1FAV A;  2Q3I A;  1L4A A;  2P67 A;  2E76 C;  1AQT A;  1SQP J;  1NDO A;  1G8J B;  3L70 E;  3CX5 D;  1FC2 C;  3C9I A;  1XTC C;  3VN0 A;  1SQV G;  3L75 E;  2QG4 A;  1M7L A;  2W83 C;  4H13 B;  1SLQ A;  5B66 H;  2ZFC A;  3C1L A;  4P1C H;  4PJ0 E;  1NU1 G;  4HYT B;  2KZJ A;  3L71 E;  3RK3 B;  3VMY A;  4AIV A;  4UB8 H;  1NTM D;  1LGH B;  2N9Y B;  1ZRT D;  2G8Y A;  3IN6 A;  1ZV8 A;  1EXJ A;  2QJY C;  1N86 A;  3H1I D;  4WB4 A;  1BE3 E;  2QM8 A;  5AW8 B;  1RIE A;  1T8Z A;  4NBC D;  1G1I A;  1Y8A A;  2FFD C;  1FZG A;  3CX5 H;  2O3J A;  2SPZ A;  1MZ9 A;  4U3F D;  5DJU B;  1KQS O;  5CBN A;  3M0D C;  3RK2 C;  3JSV C;  2GBW A;  1NTM J;  2NWF A;  1EZV G;  1AV1 A;  2OGU A;  2KP8 A;  1JY2 P;  2XDJ A;  3FWN A;  3H1I J;  1QVF O;  1P84 E;  3G3Z A;  5KLV D;  3HE4 B;  5EFW B;  1L0N K;  5HL4 A;  1JNM A;  1KD1 Q;  1K73 Q;  1DEE G;  2A45 I;  2Q7C A;  1OW8 A;  4OH8 B;  4M3L A;  3OAK A;  3JCU E;  5APS A;  1YHQ P;  4JYC A;  3V6I A;  4W7Z A;  3CPW O;  5KLV J;  1YI2 P;  1M1J A;  4HM4 A;  1FDI A;  1CZQ A;  3H1J E;  3G4S P;  1NWQ A;  3P8C E;  1MV8 A;  1QL2 A;  1IFM A;  1SVF A;  3GG2 A;  4ZNC A;  1PFI A;  2Y9Y A;  4ZKP A;  3FX0 A;  1SQV J;  1Z56 A;  3RL0 C;  1SQB G;  4HM2 A;  2NPS C;  2Q3E A;  2ZVN B;  2FYU G;  1LTJ B;  1GD2 E;  4JPZ B;  5GTH H;  2B9B A;  3RK2 D;  1KC8 Q;  1S9K D;  4C46 A;  1NTK E;  2FYN B;  3NMD A;  3L72 E;  3CCE P;  1KIL C;  2NVE A;  2HG5 D;  2AEJ A;  1S1C X;  2KI7 B;  2JZA A;  2IFN A;  3V5B A;  1IZN B;  1HTL C;  1RQV A;  3BAT A;  1RF1 A;  4NPE A;  1A02 F;  1NTZ E;  1L2P A;  4WY4 C;  1SQX E;  1Y47 A;  1G1J A;  3N7N A;  5KAF E;  3V4Q A;  4YXD C;  1T2K C;  3B8E B;  5L8R J;  1J1D C;  2IYO A;  2MKV A;  1N73 C;  2HMO A;  1U7M A;  1ZR4 A;  1K04 A;  3CCQ P;  1QGK B;  2QPZ A;  5AVX B;  1FZC A;  5KTB A;  1FQT A;  4D6T E;  4L75 A;  2E76 B;  3RBX A;  1Q81 Q;  3RL0 D;  1JY2 N;  3GCE A;  2B1X A;  2A06 D;  2NPS D;  1UUW A;  2QIW A;  1LTG C;  2Y0D A;  4QUP A;  1W2B O;  1SQB J;  4I2L C;  2WPV B;  1KIL D;  2FYU J;  2KYV A;  4NBA D;  2QJY B;  4Z1M H;  3CD6 P;  1N7L A;  1G2C A;  2NRG A;  1JEK A;  4WY4 D;  3L37 A;  3AE5 C;  4HJG H;  2FFD B;  4BRY A;  3E7K A;  3CWB G;  1RQU A;  2E5Y A;  3RK2 B;  2HYN A;  1SQP E;  2E4P A;  1T2K D;  2BEQ D;  3PLN A;  1K05 A;  2WSF J;  1YBK A;  1FZA A;  4AYC A;  2A45 H;  5B5E E;  1WT6 A;  1LTJ A;  5APU A;  5CCH C;  3R2P A;  3TNU B;  3SFD C;  3A0H E;  4NB8 D;  3V4W A;  4PD4 E;  3L35 A;  4QDC A;  2GUV A;  1SQQ K;  3AE3 C;  4HM3 A;  1SS1 A;  3C0D A;  4L73 A;  3G6E P;  2N1T C;  3KZI H;  1KN7 A;  2BMQ A;  3Q5P A;  2R3S A;  1PPJ G;  2QJP C; 
#chains in the Genus database with same CATH homology
 1EZV E;  3GTE A;  1RFS A;  4HM0 A;  4QUP A;  4HM2 A;  4P1C H;  2XSO A;  4QDF A;  1G8K B;  2BCC E;  2YFJ A;  3L71 E;  4AIV A;  1O7N A;  2HMM A;  4HKV A;  4EMJ B;  2QJK C;  4NBG D;  3GL2 A;  2QJY C;  4H0L D;  1NTM E;  4NBA D;  1BE3 E;  2FYN C;  1NTK E;  1RIE A;  3GZX A;  2YVJ B;  1ULJ A;  3L74 E;  1ZRT E;  3EN1 A;  5CXM A;  3CXH E;  1PP9 E;  3L72 E;  3H1I E;  4NBC D;  4NBD D;  1JM1 A;  1UUV A;  2D2C D;  2NVE A;  1O7P A;  2YFI A;  2GBX A;  4QUQ A;  2JZA A;  2CKF A;  3EQQ A;  4NBE D;  3VMG D;  3N0Q A;  4QDF B;  1SQP E;  1O7M A;  2E4P A;  4U3F E;  2GBW A;  4NBH D;  3VMI D;  4QDD A;  2E76 D;  2NWF A;  3H1K E;  1NTZ E;  1VM9 A;  2BMO A;  1SQX E;  1O7H A;  1O7W A;  2XSH A;  4HM1 A;  3FOU A;  3TGU E;  1P84 E;  1SJG A;  5AEU A;  1KB9 E;  1PPJ E;  2DE6 D;  3GL0 A;  4QUR A;  2IBZ E;  2E74 D;  4HM7 A;  3GZY A;  5HL4 A;  1SQV E;  2YFL A;  3GTS A;  5KLV E;  3L73 E;  1ULI A;  2NUM A;  3H1H E;  3D89 A;  1SQQ E;  5AEW A;  1EG9 A;  2HMN A;  4PV1 D;  4NBB D;  2HMO A;  3VMH D;  1SQB E;  1KYO E;  4P1B H;  2B24 A;  4NB8 D;  2NUK A;  1L0N E;  2JO6 A;  2ZT9 D;  4PD4 E;  1BCC E;  1NU1 E;  2I7F A;  1BGY E;  3AZC A;  2DE7 D;  2HMK A;  4QDC A;  2FYU E;  4H44 D;  4HM8 A;  4HJL A;  5KKZ C;  2QPZ A;  2HMJ A;  2BMR A;  2NVF A;  4QCK A;  3GOB A;  3VCA A;  2XR8 A;  4HM3 A;  3C0D A;  2E75 D;  1FQT A;  4NB9 D;  4D6T E;  2NVG A;  1WQL A;  4OGQ D;  1VCK A;  3VCP A;  4HM4 A;  5BOK A;  2Q3W A;  4HM6 A;  3H1J E;  1L0L E;  2HML A;  4H13 D;  3DQY A;  2BMQ A;  4AAY B;  1NDO A;  1G8J B;  1O7G A;  3GCE A;  4HM5 A;  3L70 E;  2ZYL A;  2B1X A;  2DE5 D;  3CWB E;  4NBF D;  1UUW A;  1VF5 D;  3GKE A;  1Q90 C;  2QJP C;  2YIU C;  3L75 E;  3CX5 E;  1NYK A;  3H1L E;  2XRX A;  2A06 E;  3BCC E;  5KLI C;  2E4Q A;  3GB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...