1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
4QDCA 3GL0A 2ZYLA 4PV1D 4HM8A 2HMKA 1L0LE 1VM9A 2Q3WA 2QPZA 2DE7D 3GCEA 4QUPA 3L71E 1O7MA 1O7NA 1RFSA 2BMOA 1KYOE 2DE5D 1NTKE 3L70E 2CKFA 4QUQA 2GBWA 3C0DA 3DQYA 4QURA 2I7FA 1L0NE 3GKEA 3H1JE 3GL2A 3GZXA 4AIVA 4H44D 1SQVE 3GZYA 4HKVA 1P84E 4AAYB 2YFLA 3VCAA 4NBCD 1PP9E 4HM7A 2E74D 5AEWA 2NUMA 2QJPC 4HM6A 2BMRA 3GTEA 1VF5D 2BMQA 3H1KE 3H1LE 4HM2A 1BGYE 1KB9E 4NBGD 1VCKA 3D89A 3VMID 2HMLA 3TGUE 2IBZE 2QJYC 4HM4A 4HM3A 2HMNA 4H13D 5KLIC 2DE6D 2NUKA 4PD4E 4HJLA 4QDFA 2BCCE 4NBHD 4QDFB 4H0LD 4P1BH 4NBBD 2HMMA 2NWFA 2NVFA 1NU1E 3GB4A 5BOKA 1Q90C 1FQTA 2QJKC 2E75D 2ZT9D 4NBED 2B24A 1O7PA 1G8JB 2HMJA 4NBFD 2E76D 3EQQA 2FYNC 4QCKA 5KLVE 1NDOA 1ULJA 4HM1A 3BCCE 2FYUE 1JM1A 2NVGA 3H1HE 1ULIA 1RIEA 2XSOA 1BCCE 4D6TE 3CX5E 3H1IE 1NYKA 3EN1A 1SQBE 3GOBA 1NTME 3CXHE 3GTSA 1SQXE 1PPJE 1SJGA 1UUWA 2B1XA 3L74E 3L75E 2YIUC 4EMJB 2XSHA 4P1CH 3VMHD 3L73E 2XRXA 4U3FE 2XR8A 2YVJB 3VMGD 1EG9A 4NBAD 3AZCA 2JO6A 5KKZC 1G8KB 3N0QA 4NB8D 4HM5A 4QDDA 5CXMA 1NTZE 1SQQE 1ZRTE 1O7GA 1EZVE 2NVEA 2YFJA 4OGQD 1SQPE 2JZAA 2A06E 4HM0A 2E4PA 2D2CD 2GBXA 5HL4A 2YFIA 1O7HA 3CWBE 4NB9D 1UUVA 2E4QA 4NBDD 1BE3E 3L72E 1WQLA 2HMOA 5AEUA 3VCPA 3FOUA 1O7WA
chains in the Genus database with same CATH superfamily
1HGVA 3BATA 5CCHA 1O7MA 1PP9J 4IOIH 1DX7A 3MHVA 2GA1A 4UB6E 4N78D 1LTJC 4N3YB 1OX3A 2WSCH 2KLUA 1Q90D 1AVOA 1X0TA 3R2PA 2QVAA 3IN6A 1SFCB 1URQD 2H89C 3P8MC 1BGYE 5AW6B 5BU5A 4DT0A 3VYIA 3TGUE 1IZNB 2JEEA 1QL2A 1T2KC 1CZQA 3PLNA 5AW5B 4BWNA 3V4QA 2V7QH 2POHA 4RO0A 5K5GB 1KORA 2Y0CA 2HFED 1Q86Q 1RIEA 3B5ND 3FWNA 5CJ4A 4NPEA 3CWBD 1A02J 1RE3C 3N7NA 1JTHB 1VPCA 1OVUA 2E75C 2FYUG 2J5UA 2XZRA 5B5EE 3L75D 3TGUJ 5AW9B 2N1TB 3M0DA 1JTHA 1ZR2A 2XV5A 1VQ7P 2K3RA 5B5EH 1IFIA 3ABVC 2K9JB 3V5BA 4DOJA 1D7MA 3H1HD 2WSEH 4U7JA 4OGQC 2KXPB 4WWIA 3H1KJ 2HODB 5AVWB 3M9HA 4QUPA 1YTZI 2CKFA 2BCCG 1JY3O 2RMZA 1KB9I 5BVZA 1L0NE 2AXTE 3TGUG 3MTUE 2E76B 3LW5J 1HJBA 2WSCJ 3H1KD 5AEWA 3B5NA 4HM6A 3KXDA 3A5TA 1S3JA 2IBZE 3MUDC 3HUSA 1BGYD 4ZNCA 3D70A 2W6JH 1JY2P 3L75J 1NKZB 2UWJE 1Q90C 1S9KE 1FQTA 2XNXA 3EQQA 2RN0A 1JCDA 1SQXG 1U57A 2HLOA 3N4XA 3CC7P 2H43A 3V6IA 2A45G 5B66E 3O8ZA 2E42A 4LC1A 1DEEG 2JWAA 1S72P 1FOSE 3AE9C 3CX5H 1GL2D 2FKWB 1VQPP 2XSHA 5AW0B 1SFCC 1YYCA 3RL0g 3MIWA 2Y9YA 1LTTC 1Y8AA 1R5SA 1LTJB 1IJDB 2DW3A 2OYHB 1P84I 3RK3C 2GUSA 1J1DB 4RJTA 2JJLA 2ZFCA 3CXHD 3HRNA 1CI6B 2IZ1A 3B5NB 3FOUA 1IFNA 4YPCA 4EI2A 1NWQA 3FXEA 3L73D 2QE7H 2R5DA 3H1LJ 3FWLA 2OYHA 3RK3E 3RGUA 2W6BA 1FZAA 4I7ZC 2HYNA 2ZYGA 2QJPB 2R5BA 4IFDK 4H44D 1U7MA 1M7LA 2M0BA 3H6PA 3OAKA 2B9BA 2NUMA 2WZ7A 5KLVG 2BMQA 3LW5H 4HM2A 1VF5B 1KB9E 5AVVB 3VMID 1AQTA 4HJLA 2JO1A 1FZBA 4KJMA 2NVFA 1YITP 1SVFA 3AEBC 3CCRP 4NBFD 2IPPA 1EXJA 3BCCJ 1T2KD 1K8AQ 1QGKB 3CX5D 4GKGA 3T97B 2OTLP 2KNCB 3PP5A 2KYVA 3NMDA 1M56D 2C9NY 3C1LA 1JEKA 4RESB 3VMHD 4ZMDA 3VMGD 3H1IJ 2KS1B 4NBAD 1N8RQ 1KQGB 3BRVB 2R32A 3AEDC 1LTBC 2K37A 3AE6C 2N1TA 2JR8A 1IFPA 3CCJP 1YQ4C 2NVEA 1XTCC 4OGQD 5APYA 3CXHI 3WUVA 3JSVC 4H13B 3H1JG 3CWBE 1SQQG 4C7RA 5TJHA 3S9OA 4IL6X 1URQC 4D6TD 3HTKB 2SPZA 2XDJA 2A06G 2P10A 2R3SA 3H1KG 2RH0A 3GCEA 3L71E 3RL0C 4QUQA 2FYZA 3H32A 3CPWO 2A45I 1J1EB 2CPBA 3TYYA 4H0LB 3GZYA 4PJ0H 3L70J 4H0LC 1VF5D 3H1KE 5CBNA 1NAFA 3D89A 1Q81Q 2JWDA 2YMYA 2ZXXA 4XA4A 4QDFB 1JUNA 2HMMA 1U7JA 4WY4D 2QJKC 3V2RA 5M1BA 3L75G 5CCHC 1PV3A 3NXSA 3WU2E 2NVGA 1LTAC 2WSEJ 1HJ0A 3MD0A 3CXHH 1RF0C 3CX5E 1NYKA 1IK7A 1VQ9P 5H2FH 1PPJE 1S5LX 2QG4A 5GTHE 4EMJB 3L70D 3M0AA 4PD4D 2WPRA 2LXCB 4JF7A 3GG2A 2E75B 1J2JB 1OW6A 2P1JA 3MP7B 2FYUJ 3Q5PA 4ZKUA 4NPFX 1SQQE 2YKOA 3L73G 1N73C 1EZVE 1HF9A 2JZAA 1NTZK 1R5LA 1M90Q 1IFJA 1H8AA 1O7HA 1BDCA 3U59A 2NPSD 3L71J 1ZV8A 1WRGA 2W27A 2KNCA 1NTZG 4L74A 3EQ2A 3AECC 3TNUA 5KAIH 2O3JA 1E79H 1L0NK 1PGPA 3GW6A 3H1JJ 1P84D 3GZXA 4HKVA 3WU2H 4HM7A 1FZCC 3D6YA 3V2NA 2ZYDA 3H1LE 1LP1A 4I7ZB 3Q1MA 2N9BA 2O01N 1CI6A 1JMBA 1BSNA 4HM3A 2HMNA 3O6QB 3HD7D 1M1JC 5KJ7A 3CI9A 2C0WA 1NGMB 3BVHA 2Q5UA 4IL6E 3KDPB 4XFJA 2KUBA 4EIJA 1H0TA 4A7PA 3RBZA 1LTIC 1ULJA 1JOCA 1G1IA 3RK3B 1K9MQ 1BE3D 2FYUE 4UB6H 1OVVA 3CCVP 1BCCE 1VQ6P 2WITA 1SQVD 2E5YA 3M9QA 2KK7A 1EG9A 2M3EA 1FZCB 1LTJA 3H1IG 3VMZA 1ZLLA 1AQ5A 1IC2A 2WT7A 1SQPE 3W67A 2RKLA 1KD1Q 2WWWA 4GOEA 2C0XA 2AXCA 3Q5RA 1VQMP 4ZKPA 3RL0D 1L0LD 1NTKK 1UIIA 1J1DC 1KN7A 2Q3WA 1BSHA 2ZVOB 4Y28J 2YO3A 1SQPG 2GBWA 2CPSA 3C0DA 4OVNF 5APSA 3A0HE 1KMIZ 3QH9A 1FDMA 2YFLA 1M8OB 3CC2P 3PHLA 1RE4C 1NKNA 2OYIA 2BMRA 4WY4C 1JM0A 1FC2C 2HODA 2LR2A 4C7NB 4NBGD 3GHGB 4ASVA 2DE6D 4QDFA 2WSSH 1A02F 4H0LD 1S2EA 1KZUB 1WT6A 3OW2O 3A0BH 1SQBJ 2HMJA 4PJ0E 1SQVK 3SWKA 1YQ3C 1HWTC 2G8YA 1OMIA 2P58A 2L91A 4BRYA 1M1JB 3L37A 4JYCA 1KILB 3H1IE 1FDIA 3EFFK 1NTME 1M57D 5TISE 1NHLA 2B1XA 3EFGA 1PPJD 1RF1A 1NYHA 2NPSB 3ZDMA 1G2CA 1HUCA 1PGJA 1FZGA 1J1EC 1M1KQ 2KSJA 2BASA 3CCQP 2BCCD 3IR9A 4NB9D 2MKVA 1VQ8P 5AVRB 2QJKB 3WMM0 1JY3P 3TGUD 2KS1A 3G71P 1O7WA 4LLHA 1SQVJ 1OIPA 1LGHB 1PGQA 2QPZA 1USEA 2DE5D 1DD4A 2I1KA 3VTPC 2I7FA 1HGZA 1P84E 1KYOI 3VCAA 3JCUE 3AE8C 1NTZJ 2WSFH 4L75A 2WMMA 2OYOA 1GK6A 1Q2NA 3CWBJ 5KAFH 4NPDA 1LTGC 2PP6A 3S1KA 5AVUB 2ZT9D 1EZVD 2M8RA 2H8PD 2Q3EA 5AVQB 3CCMP 4H13C 5GTHH 3CCUP 5AVSB 1MFZA 3VMAA 1NTMJ 3BCCE 5DJTB 1SQPK 1PL5A 2H7HA 3GTSA 1LTSC 4PV1B 4OH8B 1N86A 4UB8H 3RK2D 1GDTA 2XR8A 1OFCX 3VN0A 1FS0E 1SQQK 1IFMA 5KKZC 1FU1A 1LT9C 1OVRA 3L4FA 1QVGO 1PP9D 1NTZE 1GU5A 1QVFO 3RL0B 3KPEA 1P84H 3RBXA 2E4PA 2N1TD 5APWA 1Q7YQ 2BCCJ 5BU8B 3GL0A 1RF0A 4PV1D 4HM8A 4I1LA 1L0LE 3Q2YA 1S1CX 2IBZG 1T6AA 2XKMA 1L2PA 1L0NJ 4AIVA 3JC22 4NBCD 3A0BE 1KFNA 2G3AA 2M5AB 1UIXA 1L0LJ 1NU1G 2B89A 4RKUJ 1X9VA 1JMMA 2HMLA 2P7JA 2NUKA 4WBAA 1S9KD 3HUSC 2HPCA 5KLVK 5BOKA 3AE4C 4LGDE 3TF5A 3CL3D 3FXDA 5APUA 4W80A 2YO2A 1N73B 1GW4A 1RF1C 5KLVJ 3L72D 4U3FD 1FZCA 1LJ2A 3H1HJ 3H25A 1DH3A 3W68A 1L4AB 3L73E 1FZEA 1EQ7A 2B87A 1VQ5P 3RK3D 3AZCA 1NTMG 3N0QA 4JQ0D 1NTKD 5E79H 3L36A 3L72G 2LKMA 4GODA 2YFJA 2Z4EA 4I6MC 1NAYA 1LWUA 3H1ID 1RE4A 4I2LC 1NTMD 1K05A 1H88A 3QWOC 3OA7A 1UUVA 4JYBA 2HMOA 3AE2C 1KQSO 2ZYLA 2P2UA 3HE4B 2IYPA 1KILD 2DE7D 2K88A 1XTGB 1L0ND 1S5LH 3VP8A 4HH2A 2OYHC 3H1JD 1JB0J 2QIWA 5C39A 3MUDA 2N1TC 1AV1A 3G3ZA 1GL2B 2FFDA 3GF3A 3TNUB 2A06D 5CMZA 4HKZH 3K5BA 1LT1A 2AEJA 2JDIH 1NOHA 1URQA 5KLIC 3A3YB 2E74C 1CW5A 2ZJSE 4OGQB 3WUTA 2IX7C 5DJUB 4H44B 5TISH 1N7LA 1SQBK 1W2BO 1ULIA 3GHGA 2AXTH 2L5GB 1YJ9P 5KLIB 3L73J 3L74E 2WT7B 1DEBA 2I8DA 1LT9A 3OJAB 1KYOH 2JKVA 4U3FE 3L71D 2JO6A 1G8KB 1MZ9A 3SWYA 3H1HG 2WSFJ 3F89A 3HE5B 1NJIQ 1L4AA 2FXPA 1YIJP 1PFIA 1MFTA 3L70G 4BXLA 3L74G 2D2CD 2KSEA 2FBWC 1T3JA 1R8EA 2YNYA 1KQLA 4R4LA 4H44C 3SFDC 1ZN5A 5AEUA 1MUUA 3GLMA 1OWAA 5AVYB 3L72J 5AW1B 3L70E 2KOGA 1VF5C 1N7SC 3H32B 1KYOD 3P8CD 3GL2A 4N78E 1QEXA 3VP9A 4PD4E 3HTKA 1URQB 4GIFA 1SQVG 2OYIB 3L35A 2R44A 5AVXB 2JP3A 4HM1A 3R4YA 4PD4H 3HUSB 1OW8A 1YI2P 1SQXJ 1EZVG 2AEFA 1SJGA 1UUWA 5EFWB 5CCHD 2K9JA 3KZIH 4WY4B 4IFMA 4HM5A 4QDDA 2HG5D 1ZRTE 4K3AA 1NH4A 3AEAC 1GTWA 2PFXA 5HL4A 1N73A 3B4SA 2E4QA 1BE3E 2W6AA 3L72E 4DCKA 1HVVA 3H1LG 1IK9A 1VM9A 1FZFA 1NU1D 3HE4A 1SS1A 2HR3A 1NTKE 1RH5B 2NZ2A 3H1JE 1GW3A 2E76C 2QM7A 3H1LD 2Q1KA 2XU6A 3M91A 1QL1A 1HBWA 1BCCG 2KZJA 3V2PA 1CSBA 2V4HA 1TU3F 4W7YA 4P1BH 4NBBD 3BCCG 3C9IA 3B5NC 1X22A 2WPQA 1G8JB 4YTPC 2ZAEB 2W83C 2M3BA 2FYNC 5AW7B 3PRJA 2PGDA 2BEZF 3F5HA 2R3CA 3M06A 5CCGC 2YXQB 3EN1A 2OTJP 5AVZB 3USSA 4W7ZA 3AEGC 1LT9B 2B87B 2YXRB 2O1JA 1NTMK 4L73A 3L74D 3I55P 4HYTB 2I1JA 1BGYJ 1USDA 1SQQD 1G1JA 5L8RJ 4B86A 4D6TG 4EOTA 2E43A 1JY2O 2CK3H 1PPJG 1ZRTD 4HM0A 2J59M 1PZQA 1EXIA 1NTKG 3G4SP 2AEMA 1HTLC 5KAIE 2K1AA 4YXDC 5H2FE 2IYOA 5KAFE 1FJKA 1FDOA 2IDBA 1FE6A 2OTKE 3GF7A 1JO5A 3UIAA 1EZVI 1SQBD 4Y99C 2O01H 1OZHA 4HM4A 4DJGA 4WY4A 2QM8A 2BCCE 3S4RA 2NWFA 4U3FJ 1SQBG 4KHXA 3P8CE 2FYUD 4QCKA 4HJGH 2IFNA 3V4WA 3CD6P 3H1HE 2Y0EA 1JY2N 2E74B 4YXWH 1DD3A 2QJYB 4TLFA 4Y99B 5GTIE 3CCSP 1GL2C 4GT1A 3VMXA 1N7SA 4O9BA 1KC8Q 2PAJA 1O7GA 2ZYAA 4MN4C 2QEXP 3FX0A 2GBXA 1SP4A 2ZXEB 1SQXK 2FXOA 2W90A 3VCPA 1RY3A 3P32A 1GMJA 2IZ0A 1Z56A 1N2DC 2NPSA 3KYQA 2HMKA 3AE7C 1AA0A 1O7NA 5AW4B 5APTA 2BMOA 1KILA 3GKEA 4C7NA 4TT3H 4HB1A 5E79E 1JNMA 1PP9E 1MV8A 1NTZD 1HH0A 2QJPC 1KTMA 1L4AC 5B66H 3GTEA 2J58A 3HD7B 2QA4P 1VCKA 1KV4A 2MJZA 1H0TB 3V2QA 1RHZB 1KB9D 4H13D 1BE3J 2FFDB 3L74J 4M3LA 1Y47A 1SFCA 1NU1E 3GB4A 4NBED 3HD7A 3G9RA 1YHQP 3NFQA 3KZIE 1LP1B 2A45H 5KLVE 1NDOA 2YKQA 4ASWA 3M9BA 3T97A 1JM1A 2XSOA 2QSIA 2XNDH 2ZT9C 3U1CA 3CC4P 3A0HH 1E5WA 2Q7CA 1X79B 1QX8A 5KKZB 5CHXA 1LWUB 4N6JA 2YIUC 1Q82Q 4P1CH 2C9LY 1T3UA 2YVJB 2KZIA 2WVRA 2YIUB 4DZOA 3PH0A 1KFMA 1L0LG 1NU1J 5APXA 4BRYB 3RK2C 1GZLA 3B71A 2Q9IA 4AQRD 1PGOA 1NVOA 1GL2A 3IF4A 1QLED 3AE1C 2KIKA 1RQVA 3AEFC 2Y0DA 1WQLA 1YTZT 3CLQA 3BASA 4JBZA 1IO4A 3MGNA 5KTBA 4GDOA 3AEEC 1GU4A 1S5LE 4XE5B 4UB8E 3B8EB 3C8VA 3JCUH 4WVZA 2D2CB 4AAYB 2FY8A 4EYYQ 1VQKP 3E1IA 2IFMA 2Z5HA 1YJNP 1L0NG 1VL2A 1KB9H 1ZP0C 2E5TA 4WB4A 2QJYC 1T8ZA 1L0LK 1RQUA 4GOFA 1VQLP 3NTNA 3A7OA 1K73Q 3I5CA 1O7PA 3SSUA 1EDIA 3CMAP 1L4AD 1KQFB 3KQGA 3TDKA 1G2CB 3HE5A 1OXZA 5CBOA 5KJ7C 3G6EP 4D6TE 2OARA 1SQBE 4EDFA 3VMYA 1SQXE 2WPVB 2NRGA 4K35A 2WQYC 1BCCJ 3GMAA 4PV1C 2ZVNB 5CXMA 3O6QA 1EDKA 2ITAA 3CWBG 2Y9ZA 1N7SB 2O01J 2Q6QA 4IL6H 3SFEC 4U3FG 2QRXA 1AVYA 5AW2B 2FXMA 2A06E 1FOSF 2V7QJ 3CCLP 3Q3DA 3PTZA 3L71G 1H89A 4NBDD 3AE3C 2HPCB 4QDCA 1EC5A 1X8YA 1Y9BA 5GTIH 3CMEP 2H88C 1RFSA 1NU1K 1VDFA 4PD4I 3M0DC 1BGYG 4AYCA 2KB7P 1FAVA 1LNQA 1FBMA 1ZW0A 3TK1A 2E74D 2FYUK 3BRTB 4IFFA 4L76A 5APQA 3SWFA 1M1JA 1SQQJ 3AE5C 1SQPJ 4NBHD 5APVA 3ITKA 2VRSA 1WMKA 1NO4A 3TSIA 1K04A 2OGUA 2W8ZA 1YJWP 3U1AA 3GHGC 2KLVA 3D71A 1SQXD 1RE3A 3LIEA 4KT0J 2XRXA 3FGAD 2NPSC 4OWFA 2Q3IA 1DIPA 1LWUC 2D2CC 4NB8D 1RF1B 5KJ7D 1KILC 2ZT9B 2BEQD 1PIXA 1OW7A 3MZWB 1SQPD 5AVTB 2YFIA 1NTKJ 1FJPA 1AFOA 3VOPA 2OQQA 1N7SD 1VQ4P 1PP9G 1ZXGA 3PJSK 1KILE 2M5AA 2FFDC 2Z5IA 2KI7B 5KLVD 1W2EA 4AUWA 1KYOE 3RK2B 1VQNP 2O1KA 4C46A 3HD7C 5CCGA 3DQYA 5AW8B 1S4XA 3EWKA 4QURA 1BCCD 3IAOA 4JPZB 2KP8A 1ZR4A 1SQVE 3D6ZA 2GM4A 4CPGA 2IBZD 2LXBA 3I56P 1AJYA 1YBKA 3IFMA 1GK4A 3II6A 1SLQA 2E75D 2YMKA 3CCEP 2B24A 2B88A 4D6TJ 2E76D 2FYNB 1ZMEC 1BDDA 5AW3B 3LIDA 1GD2E 1SFCD 1EDLA 3E1RA 2N9YB 3BCCD 4QMAA 1MKMA 3GOBA 2P67A 3CXHE 1JCCA 1JY3N 1ZOYC 3WUUA 4R4MA 2GUVA 3L75E 3A2AA 2YKPA 3Q5SA 1BE3G 2K9YA 2WTYA 1VQOP 5CCGD 3KHUA 3CX5I 5CJ0A 2PRRA 1IFDA 2OYIC 3E7KA 2WPSA 2IBZI 3P7KA 1EDJA 4Z1MH 1W5CE
chains in the Genus database with same CATH topology
4QDCA 3GL0A 2ZYLA 4PV1D 4HM8A 2HMKA 1L0LE 1VM9A 2Q3WA 2QPZA 2DE7D 3GCEA 4QUPA 3L71E 1O7MA 1O7NA 1RFSA 2BMOA 1KYOE 2DE5D 1NTKE 3L70E 2CKFA 4QUQA 2GBWA 3C0DA 3DQYA 4QURA 2I7FA 1L0NE 3GKEA 3H1JE 3GL2A 3GZXA 4AIVA 4H44D 1SQVE 3GZYA 4HKVA 1P84E 4AAYB 2YFLA 3VCAA 4NBCD 1PP9E 4HM7A 2E74D 5AEWA 2NUMA 2QJPC 4HM6A 2BMRA 3GTEA 1VF5D 2BMQA 3H1KE 3H1LE 4HM2A 1BGYE 1KB9E 4NBGD 1VCKA 3D89A 3VMID 2HMLA 3TGUE 2IBZE 2QJYC 4HM4A 4HM3A 2HMNA 4H13D 5KLIC 2DE6D 2NUKA 4PD4E 4HJLA 4QDFA 2BCCE 4NBHD 4QDFB 4H0LD 4P1BH 4NBBD 2HMMA 2NWFA 2NVFA 1NU1E 3GB4A 5BOKA 1Q90C 1FQTA 2QJKC 2E75D 2ZT9D 4NBED 2B24A 1O7PA 1G8JB 2HMJA 4NBFD 2E76D 3EQQA 2FYNC 4QCKA 5KLVE 1NDOA 1ULJA 4HM1A 3BCCE 2FYUE 1JM1A 2NVGA 3H1HE 1ULIA 1RIEA 2XSOA 1BCCE 4D6TE 3CX5E 3H1IE 1NYKA 3EN1A 1SQBE 3GOBA 1NTME 3CXHE 3GTSA 1SQXE 1PPJE 1SJGA 1UUWA 2B1XA 3L74E 3L75E 2YIUC 4EMJB 2XSHA 4P1CH 3VMHD 3L73E 2XRXA 4U3FE 2XR8A 2YVJB 3VMGD 1EG9A 4NBAD 3AZCA 2JO6A 5KKZC 1G8KB 3N0QA 4NB8D 4HM5A 4QDDA 5CXMA 1NTZE 1SQQE 1ZRTE 1O7GA 1EZVE 2NVEA 2YFJA 4OGQD 1SQPE 2JZAA 2A06E 4HM0A 2E4PA 2D2CD 2GBXA 5HL4A 2YFIA 1O7HA 3CWBE 4NB9D 1UUVA 2E4QA 4NBDD 1BE3E 3L72E 1WQLA 2HMOA 5AEUA 3VCPA 3FOUA 1O7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDC A;  3GL0 A;  2ZYL A;  4PV1 D;  4HM8 A;  2HMK A;  1L0L E;  1VM9 A;  2Q3W A;  2QPZ A;  2DE7 D;  3GCE A;  4QUP A;  3L71 E;  1O7M A;  1O7N A;  1RFS A;  2BMO A;  1KYO E;  2DE5 D;  1NTK E;  3L70 E;  2CKF A;  4QUQ A;  2GBW A;  3C0D A;  3DQY A;  4QUR A;  2I7F A;  1L0N E;  3GKE A;  3H1J E;  3GL2 A;  3GZX A;  4AIV A;  4H44 D;  1SQV E;  3GZY A;  4HKV A;  1P84 E;  4AAY B;  2YFL A;  3VCA A;  4NBC D;  1PP9 E;  4HM7 A;  2E74 D;  5AEW A;  2NUM A;  2QJP C;  4HM6 A;  2BMR A;  3GTE A;  1VF5 D;  2BMQ A;  3H1K E;  3H1L E;  4HM2 A;  1BGY E;  1KB9 E;  4NBG D;  1VCK A;  3D89 A;  3VMI D;  2HML A;  3TGU E;  2IBZ E;  2QJY C;  4HM4 A;  4HM3 A;  2HMN A;  4H13 D;  5KLI C;  2DE6 D;  2NUK A;  4PD4 E;  4HJL A;  4QDF A;  2BCC E;  4NBH D;  4QDF B;  4H0L D;  4P1B H;  4NBB D;  2HMM A;  2NWF A;  2NVF A;  1NU1 E;  3GB4 A;  5BOK A;  1Q90 C;  1FQT A;  2QJK C;  2E75 D;  2ZT9 D;  4NBE D;  2B24 A;  1O7P A;  1G8J B;  2HMJ A;  4NBF D;  2E76 D;  3EQQ A;  2FYN C;  4QCK A;  5KLV E;  1NDO A;  1ULJ A;  4HM1 A;  3BCC E;  2FYU E;  1JM1 A;  2NVG A;  3H1H E;  1ULI A;  1RIE A;  2XSO A;  1BCC E;  4D6T E;  3CX5 E;  3H1I E;  1NYK A;  3EN1 A;  1SQB E;  3GOB A;  1NTM E;  3CXH E;  3GTS A;  1SQX E;  1PPJ E;  1SJG A;  1UUW A;  2B1X A;  3L74 E;  3L75 E;  2YIU C;  4EMJ B;  2XSH A;  4P1C H;  3VMH D;  3L73 E;  2XRX A;  4U3F E;  2XR8 A;  2YVJ B;  3VMG D;  1EG9 A;  4NBA D;  3AZC A;  2JO6 A;  5KKZ C;  1G8K B;  3N0Q A;  4NB8 D;  4HM5 A;  4QDD A;  5CXM A;  1NTZ E;  1SQQ E;  1ZRT E;  1O7G A;  1EZV E;  2NVE A;  2YFJ A;  4OGQ D;  1SQP E;  2JZA A;  2A06 E;  4HM0 A;  2E4P A;  2D2C D;  2GBX A;  5HL4 A;  2YFI A;  1O7H A;  3CWB E;  4NB9 D;  1UUV A;  2E4Q A;  4NBD D;  1BE3 E;  3L72 E;  1WQL A;  2HMO A;  5AEU A;  3VCP A;  3FOU A;  1O7W A; 
#chains in the Genus database with same CATH topology
 1HGV A;  3BAT A;  5CCH A;  1O7M A;  1PP9 J;  4IOI H;  1DX7 A;  3MHV A;  2GA1 A;  4UB6 E;  4N78 D;  1LTJ C;  4N3Y B;  1OX3 A;  2WSC H;  2KLU A;  1Q90 D;  1AVO A;  1X0T A;  3R2P A;  2QVA A;  3IN6 A;  1SFC B;  1URQ D;  2H89 C;  3P8M C;  1BGY E;  5AW6 B;  5BU5 A;  4DT0 A;  3VYI A;  3TGU E;  1IZN B;  2JEE A;  1QL2 A;  1T2K C;  1CZQ A;  3PLN A;  5AW5 B;  4BWN A;  3V4Q A;  2V7Q H;  2POH A;  4RO0 A;  5K5G B;  1KOR A;  2Y0C A;  2HFE D;  1Q86 Q;  1RIE A;  3B5N D;  3FWN A;  5CJ4 A;  4NPE A;  3CWB D;  1A02 J;  1RE3 C;  3N7N A;  1JTH B;  1VPC A;  1OVU A;  2E75 C;  2FYU G;  2J5U A;  2XZR A;  5B5E E;  3L75 D;  3TGU J;  5AW9 B;  2N1T B;  3M0D A;  1JTH A;  1ZR2 A;  2XV5 A;  1VQ7 P;  2K3R A;  5B5E H;  1IFI A;  3ABV C;  2K9J B;  3V5B A;  4DOJ A;  1D7M A;  3H1H D;  2WSE H;  4U7J A;  4OGQ C;  2KXP B;  4WWI A;  3H1K J;  2HOD B;  5AVW B;  3M9H A;  4QUP A;  1YTZ I;  2CKF A;  2BCC G;  1JY3 O;  2RMZ A;  1KB9 I;  5BVZ A;  1L0N E;  2AXT E;  3TGU G;  3MTU E;  2E76 B;  3LW5 J;  1HJB A;  2WSC J;  3H1K D;  5AEW A;  3B5N A;  4HM6 A;  3KXD A;  3A5T A;  1S3J A;  2IBZ E;  3MUD C;  3HUS A;  1BGY D;  4ZNC A;  3D70 A;  2W6J H;  1JY2 P;  3L75 J;  1NKZ B;  2UWJ E;  1Q90 C;  1S9K E;  1FQT A;  2XNX A;  3EQQ A;  2RN0 A;  1JCD A;  1SQX G;  1U57 A;  2HLO A;  3N4X A;  3CC7 P;  2H43 A;  3V6I A;  2A45 G;  5B66 E;  3O8Z A;  2E42 A;  4LC1 A;  1DEE G;  2JWA A;  1S72 P;  1FOS E;  3AE9 C;  3CX5 H;  1GL2 D;  2FKW B;  1VQP P;  2XSH A;  5AW0 B;  1SFC C;  1YYC A;  3RL0 g;  3MIW A;  2Y9Y A;  1LTT C;  1Y8A A;  1R5S A;  1LTJ B;  1IJD B;  2DW3 A;  2OYH B;  1P84 I;  3RK3 C;  2GUS A;  1J1D B;  4RJT A;  2JJL A;  2ZFC A;  3CXH D;  3HRN A;  1CI6 B;  2IZ1 A;  3B5N B;  3FOU A;  1IFN A;  4YPC A;  4EI2 A;  1NWQ A;  3FXE A;  3L73 D;  2QE7 H;  2R5D A;  3H1L J;  3FWL A;  2OYH A;  3RK3 E;  3RGU A;  2W6B A;  1FZA A;  4I7Z C;  2HYN A;  2ZYG A;  2QJP B;  2R5B A;  4IFD K;  4H44 D;  1U7M A;  1M7L A;  2M0B A;  3H6P A;  3OAK A;  2B9B A;  2NUM A;  2WZ7 A;  5KLV G;  2BMQ A;  3LW5 H;  4HM2 A;  1VF5 B;  1KB9 E;  5AVV B;  3VMI D;  1AQT A;  4HJL A;  2JO1 A;  1FZB A;  4KJM A;  2NVF A;  1YIT P;  1SVF A;  3AEB C;  3CCR P;  4NBF D;  2IPP A;  1EXJ A;  3BCC J;  1T2K D;  1K8A Q;  1QGK B;  3CX5 D;  4GKG A;  3T97 B;  2OTL P;  2KNC B;  3PP5 A;  2KYV A;  3NMD A;  1M56 D;  2C9N Y;  3C1L A;  1JEK A;  4RES B;  3VMH D;  4ZMD A;  3VMG D;  3H1I J;  2KS1 B;  4NBA D;  1N8R Q;  1KQG B;  3BRV B;  2R32 A;  3AED C;  1LTB C;  2K37 A;  3AE6 C;  2N1T A;  2JR8 A;  1IFP A;  3CCJ P;  1YQ4 C;  2NVE A;  1XTC C;  4OGQ D;  5APY A;  3CXH I;  3WUV A;  3JSV C;  4H13 B;  3H1J G;  3CWB E;  1SQQ G;  4C7R A;  5TJH A;  3S9O A;  4IL6 X;  1URQ C;  4D6T D;  3HTK B;  2SPZ A;  2XDJ A;  2A06 G;  2P10 A;  2R3S A;  3H1K G;  2RH0 A;  3GCE A;  3L71 E;  3RL0 C;  4QUQ A;  2FYZ A;  3H32 A;  3CPW O;  2A45 I;  1J1E B;  2CPB A;  3TYY A;  4H0L B;  3GZY A;  4PJ0 H;  3L70 J;  4H0L C;  1VF5 D;  3H1K E;  5CBN A;  1NAF A;  3D89 A;  1Q81 Q;  2JWD A;  2YMY A;  2ZXX A;  4XA4 A;  4QDF B;  1JUN A;  2HMM A;  1U7J A;  4WY4 D;  2QJK C;  3V2R A;  5M1B A;  3L75 G;  5CCH C;  1PV3 A;  3NXS A;  3WU2 E;  2NVG A;  1LTA C;  2WSE J;  1HJ0 A;  3MD0 A;  3CXH H;  1RF0 C;  3CX5 E;  1NYK A;  1IK7 A;  1VQ9 P;  5H2F H;  1PPJ E;  1S5L X;  2QG4 A;  5GTH E;  4EMJ B;  3L70 D;  3M0A A;  4PD4 D;  2WPR A;  2LXC B;  4JF7 A;  3GG2 A;  2E75 B;  1J2J B;  1OW6 A;  2P1J A;  3MP7 B;  2FYU J;  3Q5P A;  4ZKU A;  4NPF X;  1SQQ E;  2YKO A;  3L73 G;  1N73 C;  1EZV E;  1HF9 A;  2JZA A;  1NTZ K;  1R5L A;  1M90 Q;  1IFJ A;  1H8A A;  1O7H A;  1BDC A;  3U59 A;  2NPS D;  3L71 J;  1ZV8 A;  1WRG A;  2W27 A;  2KNC A;  1NTZ G;  4L74 A;  3EQ2 A;  3AEC C;  3TNU A;  5KAI H;  2O3J A;  1E79 H;  1L0N K;  1PGP A;  3GW6 A;  3H1J J;  1P84 D;  3GZX A;  4HKV A;  3WU2 H;  4HM7 A;  1FZC C;  3D6Y A;  3V2N A;  2ZYD A;  3H1L E;  1LP1 A;  4I7Z B;  3Q1M A;  2N9B A;  2O01 N;  1CI6 A;  1JMB A;  1BSN A;  4HM3 A;  2HMN A;  3O6Q B;  3HD7 D;  1M1J C;  5KJ7 A;  3CI9 A;  2C0W A;  1NGM B;  3BVH A;  2Q5U A;  4IL6 E;  3KDP B;  4XFJ A;  2KUB A;  4EIJ A;  1H0T A;  4A7P A;  3RBZ A;  1LTI C;  1ULJ A;  1JOC A;  1G1I A;  3RK3 B;  1K9M Q;  1BE3 D;  2FYU E;  4UB6 H;  1OVV A;  3CCV P;  1BCC E;  1VQ6 P;  2WIT A;  1SQV D;  2E5Y A;  3M9Q A;  2KK7 A;  1EG9 A;  2M3E A;  1FZC B;  1LTJ A;  3H1I G;  3VMZ A;  1ZLL A;  1AQ5 A;  1IC2 A;  2WT7 A;  1SQP E;  3W67 A;  2RKL A;  1KD1 Q;  2WWW A;  4GOE A;  2C0X A;  2AXC A;  3Q5R A;  1VQM P;  4ZKP A;  3RL0 D;  1L0L D;  1NTK K;  1UII A;  1J1D C;  1KN7 A;  2Q3W A;  1BSH A;  2ZVO B;  4Y28 J;  2YO3 A;  1SQP G;  2GBW A;  2CPS A;  3C0D A;  4OVN F;  5APS A;  3A0H E;  1KMI Z;  3QH9 A;  1FDM A;  2YFL A;  1M8O B;  3CC2 P;  3PHL A;  1RE4 C;  1NKN A;  2OYI A;  2BMR A;  4WY4 C;  1JM0 A;  1FC2 C;  2HOD A;  2LR2 A;  4C7N B;  4NBG D;  3GHG B;  4ASV A;  2DE6 D;  4QDF A;  2WSS H;  1A02 F;  4H0L D;  1S2E A;  1KZU B;  1WT6 A;  3OW2 O;  3A0B H;  1SQB J;  2HMJ A;  4PJ0 E;  1SQV K;  3SWK A;  1YQ3 C;  1HWT C;  2G8Y A;  1OMI A;  2P58 A;  2L91 A;  4BRY A;  1M1J B;  3L37 A;  4JYC A;  1KIL B;  3H1I E;  1FDI A;  3EFF K;  1NTM E;  1M57 D;  5TIS E;  1NHL A;  2B1X A;  3EFG A;  1PPJ D;  1RF1 A;  1NYH A;  2NPS B;  3ZDM A;  1G2C A;  1HUC A;  1PGJ A;  1FZG A;  1J1E C;  1M1K Q;  2KSJ A;  2BAS A;  3CCQ P;  2BCC D;  3IR9 A;  4NB9 D;  2MKV A;  1VQ8 P;  5AVR B;  2QJK B;  3WMM 0;  1JY3 P;  3TGU D;  2KS1 A;  3G71 P;  1O7W A;  4LLH A;  1SQV J;  1OIP A;  1LGH B;  1PGQ A;  2QPZ A;  1USE A;  2DE5 D;  1DD4 A;  2I1K A;  3VTP C;  2I7F A;  1HGZ A;  1P84 E;  1KYO I;  3VCA A;  3JCU E;  3AE8 C;  1NTZ J;  2WSF H;  4L75 A;  2WMM A;  2OYO A;  1GK6 A;  1Q2N A;  3CWB J;  5KAF H;  4NPD A;  1LTG C;  2PP6 A;  3S1K A;  5AVU B;  2ZT9 D;  1EZV D;  2M8R A;  2H8P D;  2Q3E A;  5AVQ B;  3CCM P;  4H13 C;  5GTH H;  3CCU P;  5AVS B;  1MFZ A;  3VMA A;  1NTM J;  3BCC E;  5DJT B;  1SQP K;  1PL5 A;  2H7H A;  3GTS A;  1LTS C;  4PV1 B;  4OH8 B;  1N86 A;  4UB8 H;  3RK2 D;  1GDT A;  2XR8 A;  1OFC X;  3VN0 A;  1FS0 E;  1SQQ K;  1IFM A;  5KKZ C;  1FU1 A;  1LT9 C;  1OVR A;  3L4F A;  1QVG O;  1PP9 D;  1NTZ E;  1GU5 A;  1QVF O;  3RL0 B;  3KPE A;  1P84 H;  3RBX A;  2E4P A;  2N1T D;  5APW A;  1Q7Y Q;  2BCC J;  5BU8 B;  3GL0 A;  1RF0 A;  4PV1 D;  4HM8 A;  4I1L A;  1L0L E;  3Q2Y A;  1S1C X;  2IBZ G;  1T6A A;  2XKM A;  1L2P A;  1L0N J;  4AIV A;  3JC2 2;  4NBC D;  3A0B E;  1KFN A;  2G3A A;  2M5A B;  1UIX A;  1L0L J;  1NU1 G;  2B89 A;  4RKU J;  1X9V A;  1JMM A;  2HML A;  2P7J A;  2NUK A;  4WBA A;  1S9K D;  3HUS C;  2HPC A;  5KLV K;  5BOK A;  3AE4 C;  4LGD E;  3TF5 A;  3CL3 D;  3FXD A;  5APU A;  4W80 A;  2YO2 A;  1N73 B;  1GW4 A;  1RF1 C;  5KLV J;  3L72 D;  4U3F D;  1FZC A;  1LJ2 A;  3H1H J;  3H25 A;  1DH3 A;  3W68 A;  1L4A B;  3L73 E;  1FZE A;  1EQ7 A;  2B87 A;  1VQ5 P;  3RK3 D;  3AZC A;  1NTM G;  3N0Q A;  4JQ0 D;  1NTK D;  5E79 H;  3L36 A;  3L72 G;  2LKM A;  4GOD A;  2YFJ A;  2Z4E A;  4I6M C;  1NAY A;  1LWU A;  3H1I D;  1RE4 A;  4I2L C;  1NTM D;  1K05 A;  1H88 A;  3QWO C;  3OA7 A;  1UUV A;  4JYB A;  2HMO A;  3AE2 C;  1KQS O;  2ZYL A;  2P2U A;  3HE4 B;  2IYP A;  1KIL D;  2DE7 D;  2K88 A;  1XTG B;  1L0N D;  1S5L H;  3VP8 A;  4HH2 A;  2OYH C;  3H1J D;  1JB0 J;  2QIW A;  5C39 A;  3MUD A;  2N1T C;  1AV1 A;  3G3Z A;  1GL2 B;  2FFD A;  3GF3 A;  3TNU B;  2A06 D;  5CMZ A;  4HKZ H;  3K5B A;  1LT1 A;  2AEJ A;  2JDI H;  1NOH A;  1URQ A;  5KLI C;  3A3Y B;  2E74 C;  1CW5 A;  2ZJS E;  4OGQ B;  3WUT A;  2IX7 C;  5DJU B;  4H44 B;  5TIS H;  1N7L A;  1SQB K;  1W2B O;  1ULI A;  3GHG A;  2AXT H;  2L5G B;  1YJ9 P;  5KLI B;  3L73 J;  3L74 E;  2WT7 B;  1DEB A;  2I8D A;  1LT9 A;  3OJA B;  1KYO H;  2JKV A;  4U3F E;  3L71 D;  2JO6 A;  1G8K B;  1MZ9 A;  3SWY A;  3H1H G;  2WSF J;  3F89 A;  3HE5 B;  1NJI Q;  1L4A A;  2FXP A;  1YIJ P;  1PFI A;  1MFT A;  3L70 G;  4BXL A;  3L74 G;  2D2C D;  2KSE A;  2FBW C;  1T3J A;  1R8E A;  2YNY A;  1KQL A;  4R4L A;  4H44 C;  3SFD C;  1ZN5 A;  5AEU A;  1MUU A;  3GLM A;  1OWA A;  5AVY B;  3L72 J;  5AW1 B;  3L70 E;  2KOG A;  1VF5 C;  1N7S C;  3H32 B;  1KYO D;  3P8C D;  3GL2 A;  4N78 E;  1QEX A;  3VP9 A;  4PD4 E;  3HTK A;  1URQ B;  4GIF A;  1SQV G;  2OYI B;  3L35 A;  2R44 A;  5AVX B;  2JP3 A;  4HM1 A;  3R4Y A;  4PD4 H;  3HUS B;  1OW8 A;  1YI2 P;  1SQX J;  1EZV G;  2AEF A;  1SJG A;  1UUW A;  5EFW B;  5CCH D;  2K9J A;  3KZI H;  4WY4 B;  4IFM A;  4HM5 A;  4QDD A;  2HG5 D;  1ZRT E;  4K3A A;  1NH4 A;  3AEA C;  1GTW A;  2PFX A;  5HL4 A;  1N73 A;  3B4S A;  2E4Q A;  1BE3 E;  2W6A A;  3L72 E;  4DCK A;  1HVV A;  3H1L G;  1IK9 A;  1VM9 A;  1FZF A;  1NU1 D;  3HE4 A;  1SS1 A;  2HR3 A;  1NTK E;  1RH5 B;  2NZ2 A;  3H1J E;  1GW3 A;  2E76 C;  2QM7 A;  3H1L D;  2Q1K A;  2XU6 A;  3M91 A;  1QL1 A;  1HBW A;  1BCC G;  2KZJ A;  3V2P A;  1CSB A;  2V4H A;  1TU3 F;  4W7Y A;  4P1B H;  4NBB D;  3BCC G;  3C9I A;  3B5N C;  1X22 A;  2WPQ A;  1G8J B;  4YTP C;  2ZAE B;  2W83 C;  2M3B A;  2FYN C;  5AW7 B;  3PRJ A;  2PGD A;  2BEZ F;  3F5H A;  2R3C A;  3M06 A;  5CCG C;  2YXQ B;  3EN1 A;  2OTJ P;  5AVZ B;  3USS A;  4W7Z A;  3AEG C;  1LT9 B;  2B87 B;  2YXR B;  2O1J A;  1NTM K;  4L73 A;  3L74 D;  3I55 P;  4HYT B;  2I1J A;  1BGY J;  1USD A;  1SQQ D;  1G1J A;  5L8R J;  4B86 A;  4D6T G;  4EOT A;  2E43 A;  1JY2 O;  2CK3 H;  1PPJ G;  1ZRT D;  4HM0 A;  2J59 M;  1PZQ A;  1EXI A;  1NTK G;  3G4S P;  2AEM A;  1HTL C;  5KAI E;  2K1A A;  4YXD C;  5H2F E;  2IYO A;  5KAF E;  1FJK A;  1FDO A;  2IDB A;  1FE6 A;  2OTK E;  3GF7 A;  1JO5 A;  3UIA A;  1EZV I;  1SQB D;  4Y99 C;  2O01 H;  1OZH A;  4HM4 A;  4DJG A;  4WY4 A;  2QM8 A;  2BCC E;  3S4R A;  2NWF A;  4U3F J;  1SQB G;  4KHX A;  3P8C E;  2FYU D;  4QCK A;  4HJG H;  2IFN A;  3V4W A;  3CD6 P;  3H1H E;  2Y0E A;  1JY2 N;  2E74 B;  4YXW H;  1DD3 A;  2QJY B;  4TLF A;  4Y99 B;  5GTI E;  3CCS P;  1GL2 C;  4GT1 A;  3VMX A;  1N7S A;  4O9B A;  1KC8 Q;  2PAJ A;  1O7G A;  2ZYA A;  4MN4 C;  2QEX P;  3FX0 A;  2GBX A;  1SP4 A;  2ZXE B;  1SQX K;  2FXO A;  2W90 A;  3VCP A;  1RY3 A;  3P32 A;  1GMJ A;  2IZ0 A;  1Z56 A;  1N2D C;  2NPS A;  3KYQ A;  2HMK A;  3AE7 C;  1AA0 A;  1O7N A;  5AW4 B;  5APT A;  2BMO A;  1KIL A;  3GKE A;  4C7N A;  4TT3 H;  4HB1 A;  5E79 E;  1JNM A;  1PP9 E;  1MV8 A;  1NTZ D;  1HH0 A;  2QJP C;  1KTM A;  1L4A C;  5B66 H;  3GTE A;  2J58 A;  3HD7 B;  2QA4 P;  1VCK A;  1KV4 A;  2MJZ A;  1H0T B;  3V2Q A;  1RHZ B;  1KB9 D;  4H13 D;  1BE3 J;  2FFD B;  3L74 J;  4M3L A;  1Y47 A;  1SFC A;  1NU1 E;  3GB4 A;  4NBE D;  3HD7 A;  3G9R A;  1YHQ P;  3NFQ A;  3KZI E;  1LP1 B;  2A45 H;  5KLV E;  1NDO A;  2YKQ A;  4ASW A;  3M9B A;  3T97 A;  1JM1 A;  2XSO A;  2QSI A;  2XND H;  2ZT9 C;  3U1C A;  3CC4 P;  3A0H H;  1E5W A;  2Q7C A;  1X79 B;  1QX8 A;  5KKZ B;  5CHX A;  1LWU B;  4N6J A;  2YIU C;  1Q82 Q;  4P1C H;  2C9L Y;  1T3U A;  2YVJ B;  2KZI A;  2WVR A;  2YIU B;  4DZO A;  3PH0 A;  1KFM A;  1L0L G;  1NU1 J;  5APX A;  4BRY B;  3RK2 C;  1GZL A;  3B71 A;  2Q9I A;  4AQR D;  1PGO A;  1NVO A;  1GL2 A;  3IF4 A;  1QLE D;  3AE1 C;  2KIK A;  1RQV A;  3AEF C;  2Y0D A;  1WQL A;  1YTZ T;  3CLQ A;  3BAS A;  4JBZ A;  1IO4 A;  3MGN A;  5KTB A;  4GDO A;  3AEE C;  1GU4 A;  1S5L E;  4XE5 B;  4UB8 E;  3B8E B;  3C8V A;  3JCU H;  4WVZ A;  2D2C B;  4AAY B;  2FY8 A;  4EYY Q;  1VQK P;  3E1I A;  2IFM A;  2Z5H A;  1YJN P;  1L0N G;  1VL2 A;  1KB9 H;  1ZP0 C;  2E5T A;  4WB4 A;  2QJY C;  1T8Z A;  1L0L K;  1RQU A;  4GOF A;  1VQL P;  3NTN A;  3A7O A;  1K73 Q;  3I5C A;  1O7P A;  3SSU A;  1EDI A;  3CMA P;  1L4A D;  1KQF B;  3KQG A;  3TDK A;  1G2C B;  3HE5 A;  1OXZ A;  5CBO A;  5KJ7 C;  3G6E P;  4D6T E;  2OAR A;  1SQB E;  4EDF A;  3VMY A;  1SQX E;  2WPV B;  2NRG A;  4K35 A;  2WQY C;  1BCC J;  3GMA A;  4PV1 C;  2ZVN B;  5CXM A;  3O6Q A;  1EDK A;  2ITA A;  3CWB G;  2Y9Z A;  1N7S B;  2O01 J;  2Q6Q A;  4IL6 H;  3SFE C;  4U3F G;  2QRX A;  1AVY A;  5AW2 B;  2FXM A;  2A06 E;  1FOS F;  2V7Q J;  3CCL P;  3Q3D A;  3PTZ A;  3L71 G;  1H89 A;  4NBD D;  3AE3 C;  2HPC B;  4QDC A;  1EC5 A;  1X8Y A;  1Y9B A;  5GTI H;  3CME P;  2H88 C;  1RFS A;  1NU1 K;  1VDF A;  4PD4 I;  3M0D C;  1BGY G;  4AYC A;  2KB7 P;  1FAV A;  1LNQ A;  1FBM A;  1ZW0 A;  3TK1 A;  2E74 D;  2FYU K;  3BRT B;  4IFF A;  4L76 A;  5APQ A;  3SWF A;  1M1J A;  1SQQ J;  3AE5 C;  1SQP J;  4NBH D;  5APV A;  3ITK A;  2VRS A;  1WMK A;  1NO4 A;  3TSI A;  1K04 A;  2OGU A;  2W8Z A;  1YJW P;  3U1A A;  3GHG C;  2KLV A;  3D71 A;  1SQX D;  1RE3 A;  3LIE A;  4KT0 J;  2XRX A;  3FGA D;  2NPS C;  4OWF A;  2Q3I A;  1DIP A;  1LWU C;  2D2C C;  4NB8 D;  1RF1 B;  5KJ7 D;  1KIL C;  2ZT9 B;  2BEQ D;  1PIX A;  1OW7 A;  3MZW B;  1SQP D;  5AVT B;  2YFI A;  1NTK J;  1FJP A;  1AFO A;  3VOP A;  2OQQ A;  1N7S D;  1VQ4 P;  1PP9 G;  1ZXG A;  3PJS K;  1KIL E;  2M5A A;  2FFD C;  2Z5I A;  2KI7 B;  5KLV D;  1W2E A;  4AUW A;  1KYO E;  3RK2 B;  1VQN P;  2O1K A;  4C46 A;  3HD7 C;  5CCG A;  3DQY A;  5AW8 B;  1S4X A;  3EWK A;  4QUR A;  1BCC D;  3IAO A;  4JPZ B;  2KP8 A;  1ZR4 A;  1SQV E;  3D6Z A;  2GM4 A;  4CPG A;  2IBZ D;  2LXB A;  3I56 P;  1AJY A;  1YBK A;  3IFM A;  1GK4 A;  3II6 A;  1SLQ A;  2E75 D;  2YMK A;  3CCE P;  2B24 A;  2B88 A;  4D6T J;  2E76 D;  2FYN B;  1ZME C;  1BDD A;  5AW3 B;  3LID A;  1GD2 E;  1SFC D;  1EDL A;  3E1R A;  2N9Y B;  3BCC D;  4QMA A;  1MKM A;  3GOB A;  2P67 A;  3CXH E;  1JCC A;  1JY3 N;  1ZOY C;  3WUU A;  4R4M A;  2GUV A;  3L75 E;  3A2A A;  2YKP A;  3Q5S A;  1BE3 G;  2K9Y A;  2WTY A;  1VQO P;  5CCG D;  3KHU A;  3CX5 I;  5CJ0 A;  2PRR A;  1IFD A;  2OYI C;  3E7K A;  2WPS A;  2IBZ I;  3P7K A;  1EDJ A;  4Z1M H;  1W5C E; 
#chains in the Genus database with same CATH homology
 4QDC A;  3GL0 A;  2ZYL A;  4PV1 D;  4HM8 A;  2HMK A;  1L0L E;  1VM9 A;  2Q3W A;  2QPZ A;  2DE7 D;  3GCE A;  4QUP A;  3L71 E;  1O7M A;  1O7N A;  1RFS A;  2BMO A;  1KYO E;  2DE5 D;  1NTK E;  3L70 E;  2CKF A;  4QUQ A;  2GBW A;  3C0D A;  3DQY A;  4QUR A;  2I7F A;  1L0N E;  3GKE A;  3H1J E;  3GL2 A;  3GZX A;  4AIV A;  4H44 D;  1SQV E;  3GZY A;  4HKV A;  1P84 E;  4AAY B;  2YFL A;  3VCA A;  4NBC D;  1PP9 E;  4HM7 A;  2E74 D;  5AEW A;  2NUM A;  2QJP C;  4HM6 A;  2BMR A;  3GTE A;  1VF5 D;  2BMQ A;  3H1K E;  3H1L E;  4HM2 A;  1BGY E;  1KB9 E;  4NBG D;  1VCK A;  3D89 A;  3VMI D;  2HML A;  3TGU E;  2IBZ E;  2QJY C;  4HM4 A;  4HM3 A;  2HMN A;  4H13 D;  5KLI C;  2DE6 D;  2NUK A;  4PD4 E;  4HJL A;  4QDF A;  2BCC E;  4NBH D;  4QDF B;  4H0L D;  4P1B H;  4NBB D;  2HMM A;  2NWF A;  2NVF A;  1NU1 E;  3GB4 A;  5BOK A;  1Q90 C;  1FQT A;  2QJK C;  2E75 D;  2ZT9 D;  4NBE D;  2B24 A;  1O7P A;  1G8J B;  2HMJ A;  4NBF D;  2E76 D;  3EQQ A;  2FYN C;  4QCK A;  5KLV E;  1NDO A;  1ULJ A;  4HM1 A;  3BCC E;  2FYU E;  1JM1 A;  2NVG A;  3H1H E;  1ULI A;  1RIE A;  2XSO A;  1BCC E;  4D6T E;  3CX5 E;  3H1I E;  1NYK A;  3EN1 A;  1SQB E;  3GOB A;  1NTM E;  3CXH E;  3GTS A;  1SQX E;  1PPJ E;  1SJG A;  1UUW A;  2B1X A;  3L74 E;  3L75 E;  2YIU C;  4EMJ B;  2XSH A;  4P1C H;  3VMH D;  3L73 E;  2XRX A;  4U3F E;  2XR8 A;  2YVJ B;  3VMG D;  1EG9 A;  4NBA D;  3AZC A;  2JO6 A;  5KKZ C;  1G8K B;  3N0Q A;  4NB8 D;  4HM5 A;  4QDD A;  5CXM A;  1NTZ E;  1SQQ E;  1ZRT E;  1O7G A;  1EZV E;  2NVE A;  2YFJ A;  4OGQ D;  1SQP E;  2JZA A;  2A06 E;  4HM0 A;  2E4P A;  2D2C D;  2GBX A;  5HL4 A;  2YFI A;  1O7H A;  3CWB E;  4NB9 D;  1UUV A;  2E4Q A;  4NBD D;  1BE3 E;  3L72 E;  1WQL A;  2HMO A;  5AEU A;  3VCP A;  3FOU A;  1O7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...