1NU1E

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 47
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1nu1E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nu1E02
1VM9A 2NWFA 2A06E 4QURA 1P84E 1EZVE 2HMLA 4HJLA 4HM1A 2YFJA 1KYOE 2HMMA 3CXHE 2E4PA 2B24A 5KKZC 1O7WA 2I7FA 2QJKC 2E76D 4AIVA 4NBBD 4QUPA 1SQBE 3EQQA 3TGUE 1WQLA 1EG9A 2DE5D 1FQTA 4HM6A 4EMJB 2YVJB 3L72E 3GZXA 2QPZA 4QCKA 3GL2A 2XRXA 1VF5D 4QDCA 3GCEA 2HMNA 2FYNC 4NBED 2GBXA 1NTKE 2HMJA 3GL0A 2IBZE 3H1HE 2E4QA 2E75D 3DQYA 1RFSA 4NBHD 3GB4A 4P1BH 3VCAA 3L75E 3L73E 1ZRTE 1O7HA 2HMOA 1O7NA 4P1CH 1SQPE 1RIEA 3H1KE 4HM0A 2BCCE 4H0LD 4PD4E 1G8JB 5AEUA 3VMGD 3GKEA 3H1JE 3GTEA 1BCCE 3C0DA 5BOKA 2BMRA 3VCPA 4U3FE 1NU1E 3CWBE 3EN1A 4QDFA 2NVEA 3GTSA 2GBWA 2YIUC 1KB9E 3VMHD 3VMID 1ULIA 1O7GA 4HM7A 1O7PA 4H44D 3BCCE 2XSOA 1UUWA 1SJGA 4QUQA 1VCKA 1O7MA 1SQVE 1G8KB 4NBAD 2DE7D 1ULJA 2NUMA 4NBGD 2D2CD 1UUVA 3L71E 4NBCD 3H1IE 2XR8A 2BMQA 4NB8D 4HM4A 2CKFA 4NB9D 2XSHA 2QJYC 2JZAA 1NTZE 1L0LE 4PV1D 3CX5E 2FYUE 3L74E 1JM1A 4HM3A 3L70E 4D6TE 1NTME 2E74D 1PPJE 5AEWA 3D89A 5CXMA 2DE6D 2JO6A 3AZCA 1Q90C 4HM8A 2YFIA 2HMKA 2Q3WA 3GOBA 4QDFB 5KLIC 2BMOA 4HKVA 1PP9E 1NDOA 3GZYA 4HM2A 2YFLA 1NYKA 4H13D 4NBDD 3FOUA 4QDDA 4OGQD 2QJPC 4NBFD 1BE3E 2NVGA 2NUKA 2NVFA 2ZT9D 3N0QA 1BGYE 5HL4A 4AAYB 5KLVE 1SQQE 1L0NE 3H1LE 2B1XA 1SQXE 4HM5A 2ZYLA
chains in the Genus database with same CATH superfamily
2NWFA 2FKWB 1ZOYC 1G2CA 1FU1A 5KKZC 4IL6H 4U3FG 1SQPD 3L74G 3JCUE 2IDBA 3M9BA 2FFDC 2V7QH 1IC2A 2JO1A 5KLIB 2QVAA 4QCKA 1J1EB 1HH0A 3VMZA 2JEEA 2WPVB 1GTWA 3BRVB 1GL2B 4JYBA 1S4XA 3BCCD 1AQ5A 2E4QA 1SQQJ 4O9BA 3I55P 3H1KE 2OYIB 4EI2A 4WB4A 2FYNB 5CHXA 1FJPA 4IFMA 3CC2P 1ULIA 2WMMA 1TU3F 3ITKA 2QEXP 1VCKA 3JC22 1O7MA 2N9YB 4H44B 1X22A 5AW5B 3M0DA 3GMAA 1NYHA 3CX5H 1BE3D 1JY3P 3VMYA 1S72P 1NJIQ 1VQ9P 3HE4B 2IFNA 3AEEC 3I5CA 1BCCG 4N78E 1QGKB 2A45I 1N8RQ 3AEBC 1RF1C 3O6QB 1EC5A 2M3EA 4WVZA 2ZT9D 3PP5A 4HYTB 1H0TB 1BGYE 1Q86Q 3TF5A 1OW6A 3R4YA 1NAFA 2I1KA 3C1LA 3TNUB 1BGYJ 2WITA 2B24A 1L0LG 4WY4B 2I8DA 3L70G 3VTPC 2ZYAA 1J1DC 4D6TG 2WT7B 4EMJB 2YVJB 1LWUB 5KTBA 4HJGH 1MFZA 3D6YA 1QEXA 2Q9IA 1GZLA 1Y47A 2HMJA 1N7SA 3H32A 2RKLA 3WU2H 5B66H 1GMJA 1SQVD 4PD4E 3VMGD 3IFMA 4BXLA 1QL2A 3PLNA 2JWAA 1N73C 1KB9E 3VMHD 1BDDA 3CX5D 2BASA 2QE7H 2XSOA 1AVYA 2NPSB 2BEZF 4XE5B 1HF9A 5GTIH 4HM4A 3SFDC 2QJYC 3L74E 1SQQK 1L0NK 1HGZA 1YQ4C 4HM3A 3L75G 3MGNA 4JPZB 2D2CB 1RE3A 2O01N 4U3FJ 1SLQA 3L74J 3AZCA 2C0XA 1SQXD 4HKVA 2C9NY 1NDOA 1EZVD 1FOSE 1URQA 4OGQD 3S4RA 1Q82Q 3TGUD 1VQ8P 3H1IJ 1M1JA 5KJ7A 2R3CA 1A02F 4QURA 3H1HD 2GUSA 4AIVA 2E76D 1RE4A 2KK7A 1HJ0A 2BCCD 3LIDA 3RL0D 1PP9G 1RQVA 1ZP0C 4NBED 1QX8A 2E75C 4KT0J 3HD7B 1NTKD 3CXHH 4B86A 4NPFX 1XTCC 5TISE 3H1LG 4ASVA 5C39A 1BCCE 3B5NB 1JCCA 1OIPA 2HLOA 2YIUC 1BCCJ 3IAOA 4JF7A 3CX5I 1O7GA 2E5YA 5KKZB 4YXWH 3LW5H 2FFDB 1M8OB 1OVRA 1LT9C 2O1JA 2NUMA 2M5AB 1ZMEC 1GD2E 4M3LA 4NB8D 4OH8B 1IK7A 3RK2C 1L0LE 1LTAC 3P8MC 3L70E 4D6TE 1L0LJ 1MKMA 5CXMA 3L70J 3NMDA 4D6TJ 3H1JG 2FXPA 1KYOD 1EZVI 1KILC 4H13D 1NU1G 2IZ1A 2N1TD 1IZNB 3CMEP 1IFIA 2B87B 3N0QA 3BRTB 2WTYA 4L76A 3TK1A 2Q3IA 2B1XA 3S9OA 1VQ6P 2YKPA 2FYZA 5DJUB 4C7NA 2FXMA 1GL2C 1NTZG 3CXHD 3L4FA 3HTKB 1ZV8A 1D7MA 2XV5A 1FC2C 1X9VA 3GZXA 3LIEA 1S9KE 2KI7B 3GL2A 1VF5D 2FYNC 2P67A 2CK3H 2PFXA 1RF1B 5AVTB 3L75E 1SQVK 3U1AA 5AW3B 3O8ZA 3NFQA 2Q6QA 3L75J 2K9YA 4UB8E 3VMXA 2B89A 3GTSA 1SQBJ 5DJTB 1IK9A 1UUWA 2L91A 4NPDA 1LP1B 1J1DB 3AEFC 1PV3A 3P8CD 5CCHA 1G8KB 2YKQA 4HH2A 3D71A 4GIFA 3TSIA 2IBZG 2AXTH 1SQXK 2OARA 1Q90C 2YFIA 1PP9E 3EFFK 1BDCA 2Y0CA 1GK4A 1KYOI 1FZAA 1WMKA 3V2NA 1SFCD 1HBWA 1PP9J 1N73B 2WSFH 3L37A 2NVGA 2YMKA 1AFOA 1EXIA 2PP6A 4XFJA 3PH0A 1W2BO 1JY3N 1JMBA 3AE6C 4IFFA 3H1LE 2JJLA 4C46A 1LWUC 1P84E 3CC4P 3PHLA 3UIAA 2YNYA 2QJYB 2IFMA 1NVOA 1VPCA 4QUPA 2XNDH 1AQTA 1PPJG 1L0LK 2K88A 1OMIA 1L4AB 2W8ZA 1U57A 4ZKUA 4QDCA 2RMZA 2A45H 5AVWB 5APXA 1EXJA 2ZVNB 3KQGA 1FZCB 5KLVG 3H1JE 5BOKA 3CCUP 2WVRA 1NU1E 3H1JJ 3Q5RA 3N7NA 1LNQA 3CWBD 2WSCJ 1NU1J 3KDPB 5AW0B 1U7JA 2ZT9C 3A7OA 3CCVP 1HVVA 2YMYA 2HODB 1NTZE 3A0BE 2H88C 1NTZJ 2L5GB 5AEWA 3MP7B 1FOSF 2IYOA 4DT0A 2LKMA 2E74B 3FWNA 3K5BA 1SQBK 4TLFA 4ASWA 2W83C 2SPZA 1YITP 2J59M 5HL4A 1UIXA 2K37A 1LT9B 1SQQD 3MHVA 1IFPA 1GW4A 3HE5A 2QG4A 5AW4B 3RBXA 1KILE 2E4PA 2I7FA 3RK2B 1YI2P 2FYUG 2WPQA 1T2KD 1PZQA 1PGJA 3CCQP 2PGDA 1R8EA 3MIWA 3L72D 1FE6A 5CMZA 3TDKA 3M0AA 1KILB 3B5NC 1OZHA 2IBZE 3WUUA 4P1BH 1O7HA 1RF0C 4HM0A 3AEAC 2ZYGA 4UB6E 2G8YA 2DW3A 3VCPA 3QWOC 3EN1A 1YHQP 4WBAA 1KB9H 2KNCA 1N7SD 4N6JA 1GU5A 3GHGC 5AVQB 1LT1A 2NRGA 3AECC 4N78D 5BU5A 1VQOP 4N3YB 4RJTA 1PL5A 5APTA 1LTIC 3KYQA 2XR8A 2QM7A 1HJBA 3H1KJ 3G4SP 1VQ5P 1N2DC 2WQYC 4K35A 3Q5PA 1Q2NA 1VQKP 1BGYD 3M9QA 3CCSP 1NTME 1PPJE 5TJHA 4QDFB 3GOBA 2HMKA 2E5TA 1FZGA 1NKZB 1VDFA 1YQ3C 5AW1B 1H88A 2E76C 2IYPA 4I1LA 5KAIH 2KZJA 4L73A 3F89A 1U7MA 2RN0A 4GOEA 4NBFD 2ZAEB 1NU1K 1SS1A 2NVFA 1S3JA 2O01H 4QMAA 5KLVE 3TYYA 1IFNA 4IOIH 2WSEJ 2OYIA 2ZYLA 5KLVJ 2QJPB 1KV4A 2C9LY 1URQD 2K3RA 3SSUA 1FS0E 3WMM0 1ZN5A 2R3SA 4KHXA 1PFIA 1EDLA 2QPZA 4PJ0H 5KJ7D 2XRXA 1KB9D 1N86A 1DH3A 3DQYA 1FZBA 3W68A 3A0HE 3H32B 1K05A 1H89A 1X8YA 2BMRA 1Q81Q 2A06G 1RY3A 3HE4A 4U3FD 1KQFB 4YPCA 3L74D 5E79H 3VYIA 4H13C 2N1TC 4BWNA 5AW8B 3MUDA 1GK6A 1NKNA 1NTKG 3H1ID 2FYUE 3N4XA 1UIIA 2Z5IA 2P7JA 3GF3A 2W6BA 2FYUJ 2DE6D 4WY4A 2Y0DA 2HG5D 1KQGB 1K8AQ 2WT7A 1AJYA 1S1CX 4QDDA 5H2FH 1VF5C 2OYHC 3CI9A 2QM8A 4JQ0D 1L4AC 2ZT9B 2WPSA 4AYCA 2N9BA 5AVZB 3V2QA 3S1KA 3L36A 4PD4I 1LTJA 1BCCD 1FZCC 2J5UA 2NPSA 2GBXA 1KB9I 1NWQA 2YO3A 1QVFO 1KYOH 4P1CH 3Q1MA 1ZXGA 1RIEA 1JY3O 2B88A 4R4LA 1JCDA 3E1IA 5BU8B 5KLVK 1CSBA 1L0LD 1O7PA 3AE7C 4D6TD 2KB7P 3FXDA 3EQ2A 1SFCC 3U1CA 1LTBC 2NZ2A 2LR2A 2VRSA 4RESB 2BMQA 2CKFA 2WSSH 1BSHA 2E74C 3FX0A 2FXOA 1YJNP 2JWDA 3D89A 4DCKA 5CCHD 5CCGA 2I1JA 3HUSC 4CPGA 2LXBA 2R44A 3GHGB 1M7LA 4AAYB 3HD7A 1S9KD 2JP3A 1KFMA 4OGQB 3KPEA 3FXEA 2A06E 4EIJA 4HJLA 1IFDA 2HMMA 3WU2E 5B66E 3L75D 1JTHB 1M57D 4C7NB 2M3BA 1W2EA 1EG9A 1M90Q 1E79H 1SQBD 2FYUK 1IFMA 2PRRA 5M1BA 2FFDA 2E76B 1OXZA 4EOTA 1NTKE 2M5AA 3RL0B 3GB4A 3OAKA 4BRYB 3Q5SA 2R5DA 2Q7CA 3GTEA 1YJ9P 5GTIE 2KSJA 2WSCH 5KAFE 3PJSK 3II6A 4DJGA 2Z4EA 4DZOA 2B9BA 1X0TA 2HPCB 3A2AA 3M0DC 2B87A 1PP9D 2DE7D 5AVUB 2P10A 3GG2A 3L35A 1VQMP 3BVHA 3CCLP 2QRXA 4PV1D 1FDIA 1JM1A 5CJ0A 2P2UA 3CCEP 4RO0A 1R5SA 3VP9A 2MJZA 1CI6A 2KIKA 1AA0A 3USSA 3HTKA 3G9RA 3GZYA 1L2PA 3C8VA 3CWBG 5APVA 1LTGC 1T2KC 1X79B 1R5LA 2QJPC 2Q5UA 3G3ZA 1E5WA 1QLED 1JO5A 2M8RA 4H13B 1RF1A 2N1TB 4I7ZC 1G1IA 5APQA 3L71G 3OJAB 3CXHE 3JSVC 2QA4P 1O7WA 2W6AA 3NTNA 3KZIH 5AW7B 1K04A 3E1RA 4A7PA 3H1JD 2ZXXA 3EWKA 2OGUA 2OTJP 1FDMA 1N7SC 2BEQD 1NU1D 2HR3A 4XA4A 4GODA 5GTHH 1EDKA 1PGQA 3RGUA 1JY2P 3M06A 3GL0A 2E75D 4NBHD 3H1LJ 1ZRTE 2HMOA 3FGAD 3LW5J 1VF5B 2OYHB 3L73D 4H0LD 4UB6H 5AEUA 3JCUH 1Z56A 1SQQG 1L0NG 2GUVA 1NTMG 1YYCA 2M0BA 2NVEA 2XZRA 3RK3D 3VMID 2ZJSE 4HM7A 1IO4A 1Y9BA 3KXDA 1N73A 4AUWA 1M1KQ 2H7HA 1OFCX 3L72G 1FDOA 1Y8AA 3IN6A 1RE3C 2AXCA 2ZYDA 3T97B 1SQPG 2W90A 1URQC 2Y9ZA 1VQ4P 5APYA 3EFGA 1VQPP 1P84I 2YFLA 1JMMA 3GLMA 4TT3H 1A02J 1M1JC 3BCCG 1FZFA 5KJ7C 2WSEH 2K9JA 2ZVOB 1SFCB 4LC1A 1HUCA 3SWKA 1WRGA 1RE4C 1T3UA 2IBZD 3VN0A 2HYNA 2Y0EA 1GL2D 3AEDC 2C0WA 2KOGA 3CMAP 3HUSB 3SWYA 2UWJE 2Z5HA 5CBOA 1NOHA 4W7YA 1BE3G 3A0HH 2KS1A 5APUA 3U59A 3H1KD 3CL3D 1G2CB 3MZWB 2IPPA 2O1KA 3CWBE 1DIPA 4H44D 2OTKE 1PPJD 4EYYQ 5AVSB 2K1AA 4NBAD 1ULJA 3W67A 4PD4H 1UUVA 3L71E 3KHUA 1LT9A 4HKZH 3L71J 1JOCA 2G3AA 1YBKA 1PIXA 5KLVD 5AVYB 1Q90D 3D6ZA 1KMIZ 4OGQC 1K73Q 4NBDD 2Q1KA 1DEBA 2GM4A 2V4HA 1J2JB 1KILA 3H6PA 5L8RJ 1SQQE 1L0NE 4WY4D 3AEGC 1SQVG 1T8ZA 3GF7A 1L0NJ 3Q2YA 3H1IG 4C7RA 1NTMJ 2IBZI 3OA7A 1QVGO 1LJ2A 4L74A 2QJKC 2OQQA 2AEMA 3EQQA 5AVRB 3RL0C 3L72E 1HGVA 1GL2A 1HWTC 3L72J 3R2PA 4OWFA 2W27A 2H8PD 3WUVA 4W80A 2P1JA 3VCAA 2YO2A 3QH9A 1SQPE 2JKVA 3A5TA 1MFTA 1NAYA 1SQPJ 3V2RA 1BSNA 4PD4D 4I7ZB 1SQXG 5BVZA 1NTZK 1DEEG 4QDFA 1EZVG 2NPSD 1YJWP 1IFJA 2FYUD 1KC8Q 5CCHC 3BCCE 2MKVA 2KZIA 1SJGA 3TGUG 3BCCJ 1KQLA 3CCJP 4Y99C 2OYOA 1N7SB 2D2CD 5TISH 3VP8A 1S5LE 1KZUB 2XSHA 3B71A 2YXQB 3H1HG 2KUBA 2YKOA 1OVVA 2BCCG 4HM8A 2Q3EA 4I6MC 4HM2A 4LLHA 3O6QA 5AVXB 5B5EE 1NYKA 1H0TA 3WUTA 1HTLC 1BE3E 3TNUA 3AE3C 2KLVA 2OTLP 1BE3J 4ZMDA 3E7KA 4HM5A 5CCGD 4IL6E 1LWUA 5K5GB 3MD0A 1WQLA 5AW9B 1S5LX 1URQB 3HD7D 3AE5C 5EFWB 1FAVA 3BASA 1H8AA 2V7QJ 1LTJB 4JYCA 3B5ND 2FBWC 1M1JB 2HFED 1AV1A 4IFDK 1MUUA 1RH5B 1LGHB 2E42A 2JDIH 1FJKA 3V5BA 1OWAA 3GKEA 5AW2B 3AE1C 4PV1C 5KAFH 4U3FE 3V4WA 3GW6A 1NTMK 2WZ7A 1GDTA 3IR9A 4GT1A 1GW3A 2LXCB 1JY2N 1SQBG 2KSEA 4W7ZA 1SQVE 5AW6B 5KAIE 3VMAA 1ZR2A 4IL6X 3H1IE 1SQVJ 4UB8H 3OW2O 3CX5E 2XKMA 3L70D 2ZXEB 2O01J 2KP8A 2BMOA 1SQPK 2ZFCA 2A06D 3I56P 1OVUA 3V4QA 3ABVC 3FOUA 1KORA 3H25A 3PRJA 1KN7A 2H89C 3V2PA 3SWFA 1VQ7P 4PJ0E 1SQXE 1OX3A 2ITAA 3BATA 1MV8A 1VM9A 1EZVE 2HMLA 4HM1A 2YFJA 1SQXJ 4GOFA 4H0LC 1PGOA 3C9IA 2PAJA 1EQ7A 4NBBD 1IJDB 3TGUE 1NHLA 4HM6A 3RK3C 1K9MQ 3TGUJ 1FZEA 2H43A 3P7KA 5E79E 3GCEA 1NH4A 4ZKPA 4HB1A 1P84H 3H1HE 4GKGA 5APSA 1O7NA 4YTPC 3ZDMA 3B5NA 1DX7A 3H1HJ 2BCCE 1G8JB 1CW5A 2JR8A 3P32A 4LGDE 2BCCJ 1RF0A 2GBWA 1PGPA 4WWIA 2IX7C 2XU6A 3D70A 2QJKB 1T3JA 1AVOA 4NPEA 2AEFA 4KJMA 1KQSO 1JB0J 1DD4A 2E43A 1NTKJ 3GHGA 1SP4A 1USDA 2W6JH 5H2FE 1RQUA 4NB9D 4K3AA 3L73G 1JTHA 5KLIC 1J1EC 1VQLP 1EDIA 1CI6B 2J58A 3F5HA 5CBNA 3AE2C 2OYIC 3CPWO 1KFNA 1WT6A 1G1JA 4MN4C 1M56D 2Y9YA 3A0BH 2O3JA 4BRYA 4Y99B 1T6AA 3H1LD 1KYOE 1L4AD 3RBZA 1P84D 1ZRTD 2QSIA 3NXSA 3V6IA 1SQBE 1LTTC 4H44C 3SFEC 4RKUJ 2HPCA 4Y28J 1YTZI 1USEA 2R5BA 3AE8C 4ZNCA 3A3YB 1VL2A 3AE4C 2FY8A 1GU4A 1SVFA 1JEKA 1LP1A 3CD6P 1YIJP 4QUQA 1QL1A 3MUDC 2R32A 3G71P 3M91A 1JNMA 1OW8A 3AE9C 4NBCD 4GDOA 2WWWA 1NGMB 2N1TA 4YXDC 2IZ0A 3Q3DA 2KXPB 2JZAA 2AEJA 4WY4C 2A45G 1KTMA 1DD3A 1NTZD 2E74D 3H1KG 2JO6A 3MTUE 1EDJA 2Q3WA 1CZQA 3P8CE 4PV1B 1W5CE 2CPSA 3CC7P 3CXHI 2POHA 2XDJA 2NUKA 3G6EP 3RK2D 1NTKK 2OYHA 2WPRA 2K9JB 3PTZA 4JBZA 4DOJA 1RHZB 1LTJC 2KLUA 1L4AA 2RH0A 1KILD 3CCRP 4L75A 1N7LA 2DE5D 1FQTA 1LTSC 1FBMA 2NPSC 1JM0A 5APWA 2HMNA 1OW7A 3RL0g 1FZCA 2CPBA 1RFSA 3L73E 2D2CC 3FWLA 4I2LC 1BGYG 2P58A 3HE5B 3L73J 3T97A 3C0DA 3L71D 1JUNA 2E75B 3RK3E 2KS1B 4H0LB 2YXRB 3M9HA 4OVNF 1YTZT 1ZW0A 1ZLLA 4Z1MH 3B8EB 1S2EA 1NO4A 5CJ4A 3RK3B 3VOPA 2YIUB 4NBGD 1VQNP 2HODA 5AVVB 4EDFA 1S5LH 1SFCA 2QIWA 1MZ9A 3B4SA 5CCGC 2AXTE 4R4MA 1L0ND 1XTGB 3CWBJ 2GA1A 1NTMD 1KD1Q 2KNCB 1ZR4A 4AQRD 5B5EH 3HRNA 2KYVA 3CCMP 3KZIE 3CLQA 3HD7C 3IF4A 3HUSA 1JY2O 2XNXA 2WSFJ 4U7JA 5GTHE 1Q7YQ
chains in the Genus database with same CATH topology
1VM9A 2NWFA 2A06E 4QURA 1P84E 1EZVE 2HMLA 4HJLA 4HM1A 2YFJA 1KYOE 2HMMA 3CXHE 2E4PA 2B24A 5KKZC 1O7WA 2I7FA 2QJKC 2E76D 4AIVA 4NBBD 4QUPA 1SQBE 3EQQA 3TGUE 1WQLA 1EG9A 2DE5D 1FQTA 4HM6A 4EMJB 2YVJB 3L72E 3GZXA 2QPZA 4QCKA 3GL2A 2XRXA 1VF5D 4QDCA 3GCEA 2HMNA 2FYNC 4NBED 2GBXA 1NTKE 2HMJA 3GL0A 2IBZE 3H1HE 2E4QA 2E75D 3DQYA 1RFSA 4NBHD 3GB4A 4P1BH 3VCAA 3L75E 3L73E 1ZRTE 1O7HA 2HMOA 1O7NA 4P1CH 1SQPE 1RIEA 3H1KE 4HM0A 2BCCE 4H0LD 4PD4E 1G8JB 5AEUA 3VMGD 3GKEA 3H1JE 3GTEA 1BCCE 3C0DA 5BOKA 2BMRA 3VCPA 4U3FE 1NU1E 3CWBE 3EN1A 4QDFA 2NVEA 3GTSA 2GBWA 2YIUC 1KB9E 3VMHD 3VMID 1ULIA 1O7GA 4HM7A 1O7PA 4H44D 3BCCE 2XSOA 1UUWA 1SJGA 4QUQA 1VCKA 1O7MA 1SQVE 1G8KB 4NBAD 2DE7D 1ULJA 2NUMA 4NBGD 2D2CD 1UUVA 3L71E 4NBCD 3H1IE 2XR8A 2BMQA 4NB8D 4HM4A 2CKFA 4NB9D 2XSHA 2QJYC 2JZAA 1NTZE 1L0LE 4PV1D 3CX5E 2FYUE 3L74E 1JM1A 4HM3A 3L70E 4D6TE 1NTME 2E74D 1PPJE 5AEWA 3D89A 5CXMA 2DE6D 2JO6A 3AZCA 1Q90C 4HM8A 2YFIA 2HMKA 2Q3WA 3GOBA 4QDFB 5KLIC 2BMOA 4HKVA 1PP9E 1NDOA 3GZYA 4HM2A 2YFLA 1NYKA 4H13D 4NBDD 3FOUA 4QDDA 4OGQD 2QJPC 4NBFD 1BE3E 2NVGA 2NUKA 2NVFA 2ZT9D 3N0QA 1BGYE 5HL4A 4AAYB 5KLVE 1SQQE 1L0NE 3H1LE 2B1XA 1SQXE 4HM5A 2ZYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM9 A;  2NWF A;  2A06 E;  4QUR A;  1P84 E;  1EZV E;  2HML A;  4HJL A;  4HM1 A;  2YFJ A;  1KYO E;  2HMM A;  3CXH E;  2E4P A;  2B24 A;  5KKZ C;  1O7W A;  2I7F A;  2QJK C;  2E76 D;  4AIV A;  4NBB D;  4QUP A;  1SQB E;  3EQQ A;  3TGU E;  1WQL A;  1EG9 A;  2DE5 D;  1FQT A;  4HM6 A;  4EMJ B;  2YVJ B;  3L72 E;  3GZX A;  2QPZ A;  4QCK A;  3GL2 A;  2XRX A;  1VF5 D;  4QDC A;  3GCE A;  2HMN A;  2FYN C;  4NBE D;  2GBX A;  1NTK E;  2HMJ A;  3GL0 A;  2IBZ E;  3H1H E;  2E4Q A;  2E75 D;  3DQY A;  1RFS A;  4NBH D;  3GB4 A;  4P1B H;  3VCA A;  3L75 E;  3L73 E;  1ZRT E;  1O7H A;  2HMO A;  1O7N A;  4P1C H;  1SQP E;  1RIE A;  3H1K E;  4HM0 A;  2BCC E;  4H0L D;  4PD4 E;  1G8J B;  5AEU A;  3VMG D;  3GKE A;  3H1J E;  3GTE A;  1BCC E;  3C0D A;  5BOK A;  2BMR A;  3VCP A;  4U3F E;  1NU1 E;  3CWB E;  3EN1 A;  4QDF A;  2NVE A;  3GTS A;  2GBW A;  2YIU C;  1KB9 E;  3VMH D;  3VMI D;  1ULI A;  1O7G A;  4HM7 A;  1O7P A;  4H44 D;  3BCC E;  2XSO A;  1UUW A;  1SJG A;  4QUQ A;  1VCK A;  1O7M A;  1SQV E;  1G8K B;  4NBA D;  2DE7 D;  1ULJ A;  2NUM A;  4NBG D;  2D2C D;  1UUV A;  3L71 E;  4NBC D;  3H1I E;  2XR8 A;  2BMQ A;  4NB8 D;  4HM4 A;  2CKF A;  4NB9 D;  2XSH A;  2QJY C;  2JZA A;  1NTZ E;  1L0L E;  4PV1 D;  3CX5 E;  2FYU E;  3L74 E;  1JM1 A;  4HM3 A;  3L70 E;  4D6T E;  1NTM E;  2E74 D;  1PPJ E;  5AEW A;  3D89 A;  5CXM A;  2DE6 D;  2JO6 A;  3AZC A;  1Q90 C;  4HM8 A;  2YFI A;  2HMK A;  2Q3W A;  3GOB A;  4QDF B;  5KLI C;  2BMO A;  4HKV A;  1PP9 E;  1NDO A;  3GZY A;  4HM2 A;  2YFL A;  1NYK A;  4H13 D;  4NBD D;  3FOU A;  4QDD A;  4OGQ D;  2QJP C;  4NBF D;  1BE3 E;  2NVG A;  2NUK A;  2NVF A;  2ZT9 D;  3N0Q A;  1BGY E;  5HL4 A;  4AAY B;  5KLV E;  1SQQ E;  1L0N E;  3H1L E;  2B1X A;  1SQX E;  4HM5 A;  2ZYL A; 
#chains in the Genus database with same CATH topology
 2NWF A;  2FKW B;  1ZOY C;  1G2C A;  1FU1 A;  5KKZ C;  4IL6 H;  4U3F G;  1SQP D;  3L74 G;  3JCU E;  2IDB A;  3M9B A;  2FFD C;  2V7Q H;  1IC2 A;  2JO1 A;  5KLI B;  2QVA A;  4QCK A;  1J1E B;  1HH0 A;  3VMZ A;  2JEE A;  2WPV B;  1GTW A;  3BRV B;  1GL2 B;  4JYB A;  1S4X A;  3BCC D;  1AQ5 A;  2E4Q A;  1SQQ J;  4O9B A;  3I55 P;  3H1K E;  2OYI B;  4EI2 A;  4WB4 A;  2FYN B;  5CHX A;  1FJP A;  4IFM A;  3CC2 P;  1ULI A;  2WMM A;  1TU3 F;  3ITK A;  2QEX P;  1VCK A;  3JC2 2;  1O7M A;  2N9Y B;  4H44 B;  1X22 A;  5AW5 B;  3M0D A;  3GMA A;  1NYH A;  3CX5 H;  1BE3 D;  1JY3 P;  3VMY A;  1S72 P;  1NJI Q;  1VQ9 P;  3HE4 B;  2IFN A;  3AEE C;  3I5C A;  1BCC G;  4N78 E;  1QGK B;  2A45 I;  1N8R Q;  3AEB C;  1RF1 C;  3O6Q B;  1EC5 A;  2M3E A;  4WVZ A;  2ZT9 D;  3PP5 A;  4HYT B;  1H0T B;  1BGY E;  1Q86 Q;  3TF5 A;  1OW6 A;  3R4Y A;  1NAF A;  2I1K A;  3C1L A;  3TNU B;  1BGY J;  2WIT A;  2B24 A;  1L0L G;  4WY4 B;  2I8D A;  3L70 G;  3VTP C;  2ZYA A;  1J1D C;  4D6T G;  2WT7 B;  4EMJ B;  2YVJ B;  1LWU B;  5KTB A;  4HJG H;  1MFZ A;  3D6Y A;  1QEX A;  2Q9I A;  1GZL A;  1Y47 A;  2HMJ A;  1N7S A;  3H32 A;  2RKL A;  3WU2 H;  5B66 H;  1GMJ A;  1SQV D;  4PD4 E;  3VMG D;  3IFM A;  4BXL A;  1QL2 A;  3PLN A;  2JWA A;  1N73 C;  1KB9 E;  3VMH D;  1BDD A;  3CX5 D;  2BAS A;  2QE7 H;  2XSO A;  1AVY A;  2NPS B;  2BEZ F;  4XE5 B;  1HF9 A;  5GTI H;  4HM4 A;  3SFD C;  2QJY C;  3L74 E;  1SQQ K;  1L0N K;  1HGZ A;  1YQ4 C;  4HM3 A;  3L75 G;  3MGN A;  4JPZ B;  2D2C B;  1RE3 A;  2O01 N;  4U3F J;  1SLQ A;  3L74 J;  3AZC A;  2C0X A;  1SQX D;  4HKV A;  2C9N Y;  1NDO A;  1EZV D;  1FOS E;  1URQ A;  4OGQ D;  3S4R A;  1Q82 Q;  3TGU D;  1VQ8 P;  3H1I J;  1M1J A;  5KJ7 A;  2R3C A;  1A02 F;  4QUR A;  3H1H D;  2GUS A;  4AIV A;  2E76 D;  1RE4 A;  2KK7 A;  1HJ0 A;  2BCC D;  3LID A;  3RL0 D;  1PP9 G;  1RQV A;  1ZP0 C;  4NBE D;  1QX8 A;  2E75 C;  4KT0 J;  3HD7 B;  1NTK D;  3CXH H;  4B86 A;  4NPF X;  1XTC C;  5TIS E;  3H1L G;  4ASV A;  5C39 A;  1BCC E;  3B5N B;  1JCC A;  1OIP A;  2HLO A;  2YIU C;  1BCC J;  3IAO A;  4JF7 A;  3CX5 I;  1O7G A;  2E5Y A;  5KKZ B;  4YXW H;  3LW5 H;  2FFD B;  1M8O B;  1OVR A;  1LT9 C;  2O1J A;  2NUM A;  2M5A B;  1ZME C;  1GD2 E;  4M3L A;  4NB8 D;  4OH8 B;  1IK7 A;  3RK2 C;  1L0L E;  1LTA C;  3P8M C;  3L70 E;  4D6T E;  1L0L J;  1MKM A;  5CXM A;  3L70 J;  3NMD A;  4D6T J;  3H1J G;  2FXP A;  1KYO D;  1EZV I;  1KIL C;  4H13 D;  1NU1 G;  2IZ1 A;  2N1T D;  1IZN B;  3CME P;  1IFI A;  2B87 B;  3N0Q A;  3BRT B;  2WTY A;  4L76 A;  3TK1 A;  2Q3I A;  2B1X A;  3S9O A;  1VQ6 P;  2YKP A;  2FYZ A;  5DJU B;  4C7N A;  2FXM A;  1GL2 C;  1NTZ G;  3CXH D;  3L4F A;  3HTK B;  1ZV8 A;  1D7M A;  2XV5 A;  1FC2 C;  1X9V A;  3GZX A;  3LIE A;  1S9K E;  2KI7 B;  3GL2 A;  1VF5 D;  2FYN C;  2P67 A;  2CK3 H;  2PFX A;  1RF1 B;  5AVT B;  3L75 E;  1SQV K;  3U1A A;  5AW3 B;  3O8Z A;  3NFQ A;  2Q6Q A;  3L75 J;  2K9Y A;  4UB8 E;  3VMX A;  2B89 A;  3GTS A;  1SQB J;  5DJT B;  1IK9 A;  1UUW A;  2L91 A;  4NPD A;  1LP1 B;  1J1D B;  3AEF C;  1PV3 A;  3P8C D;  5CCH A;  1G8K B;  2YKQ A;  4HH2 A;  3D71 A;  4GIF A;  3TSI A;  2IBZ G;  2AXT H;  1SQX K;  2OAR A;  1Q90 C;  2YFI A;  1PP9 E;  3EFF K;  1BDC A;  2Y0C A;  1GK4 A;  1KYO I;  1FZA A;  1WMK A;  3V2N A;  1SFC D;  1HBW A;  1PP9 J;  1N73 B;  2WSF H;  3L37 A;  2NVG A;  2YMK A;  1AFO A;  1EXI A;  2PP6 A;  4XFJ A;  3PH0 A;  1W2B O;  1JY3 N;  1JMB A;  3AE6 C;  4IFF A;  3H1L E;  2JJL A;  4C46 A;  1LWU C;  1P84 E;  3CC4 P;  3PHL A;  3UIA A;  2YNY A;  2QJY B;  2IFM A;  1NVO A;  1VPC A;  4QUP A;  2XND H;  1AQT A;  1PPJ G;  1L0L K;  2K88 A;  1OMI A;  1L4A B;  2W8Z A;  1U57 A;  4ZKU A;  4QDC A;  2RMZ A;  2A45 H;  5AVW B;  5APX A;  1EXJ A;  2ZVN B;  3KQG A;  1FZC B;  5KLV G;  3H1J E;  5BOK A;  3CCU P;  2WVR A;  1NU1 E;  3H1J J;  3Q5R A;  3N7N A;  1LNQ A;  3CWB D;  2WSC J;  1NU1 J;  3KDP B;  5AW0 B;  1U7J A;  2ZT9 C;  3A7O A;  3CCV P;  1HVV A;  2YMY A;  2HOD B;  1NTZ E;  3A0B E;  2H88 C;  1NTZ J;  2L5G B;  5AEW A;  3MP7 B;  1FOS F;  2IYO A;  4DT0 A;  2LKM A;  2E74 B;  3FWN A;  3K5B A;  1SQB K;  4TLF A;  4ASW A;  2W83 C;  2SPZ A;  1YIT P;  2J59 M;  5HL4 A;  1UIX A;  2K37 A;  1LT9 B;  1SQQ D;  3MHV A;  1IFP A;  1GW4 A;  3HE5 A;  2QG4 A;  5AW4 B;  3RBX A;  1KIL E;  2E4P A;  2I7F A;  3RK2 B;  1YI2 P;  2FYU G;  2WPQ A;  1T2K D;  1PZQ A;  1PGJ A;  3CCQ P;  2PGD A;  1R8E A;  3MIW A;  3L72 D;  1FE6 A;  5CMZ A;  3TDK A;  3M0A A;  1KIL B;  3B5N C;  1OZH A;  2IBZ E;  3WUU A;  4P1B H;  1O7H A;  1RF0 C;  4HM0 A;  3AEA C;  2ZYG A;  4UB6 E;  2G8Y A;  2DW3 A;  3VCP A;  3QWO C;  3EN1 A;  1YHQ P;  4WBA A;  1KB9 H;  2KNC A;  1N7S D;  4N6J A;  1GU5 A;  3GHG C;  5AVQ B;  1LT1 A;  2NRG A;  3AEC C;  4N78 D;  5BU5 A;  1VQO P;  4N3Y B;  4RJT A;  1PL5 A;  5APT A;  1LTI C;  3KYQ A;  2XR8 A;  2QM7 A;  1HJB A;  3H1K J;  3G4S P;  1VQ5 P;  1N2D C;  2WQY C;  4K35 A;  3Q5P A;  1Q2N A;  1VQK P;  1BGY D;  3M9Q A;  3CCS P;  1NTM E;  1PPJ E;  5TJH A;  4QDF B;  3GOB A;  2HMK A;  2E5T A;  1FZG A;  1NKZ B;  1VDF A;  1YQ3 C;  5AW1 B;  1H88 A;  2E76 C;  2IYP A;  4I1L A;  5KAI H;  2KZJ A;  4L73 A;  3F89 A;  1U7M A;  2RN0 A;  4GOE A;  4NBF D;  2ZAE B;  1NU1 K;  1SS1 A;  2NVF A;  1S3J A;  2O01 H;  4QMA A;  5KLV E;  3TYY A;  1IFN A;  4IOI H;  2WSE J;  2OYI A;  2ZYL A;  5KLV J;  2QJP B;  1KV4 A;  2C9L Y;  1URQ D;  2K3R A;  3SSU A;  1FS0 E;  3WMM 0;  1ZN5 A;  2R3S A;  4KHX A;  1PFI A;  1EDL A;  2QPZ A;  4PJ0 H;  5KJ7 D;  2XRX A;  1KB9 D;  1N86 A;  1DH3 A;  3DQY A;  1FZB A;  3W68 A;  3A0H E;  3H32 B;  1K05 A;  1H89 A;  1X8Y A;  2BMR A;  1Q81 Q;  2A06 G;  1RY3 A;  3HE4 A;  4U3F D;  1KQF B;  4YPC A;  3L74 D;  5E79 H;  3VYI A;  4H13 C;  2N1T C;  4BWN A;  5AW8 B;  3MUD A;  1GK6 A;  1NKN A;  1NTK G;  3H1I D;  2FYU E;  3N4X A;  1UII A;  2Z5I A;  2P7J A;  3GF3 A;  2W6B A;  2FYU J;  2DE6 D;  4WY4 A;  2Y0D A;  2HG5 D;  1KQG B;  1K8A Q;  2WT7 A;  1AJY A;  1S1C X;  4QDD A;  5H2F H;  1VF5 C;  2OYH C;  3CI9 A;  2QM8 A;  4JQ0 D;  1L4A C;  2ZT9 B;  2WPS A;  4AYC A;  2N9B A;  5AVZ B;  3V2Q A;  3S1K A;  3L36 A;  4PD4 I;  1LTJ A;  1BCC D;  1FZC C;  2J5U A;  2NPS A;  2GBX A;  1KB9 I;  1NWQ A;  2YO3 A;  1QVF O;  1KYO H;  4P1C H;  3Q1M A;  1ZXG A;  1RIE A;  1JY3 O;  2B88 A;  4R4L A;  1JCD A;  3E1I A;  5BU8 B;  5KLV K;  1CSB A;  1L0L D;  1O7P A;  3AE7 C;  4D6T D;  2KB7 P;  3FXD A;  3EQ2 A;  1SFC C;  3U1C A;  1LTB C;  2NZ2 A;  2LR2 A;  2VRS A;  4RES B;  2BMQ A;  2CKF A;  2WSS H;  1BSH A;  2E74 C;  3FX0 A;  2FXO A;  1YJN P;  2JWD A;  3D89 A;  4DCK A;  5CCH D;  5CCG A;  2I1J A;  3HUS C;  4CPG A;  2LXB A;  2R44 A;  3GHG B;  1M7L A;  4AAY B;  3HD7 A;  1S9K D;  2JP3 A;  1KFM A;  4OGQ B;  3KPE A;  3FXE A;  2A06 E;  4EIJ A;  4HJL A;  1IFD A;  2HMM A;  3WU2 E;  5B66 E;  3L75 D;  1JTH B;  1M57 D;  4C7N B;  2M3B A;  1W2E A;  1EG9 A;  1M90 Q;  1E79 H;  1SQB D;  2FYU K;  1IFM A;  2PRR A;  5M1B A;  2FFD A;  2E76 B;  1OXZ A;  4EOT A;  1NTK E;  2M5A A;  3RL0 B;  3GB4 A;  3OAK A;  4BRY B;  3Q5S A;  2R5D A;  2Q7C A;  3GTE A;  1YJ9 P;  5GTI E;  2KSJ A;  2WSC H;  5KAF E;  3PJS K;  3II6 A;  4DJG A;  2Z4E A;  4DZO A;  2B9B A;  1X0T A;  2HPC B;  3A2A A;  3M0D C;  2B87 A;  1PP9 D;  2DE7 D;  5AVU B;  2P10 A;  3GG2 A;  3L35 A;  1VQM P;  3BVH A;  3CCL P;  2QRX A;  4PV1 D;  1FDI A;  1JM1 A;  5CJ0 A;  2P2U A;  3CCE P;  4RO0 A;  1R5S A;  3VP9 A;  2MJZ A;  1CI6 A;  2KIK A;  1AA0 A;  3USS A;  3HTK A;  3G9R A;  3GZY A;  1L2P A;  3C8V A;  3CWB G;  5APV A;  1LTG C;  1T2K C;  1X79 B;  1R5L A;  2QJP C;  2Q5U A;  3G3Z A;  1E5W A;  1QLE D;  1JO5 A;  2M8R A;  4H13 B;  1RF1 A;  2N1T B;  4I7Z C;  1G1I A;  5APQ A;  3L71 G;  3OJA B;  3CXH E;  3JSV C;  2QA4 P;  1O7W A;  2W6A A;  3NTN A;  3KZI H;  5AW7 B;  1K04 A;  3E1R A;  4A7P A;  3H1J D;  2ZXX A;  3EWK A;  2OGU A;  2OTJ P;  1FDM A;  1N7S C;  2BEQ D;  1NU1 D;  2HR3 A;  4XA4 A;  4GOD A;  5GTH H;  1EDK A;  1PGQ A;  3RGU A;  1JY2 P;  3M06 A;  3GL0 A;  2E75 D;  4NBH D;  3H1L J;  1ZRT E;  2HMO A;  3FGA D;  3LW5 J;  1VF5 B;  2OYH B;  3L73 D;  4H0L D;  4UB6 H;  5AEU A;  3JCU H;  1Z56 A;  1SQQ G;  1L0N G;  2GUV A;  1NTM G;  1YYC A;  2M0B A;  2NVE A;  2XZR A;  3RK3 D;  3VMI D;  2ZJS E;  4HM7 A;  1IO4 A;  1Y9B A;  3KXD A;  1N73 A;  4AUW A;  1M1K Q;  2H7H A;  1OFC X;  3L72 G;  1FDO A;  1Y8A A;  3IN6 A;  1RE3 C;  2AXC A;  2ZYD A;  3T97 B;  1SQP G;  2W90 A;  1URQ C;  2Y9Z A;  1VQ4 P;  5APY A;  3EFG A;  1VQP P;  1P84 I;  2YFL A;  1JMM A;  3GLM A;  4TT3 H;  1A02 J;  1M1J C;  3BCC G;  1FZF A;  5KJ7 C;  2WSE H;  2K9J A;  2ZVO B;  1SFC B;  4LC1 A;  1HUC A;  3SWK A;  1WRG A;  1RE4 C;  1T3U A;  2IBZ D;  3VN0 A;  2HYN A;  2Y0E A;  1GL2 D;  3AED C;  2C0W A;  2KOG A;  3CMA P;  3HUS B;  3SWY A;  2UWJ E;  2Z5H A;  5CBO A;  1NOH A;  4W7Y A;  1BE3 G;  3A0H H;  2KS1 A;  5APU A;  3U59 A;  3H1K D;  3CL3 D;  1G2C B;  3MZW B;  2IPP A;  2O1K A;  3CWB E;  1DIP A;  4H44 D;  2OTK E;  1PPJ D;  4EYY Q;  5AVS B;  2K1A A;  4NBA D;  1ULJ A;  3W67 A;  4PD4 H;  1UUV A;  3L71 E;  3KHU A;  1LT9 A;  4HKZ H;  3L71 J;  1JOC A;  2G3A A;  1YBK A;  1PIX A;  5KLV D;  5AVY B;  1Q90 D;  3D6Z A;  1KMI Z;  4OGQ C;  1K73 Q;  4NBD D;  2Q1K A;  1DEB A;  2GM4 A;  2V4H A;  1J2J B;  1KIL A;  3H6P A;  5L8R J;  1SQQ E;  1L0N E;  4WY4 D;  3AEG C;  1SQV G;  1T8Z A;  3GF7 A;  1L0N J;  3Q2Y A;  3H1I G;  4C7R A;  1NTM J;  2IBZ I;  3OA7 A;  1QVG O;  1LJ2 A;  4L74 A;  2QJK C;  2OQQ A;  2AEM A;  3EQQ A;  5AVR B;  3RL0 C;  3L72 E;  1HGV A;  1GL2 A;  1HWT C;  3L72 J;  3R2P A;  4OWF A;  2W27 A;  2H8P D;  3WUV A;  4W80 A;  2P1J A;  3VCA A;  2YO2 A;  3QH9 A;  1SQP E;  2JKV A;  3A5T A;  1MFT A;  1NAY A;  1SQP J;  3V2R A;  1BSN A;  4PD4 D;  4I7Z B;  1SQX G;  5BVZ A;  1NTZ K;  1DEE G;  4QDF A;  1EZV G;  2NPS D;  1YJW P;  1IFJ A;  2FYU D;  1KC8 Q;  5CCH C;  3BCC E;  2MKV A;  2KZI A;  1SJG A;  3TGU G;  3BCC J;  1KQL A;  3CCJ P;  4Y99 C;  2OYO A;  1N7S B;  2D2C D;  5TIS H;  3VP8 A;  1S5L E;  1KZU B;  2XSH A;  3B71 A;  2YXQ B;  3H1H G;  2KUB A;  2YKO A;  1OVV A;  2BCC G;  4HM8 A;  2Q3E A;  4I6M C;  4HM2 A;  4LLH A;  3O6Q A;  5AVX B;  5B5E E;  1NYK A;  1H0T A;  3WUT A;  1HTL C;  1BE3 E;  3TNU A;  3AE3 C;  2KLV A;  2OTL P;  1BE3 J;  4ZMD A;  3E7K A;  4HM5 A;  5CCG D;  4IL6 E;  1LWU A;  5K5G B;  3MD0 A;  1WQL A;  5AW9 B;  1S5L X;  1URQ B;  3HD7 D;  3AE5 C;  5EFW B;  1FAV A;  3BAS A;  1H8A A;  2V7Q J;  1LTJ B;  4JYC A;  3B5N D;  2FBW C;  1M1J B;  2HFE D;  1AV1 A;  4IFD K;  1MUU A;  1RH5 B;  1LGH B;  2E42 A;  2JDI H;  1FJK A;  3V5B A;  1OWA A;  3GKE A;  5AW2 B;  3AE1 C;  4PV1 C;  5KAF H;  4U3F E;  3V4W A;  3GW6 A;  1NTM K;  2WZ7 A;  1GDT A;  3IR9 A;  4GT1 A;  1GW3 A;  2LXC B;  1JY2 N;  1SQB G;  2KSE A;  4W7Z A;  1SQV E;  5AW6 B;  5KAI E;  3VMA A;  1ZR2 A;  4IL6 X;  3H1I E;  1SQV J;  4UB8 H;  3OW2 O;  3CX5 E;  2XKM A;  3L70 D;  2ZXE B;  2O01 J;  2KP8 A;  2BMO A;  1SQP K;  2ZFC A;  2A06 D;  3I56 P;  1OVU A;  3V4Q A;  3ABV C;  3FOU A;  1KOR A;  3H25 A;  3PRJ A;  1KN7 A;  2H89 C;  3V2P A;  3SWF A;  1VQ7 P;  4PJ0 E;  1SQX E;  1OX3 A;  2ITA A;  3BAT A;  1MV8 A;  1VM9 A;  1EZV E;  2HML A;  4HM1 A;  2YFJ A;  1SQX J;  4GOF A;  4H0L C;  1PGO A;  3C9I A;  2PAJ A;  1EQ7 A;  4NBB D;  1IJD B;  3TGU E;  1NHL A;  4HM6 A;  3RK3 C;  1K9M Q;  3TGU J;  1FZE A;  2H43 A;  3P7K A;  5E79 E;  3GCE A;  1NH4 A;  4ZKP A;  4HB1 A;  1P84 H;  3H1H E;  4GKG A;  5APS A;  1O7N A;  4YTP C;  3ZDM A;  3B5N A;  1DX7 A;  3H1H J;  2BCC E;  1G8J B;  1CW5 A;  2JR8 A;  3P32 A;  4LGD E;  2BCC J;  1RF0 A;  2GBW A;  1PGP A;  4WWI A;  2IX7 C;  2XU6 A;  3D70 A;  2QJK B;  1T3J A;  1AVO A;  4NPE A;  2AEF A;  4KJM A;  1KQS O;  1JB0 J;  1DD4 A;  2E43 A;  1NTK J;  3GHG A;  1SP4 A;  1USD A;  2W6J H;  5H2F E;  1RQU A;  4NB9 D;  4K3A A;  3L73 G;  1JTH A;  5KLI C;  1J1E C;  1VQL P;  1EDI A;  1CI6 B;  2J58 A;  3F5H A;  5CBN A;  3AE2 C;  2OYI C;  3CPW O;  1KFN A;  1WT6 A;  1G1J A;  4MN4 C;  1M56 D;  2Y9Y A;  3A0B H;  2O3J A;  4BRY A;  4Y99 B;  1T6A A;  3H1L D;  1KYO E;  1L4A D;  3RBZ A;  1P84 D;  1ZRT D;  2QSI A;  3NXS A;  3V6I A;  1SQB E;  1LTT C;  4H44 C;  3SFE C;  4RKU J;  2HPC A;  4Y28 J;  1YTZ I;  1USE A;  2R5B A;  3AE8 C;  4ZNC A;  3A3Y B;  1VL2 A;  3AE4 C;  2FY8 A;  1GU4 A;  1SVF A;  1JEK A;  1LP1 A;  3CD6 P;  1YIJ P;  4QUQ A;  1QL1 A;  3MUD C;  2R32 A;  3G71 P;  3M91 A;  1JNM A;  1OW8 A;  3AE9 C;  4NBC D;  4GDO A;  2WWW A;  1NGM B;  2N1T A;  4YXD C;  2IZ0 A;  3Q3D A;  2KXP B;  2JZA A;  2AEJ A;  4WY4 C;  2A45 G;  1KTM A;  1DD3 A;  1NTZ D;  2E74 D;  3H1K G;  2JO6 A;  3MTU E;  1EDJ A;  2Q3W A;  1CZQ A;  3P8C E;  4PV1 B;  1W5C E;  2CPS A;  3CC7 P;  3CXH I;  2POH A;  2XDJ A;  2NUK A;  3G6E P;  3RK2 D;  1NTK K;  2OYH A;  2WPR A;  2K9J B;  3PTZ A;  4JBZ A;  4DOJ A;  1RHZ B;  1LTJ C;  2KLU A;  1L4A A;  2RH0 A;  1KIL D;  3CCR P;  4L75 A;  1N7L A;  2DE5 D;  1FQT A;  1LTS C;  1FBM A;  2NPS C;  1JM0 A;  5APW A;  2HMN A;  1OW7 A;  3RL0 g;  1FZC A;  2CPB A;  1RFS A;  3L73 E;  2D2C C;  3FWL A;  4I2L C;  1BGY G;  2P58 A;  3HE5 B;  3L73 J;  3T97 A;  3C0D A;  3L71 D;  1JUN A;  2E75 B;  3RK3 E;  2KS1 B;  4H0L B;  2YXR B;  3M9H A;  4OVN F;  1YTZ T;  1ZW0 A;  1ZLL A;  4Z1M H;  3B8E B;  1S2E A;  1NO4 A;  5CJ4 A;  3RK3 B;  3VOP A;  2YIU B;  4NBG D;  1VQN P;  2HOD A;  5AVV B;  4EDF A;  1S5L H;  1SFC A;  2QIW A;  1MZ9 A;  3B4S A;  5CCG C;  2AXT E;  4R4M A;  1L0N D;  1XTG B;  3CWB J;  2GA1 A;  1NTM D;  1KD1 Q;  2KNC B;  1ZR4 A;  4AQR D;  5B5E H;  3HRN A;  2KYV A;  3CCM P;  3KZI E;  3CLQ A;  3HD7 C;  3IF4 A;  3HUS A;  1JY2 O;  2XNX A;  2WSF J;  4U7J A;  5GTH E;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 1VM9 A;  2NWF A;  2A06 E;  4QUR A;  1P84 E;  1EZV E;  2HML A;  4HJL A;  4HM1 A;  2YFJ A;  1KYO E;  2HMM A;  3CXH E;  2E4P A;  2B24 A;  5KKZ C;  1O7W A;  2I7F A;  2QJK C;  2E76 D;  4AIV A;  4NBB D;  4QUP A;  1SQB E;  3EQQ A;  3TGU E;  1WQL A;  1EG9 A;  2DE5 D;  1FQT A;  4HM6 A;  4EMJ B;  2YVJ B;  3L72 E;  3GZX A;  2QPZ A;  4QCK A;  3GL2 A;  2XRX A;  1VF5 D;  4QDC A;  3GCE A;  2HMN A;  2FYN C;  4NBE D;  2GBX A;  1NTK E;  2HMJ A;  3GL0 A;  2IBZ E;  3H1H E;  2E4Q A;  2E75 D;  3DQY A;  1RFS A;  4NBH D;  3GB4 A;  4P1B H;  3VCA A;  3L75 E;  3L73 E;  1ZRT E;  1O7H A;  2HMO A;  1O7N A;  4P1C H;  1SQP E;  1RIE A;  3H1K E;  4HM0 A;  2BCC E;  4H0L D;  4PD4 E;  1G8J B;  5AEU A;  3VMG D;  3GKE A;  3H1J E;  3GTE A;  1BCC E;  3C0D A;  5BOK A;  2BMR A;  3VCP A;  4U3F E;  1NU1 E;  3CWB E;  3EN1 A;  4QDF A;  2NVE A;  3GTS A;  2GBW A;  2YIU C;  1KB9 E;  3VMH D;  3VMI D;  1ULI A;  1O7G A;  4HM7 A;  1O7P A;  4H44 D;  3BCC E;  2XSO A;  1UUW A;  1SJG A;  4QUQ A;  1VCK A;  1O7M A;  1SQV E;  1G8K B;  4NBA D;  2DE7 D;  1ULJ A;  2NUM A;  4NBG D;  2D2C D;  1UUV A;  3L71 E;  4NBC D;  3H1I E;  2XR8 A;  2BMQ A;  4NB8 D;  4HM4 A;  2CKF A;  4NB9 D;  2XSH A;  2QJY C;  2JZA A;  1NTZ E;  1L0L E;  4PV1 D;  3CX5 E;  2FYU E;  3L74 E;  1JM1 A;  4HM3 A;  3L70 E;  4D6T E;  1NTM E;  2E74 D;  1PPJ E;  5AEW A;  3D89 A;  5CXM A;  2DE6 D;  2JO6 A;  3AZC A;  1Q90 C;  4HM8 A;  2YFI A;  2HMK A;  2Q3W A;  3GOB A;  4QDF B;  5KLI C;  2BMO A;  4HKV A;  1PP9 E;  1NDO A;  3GZY A;  4HM2 A;  2YFL A;  1NYK A;  4H13 D;  4NBD D;  3FOU A;  4QDD A;  4OGQ D;  2QJP C;  4NBF D;  1BE3 E;  2NVG A;  2NUK A;  2NVF A;  2ZT9 D;  3N0Q A;  1BGY E;  5HL4 A;  4AAY B;  5KLV E;  1SQQ E;  1L0N E;  3H1L E;  2B1X A;  1SQX E;  4HM5 A;  2ZYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...