1BE3E

Cytochrome bc1 complex from bovine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 40
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1be3E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1be3E02
4QDDA 4EMJB 4H44D 4H13D 2FYUE 3C0DA 1SQXE 1NYKA 2BMQA 1VF5D 3GKEA 3EQQA 1RFSA 1UUWA 4QDCA 4NBBD 3L70E 2IBZE 3GCEA 2HMNA 2E74D 3H1IE 1ULJA 1SQPE 4QDFA 2XRXA 3H1LE 2GBXA 2QPZA 2ZT9D 4QURA 2Q3WA 2XSOA 2CKFA 5AEWA 4NBGD 1KB9E 1EG9A 4D6TE 3AZCA 4HM8A 4HM1A 1NTZE 2JO6A 4NBHD 1O7WA 1BE3E 1RIEA 4NBAD 1O7NA 1O7PA 1SJGA 3DQYA 5BOKA 2DE7D 4HJLA 3GL0A 5KKZC 4QDFB 4HM5A 1Q90C 3D89A 4HM0A 4NB9D 3CXHE 3H1HE 1NU1E 3L75E 2E4PA 4NBED 2JZAA 1PP9E 2NUKA 2QJPC 2QJYC 2NVFA 3GOBA 3H1JE 1NTME 5AEUA 3H1KE 3L72E 2YFJA 1FQTA 4P1CH 4HM6A 4PV1D 5HL4A 3L71E 2HMJA 4HM3A 3GB4A 1JM1A 1BGYE 2HMOA 2A06E 1WQLA 1L0NE 1SQBE 3GL2A 4NBFD 2D2CD 2HMMA 2E76D 2HMLA 3GZYA 3GTSA 3L74E 2YIUC 3VMGD 2ZYLA 3FOUA 1ZRTE 2B1XA 1L0LE 4HM4A 4NBDD 4HM2A 3TGUE 3CX5E 4NBCD 3N0QA 2XSHA 4P1BH 1VCKA 2NUMA 1BCCE 1SQQE 4AAYB 1KYOE 3VMID 2I7FA 4H0LD 2DE6D 2NVEA 2E4QA 1O7MA 2B24A 5CXMA 5KLVE 2YFIA 2GBWA 4PD4E 1O7HA 1PPJE 1NDOA 1P84E 2YFLA 3VCPA 2QJKC 3VMHD 2E75D 2XR8A 3L73E 2NWFA 4QUQA 2HMKA 4HM7A 1O7GA 4QUPA 4OGQD 3EN1A 1G8KB 1UUVA 2NVGA 4QCKA 3BCCE 2YVJB 3GTEA 4NB8D 4HKVA 3GZXA 1SQVE 1G8JB 3VCAA 1EZVE 1ULIA 2BMRA 2BMOA 2FYNC 1VM9A 1NTKE 5KLIC 4U3FE 4AIVA 2BCCE 3CWBE 2DE5D
chains in the Genus database with same CATH superfamily
1VQKP 4I1LA 1GK6A 2XNXA 4AYCA 3BATA 1FDOA 1RQUA 3HD7D 1LTJB 2XDJA 2M8RA 3L70J 4RJTA 3MUDC 4L75A 2FYUG 1VQ7P 3HUSA 1A02F 4NBHD 1AA0A 1L0NK 2E5YA 1FS0E 2WPSA 4HJLA 3E7KA 2IZ0A 3TNUA 1LTSC 2PP6A 3RBXA 4LGDE 1E79H 2QJPC 2JZAA 1KB9D 3CWBJ 5AEUA 2HG5D 4WY4B 5CBNA 2ZYDA 3V2PA 1BGYE 3BCCJ 1EDJA 2WSEJ 3A2AA 1SQQG 1Y8AA 2A06G 1D7MA 3L4FA 3RL0g 2HYNA 4K3AA 3M0DA 2H88C 1NAYA 1H88A 1O7HA 3H1JG 1Q7YQ 1PV3A 1YI2P 4WBAA 1NU1D 1YJNP 3H1JJ 3SWFA 1X79B 3CI9A 3B71A 3W68A 1Q86Q 1T3UA 3BVHA 1M1JB 1SQVE 1G8JB 5AW5B 2QVAA 5AW6B 2ZJSE 2NPSA 4H44D 2O01H 1VPCA 2WITA 3NFQA 3ZDMA 1RHZB 2ZXXA 4NBBD 4TLFA 1KQSO 1KB9H 1KILB 1CI6A 1ZR2A 2N1TB 1N86A 1NTKG 1J2JB 1KMIZ 1T8ZA 2FFDC 3E1RA 3AE2C 1NTZE 4C7NA 5AVTB 2IBZD 2XV5A 1X9VA 1EZVG 3ITKA 1CW5A 5GTHH 5CMZA 1BSNA 2JP3A 5BU5A 2KZJA 2NPSD 3H1KE 1OIPA 1SP4A 3AE1C 4IOIH 4PV1D 2A45G 4EIJA 1BCCG 2K9JB 3GF7A 3CCJP 1HJBA 1OZHA 4H44C 4P1BH 1K9MQ 1G2CA 2Z5IA 1RH5B 2P1JA 1BE3D 1OW7A 3TDKA 4JPZB 2FYZA 3H1IJ 2YMKA 1NU1J 4JF7A 1T2KD 4D6TD 2P67A 4DJGA 4U3FD 3SSUA 4QUQA 3U1AA 3HRNA 2QJKB 1MZ9A 3KYQA 1EDLA 1UUVA 2RKLA 3RK3E 5GTHE 1WRGA 1RQVA 2FYNC 4KHXA 3V4QA 3GMAA 4YXDC 1BE3G 4W80A 4A7PA 1DX7A 4GODA 1FZCC 1UIIA 4QDCA 1RFSA 1IFJA 5KJ7A 1ZW0A 3P7KA 2Q3EA 2QE7H 3H1LE 1M1KQ 3I55P 1LTTC 5L8RJ 1T2KC 4NBGD 1KB9E 1JY2O 1LT1A 1XTCC 2P58A 5KKZB 1SJGA 1NO4A 2D2CB 1SQPK 5CCGD 1H89A 1FDIA 4NBED 3CCSP 2AXTH 1URQD 1ZR4A 2E76C 5AVSB 2YIUB 1NKNA 1WQLA 3CX5H 3TNUB 1KZUB 2RMZA 3N7NA 3MTUE 3SFEC 3GF3A 1SQBG 1BCCE 4N3YB 1K73Q 1LNQA 2E4QA 2HFED 3VTPC 2R32A 4MN4C 2HR3A 3RL0C 1AFOA 2V7QJ 1EZVI 1EXJA 5B66H 1VF5B 4UB8E 1VQ9P 2BCCJ 4HM7A 3USSA 1RE4A 2CPBA 4UB8H 1JCDA 1NTZG 3D71A 1L0ND 3FXEA 2BMRA 4IFMA 1BSHA 4AIVA 4LC1A 1T6AA 2BCCE 1ZMEC 3H1IG 3AE6C 4NPEA 3EQQA 3LIEA 3ABVC 4Y99B 2AXCA 3H1IE 3V6IA 2XRXA 4GIFA 1L4AA 3SFDC 5AEWA 3H1KD 5M1BA 5DJUB 3L75G 3WMM0 4I6MC 3H1LJ 2E5TA 1HGVA 1O7WA 2Y9ZA 4NBAD 1KQFB 2NPSC 1URQC 3CCVP 1QGKB 3WUTA 2M5AB 2NVFA 4YPCA 1SFCA 1GU5A 1NTMK 5GTIE 1OX3A 1PP9J 1SQBE 3RK2D 4WY4C 1HJ0A 4ASWA 3R2PA 2R44A 3TGUE 3N0QA 1Q90D 2IZ1A 3TGUG 1KFMA 4AAYB 4LLHA 4UB6H 4K35A 4W7ZA 5CXMA 2E42A 2YFIA 5E79E 3CPWO 1KFNA 1Y9BA 2YMYA 1YTZI 3KXDA 2XR8A 1DD3A 3PH0A 2BEZF 3A7OA 4OGQD 1USDA 1BE3J 1R8EA 1L0NJ 1N2DC 2OTKE 2YO2A 2BMOA 2J5UA 4C46A 1JTHB 1Y47A 1NTZD 2IBZE 2M3BA 1GTWA 2K37A 3L75J 1KD1Q 3CMEP 1L0LK 1KILC 2Q3WA 2CKFA 2FBWC 2IFNA 4N6JA 5KAFE 2R5BA 5CCGA 2B88A 4C7NB 1M56D 3DQYA 3G4SP 1IFIA 4NPDA 1EDIA 3RK2C 1RE4C 3A0BH 3QWOC 3L36A 3P32A 3GZYA 1SQPJ 2B89A 4HKZH 4NBDD 1W2BO 2K1AA 3V2RA 1KYOE 2NRGA 4H0LD 2Y0DA 4EDFA 2E74B 5KLVE 2OYHB 2NZ2A 3OA7A 1LWUC 2Q6QA 1NKZB 2QEXP 1VQ4P 2YFLA 5KLIB 5KLVJ 1NU1G 2Z4EA 2GM4A 4Y99C 3V4WA 1NWQA 3RL0D 1NTKE 5TISH 1YHQP 2K9YA 1CZQA 4QDDA 2IPPA 1JMMA 1LTGC 1DIPA 3B4SA 4QURA 2WSFJ 4HYTB 1PGPA 3H32B 4Z1MH 1NGMB 1FZEA 5DJTB 1SQBK 1S9KD 1BDDA 1JNMA 4HM5A 1FJKA 2LKMA 1LTJA 4PD4H 3L71J 1P84D 3AEBC 3VN0A 2ZVNB 2JR8A 1NVOA 2YKQA 3CCUP 3GL2A 2WSCJ 2HMLA 3L74E 1KV4A 4HM4A 1FZAA 2IYOA 1YJWP 3GW6A 2XSHA 5AW7B 4U3FJ 3P8MC 2GA1A 1JY3O 4RKUJ 1GL2D 3UIAA 2WZ7A 2BEQD 2LXBA 2LXCB 3V2QA 3VP8A 1FZCA 1X22A 5AW0B 1JCCA 1G2CB 3RL0B 3MP7B 4QUPA 2K9JA 3CCLP 1RF0A 2KLVA 3D6ZA 1NOHA 1PP9D 1NTMJ 3FWLA 3C8VA 3IFMA 3GHGA 1NTKJ 3GCEA 1IZNB 2HMNA 2E74D 3T97B 2C9LY 4I2LC 1M1JA 2ITAA 4D6TE 3AZCA 4IL6X 2N9BA 3F5HA 5AW1B 2QRXA 1YITP 3H1HD 2MKVA 1LGHB 1QVGO 2QG4A 2NPSB 1Z56A 3TGUD 1KYOD 5AVXB 5B5EE 1PIXA 5AVWB 5C39A 3KZIE 4NPFX 3L71E 2HMJA 3SWYA 4PJ0E 3IF4A 2M3EA 1JM1A 1MKMA 5AW9B 2WVRA 1IK7A 2ZYLA 1ZRTE 1OXZA 2LR2A 4NBCD 2E76B 1A02J 3VMID 1SQQK 5APTA 3GHGB 3MIWA 2GBWA 2OGUA 3WU2H 5AVQB 1BGYG 1NTKD 4DCKA 1PPJE 4XE5B 1PGJA 3L72G 3VCPA 1HWTC 2OYOA 5AVZB 3L73E 1FBMA 3Q5SA 2IYPA 5BVZA 1H8AA 4NB8D 3A0HE 3BCCD 1K8AQ 1FJPA 4KJMA 4PV1C 2I7FA 2C0WA 1MFTA 1SVFA 2ZXEB 1N73B 4ASVA 1J1DC 1HH0A 3G6EP 3RBZA 2A06D 2KXPB 1SQPE 1EQ7A 5KAIE 2L91A 2QM8A 3B5NA 3NXSA 2AEFA 2JJLA 3L73G 5BOKA 2RN0A 2QJPB 3BRTB 1DEEG 3L72J 1PPJG 2Q1KA 2E4PA 3F89A 1OW8A 1BGYJ 5AW3B 1RE3A 2B87B 1HF9A 4P1CH 4CPGA 1NAFA 2KSJA 2W8ZA 1NU1K 3CC2P 3VMGD 1S5LH 2CK3H 4N78D 1GL2A 1SQVJ 4DZOA 1S5LX 1RF0C 1OVRA 3U59A 1GZLA 4WB4A 2PRRA 2NUMA 1GDTA 1L4AC 1SQQD 2IX7C 2B24A 1IK9A 1JY2P 1OW6A 1OVVA 3CXHI 2DW3A 2N1TA 1VQMP 3CCEP 3Q1MA 3WUVA 1NDOA 2I1KA 2WTYA 1M1JC 3V2NA 3VMXA 1HGZA 2OYIB 1SQBD 5CJ4A 1SLQA 3AEDC 1UIXA 2KP8A 1EZVE 1M90Q 3A5TA 3JCUH 1VM9A 1OWAA 1JUNA 2DE5D 2P7JA 2YKPA 3C0DA 3EFFK 1SQXE 3TK1A 1R5LA 1GW4A 4IL6E 1G1IA 2WWWA 1IO4A 1YIJP 1FOSF 2FFDB 1YBKA 4XFJA 2XSOA 5APXA 2OQQA 1EC5A 3L73J 3BCCG 2P10A 3WUUA 1KYOI 1MV8A 3G71P 2DE7D 2YXQB 1SQVK 3H1KJ 3D89A 2JWDA 4WVZA 2AEMA 3L74D 1DEBA 5AVRB 3L72E 2JEEA 2B87A 1LTAC 3M9QA 2KIKA 1Q2NA 4U7JA 2HMMA 1RF1C 1PPJD 2C0XA 3GG2A 4H44B 1L0LG 1GL2B 3CLQA 3NTNA 3L73D 1GK4A 3N4XA 2WT7A 1EXIA 5CCHD 1NTMG 4JYBA 3PTZA 1M7LA 5H2FH 3AE3C 4PV1B 1HTLC 5TJHA 3HUSC 2KSEA 3EQ2A 2NWFA 4IFFA 1HVVA 1K04A 2ZFCA 1LWUB 1SQPD 1SQBJ 3WU2E 3GZXA 1FU1A 4BWNA 5KLIC 2IDBA 2FYUE 3II6A 1MUUA 1UUWA 1JOCA 5KLVK 5CCHA 1E5WA 1KTMA 1AQ5A 4WY4D 4PD4I 2I8DA 4H13C 4PJ0H 1QX8A 3P8CD 1AVYA 1M8OB 5B5EH 2D2CC 3CCRP 2KLUA 4HM1A 2JO6A 1SQQJ 1RIEA 2J59M 2FXOA 1O7PA 1FDMA 3RK3C 5H2FE 3CC7P 1YTZT 4QDFB 2Q5UA 4HM0A 1OVUA 1NTZJ 2PAJA 1PL5A 1ZRTD 2ZYAA 3KPEA 3CL3D 1FQTA 3VMAA 3CC4P 4HM3A 1P84H 3GB4A 3HE4B 2HMOA 4OVNF 4BRYB 2E76D 1BGYD 2HODB 4Y28J 1FC2C 3L35A 5APUA 4GDOA 2AEJA 3MGNA 3CD6P 1S4XA 3H1JD 2PFXA 1JY3P 5AW2B 3L74G 3KHUA 1S9KE 5KJ7D 2OYIC 2WPVB 1PP9G 1RY3A 3Q2YA 3EWKA 3I56P 1P84E 1FZGA 1N8RQ 1SQXD 3VMHD 3PRJA 1U57A 2V7QH 1VQ5P 1KORA 3K5BA 1NH4A 3EN1A 2HPCA 2O1JA 3MHVA 1K05A 1SQVD 2BCCD 3A3YB 2ZAEB 1AQTA 1IFNA 2PGDA 2C9NY 1N7SC 1N73C 3B5NC 1JMBA 1ULJA 3CMAP 2GBXA 2JO1A 5AW4B 1VQLP 1IFDA 3L72D 1EG9A 3HD7A 2FYUK 2QA4P 1JY3N 2A45H 4BXLA 3CXHH 3U1CA 1PP9E 2NUKA 4N78E 2KS1B 2HPCB 2ZT9C 2BASA 3TGUJ 2QIWA 2JDIH 3AEEC 2KNCA 4HJGH 2B1XA 3V5BA 2M5AA 2WSEH 4L76A 1FOSE 3HD7C 4ZKPA 1SQXJ 1VCKA 3IR9A 1YYCA 5CHXA 1HBWA 3LIDA 2YNYA 3Q5PA 3Q5RA 3MZWB 4O9BA 3S4RA 4TT3H 1T3JA 1PZQA 1BCCJ 1USEA 1LTIC 2IFMA 1CSBA 3AE7C 3SWKA 2OARA 3QH9A 3CCMP 4GOEA 1GD2E 5KAIH 2V4HA 1ZLLA 2HODA 2XZRA 4WWIA 2W6AA 3CWBE 1LT9A 4D6TG 4H13D 3FWNA 1Q82Q 3OAKA 1KC8Q 2POHA 2VRSA 1LWUA 2KK7A 4L73A 2FFDA 1S3JA 3CWBG 4QDFA 2BCCG 2R5DA 2JKVA 1Q81Q 2ZT9D 3A0HH 4IL6H 3AEFC 4ZNCA 5BU8B 2YXRB 2WSCH 1SFCB 1J1EC 1KILD 1NJIQ 5KKZC 4NB9D 3CXHE 4EI2A 2KOGA 3GOBA 3H1JE 1NTME 1L0LJ 1SS1A 2FXPA 3AEAC 2Q3IA 4HM6A 2L5GB 2A06E 1IFPA 4NBFD 4I7ZC 3KQGA 2YIUC 1L0LE 4EOTA 3M9BA 5AVUB 5K5GB 4HM2A 4XA4A 3M06A 1ZXGA 2E74C 4B86A 2OYHC 5AVYB 1KILA 2E43A 1BCCD 1O7MA 2IBZI 4M3LA 1H0TA 1M57D 2CPSA 1S5LE 4H0LC 2XU6A 3LW5J 3OJAB 1KN7A 1YJ9P 2G8YA 4ZMDA 5AVVB 1W5CE 2FYUD 1X8YA 3EFGA 1GU4A 3L37A 4QCKA 2O01N 1ZN5A 2W27A 1AVOA 2OTLP 4HKVA 5E79H 1JB0J 1LTJC 1S72P 3CX5I 3L75E 3P8CE 5APSA 2FKWB 2BMQA 2OYIA 1FAVA 1MFZA 4R4MA 2O3JA 2E75C 2QPZA 1L2PA 1VQ8P 4GKGA 2W6BA 2KZIA 3L74J 3PJSK 1WMKA 3D70A 1FE6A 3MD0A 1N73A 2KS1A 2MJZA 2FXMA 2YKOA 1LTBC 2I1JA 2ZT9B 3H25A 4L74A 1NU1E 1EZVD 3RK3B 1URQB 3AE4C 4JYCA 3H32A 1H0TB 1LT9B 4JQ0D 2Y9YA 1LP1B 1GMJA 3NMDA 3O6QB 1QVFO 2KUBA 5KLVG 4RO0A 1G1JA 2ZYGA 1ZP0C 2Y0EA 4C7RA 3HE5B 5CCHC 4PD4E 1GL2C 2WPRA 2QM7A 5KTBA 2E75D 1JM0A 3FX0A 1O7GA 2J58A 2A45I 3C9IA 3M0AA 3OW2O 3G3ZA 1W2EA 1X0TA 1KQLA 1SQPG 3HUSB 4KT0J 1KILE 3E1IA 1KB9I 4OWFA 3GKEA 2GUSA 2WSFH 1IJDB 3L70G 3PP5A 4OGQC 2O1KA 2Q7CA 2XKMA 4D6TJ 2IBZG 3C1LA 3HTKA 5AW8B 2Y0CA 3Q3DA 2UWJE 3AECC 1NYHA 2K88A 2WT7B 2AXTE 1BE3E 3IAOA 3RGUA 1O7NA 3L70D 3B8EB 1YQ3C 4H13B 3GL0A 5EFWB 3TYYA 3AE5C 3BASA 1P84I 2YFJA 2KYVA 3L71D 1S2EA 5HL4A 1FZBA 1IFMA 4HB1A 3RK2B 4DT0A 2D2CD 2YO3A 3S1KA 1AJYA 3FOUA 1KQGB 2QJYB 4QMAA 4H0LB 2H8PD 2WMMA 4EYYQ 1L0NG 2QSIA 2N1TD 3L71G 2DE6D 2NVEA 4ZKUA 2OYHA 3HE5A 2WPQA 5KLVD 3HTKB 3JCUE 1VQNP 2KI7B 3L75D 4R4LA 2FYNB 3CX5D 3PLNA 1N7LA 3MUDA 4BRYA 2NVGA 3BCCE 1HUCA 1J1DB 2E75B 3VMZA 3CCQP 1PGQA 1URQA 1VQ6P 4W7YA 4DOJA 2N9YB 2N1TC 4HH2A 3KDPB 4AQRD 3GLMA 3B5ND 1SQXG 2SPZA 1XTGB 3H6PA 4GT1A 1QEXA 1YQ4C 3G9RA 1GW3A 4AUWA 3CXHD 3M91A 4HM8A 1N7SB 1JO5A 3B5NB 5TISE 1SQVG 1CI6B 1J1EB 5CCGC 3TSIA 1Q90C 3O6QA 3M0DC 4IFDK 1JTHA 1JEKA 1L0LD 2JWAA 5APVA 2ZVOB 3LW5H 3M9HA 2G3AA 1PFIA 1L0NE 1QLED 4OH8B 3I5CA 1L4AB 1JY2N 2K3RA 1KYOH 2WQYC 1BDCA 1SQQE 2XNDH 5GTIH 3HE4A 1VF5C 5APYA 1VQPP 3H1ID 1NHLA 1LJ2A 2W90A 1L4AD 3VP9A 1AV1A 1U7MA 3HD7B 3AEGC 1ZOYC 3VOPA 1RF1A 2QJKC 2R3CA 3A0BE 2H7HA 2FY8A 5APQA 2B9BA 4YTPC 1QL2A 1RE3C 1G8KB 4OGQB 3TF5A 3VCAA 1ULIA 1FZCB 1IC2A 4U3FE 3FGAD 4WY4A 1SFCD 4EMJB 1NYKA 3JSVC 1VF5D 5KAFH 3FXDA 3L70E 3BRVB 3H1LG 2M0BA 1ZV8A 3RK3D 3T97A 1TU3F 2Q9IA 4U3FG 1EDKA 1VDFA 1VQOP 1PGOA 1FZFA 3H1HJ 3AE8C 2HLOA 5KJ7C 1N7SA 3KZIH 2RH0A 5B66E 3O8ZA 2Z5HA 3H1LD 3IN6A 3H1HE 1QL1A 2QJYC 3VYIA 1SFCC 4YXWH 2R3SA 3CWBD 3PHLA 2OTJP 5CBOA 1SQXK 4JBZA 1RF1B 1NTZK 3S9OA 1DD4A 1LP1A 2P2UA 5CJ0A 1WT6A 2GUVA 1LT9C 3GTSA 3AE9C 4PD4D 2W83C 1S1CX 3W67A 2H89C 3CX5E 4UB6E 1OMIA 2H43A 1OFCX 1N7SD 2FYUJ 4I7ZB 5APWA 2WSSH 3GHGC 2W6JH 1R5SA 3H1KG 2KB7P 1NTMD 4RESB 3VMYA 1DH3A 3R4YA 1U7JA 2HMKA 3H1HG 3JC22 1VL2A 3D6YA 4GOFA 2YVJB 3GTEA 2KNCB 2O01J 1NTKK
chains in the Genus database with same CATH topology
4QDDA 4EMJB 4H44D 4H13D 2FYUE 3C0DA 1SQXE 1NYKA 2BMQA 1VF5D 3GKEA 3EQQA 1RFSA 1UUWA 4QDCA 4NBBD 3L70E 2IBZE 3GCEA 2HMNA 2E74D 3H1IE 1ULJA 1SQPE 4QDFA 2XRXA 3H1LE 2GBXA 2QPZA 2ZT9D 4QURA 2Q3WA 2XSOA 2CKFA 5AEWA 4NBGD 1KB9E 1EG9A 4D6TE 3AZCA 4HM8A 4HM1A 1NTZE 2JO6A 4NBHD 1O7WA 1BE3E 1RIEA 4NBAD 1O7NA 1O7PA 1SJGA 3DQYA 5BOKA 2DE7D 4HJLA 3GL0A 5KKZC 4QDFB 4HM5A 1Q90C 3D89A 4HM0A 4NB9D 3CXHE 3H1HE 1NU1E 3L75E 2E4PA 4NBED 2JZAA 1PP9E 2NUKA 2QJPC 2QJYC 2NVFA 3GOBA 3H1JE 1NTME 5AEUA 3H1KE 3L72E 2YFJA 1FQTA 4P1CH 4HM6A 4PV1D 5HL4A 3L71E 2HMJA 4HM3A 3GB4A 1JM1A 1BGYE 2HMOA 2A06E 1WQLA 1L0NE 1SQBE 3GL2A 4NBFD 2D2CD 2HMMA 2E76D 2HMLA 3GZYA 3GTSA 3L74E 2YIUC 3VMGD 2ZYLA 3FOUA 1ZRTE 2B1XA 1L0LE 4HM4A 4NBDD 4HM2A 3TGUE 3CX5E 4NBCD 3N0QA 2XSHA 4P1BH 1VCKA 2NUMA 1BCCE 1SQQE 4AAYB 1KYOE 3VMID 2I7FA 4H0LD 2DE6D 2NVEA 2E4QA 1O7MA 2B24A 5CXMA 5KLVE 2YFIA 2GBWA 4PD4E 1O7HA 1PPJE 1NDOA 1P84E 2YFLA 3VCPA 2QJKC 3VMHD 2E75D 2XR8A 3L73E 2NWFA 4QUQA 2HMKA 4HM7A 1O7GA 4QUPA 4OGQD 3EN1A 1G8KB 1UUVA 2NVGA 4QCKA 3BCCE 2YVJB 3GTEA 4NB8D 4HKVA 3GZXA 1SQVE 1G8JB 3VCAA 1EZVE 1ULIA 2BMRA 2BMOA 2FYNC 1VM9A 1NTKE 5KLIC 4U3FE 4AIVA 2BCCE 3CWBE 2DE5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QDD A;  4EMJ B;  4H44 D;  4H13 D;  2FYU E;  3C0D A;  1SQX E;  1NYK A;  2BMQ A;  1VF5 D;  3GKE A;  3EQQ A;  1RFS A;  1UUW A;  4QDC A;  4NBB D;  3L70 E;  2IBZ E;  3GCE A;  2HMN A;  2E74 D;  3H1I E;  1ULJ A;  1SQP E;  4QDF A;  2XRX A;  3H1L E;  2GBX A;  2QPZ A;  2ZT9 D;  4QUR A;  2Q3W A;  2XSO A;  2CKF A;  5AEW A;  4NBG D;  1KB9 E;  1EG9 A;  4D6T E;  3AZC A;  4HM8 A;  4HM1 A;  1NTZ E;  2JO6 A;  4NBH D;  1O7W A;  1BE3 E;  1RIE A;  4NBA D;  1O7N A;  1O7P A;  1SJG A;  3DQY A;  5BOK A;  2DE7 D;  4HJL A;  3GL0 A;  5KKZ C;  4QDF B;  4HM5 A;  1Q90 C;  3D89 A;  4HM0 A;  4NB9 D;  3CXH E;  3H1H E;  1NU1 E;  3L75 E;  2E4P A;  4NBE D;  2JZA A;  1PP9 E;  2NUK A;  2QJP C;  2QJY C;  2NVF A;  3GOB A;  3H1J E;  1NTM E;  5AEU A;  3H1K E;  3L72 E;  2YFJ A;  1FQT A;  4P1C H;  4HM6 A;  4PV1 D;  5HL4 A;  3L71 E;  2HMJ A;  4HM3 A;  3GB4 A;  1JM1 A;  1BGY E;  2HMO A;  2A06 E;  1WQL A;  1L0N E;  1SQB E;  3GL2 A;  4NBF D;  2D2C D;  2HMM A;  2E76 D;  2HML A;  3GZY A;  3GTS A;  3L74 E;  2YIU C;  3VMG D;  2ZYL A;  3FOU A;  1ZRT E;  2B1X A;  1L0L E;  4HM4 A;  4NBD D;  4HM2 A;  3TGU E;  3CX5 E;  4NBC D;  3N0Q A;  2XSH A;  4P1B H;  1VCK A;  2NUM A;  1BCC E;  1SQQ E;  4AAY B;  1KYO E;  3VMI D;  2I7F A;  4H0L D;  2DE6 D;  2NVE A;  2E4Q A;  1O7M A;  2B24 A;  5CXM A;  5KLV E;  2YFI A;  2GBW A;  4PD4 E;  1O7H A;  1PPJ E;  1NDO A;  1P84 E;  2YFL A;  3VCP A;  2QJK C;  3VMH D;  2E75 D;  2XR8 A;  3L73 E;  2NWF A;  4QUQ A;  2HMK A;  4HM7 A;  1O7G A;  4QUP A;  4OGQ D;  3EN1 A;  1G8K B;  1UUV A;  2NVG A;  4QCK A;  3BCC E;  2YVJ B;  3GTE A;  4NB8 D;  4HKV A;  3GZX A;  1SQV E;  1G8J B;  3VCA A;  1EZV E;  1ULI A;  2BMR A;  2BMO A;  2FYN C;  1VM9 A;  1NTK E;  5KLI C;  4U3F E;  4AIV A;  2BCC E;  3CWB E;  2DE5 D; 
#chains in the Genus database with same CATH topology
 1VQK P;  4I1L A;  1GK6 A;  2XNX A;  4AYC A;  3BAT A;  1FDO A;  1RQU A;  3HD7 D;  1LTJ B;  2XDJ A;  2M8R A;  3L70 J;  4RJT A;  3MUD C;  4L75 A;  2FYU G;  1VQ7 P;  3HUS A;  1A02 F;  4NBH D;  1AA0 A;  1L0N K;  2E5Y A;  1FS0 E;  2WPS A;  4HJL A;  3E7K A;  2IZ0 A;  3TNU A;  1LTS C;  2PP6 A;  3RBX A;  4LGD E;  1E79 H;  2QJP C;  2JZA A;  1KB9 D;  3CWB J;  5AEU A;  2HG5 D;  4WY4 B;  5CBN A;  2ZYD A;  3V2P A;  1BGY E;  3BCC J;  1EDJ A;  2WSE J;  3A2A A;  1SQQ G;  1Y8A A;  2A06 G;  1D7M A;  3L4F A;  3RL0 g;  2HYN A;  4K3A A;  3M0D A;  2H88 C;  1NAY A;  1H88 A;  1O7H A;  3H1J G;  1Q7Y Q;  1PV3 A;  1YI2 P;  4WBA A;  1NU1 D;  1YJN P;  3H1J J;  3SWF A;  1X79 B;  3CI9 A;  3B71 A;  3W68 A;  1Q86 Q;  1T3U A;  3BVH A;  1M1J B;  1SQV E;  1G8J B;  5AW5 B;  2QVA A;  5AW6 B;  2ZJS E;  2NPS A;  4H44 D;  2O01 H;  1VPC A;  2WIT A;  3NFQ A;  3ZDM A;  1RHZ B;  2ZXX A;  4NBB D;  4TLF A;  1KQS O;  1KB9 H;  1KIL B;  1CI6 A;  1ZR2 A;  2N1T B;  1N86 A;  1NTK G;  1J2J B;  1KMI Z;  1T8Z A;  2FFD C;  3E1R A;  3AE2 C;  1NTZ E;  4C7N A;  5AVT B;  2IBZ D;  2XV5 A;  1X9V A;  1EZV G;  3ITK A;  1CW5 A;  5GTH H;  5CMZ A;  1BSN A;  2JP3 A;  5BU5 A;  2KZJ A;  2NPS D;  3H1K E;  1OIP A;  1SP4 A;  3AE1 C;  4IOI H;  4PV1 D;  2A45 G;  4EIJ A;  1BCC G;  2K9J B;  3GF7 A;  3CCJ P;  1HJB A;  1OZH A;  4H44 C;  4P1B H;  1K9M Q;  1G2C A;  2Z5I A;  1RH5 B;  2P1J A;  1BE3 D;  1OW7 A;  3TDK A;  4JPZ B;  2FYZ A;  3H1I J;  2YMK A;  1NU1 J;  4JF7 A;  1T2K D;  4D6T D;  2P67 A;  4DJG A;  4U3F D;  3SSU A;  4QUQ A;  3U1A A;  3HRN A;  2QJK B;  1MZ9 A;  3KYQ A;  1EDL A;  1UUV A;  2RKL A;  3RK3 E;  5GTH E;  1WRG A;  1RQV A;  2FYN C;  4KHX A;  3V4Q A;  3GMA A;  4YXD C;  1BE3 G;  4W80 A;  4A7P A;  1DX7 A;  4GOD A;  1FZC C;  1UII A;  4QDC A;  1RFS A;  1IFJ A;  5KJ7 A;  1ZW0 A;  3P7K A;  2Q3E A;  2QE7 H;  3H1L E;  1M1K Q;  3I55 P;  1LTT C;  5L8R J;  1T2K C;  4NBG D;  1KB9 E;  1JY2 O;  1LT1 A;  1XTC C;  2P58 A;  5KKZ B;  1SJG A;  1NO4 A;  2D2C B;  1SQP K;  5CCG D;  1H89 A;  1FDI A;  4NBE D;  3CCS P;  2AXT H;  1URQ D;  1ZR4 A;  2E76 C;  5AVS B;  2YIU B;  1NKN A;  1WQL A;  3CX5 H;  3TNU B;  1KZU B;  2RMZ A;  3N7N A;  3MTU E;  3SFE C;  3GF3 A;  1SQB G;  1BCC E;  4N3Y B;  1K73 Q;  1LNQ A;  2E4Q A;  2HFE D;  3VTP C;  2R32 A;  4MN4 C;  2HR3 A;  3RL0 C;  1AFO A;  2V7Q J;  1EZV I;  1EXJ A;  5B66 H;  1VF5 B;  4UB8 E;  1VQ9 P;  2BCC J;  4HM7 A;  3USS A;  1RE4 A;  2CPB A;  4UB8 H;  1JCD A;  1NTZ G;  3D71 A;  1L0N D;  3FXE A;  2BMR A;  4IFM A;  1BSH A;  4AIV A;  4LC1 A;  1T6A A;  2BCC E;  1ZME C;  3H1I G;  3AE6 C;  4NPE A;  3EQQ A;  3LIE A;  3ABV C;  4Y99 B;  2AXC A;  3H1I E;  3V6I A;  2XRX A;  4GIF A;  1L4A A;  3SFD C;  5AEW A;  3H1K D;  5M1B A;  5DJU B;  3L75 G;  3WMM 0;  4I6M C;  3H1L J;  2E5T A;  1HGV A;  1O7W A;  2Y9Z A;  4NBA D;  1KQF B;  2NPS C;  1URQ C;  3CCV P;  1QGK B;  3WUT A;  2M5A B;  2NVF A;  4YPC A;  1SFC A;  1GU5 A;  1NTM K;  5GTI E;  1OX3 A;  1PP9 J;  1SQB E;  3RK2 D;  4WY4 C;  1HJ0 A;  4ASW A;  3R2P A;  2R44 A;  3TGU E;  3N0Q A;  1Q90 D;  2IZ1 A;  3TGU G;  1KFM A;  4AAY B;  4LLH A;  4UB6 H;  4K35 A;  4W7Z A;  5CXM A;  2E42 A;  2YFI A;  5E79 E;  3CPW O;  1KFN A;  1Y9B A;  2YMY A;  1YTZ I;  3KXD A;  2XR8 A;  1DD3 A;  3PH0 A;  2BEZ F;  3A7O A;  4OGQ D;  1USD A;  1BE3 J;  1R8E A;  1L0N J;  1N2D C;  2OTK E;  2YO2 A;  2BMO A;  2J5U A;  4C46 A;  1JTH B;  1Y47 A;  1NTZ D;  2IBZ E;  2M3B A;  1GTW A;  2K37 A;  3L75 J;  1KD1 Q;  3CME P;  1L0L K;  1KIL C;  2Q3W A;  2CKF A;  2FBW C;  2IFN A;  4N6J A;  5KAF E;  2R5B A;  5CCG A;  2B88 A;  4C7N B;  1M56 D;  3DQY A;  3G4S P;  1IFI A;  4NPD A;  1EDI A;  3RK2 C;  1RE4 C;  3A0B H;  3QWO C;  3L36 A;  3P32 A;  3GZY A;  1SQP J;  2B89 A;  4HKZ H;  4NBD D;  1W2B O;  2K1A A;  3V2R A;  1KYO E;  2NRG A;  4H0L D;  2Y0D A;  4EDF A;  2E74 B;  5KLV E;  2OYH B;  2NZ2 A;  3OA7 A;  1LWU C;  2Q6Q A;  1NKZ B;  2QEX P;  1VQ4 P;  2YFL A;  5KLI B;  5KLV J;  1NU1 G;  2Z4E A;  2GM4 A;  4Y99 C;  3V4W A;  1NWQ A;  3RL0 D;  1NTK E;  5TIS H;  1YHQ P;  2K9Y A;  1CZQ A;  4QDD A;  2IPP A;  1JMM A;  1LTG C;  1DIP A;  3B4S A;  4QUR A;  2WSF J;  4HYT B;  1PGP A;  3H32 B;  4Z1M H;  1NGM B;  1FZE A;  5DJT B;  1SQB K;  1S9K D;  1BDD A;  1JNM A;  4HM5 A;  1FJK A;  2LKM A;  1LTJ A;  4PD4 H;  3L71 J;  1P84 D;  3AEB C;  3VN0 A;  2ZVN B;  2JR8 A;  1NVO A;  2YKQ A;  3CCU P;  3GL2 A;  2WSC J;  2HML A;  3L74 E;  1KV4 A;  4HM4 A;  1FZA A;  2IYO A;  1YJW P;  3GW6 A;  2XSH A;  5AW7 B;  4U3F J;  3P8M C;  2GA1 A;  1JY3 O;  4RKU J;  1GL2 D;  3UIA A;  2WZ7 A;  2BEQ D;  2LXB A;  2LXC B;  3V2Q A;  3VP8 A;  1FZC A;  1X22 A;  5AW0 B;  1JCC A;  1G2C B;  3RL0 B;  3MP7 B;  4QUP A;  2K9J A;  3CCL P;  1RF0 A;  2KLV A;  3D6Z A;  1NOH A;  1PP9 D;  1NTM J;  3FWL A;  3C8V A;  3IFM A;  3GHG A;  1NTK J;  3GCE A;  1IZN B;  2HMN A;  2E74 D;  3T97 B;  2C9L Y;  4I2L C;  1M1J A;  2ITA A;  4D6T E;  3AZC A;  4IL6 X;  2N9B A;  3F5H A;  5AW1 B;  2QRX A;  1YIT P;  3H1H D;  2MKV A;  1LGH B;  1QVG O;  2QG4 A;  2NPS B;  1Z56 A;  3TGU D;  1KYO D;  5AVX B;  5B5E E;  1PIX A;  5AVW B;  5C39 A;  3KZI E;  4NPF X;  3L71 E;  2HMJ A;  3SWY A;  4PJ0 E;  3IF4 A;  2M3E A;  1JM1 A;  1MKM A;  5AW9 B;  2WVR A;  1IK7 A;  2ZYL A;  1ZRT E;  1OXZ A;  2LR2 A;  4NBC D;  2E76 B;  1A02 J;  3VMI D;  1SQQ K;  5APT A;  3GHG B;  3MIW A;  2GBW A;  2OGU A;  3WU2 H;  5AVQ B;  1BGY G;  1NTK D;  4DCK A;  1PPJ E;  4XE5 B;  1PGJ A;  3L72 G;  3VCP A;  1HWT C;  2OYO A;  5AVZ B;  3L73 E;  1FBM A;  3Q5S A;  2IYP A;  5BVZ A;  1H8A A;  4NB8 D;  3A0H E;  3BCC D;  1K8A Q;  1FJP A;  4KJM A;  4PV1 C;  2I7F A;  2C0W A;  1MFT A;  1SVF A;  2ZXE B;  1N73 B;  4ASV A;  1J1D C;  1HH0 A;  3G6E P;  3RBZ A;  2A06 D;  2KXP B;  1SQP E;  1EQ7 A;  5KAI E;  2L91 A;  2QM8 A;  3B5N A;  3NXS A;  2AEF A;  2JJL A;  3L73 G;  5BOK A;  2RN0 A;  2QJP B;  3BRT B;  1DEE G;  3L72 J;  1PPJ G;  2Q1K A;  2E4P A;  3F89 A;  1OW8 A;  1BGY J;  5AW3 B;  1RE3 A;  2B87 B;  1HF9 A;  4P1C H;  4CPG A;  1NAF A;  2KSJ A;  2W8Z A;  1NU1 K;  3CC2 P;  3VMG D;  1S5L H;  2CK3 H;  4N78 D;  1GL2 A;  1SQV J;  4DZO A;  1S5L X;  1RF0 C;  1OVR A;  3U59 A;  1GZL A;  4WB4 A;  2PRR A;  2NUM A;  1GDT A;  1L4A C;  1SQQ D;  2IX7 C;  2B24 A;  1IK9 A;  1JY2 P;  1OW6 A;  1OVV A;  3CXH I;  2DW3 A;  2N1T A;  1VQM P;  3CCE P;  3Q1M A;  3WUV A;  1NDO A;  2I1K A;  2WTY A;  1M1J C;  3V2N A;  3VMX A;  1HGZ A;  2OYI B;  1SQB D;  5CJ4 A;  1SLQ A;  3AED C;  1UIX A;  2KP8 A;  1EZV E;  1M90 Q;  3A5T A;  3JCU H;  1VM9 A;  1OWA A;  1JUN A;  2DE5 D;  2P7J A;  2YKP A;  3C0D A;  3EFF K;  1SQX E;  3TK1 A;  1R5L A;  1GW4 A;  4IL6 E;  1G1I A;  2WWW A;  1IO4 A;  1YIJ P;  1FOS F;  2FFD B;  1YBK A;  4XFJ A;  2XSO A;  5APX A;  2OQQ A;  1EC5 A;  3L73 J;  3BCC G;  2P10 A;  3WUU A;  1KYO I;  1MV8 A;  3G71 P;  2DE7 D;  2YXQ B;  1SQV K;  3H1K J;  3D89 A;  2JWD A;  4WVZ A;  2AEM A;  3L74 D;  1DEB A;  5AVR B;  3L72 E;  2JEE A;  2B87 A;  1LTA C;  3M9Q A;  2KIK A;  1Q2N A;  4U7J A;  2HMM A;  1RF1 C;  1PPJ D;  2C0X A;  3GG2 A;  4H44 B;  1L0L G;  1GL2 B;  3CLQ A;  3NTN A;  3L73 D;  1GK4 A;  3N4X A;  2WT7 A;  1EXI A;  5CCH D;  1NTM G;  4JYB A;  3PTZ A;  1M7L A;  5H2F H;  3AE3 C;  4PV1 B;  1HTL C;  5TJH A;  3HUS C;  2KSE A;  3EQ2 A;  2NWF A;  4IFF A;  1HVV A;  1K04 A;  2ZFC A;  1LWU B;  1SQP D;  1SQB J;  3WU2 E;  3GZX A;  1FU1 A;  4BWN A;  5KLI C;  2IDB A;  2FYU E;  3II6 A;  1MUU A;  1UUW A;  1JOC A;  5KLV K;  5CCH A;  1E5W A;  1KTM A;  1AQ5 A;  4WY4 D;  4PD4 I;  2I8D A;  4H13 C;  4PJ0 H;  1QX8 A;  3P8C D;  1AVY A;  1M8O B;  5B5E H;  2D2C C;  3CCR P;  2KLU A;  4HM1 A;  2JO6 A;  1SQQ J;  1RIE A;  2J59 M;  2FXO A;  1O7P A;  1FDM A;  3RK3 C;  5H2F E;  3CC7 P;  1YTZ T;  4QDF B;  2Q5U A;  4HM0 A;  1OVU A;  1NTZ J;  2PAJ A;  1PL5 A;  1ZRT D;  2ZYA A;  3KPE A;  3CL3 D;  1FQT A;  3VMA A;  3CC4 P;  4HM3 A;  1P84 H;  3GB4 A;  3HE4 B;  2HMO A;  4OVN F;  4BRY B;  2E76 D;  1BGY D;  2HOD B;  4Y28 J;  1FC2 C;  3L35 A;  5APU A;  4GDO A;  2AEJ A;  3MGN A;  3CD6 P;  1S4X A;  3H1J D;  2PFX A;  1JY3 P;  5AW2 B;  3L74 G;  3KHU A;  1S9K E;  5KJ7 D;  2OYI C;  2WPV B;  1PP9 G;  1RY3 A;  3Q2Y A;  3EWK A;  3I56 P;  1P84 E;  1FZG A;  1N8R Q;  1SQX D;  3VMH D;  3PRJ A;  1U57 A;  2V7Q H;  1VQ5 P;  1KOR A;  3K5B A;  1NH4 A;  3EN1 A;  2HPC A;  2O1J A;  3MHV A;  1K05 A;  1SQV D;  2BCC D;  3A3Y B;  2ZAE B;  1AQT A;  1IFN A;  2PGD A;  2C9N Y;  1N7S C;  1N73 C;  3B5N C;  1JMB A;  1ULJ A;  3CMA P;  2GBX A;  2JO1 A;  5AW4 B;  1VQL P;  1IFD A;  3L72 D;  1EG9 A;  3HD7 A;  2FYU K;  2QA4 P;  1JY3 N;  2A45 H;  4BXL A;  3CXH H;  3U1C A;  1PP9 E;  2NUK A;  4N78 E;  2KS1 B;  2HPC B;  2ZT9 C;  2BAS A;  3TGU J;  2QIW A;  2JDI H;  3AEE C;  2KNC A;  4HJG H;  2B1X A;  3V5B A;  2M5A A;  2WSE H;  4L76 A;  1FOS E;  3HD7 C;  4ZKP A;  1SQX J;  1VCK A;  3IR9 A;  1YYC A;  5CHX A;  1HBW A;  3LID A;  2YNY A;  3Q5P A;  3Q5R A;  3MZW B;  4O9B A;  3S4R A;  4TT3 H;  1T3J A;  1PZQ A;  1BCC J;  1USE A;  1LTI C;  2IFM A;  1CSB A;  3AE7 C;  3SWK A;  2OAR A;  3QH9 A;  3CCM P;  4GOE A;  1GD2 E;  5KAI H;  2V4H A;  1ZLL A;  2HOD A;  2XZR A;  4WWI A;  2W6A A;  3CWB E;  1LT9 A;  4D6T G;  4H13 D;  3FWN A;  1Q82 Q;  3OAK A;  1KC8 Q;  2POH A;  2VRS A;  1LWU A;  2KK7 A;  4L73 A;  2FFD A;  1S3J A;  3CWB G;  4QDF A;  2BCC G;  2R5D A;  2JKV A;  1Q81 Q;  2ZT9 D;  3A0H H;  4IL6 H;  3AEF C;  4ZNC A;  5BU8 B;  2YXR B;  2WSC H;  1SFC B;  1J1E C;  1KIL D;  1NJI Q;  5KKZ C;  4NB9 D;  3CXH E;  4EI2 A;  2KOG A;  3GOB A;  3H1J E;  1NTM E;  1L0L J;  1SS1 A;  2FXP A;  3AEA C;  2Q3I A;  4HM6 A;  2L5G B;  2A06 E;  1IFP A;  4NBF D;  4I7Z C;  3KQG A;  2YIU C;  1L0L E;  4EOT A;  3M9B A;  5AVU B;  5K5G B;  4HM2 A;  4XA4 A;  3M06 A;  1ZXG A;  2E74 C;  4B86 A;  2OYH C;  5AVY B;  1KIL A;  2E43 A;  1BCC D;  1O7M A;  2IBZ I;  4M3L A;  1H0T A;  1M57 D;  2CPS A;  1S5L E;  4H0L C;  2XU6 A;  3LW5 J;  3OJA B;  1KN7 A;  1YJ9 P;  2G8Y A;  4ZMD A;  5AVV B;  1W5C E;  2FYU D;  1X8Y A;  3EFG A;  1GU4 A;  3L37 A;  4QCK A;  2O01 N;  1ZN5 A;  2W27 A;  1AVO A;  2OTL P;  4HKV A;  5E79 H;  1JB0 J;  1LTJ C;  1S72 P;  3CX5 I;  3L75 E;  3P8C E;  5APS A;  2FKW B;  2BMQ A;  2OYI A;  1FAV A;  1MFZ A;  4R4M A;  2O3J A;  2E75 C;  2QPZ A;  1L2P A;  1VQ8 P;  4GKG A;  2W6B A;  2KZI A;  3L74 J;  3PJS K;  1WMK A;  3D70 A;  1FE6 A;  3MD0 A;  1N73 A;  2KS1 A;  2MJZ A;  2FXM A;  2YKO A;  1LTB C;  2I1J A;  2ZT9 B;  3H25 A;  4L74 A;  1NU1 E;  1EZV D;  3RK3 B;  1URQ B;  3AE4 C;  4JYC A;  3H32 A;  1H0T B;  1LT9 B;  4JQ0 D;  2Y9Y A;  1LP1 B;  1GMJ A;  3NMD A;  3O6Q B;  1QVF O;  2KUB A;  5KLV G;  4RO0 A;  1G1J A;  2ZYG A;  1ZP0 C;  2Y0E A;  4C7R A;  3HE5 B;  5CCH C;  4PD4 E;  1GL2 C;  2WPR A;  2QM7 A;  5KTB A;  2E75 D;  1JM0 A;  3FX0 A;  1O7G A;  2J58 A;  2A45 I;  3C9I A;  3M0A A;  3OW2 O;  3G3Z A;  1W2E A;  1X0T A;  1KQL A;  1SQP G;  3HUS B;  4KT0 J;  1KIL E;  3E1I A;  1KB9 I;  4OWF A;  3GKE A;  2GUS A;  2WSF H;  1IJD B;  3L70 G;  3PP5 A;  4OGQ C;  2O1K A;  2Q7C A;  2XKM A;  4D6T J;  2IBZ G;  3C1L A;  3HTK A;  5AW8 B;  2Y0C A;  3Q3D A;  2UWJ E;  3AEC C;  1NYH A;  2K88 A;  2WT7 B;  2AXT E;  1BE3 E;  3IAO A;  3RGU A;  1O7N A;  3L70 D;  3B8E B;  1YQ3 C;  4H13 B;  3GL0 A;  5EFW B;  3TYY A;  3AE5 C;  3BAS A;  1P84 I;  2YFJ A;  2KYV A;  3L71 D;  1S2E A;  5HL4 A;  1FZB A;  1IFM A;  4HB1 A;  3RK2 B;  4DT0 A;  2D2C D;  2YO3 A;  3S1K A;  1AJY A;  3FOU A;  1KQG B;  2QJY B;  4QMA A;  4H0L B;  2H8P D;  2WMM A;  4EYY Q;  1L0N G;  2QSI A;  2N1T D;  3L71 G;  2DE6 D;  2NVE A;  4ZKU A;  2OYH A;  3HE5 A;  2WPQ A;  5KLV D;  3HTK B;  3JCU E;  1VQN P;  2KI7 B;  3L75 D;  4R4L A;  2FYN B;  3CX5 D;  3PLN A;  1N7L A;  3MUD A;  4BRY A;  2NVG A;  3BCC E;  1HUC A;  1J1D B;  2E75 B;  3VMZ A;  3CCQ P;  1PGQ A;  1URQ A;  1VQ6 P;  4W7Y A;  4DOJ A;  2N9Y B;  2N1T C;  4HH2 A;  3KDP B;  4AQR D;  3GLM A;  3B5N D;  1SQX G;  2SPZ A;  1XTG B;  3H6P A;  4GT1 A;  1QEX A;  1YQ4 C;  3G9R A;  1GW3 A;  4AUW A;  3CXH D;  3M91 A;  4HM8 A;  1N7S B;  1JO5 A;  3B5N B;  5TIS E;  1SQV G;  1CI6 B;  1J1E B;  5CCG C;  3TSI A;  1Q90 C;  3O6Q A;  3M0D C;  4IFD K;  1JTH A;  1JEK A;  1L0L D;  2JWA A;  5APV A;  2ZVO B;  3LW5 H;  3M9H A;  2G3A A;  1PFI A;  1L0N E;  1QLE D;  4OH8 B;  3I5C A;  1L4A B;  1JY2 N;  2K3R A;  1KYO H;  2WQY C;  1BDC A;  1SQQ E;  2XND H;  5GTI H;  3HE4 A;  1VF5 C;  5APY A;  1VQP P;  3H1I D;  1NHL A;  1LJ2 A;  2W90 A;  1L4A D;  3VP9 A;  1AV1 A;  1U7M A;  3HD7 B;  3AEG C;  1ZOY C;  3VOP A;  1RF1 A;  2QJK C;  2R3C A;  3A0B E;  2H7H A;  2FY8 A;  5APQ A;  2B9B A;  4YTP C;  1QL2 A;  1RE3 C;  1G8K B;  4OGQ B;  3TF5 A;  3VCA A;  1ULI A;  1FZC B;  1IC2 A;  4U3F E;  3FGA D;  4WY4 A;  1SFC D;  4EMJ B;  1NYK A;  3JSV C;  1VF5 D;  5KAF H;  3FXD A;  3L70 E;  3BRV B;  3H1L G;  2M0B A;  1ZV8 A;  3RK3 D;  3T97 A;  1TU3 F;  2Q9I A;  4U3F G;  1EDK A;  1VDF A;  1VQO P;  1PGO A;  1FZF A;  3H1H J;  3AE8 C;  2HLO A;  5KJ7 C;  1N7S A;  3KZI H;  2RH0 A;  5B66 E;  3O8Z A;  2Z5H A;  3H1L D;  3IN6 A;  3H1H E;  1QL1 A;  2QJY C;  3VYI A;  1SFC C;  4YXW H;  2R3S A;  3CWB D;  3PHL A;  2OTJ P;  5CBO A;  1SQX K;  4JBZ A;  1RF1 B;  1NTZ K;  3S9O A;  1DD4 A;  1LP1 A;  2P2U A;  5CJ0 A;  1WT6 A;  2GUV A;  1LT9 C;  3GTS A;  3AE9 C;  4PD4 D;  2W83 C;  1S1C X;  3W67 A;  2H89 C;  3CX5 E;  4UB6 E;  1OMI A;  2H43 A;  1OFC X;  1N7S D;  2FYU J;  4I7Z B;  5APW A;  2WSS H;  3GHG C;  2W6J H;  1R5S A;  3H1K G;  2KB7 P;  1NTM D;  4RES B;  3VMY A;  1DH3 A;  3R4Y A;  1U7J A;  2HMK A;  3H1H G;  3JC2 2;  1VL2 A;  3D6Y A;  4GOF A;  2YVJ B;  3GTE A;  2KNC B;  2O01 J;  1NTK K; 
#chains in the Genus database with same CATH homology
 4QDD A;  4EMJ B;  4H44 D;  4H13 D;  2FYU E;  3C0D A;  1SQX E;  1NYK A;  2BMQ A;  1VF5 D;  3GKE A;  3EQQ A;  1RFS A;  1UUW A;  4QDC A;  4NBB D;  3L70 E;  2IBZ E;  3GCE A;  2HMN A;  2E74 D;  3H1I E;  1ULJ A;  1SQP E;  4QDF A;  2XRX A;  3H1L E;  2GBX A;  2QPZ A;  2ZT9 D;  4QUR A;  2Q3W A;  2XSO A;  2CKF A;  5AEW A;  4NBG D;  1KB9 E;  1EG9 A;  4D6T E;  3AZC A;  4HM8 A;  4HM1 A;  1NTZ E;  2JO6 A;  4NBH D;  1O7W A;  1BE3 E;  1RIE A;  4NBA D;  1O7N A;  1O7P A;  1SJG A;  3DQY A;  5BOK A;  2DE7 D;  4HJL A;  3GL0 A;  5KKZ C;  4QDF B;  4HM5 A;  1Q90 C;  3D89 A;  4HM0 A;  4NB9 D;  3CXH E;  3H1H E;  1NU1 E;  3L75 E;  2E4P A;  4NBE D;  2JZA A;  1PP9 E;  2NUK A;  2QJP C;  2QJY C;  2NVF A;  3GOB A;  3H1J E;  1NTM E;  5AEU A;  3H1K E;  3L72 E;  2YFJ A;  1FQT A;  4P1C H;  4HM6 A;  4PV1 D;  5HL4 A;  3L71 E;  2HMJ A;  4HM3 A;  3GB4 A;  1JM1 A;  1BGY E;  2HMO A;  2A06 E;  1WQL A;  1L0N E;  1SQB E;  3GL2 A;  4NBF D;  2D2C D;  2HMM A;  2E76 D;  2HML A;  3GZY A;  3GTS A;  3L74 E;  2YIU C;  3VMG D;  2ZYL A;  3FOU A;  1ZRT E;  2B1X A;  1L0L E;  4HM4 A;  4NBD D;  4HM2 A;  3TGU E;  3CX5 E;  4NBC D;  3N0Q A;  2XSH A;  4P1B H;  1VCK A;  2NUM A;  1BCC E;  1SQQ E;  4AAY B;  1KYO E;  3VMI D;  2I7F A;  4H0L D;  2DE6 D;  2NVE A;  2E4Q A;  1O7M A;  2B24 A;  5CXM A;  5KLV E;  2YFI A;  2GBW A;  4PD4 E;  1O7H A;  1PPJ E;  1NDO A;  1P84 E;  2YFL A;  3VCP A;  2QJK C;  3VMH D;  2E75 D;  2XR8 A;  3L73 E;  2NWF A;  4QUQ A;  2HMK A;  4HM7 A;  1O7G A;  4QUP A;  4OGQ D;  3EN1 A;  1G8K B;  1UUV A;  2NVG A;  4QCK A;  3BCC E;  2YVJ B;  3GTE A;  4NB8 D;  4HKV A;  3GZX A;  1SQV E;  1G8J B;  3VCA A;  1EZV E;  1ULI A;  2BMR A;  2BMO A;  2FYN C;  1VM9 A;  1NTK E;  5KLI C;  4U3F E;  4AIV A;  2BCC E;  3CWB E;  2DE5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...