1BE3E

Cytochrome bc1 complex from bovine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 40
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1be3E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1be3E02
3BCCE 3L73E 1BCCE 2BMQA 4PV1D 2DE6D 2HMLA 1L0LE 2IBZE 1Q90C 3GL2A 4H0LD 4HM7A 5AEUA 4NBFD 3AZCA 1VCKA 4NBGD 2B24A 3L75E 5KLVE 2XR8A 1ZRTE 2NUKA 5KKZC 2E4PA 1O7PA 4HM1A 1SJGA 1UUVA 1BE3E 1WQLA 4OGQD 5AEWA 4QDFB 3GB4A 2QJPC 3D89A 3L70E 1SQQE 2A06E 2QJKC 2E4QA 2Q3WA 1NYKA 2HMKA 1VM9A 2YFIA 4H13D 4HKVA 3H1LE 1L0NE 4AAYB 3L72E 2NVFA 2XRXA 4HJLA 2DE7D 1RFSA 4PD4E 3VMHD 4EMJB 2BCCE 3TGUE 3GTSA 5KLIC 2D2CD 3GKEA 2HMMA 3GL0A 2BMRA 1G8KB 2JZAA 4HM5A 1UUWA 1EG9A 2E76D 1BGYE 1SQPE 1KB9E 5HL4A 4HM3A 3VCAA 1O7MA 3EQQA 1NU1E 2QPZA 1NDOA 4P1BH 1JM1A 1SQXE 4QDCA 4HM4A 3CX5E 2YFLA 4NBHD 3N0QA 2YVJB 4QUPA 2I7FA 4P1CH 4QURA 2B1XA 4NBAD 1SQVE 2NUMA 2JO6A 4QCKA 3GTEA 1G8JB 1PP9E 2FYNC 4D6TE 2YFJA 2NVEA 2HMJA 3H1JE 5CXMA 3H1IE 2NVGA 4QDDA 2E74D 3VMGD 2BMOA 1EZVE 2YIUC 4HM2A 1O7HA 3VMID 4U3FE 1NTZE 1NTKE 1FQTA 2GBWA 2QJYC 4AIVA 3L71E 1O7GA 4NBBD 3CXHE 1O7WA 3GZYA 4HM6A 2ZT9D 3C0DA 2FYUE 2NWFA 4QDFA 3GZXA 1VF5D 1SQBE 1ULJA 4NBED 1O7NA 2CKFA 1KYOE 4NB9D 2XSHA 4H44D 4NBDD 3DQYA 2XSOA 2E75D 1P84E 3H1HE 1ULIA 4HM8A 3EN1A 1RIEA 2ZYLA 2HMNA 2GBXA 3H1KE 4NB8D 3GOBA 4QUQA 3L74E 2DE5D 1NTME 3GCEA 4NBCD 3VCPA 1PPJE 3FOUA 3CWBE 5BOKA 4HM0A 2HMOA
chains in the Genus database with same CATH superfamily
4HH2A 1NU1D 3S1KA 2HLOA 2XNDH 4OGQD 2QJPC 3T97A 2WSCH 1OVVA 3A2AA 2OYIC 1OX3A 2P1JA 2RKLA 1L4AB 3GTSA 2N9BA 2XV5A 3ITKA 2GA1A 4W7YA 3P32A 3A3YB 3IFMA 2FFDA 4DJGA 5M1BA 3MIWA 3H1HD 2QPZA 4AYCA 1SQXE 3T97B 4HM4A 1KZUB 3L74D 1NTMD 1PPJD 3JC22 3W67A 1ZXGA 2YVJB 3FXDA 1IFJA 1W5CE 3RK2B 1NYHA 2ZXXA 1MFTA 3M9BA 2A45H 1GW4A 1SQQD 1L4AC 2JKVA 2FFDB 3PRJA 2ZYGA 1L0ND 3CXHI 4A7PA 2IPPA 1KMIZ 3BCCG 2BCCD 5AVUB 4GIFA 1KYOI 3CPWO 1FZCA 5AW5B 2M0BA 4HM8A 1HF9A 2Z5HA 3M91A 4U3FJ 1VQKP 3VCPA 1FAVA 1U57A 3AE4C 1BCCE 1HJBA 3RK2C 4NBFD 2FYUJ 4JPZB 1DD3A 3WU2H 1SJGA 5APQA 2FFDC 2WMMA 2FYUK 1FZCB 3H6PA 3L72E 3V4QA 2JR8A 5AW3B 2KLVA 4HB1A 2P7JA 1H8AA 2QJYB 3AE7C 1Q86Q 2NPSA 2IFNA 1UUWA 1SQPJ 3AEBC 2SPZA 4GODA 4ZNCA 3H1JG 2ZJSE 4KHXA 1SQPK 5AVSB 4GT1A 3CMAP 2O01N 1YQ3C 3CXHH 1K9MQ 3AEDC 1FZCC 3AE2C 4U3FE 1KYOH 1OW7A 2NPSB 3FWNA 3AE6C 2KOGA 2QJYC 2W90A 2WITA 1GK6A 4B86A 1RHZB 2FYUE 1NKNA 2FYZA 2AXCA 1IZNB 4NPFX 2M5AA 4W80A 3EQ2A 2IBZE 1PL5A 2DE6D 4L74A 2HMLA 3AEAC 4HM7A 4EDFA 3CMEP 3H1LG 2O3JA 1FBMA 3L75E 1AFOA 3CX5D 3P7KA 1SQVD 5KAIH 1VQOP 2NPSC 3PLNA 2YO3A 2KZIA 1VM9A 2ITAA 2Y0EA 1KTMA 2YIUB 5B66H 3D6YA 3L73J 1RF0A 3L70G 2M5AB 5CJ4A 3GMAA 4I1LA 5AVTB 5GTIE 1NWQA 2N1TA 1RY3A 3NTNA 2KP8A 1BGYJ 3VYIA 3AE9C 3LIEA 5GTHE 1NU1J 1N7LA 3RL0B 4I7ZC 4OWFA 4NPEA 1FOSE 2KIKA 2ZT9B 1VQLP 2C9NY 1NO4A 2FY8A 5BU8B 2YIUC 3TSIA 2N1TB 4WY4A 3VTPC 1ZR4A 1PFIA 1VQ5P 1LWUC 1FQTA 2OTJP 2YKOA 5KAFE 3H1IG 2POHA 1SQXD 4BXLA 3CWBG 4R4MA 1L0LG 3L71G 3H1HJ 2KSJA 3RL0C 5KLIB 1JEKA 1FOSF 1KFNA 1NTMJ 3F5HA 2DE5D 3HUSA 3BCCE 3L73E 2ZT9C 4BRYA 4WY4B 1RF0C 1Q7YQ 1DX7A 1CW5A 4HYTB 2YO2A 2N1TC 1LTGC 1ZR2A 1VQ7P 1OW8A 1PP9D 1SQQJ 1A02J 1NOHA 1FZGA 3TDKA 3Q5SA 1L0NJ 3P8CE 1BDDA 4HJLA 4IL6X 1DD4A 1EC5A 3VN0A 2XZRA 1E79H 3HUSB 5KLIC 4BRYB 2BMRA 4EYYQ 1BE3J 1Q81Q 4HM3A 3VCAA 3Q3DA 3EQQA 2KYVA 2LXBA 3CD6P 3SWFA 5CBOA 1R5LA 1J1EB 3V2QA 3HE4A 2B1XA 1RF1A 4YXDC 1KN7A 1NTKG 4GDOA 1LT1A 1NKZB 3H1JE 4QDDA 4JF7A 1YIJP 4TT3H 3EFFK 5B5EH 3KPEA 4JYCA 2QJKB 2HODA 3HUSC 2P10A 2I1KA 4HM6A 1KFMA 1JM0A 2G3AA 2CKFA 1SFCA 3DQYA 3TGUD 1X8YA 2IYPA 5AVVB 1YYCA 1AJYA 3HE4B 2O01H 1ZW0A 1ZMEC 3EN1A 2WT7A 3KHUA 3V6IA 1RF1B 1VPCA 3MUDA 2E75B 1ZLLA 5AW0B 1J1EC 4XE5B 3W68A 4QCKA 3GL2A 3L37A 1GU4A 1S2EA 1JNMA 3M06A 1KORA 1YITP 2HODB 4EOTA 1JY3P 1BE3E 2D2CB 4D6TD 2QJKC 1GW3A 1FJPA 4C7NA 1SFCB 4HKVA 3H1LE 1BDCA 3A7OA 4EIJA 3VMYA 2NVFA 2WT7B 1EDIA 1EDKA 3OW2O 5BVZA 2M8RA 1IK7A 1RF1C 4L76A 2E75C 1S9KD 1T2KC 2LXCB 2JWDA 3RK3E 1L0LK 2WSEH 3SFEC 1AV1A 4C7NB 2D2CC 1SQVJ 4NBAD 2QE7H 1SFCC 3WMM0 4LC1A 5CXMA 2N1TD 5AW9B 3B5ND 1O7HA 3MUDC 3HD7D 3RK3B 1RQUA 1T3JA 3C0DA 4PV1B 4N78E 4U3FG 3M9HA 1S1CX 4H44D 2PFXA 1P84E 1EXJA 1JY2N 2GUVA 2HMNA 2FYUG 1HVVA 3H1KE 4QUQA 1QLED 1T6AA 2L5GB 3CWBE 2IBZI 1L0LE 2O1JA 1GDTA 1VCKA 2B24A 5CCHD 1ZRTE 5B5EE 1MUUA 1MKMA 2J5UA 3GB4A 2RMZA 3D89A 3CCQP 3RK3C 3PH0A 5DJTB 4PV1C 1K05A 2CPSA 1VQ9P 1NTZD 1OWAA 1HUCA 1SQPG 1EQ7A 3AEFC 4EI2A 3CXHD 1Q82Q 2NRGA 2Z4EA 1SQBD 3P8MC 4IFDK 1KYOD 4RJTA 1GU5A 5AVYB 2P67A 3S9OA 1IK9A 3WUVA 1JMBA 1MFZA 1KV4A 1NDOA 4P1BH 3FXEA 1IFIA 4C7RA 1PV3A 1PP9J 3O8ZA 1AQTA 1G1IA 1CI6A 5KKZB 3SWKA 5E79E 1NTKE 2ZFCA 2QM8A 4H0LB 1NJIQ 1H88A 2MKVA 1URQA 2XSHA 3G3ZA 3V2RA 2XSOA 1W2EA 2E75D 4WWIA 3GOBA 4NBCD 1Q2NA 4HKZH 1VQMP 1GL2D 1CI6B 3FOUA 1XTGB 4I2LC 1Q90C 2C0WA 3L36A 1S5LX 4NBGD 3CCSP 5KKZC 4L75A 3L73G 1NAYA 3HRNA 3PJSK 3LW5J 3CCEP 2A06E 2K3RA 2Q3WA 5GTIH 4H13D 1URQB 2HYNA 1EZVD 4UB8E 4H0LC 2ZVNB 2XRXA 3GW6A 1BGYG 5GTHH 3BATA 3TGUJ 5KLVJ 3AE8C 1N7SA 2KS1A 2JJLA 5KJ7A 5AVWB 3FGAD 3M0DA 5AW6B 5KLVK 1JM1A 3H1LD 2AEFA 2YFLA 4NBHD 1KD1Q 1Y47A 5K5GB 2HFED 1G8JB 1VF5B 3MTUE 3R4YA 5KAFH 1URQC 1SLQA 1PGPA 3IF4A 1N7SB 3QH9A 2KS1B 2KI7B 2B88A 3L70D 4IL6E 1O7WA 2WPRA 2YKPA 3E1IA 2V4HA 1NTMG 2JEEA 1PPJG 3CC7P 4GKGA 4NB9D 3R2PA 2LKMA 1OVUA 3HE5A 1KQLA 4AUWA 4R4LA 5CMZA 2ZYAA 3MZWB 2W6AA 1VF5C 1SQQG 4HJGH 2AEJA 5KLVE 2AEMA 5AVQB 1L0NG 2NUKA 2KSEA 1N7SC 4N78D 1IFPA 1YJ9P 2N9YB 5KJ7C 1X9VA 3H1ID 2YFIA 2E76B 3M0DC 1R8EA 1BE3G 3HE5B 3CWBD 3L71D 1EDLA 2HR3A 2JZAA 4HM5A 1G2CA 1EG9A 2PP6A 1SQPE 2IZ0A 1O7MA 4UB6H 3JCUH 1N8RQ 2H7HA 1L4AD 1VDFA 2AXTE 2JP3A 4QURA 2H43A 2Y9ZA 2NVEA 2HMJA 2E76C 5CCGA 2BEQD 2J58A 1K8AQ 2WWWA 3ABVC 1NTZJ 2KXPB 1RH5B 3VP9A 1G2CB 3RBXA 1SQBJ 1FDMA 1ULJA 3RK2D 1O7NA 3GLMA 3NMDA 3KQGA 2GM4A 1NU1K 2FXMA 2WTYA 1CZQA 4DOJA 1P84I 1USDA 4PJ0H 3VMZA 2R5DA 1J1DB 2WZ7A 4TLFA 1NTKD 5EFWB 3B4SA 3H1KG 1TU3F 1DIPA 5AEWA 3B8EB 4OH8B 2E4QA 1KB9I 1NYKA 1PGJA 3G4SP 3L74J 4OVNF 1LJ2A 1FE6A 1RFSA 2Y9YA 1JTHB 1PZQA 5H2FE 1J2JB 4DT0A 1NTMK 2PRRA 3GF3A 1JCDA 1J1DC 1BGYE 2WSFJ 5CCGC 2E74B 3D6ZA 1NU1E 2QSIA 1QVFO 3KDPB 2K1AA 4YPCA 2L91A 2I8DA 4JYBA 3TF5A 3N0QA 1FDIA 3G71P 2I1JA 2BCCJ 5CHXA 1BCCD 2I7FA 1SQQK 2RN0A 3GTEA 1HH0A 2OGUA 1L0NK 3U1AA 3N7NA 1N73A 4WY4C 1P84H 1RE3A 4L73A 4O9BA 4K35A 1LGHB 4QDFA 2NWFA 3U59A 2W27A 2FXPA 3L72D 3LIDA 3JSVC 3OJAB 3USSA 2Q3EA 4UB6E 3JCUE 2E74C 4AQRD 1OXZA 3H1HE 2QA4P 2W6BA 2NPSD 1KC8Q 3L74E 1NTME 3PTZA 1EXIA 3SWYA 1PPJE 2K9YA 5BOKA 2YXQB 4HM0A 3PHLA 1KB9H 3O6QA 2Y0CA 5AEUA 3OA7A 2XNXA 3QWOC 1N73B 5AW1B 2E4PA 2FKWB 1IFNA 1H0TB 1UUVA 1WQLA 3CCRP 4QDFB 3EWKA 3VMXA 3WUUA 2PGDA 1SQQE 1SVFA 1L0NE 1FZFA 1JOCA 2M3BA 2WSSH 4U3FD 5AW2B 2A06G 2WPSA 2BCCE 3A5TA 4PJ0E 2G8YA 2FYUD 3O6QB 1MV8A 2H8PD 1PP9G 1PGQA 3GHGA 3NXSA 1ZV8A 1N73C 1RE3C 5E79H 2IBZD 1QL2A 4P1CH 1A02F 2ZXEB 4YXWH 3GF7A 3L75D 2NVGA 1YBKA 1PGOA 3BVHA 3RL0D 2XKMA 1SQPD 4CPGA 3Q2YA 1CSBA 3RGUA 2JDIH 4ZKUA 2IFMA 2WVRA 2ZT9D 2K88A 1G1JA 3GHGB 5CJ0A 2HG5D 3F89A 1LTAC 2K37A 1WT6A 3KZIE 4NBDD 1RIEA 5CCGD 1Z56A 1SQVK 1OW6A 5DJUB 2O01J 1H89A 4PD4I 1UIXA 1OMIA 2QVAA 4UB8H 1LTTC 1O7PA 1QX8A 2FYNB 5KLVG 3V2PA 1U7MA 2R3CA 3GHGC 1OZHA 3BRTB 4WY4D 4ASVA 5APTA 1M57D 2ZAEB 1LTSC 4RKUJ 1E5WA 5KTBA 1VQ4P 3L4FA 5BU5A 2M3EA 2HMMA 1U7JA 3VMAA 1LT9A 1G8KB 2OQQA 1YTZT 1JY2O 1KB9E 2CPBA 1SQXJ 3K5BA 3CX5E 3SSUA 4Y99B 4K3AA 2V7QJ 1HJ0A 2RH0A 3CCVP 4QUPA 3BCCD 3L73D 2E43A 3CCLP 1SQVE 4IL6H 1AQ5A 4Z1MH 2FYNC 1LP1A 1NH4A 1SQXK 5APWA 4IOIH 3I55P 4HM2A 4W7ZA 3AEEC 1DEBA 3AE5C 1LT9B 1S4XA 3LW5H 1IO4A 3P8CD 2XU6A 1MZ9A 3S4RA 1OIPA 4PD4H 2P58A 1JCCA 3E7KA 4Y99C 3CI9A 2R44A 5AW7B 1LP1B 1T3UA 4DZOA 3AEGC 1BCCJ 2Y0DA 3M0AA 2BMQA 5L8RJ 3PP5A 2H88C 4U7JA 1ZP0C 1JY2P 2JO1A 4KJMA 2E42A 2B87A 3CCJP 1LT9C 4XFJA 1T2KD 3H1JD 3SFDC 3CCUP 3AECC 3N4XA 2BASA 3L72J 3RL0g 3VMHD 1FZBA 4EMJB 4DCKA 2J59M 2QRXA 2D2CD 3I5CA 2IDBA 3OAKA 2AXTH 4QMAA 3MHVA 1SFCD 1YI2P 2B87B 4NPDA 3E1RA 3V5BA 4YTPC 1YTZI 1FC2C 2WSCJ 1NTZG 1NU1G 2JO6A 1LTIC 1PP9E 2YKQA 4WB4A 4N3YB 1SQBG 2Q6QA 1BE3D 4M3LA 1Y8AA 4JQ0D 1D7MA 5AW4B 2XDJA 1NGMB 3IAOA 1JUNA 3GZXA 1N86A 3IN6A 3I56P 3A0BH 1KILE 4D6TJ 1KILA 2E5TA 3CC4P 1IFMA 3ZDMA 2HPCA 2GBXA 1WRGA 1LTJA 3RK3D 4XA4A 1BSNA 1R5SA 2KUBA 4PV1D 3H1HG 1QGKB 2CK3H 1QL1A 3L75J 3L74G 4HM1A 4Y28J 2IZ1A 3Q1MA 1M1JA 5CBNA 5H2FH 1K04A 1KILB 1DEEG 2P2UA 2HPCB 2DE7D 4PD4E 5APSA 3H25A 1LTJB 1WMKA 3TGUE 1NVOA 1HGZA 4RO0A 1S3JA 1VQ8P 1GD2E 2BCCG 2QEXP 1EZVI 1P84D 4RESB 3H1KD 1EZVG 1M1JB 2OTLP 2BEZF 1L0LD 4D6TE 2YFJA 1KQSO 2QG4A 2OYHA 1KILC 1ZRTD 5APYA 2DW3A 1SP4A 3CLQA 2W83C 3VMID 1LWUA 1KB9D 2O1KA 1LTJC 5TISH 2GBWA 4AIVA 2H89C 1O7GA 1FS0E 5AVZB 1BSHA 2OTKE 1PIXA 4I7ZB 4MN4C 1S9KE 1Q90D 4NBED 3TYYA 5C39A 1FZEA 1QVGO 3Q5RA 3TNUA 3MGNA 1VQPP 3WUTA 1M1JC 2OYHB 1HTLC 3BCCJ 1VL2A 3EFGA 2C0XA 4H0LD 1NAFA 2WSFH 1LWUB 2Q9IA 2XR8A 1N2DC 2KLUA 1GMJA 1NTZK 3B5NA 4GOEA 1EDJA 2B9BA 4GOFA 3HD7A 2R3SA 2YMKA 1GK4A 1SQBK 3CL3D 4LGDE 4WBAA 1JTHA 2KNCA 3WU2E 3A0BE 3TNUB 1USEA 1M8OB 1S5LH 3FX0A 5AVRB 1GZLA 4ZKPA 2OYHC 1URQD 5HL4A 2YMYA 3B5NB 2R32A 4QDCA 1RQVA 2R5BA 5CCHA 3HD7B 3CX5I 3L35A 2IX7C 2KNCB 2NUMA 1YJWP 1W2BO 1SS1A 4WVZA 3H1JJ 3G9RA 4H44B 2QM7A 2BMOA 3G6EP 1FDOA 1SQVG 2VRSA 1AVOA 1NTZE 3TK1A 1K73Q 3KZIH 2A06D 5APUA 4LLHA 4IFMA 3CXHE 1VF5D 1SQBE 1KYOE 1VQ6P 1YJNP 2OYOA 5AW8B 3B5NC 1ULIA 1N7SD 1M90Q 1HWTC 1YQ4C 3HD7C 5KJ7D 3GCEA 1JY3N 1LNQA 3MP7B 1ZN5A 4I6MC 2NZ2A 3RBZA 1H0TA 4H44C 2OARA 3B71A 1RE4A 5TISE 3D71A 5AVXB 1OFCX 1AA0A 1JMMA 1KILD 2K9JA 1HGVA 4OGQB 2HMKA 3H1LJ 1JY3O 2FBWC 2W6JH 3GG2A 2C9LY 2YXRB 3CCMP 5KAIE 5CCHC 1IJDB 3C9IA 4IFFA 2KZJA 3M9QA 1VQNP 3A0HH 2MJZA 3C1LA 2QIWA 1SQXG 3GKEA 2Q7CA 2WPQA 3V4WA 3CX5H 5B66E 2E76D 3L70J 1GL2A 1ZOYC 3KXDA 2K9JB 3CC2P 1LTBC 1X22A 1KQGB 1HBWA 1FZAA 1DH3A 4PD4D 3BRVB 1IFDA 3AE1C 4OGQC 1KQFB 1YHQP 1M56D 5KLVD 1X0TA 4ASWA 3C8VA 1EZVE 2Q1KA 1OVRA 3U1CA 1QEXA 3D70A 5APVA 1S5LE 1GTWA 3HTKA 1GL2B 3II6A 1FJKA 1UIIA 2FXOA 1XTCC 2Q3IA 1BCCG 2GUSA 1RE4C 3H1IJ 2YNYA 3H1KJ 4NB8D 1JB0J 2KB7P 3CWBJ 4H13B 2HMOA 1L0LJ 3L71J 1FU1A 3AZCA 2IYOA 1L2PA 3VP8A 3L72G 2ZYDA 3HTKB 2V7QH 2UWJE 3MD0A 3L70E 4C46A 2LR2A 1Y9BA 1GL2C 2B89A 4AAYB 5TJHA 3GL0A 2E5YA 2WPVB 4H13C 3KYQA 3TGUG 2OYIA 5APXA 3VOPA 4KT0J 2WQYC 1T8ZA 3H32A 3H1IE 2E74D 3VMGD 2W8ZA 1IC2A 3BASA 1NTKJ 3A0HE 4D6TG 2QJPB 3NFQA 3FWLA 3L71E 4NBBD 2ZVOB 3GZYA 2PAJA 1X79B 2OYIB 2Z5IA 1M1KQ 2WSEJ 2Q5UA 4JBZA 1M7LA 2A45I 2IBZG 2JWAA 2KK7A 1NTKK 3V2NA 4ZMDA 3IR9A 3Q5PA 1S72P 1AVYA 2ZYLA 3L75G 3UIAA 4N6JA 2A45G 3H32B 3AE3C 1L4AA 1JO5A 4BWNA 1NHLA 1BGYD
chains in the Genus database with same CATH topology
3BCCE 3L73E 1BCCE 2BMQA 4PV1D 2DE6D 2HMLA 1L0LE 2IBZE 1Q90C 3GL2A 4H0LD 4HM7A 5AEUA 4NBFD 3AZCA 1VCKA 4NBGD 2B24A 3L75E 5KLVE 2XR8A 1ZRTE 2NUKA 5KKZC 2E4PA 1O7PA 4HM1A 1SJGA 1UUVA 1BE3E 1WQLA 4OGQD 5AEWA 4QDFB 3GB4A 2QJPC 3D89A 3L70E 1SQQE 2A06E 2QJKC 2E4QA 2Q3WA 1NYKA 2HMKA 1VM9A 2YFIA 4H13D 4HKVA 3H1LE 1L0NE 4AAYB 3L72E 2NVFA 2XRXA 4HJLA 2DE7D 1RFSA 4PD4E 3VMHD 4EMJB 2BCCE 3TGUE 3GTSA 5KLIC 2D2CD 3GKEA 2HMMA 3GL0A 2BMRA 1G8KB 2JZAA 4HM5A 1UUWA 1EG9A 2E76D 1BGYE 1SQPE 1KB9E 5HL4A 4HM3A 3VCAA 1O7MA 3EQQA 1NU1E 2QPZA 1NDOA 4P1BH 1JM1A 1SQXE 4QDCA 4HM4A 3CX5E 2YFLA 4NBHD 3N0QA 2YVJB 4QUPA 2I7FA 4P1CH 4QURA 2B1XA 4NBAD 1SQVE 2NUMA 2JO6A 4QCKA 3GTEA 1G8JB 1PP9E 2FYNC 4D6TE 2YFJA 2NVEA 2HMJA 3H1JE 5CXMA 3H1IE 2NVGA 4QDDA 2E74D 3VMGD 2BMOA 1EZVE 2YIUC 4HM2A 1O7HA 3VMID 4U3FE 1NTZE 1NTKE 1FQTA 2GBWA 2QJYC 4AIVA 3L71E 1O7GA 4NBBD 3CXHE 1O7WA 3GZYA 4HM6A 2ZT9D 3C0DA 2FYUE 2NWFA 4QDFA 3GZXA 1VF5D 1SQBE 1ULJA 4NBED 1O7NA 2CKFA 1KYOE 4NB9D 2XSHA 4H44D 4NBDD 3DQYA 2XSOA 2E75D 1P84E 3H1HE 1ULIA 4HM8A 3EN1A 1RIEA 2ZYLA 2HMNA 2GBXA 3H1KE 4NB8D 3GOBA 4QUQA 3L74E 2DE5D 1NTME 3GCEA 4NBCD 3VCPA 1PPJE 3FOUA 3CWBE 5BOKA 4HM0A 2HMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC E;  3L73 E;  1BCC E;  2BMQ A;  4PV1 D;  2DE6 D;  2HML A;  1L0L E;  2IBZ E;  1Q90 C;  3GL2 A;  4H0L D;  4HM7 A;  5AEU A;  4NBF D;  3AZC A;  1VCK A;  4NBG D;  2B24 A;  3L75 E;  5KLV E;  2XR8 A;  1ZRT E;  2NUK A;  5KKZ C;  2E4P A;  1O7P A;  4HM1 A;  1SJG A;  1UUV A;  1BE3 E;  1WQL A;  4OGQ D;  5AEW A;  4QDF B;  3GB4 A;  2QJP C;  3D89 A;  3L70 E;  1SQQ E;  2A06 E;  2QJK C;  2E4Q A;  2Q3W A;  1NYK A;  2HMK A;  1VM9 A;  2YFI A;  4H13 D;  4HKV A;  3H1L E;  1L0N E;  4AAY B;  3L72 E;  2NVF A;  2XRX A;  4HJL A;  2DE7 D;  1RFS A;  4PD4 E;  3VMH D;  4EMJ B;  2BCC E;  3TGU E;  3GTS A;  5KLI C;  2D2C D;  3GKE A;  2HMM A;  3GL0 A;  2BMR A;  1G8K B;  2JZA A;  4HM5 A;  1UUW A;  1EG9 A;  2E76 D;  1BGY E;  1SQP E;  1KB9 E;  5HL4 A;  4HM3 A;  3VCA A;  1O7M A;  3EQQ A;  1NU1 E;  2QPZ A;  1NDO A;  4P1B H;  1JM1 A;  1SQX E;  4QDC A;  4HM4 A;  3CX5 E;  2YFL A;  4NBH D;  3N0Q A;  2YVJ B;  4QUP A;  2I7F A;  4P1C H;  4QUR A;  2B1X A;  4NBA D;  1SQV E;  2NUM A;  2JO6 A;  4QCK A;  3GTE A;  1G8J B;  1PP9 E;  2FYN C;  4D6T E;  2YFJ A;  2NVE A;  2HMJ A;  3H1J E;  5CXM A;  3H1I E;  2NVG A;  4QDD A;  2E74 D;  3VMG D;  2BMO A;  1EZV E;  2YIU C;  4HM2 A;  1O7H A;  3VMI D;  4U3F E;  1NTZ E;  1NTK E;  1FQT A;  2GBW A;  2QJY C;  4AIV A;  3L71 E;  1O7G A;  4NBB D;  3CXH E;  1O7W A;  3GZY A;  4HM6 A;  2ZT9 D;  3C0D A;  2FYU E;  2NWF A;  4QDF A;  3GZX A;  1VF5 D;  1SQB E;  1ULJ A;  4NBE D;  1O7N A;  2CKF A;  1KYO E;  4NB9 D;  2XSH A;  4H44 D;  4NBD D;  3DQY A;  2XSO A;  2E75 D;  1P84 E;  3H1H E;  1ULI A;  4HM8 A;  3EN1 A;  1RIE A;  2ZYL A;  2HMN A;  2GBX A;  3H1K E;  4NB8 D;  3GOB A;  4QUQ A;  3L74 E;  2DE5 D;  1NTM E;  3GCE A;  4NBC D;  3VCP A;  1PPJ E;  3FOU A;  3CWB E;  5BOK A;  4HM0 A;  2HMO A; 
#chains in the Genus database with same CATH topology
 4HH2 A;  1NU1 D;  3S1K A;  2HLO A;  2XND H;  4OGQ D;  2QJP C;  3T97 A;  2WSC H;  1OVV A;  3A2A A;  2OYI C;  1OX3 A;  2P1J A;  2RKL A;  1L4A B;  3GTS A;  2N9B A;  2XV5 A;  3ITK A;  2GA1 A;  4W7Y A;  3P32 A;  3A3Y B;  3IFM A;  2FFD A;  4DJG A;  5M1B A;  3MIW A;  3H1H D;  2QPZ A;  4AYC A;  1SQX E;  3T97 B;  4HM4 A;  1KZU B;  3L74 D;  1NTM D;  1PPJ D;  3JC2 2;  3W67 A;  1ZXG A;  2YVJ B;  3FXD A;  1IFJ A;  1W5C E;  3RK2 B;  1NYH A;  2ZXX A;  1MFT A;  3M9B A;  2A45 H;  1GW4 A;  1SQQ D;  1L4A C;  2JKV A;  2FFD B;  3PRJ A;  2ZYG A;  1L0N D;  3CXH I;  4A7P A;  2IPP A;  1KMI Z;  3BCC G;  2BCC D;  5AVU B;  4GIF A;  1KYO I;  3CPW O;  1FZC A;  5AW5 B;  2M0B A;  4HM8 A;  1HF9 A;  2Z5H A;  3M91 A;  4U3F J;  1VQK P;  3VCP A;  1FAV A;  1U57 A;  3AE4 C;  1BCC E;  1HJB A;  3RK2 C;  4NBF D;  2FYU J;  4JPZ B;  1DD3 A;  3WU2 H;  1SJG A;  5APQ A;  2FFD C;  2WMM A;  2FYU K;  1FZC B;  3H6P A;  3L72 E;  3V4Q A;  2JR8 A;  5AW3 B;  2KLV A;  4HB1 A;  2P7J A;  1H8A A;  2QJY B;  3AE7 C;  1Q86 Q;  2NPS A;  2IFN A;  1UUW A;  1SQP J;  3AEB C;  2SPZ A;  4GOD A;  4ZNC A;  3H1J G;  2ZJS E;  4KHX A;  1SQP K;  5AVS B;  4GT1 A;  3CMA P;  2O01 N;  1YQ3 C;  3CXH H;  1K9M Q;  3AED C;  1FZC C;  3AE2 C;  4U3F E;  1KYO H;  1OW7 A;  2NPS B;  3FWN A;  3AE6 C;  2KOG A;  2QJY C;  2W90 A;  2WIT A;  1GK6 A;  4B86 A;  1RHZ B;  2FYU E;  1NKN A;  2FYZ A;  2AXC A;  1IZN B;  4NPF X;  2M5A A;  4W80 A;  3EQ2 A;  2IBZ E;  1PL5 A;  2DE6 D;  4L74 A;  2HML A;  3AEA C;  4HM7 A;  4EDF A;  3CME P;  3H1L G;  2O3J A;  1FBM A;  3L75 E;  1AFO A;  3CX5 D;  3P7K A;  1SQV D;  5KAI H;  1VQO P;  2NPS C;  3PLN A;  2YO3 A;  2KZI A;  1VM9 A;  2ITA A;  2Y0E A;  1KTM A;  2YIU B;  5B66 H;  3D6Y A;  3L73 J;  1RF0 A;  3L70 G;  2M5A B;  5CJ4 A;  3GMA A;  4I1L A;  5AVT B;  5GTI E;  1NWQ A;  2N1T A;  1RY3 A;  3NTN A;  2KP8 A;  1BGY J;  3VYI A;  3AE9 C;  3LIE A;  5GTH E;  1NU1 J;  1N7L A;  3RL0 B;  4I7Z C;  4OWF A;  4NPE A;  1FOS E;  2KIK A;  2ZT9 B;  1VQL P;  2C9N Y;  1NO4 A;  2FY8 A;  5BU8 B;  2YIU C;  3TSI A;  2N1T B;  4WY4 A;  3VTP C;  1ZR4 A;  1PFI A;  1VQ5 P;  1LWU C;  1FQT A;  2OTJ P;  2YKO A;  5KAF E;  3H1I G;  2POH A;  1SQX D;  4BXL A;  3CWB G;  4R4M A;  1L0L G;  3L71 G;  3H1H J;  2KSJ A;  3RL0 C;  5KLI B;  1JEK A;  1FOS F;  1KFN A;  1NTM J;  3F5H A;  2DE5 D;  3HUS A;  3BCC E;  3L73 E;  2ZT9 C;  4BRY A;  4WY4 B;  1RF0 C;  1Q7Y Q;  1DX7 A;  1CW5 A;  4HYT B;  2YO2 A;  2N1T C;  1LTG C;  1ZR2 A;  1VQ7 P;  1OW8 A;  1PP9 D;  1SQQ J;  1A02 J;  1NOH A;  1FZG A;  3TDK A;  3Q5S A;  1L0N J;  3P8C E;  1BDD A;  4HJL A;  4IL6 X;  1DD4 A;  1EC5 A;  3VN0 A;  2XZR A;  1E79 H;  3HUS B;  5KLI C;  4BRY B;  2BMR A;  4EYY Q;  1BE3 J;  1Q81 Q;  4HM3 A;  3VCA A;  3Q3D A;  3EQQ A;  2KYV A;  2LXB A;  3CD6 P;  3SWF A;  5CBO A;  1R5L A;  1J1E B;  3V2Q A;  3HE4 A;  2B1X A;  1RF1 A;  4YXD C;  1KN7 A;  1NTK G;  4GDO A;  1LT1 A;  1NKZ B;  3H1J E;  4QDD A;  4JF7 A;  1YIJ P;  4TT3 H;  3EFF K;  5B5E H;  3KPE A;  4JYC A;  2QJK B;  2HOD A;  3HUS C;  2P10 A;  2I1K A;  4HM6 A;  1KFM A;  1JM0 A;  2G3A A;  2CKF A;  1SFC A;  3DQY A;  3TGU D;  1X8Y A;  2IYP A;  5AVV B;  1YYC A;  1AJY A;  3HE4 B;  2O01 H;  1ZW0 A;  1ZME C;  3EN1 A;  2WT7 A;  3KHU A;  3V6I A;  1RF1 B;  1VPC A;  3MUD A;  2E75 B;  1ZLL A;  5AW0 B;  1J1E C;  4XE5 B;  3W68 A;  4QCK A;  3GL2 A;  3L37 A;  1GU4 A;  1S2E A;  1JNM A;  3M06 A;  1KOR A;  1YIT P;  2HOD B;  4EOT A;  1JY3 P;  1BE3 E;  2D2C B;  4D6T D;  2QJK C;  1GW3 A;  1FJP A;  4C7N A;  1SFC B;  4HKV A;  3H1L E;  1BDC A;  3A7O A;  4EIJ A;  3VMY A;  2NVF A;  2WT7 B;  1EDI A;  1EDK A;  3OW2 O;  5BVZ A;  2M8R A;  1IK7 A;  1RF1 C;  4L76 A;  2E75 C;  1S9K D;  1T2K C;  2LXC B;  2JWD A;  3RK3 E;  1L0L K;  2WSE H;  3SFE C;  1AV1 A;  4C7N B;  2D2C C;  1SQV J;  4NBA D;  2QE7 H;  1SFC C;  3WMM 0;  4LC1 A;  5CXM A;  2N1T D;  5AW9 B;  3B5N D;  1O7H A;  3MUD C;  3HD7 D;  3RK3 B;  1RQU A;  1T3J A;  3C0D A;  4PV1 B;  4N78 E;  4U3F G;  3M9H A;  1S1C X;  4H44 D;  2PFX A;  1P84 E;  1EXJ A;  1JY2 N;  2GUV A;  2HMN A;  2FYU G;  1HVV A;  3H1K E;  4QUQ A;  1QLE D;  1T6A A;  2L5G B;  3CWB E;  2IBZ I;  1L0L E;  2O1J A;  1GDT A;  1VCK A;  2B24 A;  5CCH D;  1ZRT E;  5B5E E;  1MUU A;  1MKM A;  2J5U A;  3GB4 A;  2RMZ A;  3D89 A;  3CCQ P;  3RK3 C;  3PH0 A;  5DJT B;  4PV1 C;  1K05 A;  2CPS A;  1VQ9 P;  1NTZ D;  1OWA A;  1HUC A;  1SQP G;  1EQ7 A;  3AEF C;  4EI2 A;  3CXH D;  1Q82 Q;  2NRG A;  2Z4E A;  1SQB D;  3P8M C;  4IFD K;  1KYO D;  4RJT A;  1GU5 A;  5AVY B;  2P67 A;  3S9O A;  1IK9 A;  3WUV A;  1JMB A;  1MFZ A;  1KV4 A;  1NDO A;  4P1B H;  3FXE A;  1IFI A;  4C7R A;  1PV3 A;  1PP9 J;  3O8Z A;  1AQT A;  1G1I A;  1CI6 A;  5KKZ B;  3SWK A;  5E79 E;  1NTK E;  2ZFC A;  2QM8 A;  4H0L B;  1NJI Q;  1H88 A;  2MKV A;  1URQ A;  2XSH A;  3G3Z A;  3V2R A;  2XSO A;  1W2E A;  2E75 D;  4WWI A;  3GOB A;  4NBC D;  1Q2N A;  4HKZ H;  1VQM P;  1GL2 D;  1CI6 B;  3FOU A;  1XTG B;  4I2L C;  1Q90 C;  2C0W A;  3L36 A;  1S5L X;  4NBG D;  3CCS P;  5KKZ C;  4L75 A;  3L73 G;  1NAY A;  3HRN A;  3PJS K;  3LW5 J;  3CCE P;  2A06 E;  2K3R A;  2Q3W A;  5GTI H;  4H13 D;  1URQ B;  2HYN A;  1EZV D;  4UB8 E;  4H0L C;  2ZVN B;  2XRX A;  3GW6 A;  1BGY G;  5GTH H;  3BAT A;  3TGU J;  5KLV J;  3AE8 C;  1N7S A;  2KS1 A;  2JJL A;  5KJ7 A;  5AVW B;  3FGA D;  3M0D A;  5AW6 B;  5KLV K;  1JM1 A;  3H1L D;  2AEF A;  2YFL A;  4NBH D;  1KD1 Q;  1Y47 A;  5K5G B;  2HFE D;  1G8J B;  1VF5 B;  3MTU E;  3R4Y A;  5KAF H;  1URQ C;  1SLQ A;  1PGP A;  3IF4 A;  1N7S B;  3QH9 A;  2KS1 B;  2KI7 B;  2B88 A;  3L70 D;  4IL6 E;  1O7W A;  2WPR A;  2YKP A;  3E1I A;  2V4H A;  1NTM G;  2JEE A;  1PPJ G;  3CC7 P;  4GKG A;  4NB9 D;  3R2P A;  2LKM A;  1OVU A;  3HE5 A;  1KQL A;  4AUW A;  4R4L A;  5CMZ A;  2ZYA A;  3MZW B;  2W6A A;  1VF5 C;  1SQQ G;  4HJG H;  2AEJ A;  5KLV E;  2AEM A;  5AVQ B;  1L0N G;  2NUK A;  2KSE A;  1N7S C;  4N78 D;  1IFP A;  1YJ9 P;  2N9Y B;  5KJ7 C;  1X9V A;  3H1I D;  2YFI A;  2E76 B;  3M0D C;  1R8E A;  1BE3 G;  3HE5 B;  3CWB D;  3L71 D;  1EDL A;  2HR3 A;  2JZA A;  4HM5 A;  1G2C A;  1EG9 A;  2PP6 A;  1SQP E;  2IZ0 A;  1O7M A;  4UB6 H;  3JCU H;  1N8R Q;  2H7H A;  1L4A D;  1VDF A;  2AXT E;  2JP3 A;  4QUR A;  2H43 A;  2Y9Z A;  2NVE A;  2HMJ A;  2E76 C;  5CCG A;  2BEQ D;  2J58 A;  1K8A Q;  2WWW A;  3ABV C;  1NTZ J;  2KXP B;  1RH5 B;  3VP9 A;  1G2C B;  3RBX A;  1SQB J;  1FDM A;  1ULJ A;  3RK2 D;  1O7N A;  3GLM A;  3NMD A;  3KQG A;  2GM4 A;  1NU1 K;  2FXM A;  2WTY A;  1CZQ A;  4DOJ A;  1P84 I;  1USD A;  4PJ0 H;  3VMZ A;  2R5D A;  1J1D B;  2WZ7 A;  4TLF A;  1NTK D;  5EFW B;  3B4S A;  3H1K G;  1TU3 F;  1DIP A;  5AEW A;  3B8E B;  4OH8 B;  2E4Q A;  1KB9 I;  1NYK A;  1PGJ A;  3G4S P;  3L74 J;  4OVN F;  1LJ2 A;  1FE6 A;  1RFS A;  2Y9Y A;  1JTH B;  1PZQ A;  5H2F E;  1J2J B;  4DT0 A;  1NTM K;  2PRR A;  3GF3 A;  1JCD A;  1J1D C;  1BGY E;  2WSF J;  5CCG C;  2E74 B;  3D6Z A;  1NU1 E;  2QSI A;  1QVF O;  3KDP B;  2K1A A;  4YPC A;  2L91 A;  2I8D A;  4JYB A;  3TF5 A;  3N0Q A;  1FDI A;  3G71 P;  2I1J A;  2BCC J;  5CHX A;  1BCC D;  2I7F A;  1SQQ K;  2RN0 A;  3GTE A;  1HH0 A;  2OGU A;  1L0N K;  3U1A A;  3N7N A;  1N73 A;  4WY4 C;  1P84 H;  1RE3 A;  4L73 A;  4O9B A;  4K35 A;  1LGH B;  4QDF A;  2NWF A;  3U59 A;  2W27 A;  2FXP A;  3L72 D;  3LID A;  3JSV C;  3OJA B;  3USS A;  2Q3E A;  4UB6 E;  3JCU E;  2E74 C;  4AQR D;  1OXZ A;  3H1H E;  2QA4 P;  2W6B A;  2NPS D;  1KC8 Q;  3L74 E;  1NTM E;  3PTZ A;  1EXI A;  3SWY A;  1PPJ E;  2K9Y A;  5BOK A;  2YXQ B;  4HM0 A;  3PHL A;  1KB9 H;  3O6Q A;  2Y0C A;  5AEU A;  3OA7 A;  2XNX A;  3QWO C;  1N73 B;  5AW1 B;  2E4P A;  2FKW B;  1IFN A;  1H0T B;  1UUV A;  1WQL A;  3CCR P;  4QDF B;  3EWK A;  3VMX A;  3WUU A;  2PGD A;  1SQQ E;  1SVF A;  1L0N E;  1FZF A;  1JOC A;  2M3B A;  2WSS H;  4U3F D;  5AW2 B;  2A06 G;  2WPS A;  2BCC E;  3A5T A;  4PJ0 E;  2G8Y A;  2FYU D;  3O6Q B;  1MV8 A;  2H8P D;  1PP9 G;  1PGQ A;  3GHG A;  3NXS A;  1ZV8 A;  1N73 C;  1RE3 C;  5E79 H;  2IBZ D;  1QL2 A;  4P1C H;  1A02 F;  2ZXE B;  4YXW H;  3GF7 A;  3L75 D;  2NVG A;  1YBK A;  1PGO A;  3BVH A;  3RL0 D;  2XKM A;  1SQP D;  4CPG A;  3Q2Y A;  1CSB A;  3RGU A;  2JDI H;  4ZKU A;  2IFM A;  2WVR A;  2ZT9 D;  2K88 A;  1G1J A;  3GHG B;  5CJ0 A;  2HG5 D;  3F89 A;  1LTA C;  2K37 A;  1WT6 A;  3KZI E;  4NBD D;  1RIE A;  5CCG D;  1Z56 A;  1SQV K;  1OW6 A;  5DJU B;  2O01 J;  1H89 A;  4PD4 I;  1UIX A;  1OMI A;  2QVA A;  4UB8 H;  1LTT C;  1O7P A;  1QX8 A;  2FYN B;  5KLV G;  3V2P A;  1U7M A;  2R3C A;  3GHG C;  1OZH A;  3BRT B;  4WY4 D;  4ASV A;  5APT A;  1M57 D;  2ZAE B;  1LTS C;  4RKU J;  1E5W A;  5KTB A;  1VQ4 P;  3L4F A;  5BU5 A;  2M3E A;  2HMM A;  1U7J A;  3VMA A;  1LT9 A;  1G8K B;  2OQQ A;  1YTZ T;  1JY2 O;  1KB9 E;  2CPB A;  1SQX J;  3K5B A;  3CX5 E;  3SSU A;  4Y99 B;  4K3A A;  2V7Q J;  1HJ0 A;  2RH0 A;  3CCV P;  4QUP A;  3BCC D;  3L73 D;  2E43 A;  3CCL P;  1SQV E;  4IL6 H;  1AQ5 A;  4Z1M H;  2FYN C;  1LP1 A;  1NH4 A;  1SQX K;  5APW A;  4IOI H;  3I55 P;  4HM2 A;  4W7Z A;  3AEE C;  1DEB A;  3AE5 C;  1LT9 B;  1S4X A;  3LW5 H;  1IO4 A;  3P8C D;  2XU6 A;  1MZ9 A;  3S4R A;  1OIP A;  4PD4 H;  2P58 A;  1JCC A;  3E7K A;  4Y99 C;  3CI9 A;  2R44 A;  5AW7 B;  1LP1 B;  1T3U A;  4DZO A;  3AEG C;  1BCC J;  2Y0D A;  3M0A A;  2BMQ A;  5L8R J;  3PP5 A;  2H88 C;  4U7J A;  1ZP0 C;  1JY2 P;  2JO1 A;  4KJM A;  2E42 A;  2B87 A;  3CCJ P;  1LT9 C;  4XFJ A;  1T2K D;  3H1J D;  3SFD C;  3CCU P;  3AEC C;  3N4X A;  2BAS A;  3L72 J;  3RL0 g;  3VMH D;  1FZB A;  4EMJ B;  4DCK A;  2J59 M;  2QRX A;  2D2C D;  3I5C A;  2IDB A;  3OAK A;  2AXT H;  4QMA A;  3MHV A;  1SFC D;  1YI2 P;  2B87 B;  4NPD A;  3E1R A;  3V5B A;  4YTP C;  1YTZ I;  1FC2 C;  2WSC J;  1NTZ G;  1NU1 G;  2JO6 A;  1LTI C;  1PP9 E;  2YKQ A;  4WB4 A;  4N3Y B;  1SQB G;  2Q6Q A;  1BE3 D;  4M3L A;  1Y8A A;  4JQ0 D;  1D7M A;  5AW4 B;  2XDJ A;  1NGM B;  3IAO A;  1JUN A;  3GZX A;  1N86 A;  3IN6 A;  3I56 P;  3A0B H;  1KIL E;  4D6T J;  1KIL A;  2E5T A;  3CC4 P;  1IFM A;  3ZDM A;  2HPC A;  2GBX A;  1WRG A;  1LTJ A;  3RK3 D;  4XA4 A;  1BSN A;  1R5S A;  2KUB A;  4PV1 D;  3H1H G;  1QGK B;  2CK3 H;  1QL1 A;  3L75 J;  3L74 G;  4HM1 A;  4Y28 J;  2IZ1 A;  3Q1M A;  1M1J A;  5CBN A;  5H2F H;  1K04 A;  1KIL B;  1DEE G;  2P2U A;  2HPC B;  2DE7 D;  4PD4 E;  5APS A;  3H25 A;  1LTJ B;  1WMK A;  3TGU E;  1NVO A;  1HGZ A;  4RO0 A;  1S3J A;  1VQ8 P;  1GD2 E;  2BCC G;  2QEX P;  1EZV I;  1P84 D;  4RES B;  3H1K D;  1EZV G;  1M1J B;  2OTL P;  2BEZ F;  1L0L D;  4D6T E;  2YFJ A;  1KQS O;  2QG4 A;  2OYH A;  1KIL C;  1ZRT D;  5APY A;  2DW3 A;  1SP4 A;  3CLQ A;  2W83 C;  3VMI D;  1LWU A;  1KB9 D;  2O1K A;  1LTJ C;  5TIS H;  2GBW A;  4AIV A;  2H89 C;  1O7G A;  1FS0 E;  5AVZ B;  1BSH A;  2OTK E;  1PIX A;  4I7Z B;  4MN4 C;  1S9K E;  1Q90 D;  4NBE D;  3TYY A;  5C39 A;  1FZE A;  1QVG O;  3Q5R A;  3TNU A;  3MGN A;  1VQP P;  3WUT A;  1M1J C;  2OYH B;  1HTL C;  3BCC J;  1VL2 A;  3EFG A;  2C0X A;  4H0L D;  1NAF A;  2WSF H;  1LWU B;  2Q9I A;  2XR8 A;  1N2D C;  2KLU A;  1GMJ A;  1NTZ K;  3B5N A;  4GOE A;  1EDJ A;  2B9B A;  4GOF A;  3HD7 A;  2R3S A;  2YMK A;  1GK4 A;  1SQB K;  3CL3 D;  4LGD E;  4WBA A;  1JTH A;  2KNC A;  3WU2 E;  3A0B E;  3TNU B;  1USE A;  1M8O B;  1S5L H;  3FX0 A;  5AVR B;  1GZL A;  4ZKP A;  2OYH C;  1URQ D;  5HL4 A;  2YMY A;  3B5N B;  2R32 A;  4QDC A;  1RQV A;  2R5B A;  5CCH A;  3HD7 B;  3CX5 I;  3L35 A;  2IX7 C;  2KNC B;  2NUM A;  1YJW P;  1W2B O;  1SS1 A;  4WVZ A;  3H1J J;  3G9R A;  4H44 B;  2QM7 A;  2BMO A;  3G6E P;  1FDO A;  1SQV G;  2VRS A;  1AVO A;  1NTZ E;  3TK1 A;  1K73 Q;  3KZI H;  2A06 D;  5APU A;  4LLH A;  4IFM A;  3CXH E;  1VF5 D;  1SQB E;  1KYO E;  1VQ6 P;  1YJN P;  2OYO A;  5AW8 B;  3B5N C;  1ULI A;  1N7S D;  1M90 Q;  1HWT C;  1YQ4 C;  3HD7 C;  5KJ7 D;  3GCE A;  1JY3 N;  1LNQ A;  3MP7 B;  1ZN5 A;  4I6M C;  2NZ2 A;  3RBZ A;  1H0T A;  4H44 C;  2OAR A;  3B71 A;  1RE4 A;  5TIS E;  3D71 A;  5AVX B;  1OFC X;  1AA0 A;  1JMM A;  1KIL D;  2K9J A;  1HGV A;  4OGQ B;  2HMK A;  3H1L J;  1JY3 O;  2FBW C;  2W6J H;  3GG2 A;  2C9L Y;  2YXR B;  3CCM P;  5KAI E;  5CCH C;  1IJD B;  3C9I A;  4IFF A;  2KZJ A;  3M9Q A;  1VQN P;  3A0H H;  2MJZ A;  3C1L A;  2QIW A;  1SQX G;  3GKE A;  2Q7C A;  2WPQ A;  3V4W A;  3CX5 H;  5B66 E;  2E76 D;  3L70 J;  1GL2 A;  1ZOY C;  3KXD A;  2K9J B;  3CC2 P;  1LTB C;  1X22 A;  1KQG B;  1HBW A;  1FZA A;  1DH3 A;  4PD4 D;  3BRV B;  1IFD A;  3AE1 C;  4OGQ C;  1KQF B;  1YHQ P;  1M56 D;  5KLV D;  1X0T A;  4ASW A;  3C8V A;  1EZV E;  2Q1K A;  1OVR A;  3U1C A;  1QEX A;  3D70 A;  5APV A;  1S5L E;  1GTW A;  3HTK A;  1GL2 B;  3II6 A;  1FJK A;  1UII A;  2FXO A;  1XTC C;  2Q3I A;  1BCC G;  2GUS A;  1RE4 C;  3H1I J;  2YNY A;  3H1K J;  4NB8 D;  1JB0 J;  2KB7 P;  3CWB J;  4H13 B;  2HMO A;  1L0L J;  3L71 J;  1FU1 A;  3AZC A;  2IYO A;  1L2P A;  3VP8 A;  3L72 G;  2ZYD A;  3HTK B;  2V7Q H;  2UWJ E;  3MD0 A;  3L70 E;  4C46 A;  2LR2 A;  1Y9B A;  1GL2 C;  2B89 A;  4AAY B;  5TJH A;  3GL0 A;  2E5Y A;  2WPV B;  4H13 C;  3KYQ A;  3TGU G;  2OYI A;  5APX A;  3VOP A;  4KT0 J;  2WQY C;  1T8Z A;  3H32 A;  3H1I E;  2E74 D;  3VMG D;  2W8Z A;  1IC2 A;  3BAS A;  1NTK J;  3A0H E;  4D6T G;  2QJP B;  3NFQ A;  3FWL A;  3L71 E;  4NBB D;  2ZVO B;  3GZY A;  2PAJ A;  1X79 B;  2OYI B;  2Z5I A;  1M1K Q;  2WSE J;  2Q5U A;  4JBZ A;  1M7L A;  2A45 I;  2IBZ G;  2JWA A;  2KK7 A;  1NTK K;  3V2N A;  4ZMD A;  3IR9 A;  3Q5P A;  1S72 P;  1AVY A;  2ZYL A;  3L75 G;  3UIA A;  4N6J A;  2A45 G;  3H32 B;  3AE3 C;  1L4A A;  1JO5 A;  4BWN A;  1NHL A;  1BGY D; 
#chains in the Genus database with same CATH homology
 3BCC E;  3L73 E;  1BCC E;  2BMQ A;  4PV1 D;  2DE6 D;  2HML A;  1L0L E;  2IBZ E;  1Q90 C;  3GL2 A;  4H0L D;  4HM7 A;  5AEU A;  4NBF D;  3AZC A;  1VCK A;  4NBG D;  2B24 A;  3L75 E;  5KLV E;  2XR8 A;  1ZRT E;  2NUK A;  5KKZ C;  2E4P A;  1O7P A;  4HM1 A;  1SJG A;  1UUV A;  1BE3 E;  1WQL A;  4OGQ D;  5AEW A;  4QDF B;  3GB4 A;  2QJP C;  3D89 A;  3L70 E;  1SQQ E;  2A06 E;  2QJK C;  2E4Q A;  2Q3W A;  1NYK A;  2HMK A;  1VM9 A;  2YFI A;  4H13 D;  4HKV A;  3H1L E;  1L0N E;  4AAY B;  3L72 E;  2NVF A;  2XRX A;  4HJL A;  2DE7 D;  1RFS A;  4PD4 E;  3VMH D;  4EMJ B;  2BCC E;  3TGU E;  3GTS A;  5KLI C;  2D2C D;  3GKE A;  2HMM A;  3GL0 A;  2BMR A;  1G8K B;  2JZA A;  4HM5 A;  1UUW A;  1EG9 A;  2E76 D;  1BGY E;  1SQP E;  1KB9 E;  5HL4 A;  4HM3 A;  3VCA A;  1O7M A;  3EQQ A;  1NU1 E;  2QPZ A;  1NDO A;  4P1B H;  1JM1 A;  1SQX E;  4QDC A;  4HM4 A;  3CX5 E;  2YFL A;  4NBH D;  3N0Q A;  2YVJ B;  4QUP A;  2I7F A;  4P1C H;  4QUR A;  2B1X A;  4NBA D;  1SQV E;  2NUM A;  2JO6 A;  4QCK A;  3GTE A;  1G8J B;  1PP9 E;  2FYN C;  4D6T E;  2YFJ A;  2NVE A;  2HMJ A;  3H1J E;  5CXM A;  3H1I E;  2NVG A;  4QDD A;  2E74 D;  3VMG D;  2BMO A;  1EZV E;  2YIU C;  4HM2 A;  1O7H A;  3VMI D;  4U3F E;  1NTZ E;  1NTK E;  1FQT A;  2GBW A;  2QJY C;  4AIV A;  3L71 E;  1O7G A;  4NBB D;  3CXH E;  1O7W A;  3GZY A;  4HM6 A;  2ZT9 D;  3C0D A;  2FYU E;  2NWF A;  4QDF A;  3GZX A;  1VF5 D;  1SQB E;  1ULJ A;  4NBE D;  1O7N A;  2CKF A;  1KYO E;  4NB9 D;  2XSH A;  4H44 D;  4NBD D;  3DQY A;  2XSO A;  2E75 D;  1P84 E;  3H1H E;  1ULI A;  4HM8 A;  3EN1 A;  1RIE A;  2ZYL A;  2HMN A;  2GBX A;  3H1K E;  4NB8 D;  3GOB A;  4QUQ A;  3L74 E;  2DE5 D;  1NTM E;  3GCE A;  4NBC D;  3VCP A;  1PPJ E;  3FOU A;  3CWB E;  5BOK A;  4HM0 A;  2HMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...