1BE3E

Cytochrome bc1 complex from bovine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 40
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1be3E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1be3E02
1G8JB 2DE6D 2NUKA 4HM2A 1NTZE 2FYUE 1RIEA 2BMQA 2YIUC 4HM4A 2HMJA 3L75E 2GBWA 5AEUA 3VCPA 1O7HA 4NBED 3GL2A 2HMNA 2JZAA 2D2CD 2NUMA 3CX5E 4AAYB 1KB9E 3VCAA 2QJYC 1O7PA 3D89A 2HMLA 4H0LD 3CXHE 2E75D 4NBDD 4NBFD 2BCCE 4HKVA 1O7WA 4QDFA 1ZRTE 1O7NA 2BMOA 2NVEA 2ZYLA 5KLVE 2HMOA 1NTKE 4QUQA 2DE5D 5AEWA 4PV1D 3TGUE 2XSHA 4HM1A 4P1BH 1L0LE 1SQQE 3CWBE 1UUWA 1ULIA 4QDFB 1PP9E 3GB4A 4OGQD 4QURA 4P1CH 3VMHD 1EG9A 2NVFA 3VMGD 3GL0A 2HMMA 4NBBD 2FYNC 1SQVE 3GCEA 2YFJA 4HM5A 1EZVE 1NU1E 1NYKA 3AZCA 2CKFA 4HM7A 4H44D 3N0QA 2E4QA 2XSOA 1NTME 2B1XA 4QUPA 3H1HE 3VMID 1G8KB 3EQQA 1BCCE 4HM6A 1BE3E 4HM3A 4EMJB 3L74E 1RFSA 1NDOA 3H1IE 3H1LE 1L0NE 1PPJE 1BGYE 3C0DA 2ZT9D 1JM1A 3GOBA 4PD4E 4QDDA 5HL4A 1KYOE 3GTEA 2B24A 5KKZC 1ULJA 4NBCD 2E4PA 4HM8A 4NB8D 2IBZE 2BMRA 3GZXA 3L72E 4QDCA 4NB9D 1VF5D 2E74D 4NBHD 3L71E 2YFLA 3DQYA 5CXMA 1WQLA 4H13D 2DE7D 1UUVA 1SQXE 2GBXA 2XRXA 2HMKA 4HM0A 2NVGA 2YVJB 3L70E 4NBGD 3H1JE 5BOKA 1P84E 1SQPE 1SQBE 2E76D 2QJKC 2QPZA 4D6TE 3GTSA 4AIVA 2QJPC 3EN1A 2A06E 1Q90C 2JO6A 4HJLA 2NWFA 4QCKA 4NBAD 3FOUA 2I7FA 4U3FE 1VM9A 3GKEA 3H1KE 2Q3WA 1VCKA 1SJGA 2XR8A 5KLIC 3GZYA 3BCCE 1O7MA 2YFIA 1FQTA 1O7GA 3L73E
chains in the Genus database with same CATH superfamily
3TGUJ 2IZ0A 1G1IA 2YIUB 2J58A 1KB9I 1EZVI 1KFMA 3AEGC 5AEUA 4GIFA 3H1IG 1SQBD 1SS1A 3RK2C 2E75D 2WITA 5M1BA 1IJDB 1AA0A 1EXJA 2GUSA 3AEDC 3H1IJ 4AYCA 1N73C 2IFMA 1KMIZ 2XDJA 4QURA 1JUNA 3M91A 5AVWB 2FYUK 3L75G 4NBBD 2PP6A 2KS1B 2PFXA 5DJTB 4Z1MH 1YITP 3L70J 2E42A 1U7MA 2B89A 1L4AC 1GL2C 3F5HA 1CZQA 2I1JA 3CC2P 1JO5A 2BMRA 2WSEH 3OA7A 3H1KJ 1VF5D 1PP9G 4ASWA 1Q7YQ 1E79H 2RMZA 1X22A 4WBAA 2DE7D 3BRVB 2WPVB 5APYA 1H89A 3L73J 2LXCB 1FZCC 5AVZB 5CCHD 3V4WA 2N9BA 4HJLA 4GT1A 5B5EE 1SQQG 1LWUC 5APUA 1M1KQ 2ZYGA 3CC4P 1HWTC 5TISE 1QLED 3S1KA 3GF7A 1NU1D 2KK7A 1SQXD 3B71A 3HD7B 2VRSA 1SQQJ 3TYYA 2KI7B 2JWDA 1Q81Q 3GL2A 1SQBG 1JMMA 2A06G 1LWUB 2HMLA 2WSFH 2BCCE 2RN0A 3AEFC 1NTKE 1EC5A 2AXTH 4K3AA 2KS1A 4P1BH 1FBMA 1DD3A 2I1KA 1LTAC 4DOJA 3CL3D 1S5LE 3A3YB 4TLFA 4YPCA 4R4MA 3VN0A 3AZCA 1BCCE 1JM0A 1J1EB 5B66H 1ZRTD 2FBWC 3M06A 2ZT9D 2CPSA 3RK3D 2B24A 3JC22 2J59M 4WVZA 4PJ0H 4HM8A 2N1TB 1GK4A 4QDCA 3V2PA 3MP7B 4CPGA 2OTLP 2RH0A 1S3JA 1BSHA 3T97B 3TNUB 2O01J 2M3BA 3MTUE 2G8YA 1J1DB 1VDFA 1DEEG 3GW6A 2FY8A 2D2CC 2LR2A 3GTSA 1NTMK 2P7JA 3CX5H 3QH9A 5APXA 3L74G 3CXHH 4EYYQ 2NWFA 1L0LD 4U3FE 1VM9A 2WTYA 2KZIA 3HD7A 5KLIC 3WU2H 2JR8A 3CLQA 4XA4A 4QMAA 5KJ7C 2YMKA 1SQXG 1LWUA 3SWYA 1ZW0A 4N6JA 3L75E 3GHGB 1S9KE 1OZHA 1L2PA 1FDOA 2HLOA 1SQPG 2HMNA 1FAVA 1PGJA 1NU1J 1JY2P 2IBZD 5CCGC 4L74A 4YXWH 3RL0C 2NVEA 1KV4A 3L71D 3M0AA 1NHLA 3PJSK 2R3SA 3MZWB 1PP9E 3BVHA 3WUVA 2ZVOB 2O1KA 3F89A 1HTLC 2K3RA 2KB7P 4PD4I 2N1TA 3FX0A 1VQ9P 2E76B 3RL0B 1EDKA 1KC8Q 3Q2YA 1FJPA 3T97A 5AW2B 3TNUA 1VQNP 5KAIE 2WVRA 1YBKA 3D6YA 1FZBA 1NWQA 3RK2D 1SQVD 4RO0A 2FYZA 1KQFB 3IFMA 1IC2A 3VMZA 1K05A 2GUVA 3JCUH 1N86A 2ZXEB 1VQKP 1SQBE 2QJKC 3M9HA 2IZ1A 3V2QA 2A06E 4EOTA 3S9OA 1FZEA 3EWKA 1KILE 1KILC 3MHVA 3GHGA 4PV1B 1QX8A 2FXOA 3NTNA 2FXPA 4HM4A 1L0LJ 1OW8A 2QJKB 1JY3N 2A45H 3H6PA 5AVTB 1HGZA 2NZ2A 3SWFA 1HF9A 3AEAC 3CI9A 5AVQB 2MJZA 2IBZG 2WPRA 3LIEA 2Q6QA 3ABVC 1HGVA 1KFNA 3AE4C 5AVUB 3FWNA 1SFCC 2FYUG 3IR9A 3H32B 2NVFA 3E1IA 1P84I 1LTSC 3L71J 4L73A 5APQA 4C7NB 3GCEA 3UIAA 3HE4B 4KJMA 5CCHC 2R5DA 3L74E 1NDOA 5GTIH 3QWOC 3Q1MA 1ULJA 2QG4A 1SFCB 4BXLA 1YJ9P 4XE5B 2L5GB 2FFDB 3CCJP 3MIWA 5AVRB 1RF1B 1SQVG 1SQXE 2XRXA 3KHUA 4L76A 2BCCD 1SQPE 4D6TE 4WY4C 1KB9H 1NTKD 4M3LA 1MZ9A 1YJNP 1T3UA 2Q3WA 2N1TD 2WQYC 1JB0J 1VQ6P 1XTGB 1M7LA 2OYHC 1BDCA 4OGQB 1OIPA 2KZJA 3R2PA 3H1JD 1BCCD 1FZAA 2PAJA 1VQ7P 1JMBA 3WUTA 1PGOA 1GD2E 1OVUA 2O1JA 5BU8B 1LJ2A 1ZRTE 5AW3B 3H32A 2ZT9C 5L8RJ 3RK3E 2FXMA 3RK3C 2DE5D 4C7NA 1JNMA 2OYHB 3SWKA 2JKVA 1Z56A 3HE4A 2Y0DA 1NTZK 1NH4A 5AW7B 3GL0A 3D71A 2FYNC 1QVFO 2GM4A 4U3FD 4I2LC 1SFCA 1N7SB 2O01N 3C9IA 1YTZT 2FFDA 1QVGO 2JO1A 1PPJE 1BGYE 4JF7A 3LW5J 1RF1A 2AXTE 1Q86Q 1LGHB 2YO3A 2Z4EA 5CJ4A 2LKMA 3L75D 1WT6A 4TT3H 4N3YB 3A7OA 2JDIH 1QL1A 5C39A 4OWFA 1NOHA 5BOKA 2Y0CA 1MKMA 2BCCG 1Q2NA 4JBZA 2QA4P 1PL5A 2E76D 3RL0D 1HH0A 1NTKG 2E5TA 3CCRP 3U1AA 1DH3A 2JEEA 3SFEC 1PP9D 4PJ0E 2BCCJ 1MV8A 5BU5A 2PRRA 1NTKJ 1S1CX 3A2AA 2FYUE 2G3AA 1AFOA 2YIUC 1FDMA 1ZOYC 1A02F 2I8DA 3H1JG 1LTBC 1AQTA 3MUDC 1M57D 3CX5E 2OYHA 2QJYB 3CXHE 1VQLP 1FS0E 2E5YA 4HKVA 2W83C 2BMOA 1S5LX 1BCCJ 4PV1D 2QM8A 3WU2E 2K88A 2QM7A 3M9BA 3Q5SA 4N78E 4WWIA 3CCLP 1Y47A 5E79H 4R4LA 2O01H 3VMHD 2FKWB 4MN4C 4H13B 1SQVE 1NKNA 4GODA 2H43A 2A06D 3E7KA 4U3FG 1KYOI 1X8YA 1KILD 1PFIA 3CPWO 3H1HE 1VQ4P 4HYTB 4EMJB 5KLVD 2NPSB 3V6IA 5AW8B 2H88C 1ZR4A 1RE3A 3MGNA 1GMJA 1HBWA 2AXCA 3CCSP 2ZVNB 2V7QJ 1D7MA 4UB8H 2C9NY 2NRGA 1DIPA 3L75J 2QJPB 1Q90C 1JY3O 3WMM0 2C9LY 1AJYA 3TK1A 3VMYA 1SFCD 3L72D 2N9YB 3IAOA 2KYVA 1K9MQ 1LTGC 1G8JB 1IK9A 5AVXB 3HD7C 3GF3A 3RGUA 3N4XA 3I5CA 1PP9J 1JCDA 3JCUE 3L74D 3AE6C 1ZXGA 3RBXA 1YHQP 2CPBA 2P10A 4A7PA 3MUDA 4PD4H 3NMDA 3KXDA 4GDOA 1USDA 2IPPA 1NJIQ 1TU3F 5APTA 1ZMEC 4OGQD 1SP4A 1SQPD 1LP1B 4LC1A 2HMMA 4D6TD 1M8OB 4WY4D 2YFJA 3W67A 2IX7C 3V4QA 2CK3H 2NPSA 1IFPA 1NTME 2DW3A 1IFIA 3VP9A 1CSBA 1J1EC 5KLVG 1SQBJ 5HL4A 3FXEA 3A0BH 1GW4A 2IYOA 2N1TC 2ITAA 5CXMA 1XTCC 3SFDC 1G2CB 1NYHA 3CCUP 2Y0EA 1GU5A 1OVRA 1W2BO 3H1JE 3KPEA 1J1DC 2W27A 3ZDMA 3GMAA 3RBZA 4NPEA 5GTIE 1H8AA 1L0NK 4IFMA 1YJWP 2WSCH 3L72G 1H88A 1IFDA 3P8MC 1R5LA 4Y28J 4IL6H 3GHGC 3KYQA 2M8RA 2W6AA 2YXQB 1PPJD 1BGYD 4H44B 2HYNA 1KB9E 3VCAA 3D89A 2KP8A 1KORA 4NBDD 4ASVA 1O7WA 3B8EB 3VTPC 2ZYLA 1OXZA 3L74J 4IFDK 2KUBA 2YKOA 3A5TA 1NTZG 1ULIA 2JJLA 2UWJE 1EG9A 3B5NC 1A02J 4D6TG 1JOCA 4HH2A 3A0HH 2QRXA 2B1XA 1SQXJ 3H25A 2E76C 1R8EA 1BE3E 1SQPJ 1BDDA 2R44A 3GOBA 4D6TJ 2OTJP 1G2CA 2JP3A 1T8ZA 3IF4A 2FYUD 3L37A 5KAFH 1EDIA 3GZXA 5AVYB 3CWBD 3B5NB 4YXDC 4H13D 1K04A 2WSEJ 3CX5D 3G71P 3M0DC 2SPZA 3O8ZA 1G1JA 3CXHD 1SLQA 3CCMP 1NKZB 1M1JB 2ZYDA 1FDIA 4NBAD 1MUUA 2NPSD 1NO4A 4N78D 2XZRA 1GTWA 5AVVB 4PV1C 1FU1A 1O7GA 4LLHA 1J2JB 2XNDH 2R5BA 3H1HD 1OW6A 1VL2A 3L36A 3CC7P 2WPSA 3G3ZA 1YTZI 1LTJB 1PPJG 1BGYG 1JY2N 1ZLLA 1KN7A 3AEEC 1K73Q 1N2DC 1VPCA 3B4SA 5KLVE 2K1AA 2WSFJ 3FXDA 1BGYJ 5B5EH 2KSJA 3D70A 3VMAA 1AV1A 2E74B 1X9VA 2M0BA 2WT7B 1Q90D 2KNCB 2XU6A 2CKFA 4BWNA 5AW1B 1FC2C 2BEQD 4HM6A 3HRNA 3B5NA 2IBZI 1RY3A 1T2KC 2V4HA 4NB8D 2E75B 3HD7D 1VQMP 3L72E 3CWBG 2FFDC 1DD4A 1SQQK 5E79E 3VOPA 4UB6H 4RKUJ 1M1JA 1RF1C 2B87B 1IFMA 2K37A 5AW4B 2W6BA 1FOSE 1U7JA 1W2EA 2P2UA 2FYUJ 2OYIB 1JCCA 2HPCB 1YI2P 3H1LD 3K5BA 4H0LB 3M0DA 4QCKA 1ZR2A 1SQBK 1VCKA 2M3EA 3EFGA 3Q5PA 1LTJA 1HJ0A 2W8ZA 1LTIC 1NTZE 1RIEA 1NTMD 4OGQC 3H1HG 1R5SA 3KDPB 3VMXA 1SQVJ 4K35A 3KZIH 1RHZB 4O9BA 3H1HJ 1KYOH 4QUQA 3OJAB 3HUSB 2KLUA 2WT7A 3G6EP 3BCCD 2KNCA 1OVVA 2R32A 2IDBA 3Q3DA 4QDFB 2W6JH 1GW3A 3MD0A 1FZFA 3AE3C 1RH5B 2XKMA 4ZNCA 1NYKA 4H44D 2XSOA 2KOGA 5CHXA 4QUPA 1JTHB 1N7SC 1W5CE 4EDFA 2Z5IA 3VMID 1CI6B 2KXPB 1PV3A 1X0TA 1JM1A 4PD4E 5KKZB 1X79B 2B87A 2OYIA 1YQ4C 2ZAEB 5EFWB 2YFLA 2YKQA 2HPCA 1USEA 1KB9D 1EZVD 3NFQA 2AEFA 2QSIA 4JYCA 1RE3C 1NU1K 3S4RA 1SQXK 4AIVA 3CCQP 5H2FH 2JO6A 3H1LG 2B88A 2OQQA 2I7FA 1KYOD 1RQVA 3CMAP 3A0BE 1PIXA 3B5ND 1OX3A 2A45G 2JWAA 4I7ZB 1NTMG 2YMYA 2HMJA 1BE3D 2MKVA 2J5UA 3D6ZA 5B66E 3HUSA 1AVOA 3CD6P 5CBNA 2QJYC 1Y9BA 1NTMJ 1Y8AA 4QDFA 3H1KD 1MFZA 5AEWA 4HKZH 3BCCG 1IK7A 3EQ2A 3CWBE 1OW7A 1UUWA 1JTHA 1LTTC 2ZJSE 1CI6A 4H13C 3U1CA 4C46A 1OFCX 4IL6E 1OWAA 4HM7A 2WPQA 2E4QA 3AE8C 3PHLA 2HFED 1AVYA 3HE5B 3H1JJ 3FWLA 1NAYA 3V5BA 2NPSC 2YKPA 5DJUB 1PGQA 1N7SA 4NB9D 1VQOP 2E74D 2HR3A 3AE5C 1L0LK 1SVFA 2OGUA 2Z5HA 1IFNA 2C0WA 1EZVG 3A0HE 4U7JA 4NBGD 4RJTA 1S2EA 5CBOA 2YO2A 3V2NA 1LNQA 2QJPC 1QEXA 3LIDA 1ZP0C 2ZXXA 1JY2O 4U3FJ 5KAFE 3GZYA 1O7MA 2DE6D 1IFJA 2K9JB 1WRGA 1HJBA 3L70G 1GK6A 1DX7A 1BE3G 4YTPC 3VCPA 1GDTA 2JZAA 2RKLA 3RK2B 1T2KD 1Q82Q 2Q7CA 4H0LD 3BASA 4XFJA 2QEXP 3BATA 1O7NA 3H1KG 3I55P 4AUWA 1BE3J 3AE9C 1VQ5P 3L73G 1N73B 3HE5A 3EFFK 2YXRB 1YQ3C 1URQC 4AQRD 1KQGB 3O6QB 2M5AB 1M90Q 4DZOA 3ITKA 1SQVK 1EXIA 3EQQA 2HG5D 3H1LE 1L0NE 1L4AB 1GL2B 1NTZD 3PTZA 3FGAD 1URQB 1RE4C 3PH0A 1YYCA 3DQYA 3L35A 1UUVA 3AECC 4W7ZA 1KD1Q 5AW5B 5GTHH 1FZCB 2OARA 3PLNA 4DCKA 3CCVP 1VQPP 1FZGA 2K9JA 4I6MC 1YIJP 1OMIA 4GOEA 3BCCE 3G4SP 5KLVJ 4UB6E 1N7SD 1O7HA 4NBED 4RESB 4H44C 4PD4D 5CMZA 2H8PD 4NBFD 1N73A 1NVOA 3TGUE 3O6QA 4Y99C 2M5AA 4ZMDA 1JEKA 4HB1A 3G9RA 4P1CH 3L72J 2QVAA 5AW9B 1PGPA 1L4AA 1EZVE 1KQLA 2Q1KA 2WSSH 4ZKPA 1P84H 1GL2A 1HUCA 5APVA 1URQA 2Q9IA 3KZIE 1LP1A 3HTKB 3P8CD 4Y99B 3H1IE 1KYOE 3GTEA 4JPZB 4NBCD 1NTKK 2E43A 1FZCA 3RL0g 4DJGA 2GBXA 2WMMA 2OYOA 1NU1G 3L70E 1NTZJ 1GZLA 1RE4A 2D2CB 2QPZA 1M1JC 1T6AA 2HODB 3H1KE 5CJ0A 3R4YA 5KLIB 2KLVA 3L73E 4NPDA 4EIJA 2NUKA 2Q3IA 2IYPA 4HM2A 4GKGA 3C1LA 2BMQA 2QE7H 2POHA 1VQ8P 2GBWA 1P84D 3U59A 1LTJC 1JY3P 2NUMA 4JQ0D 2WZ7A 5H2FE 3NXSA 2P1JA 2LXBA 5APSA 1SQQE 2KSEA 2Y9ZA 2E74C 3GB4A 1S4XA 4OVNF 1FE6A 3HTKA 4OH8B 3TSIA 3AE7C 1H0TB 3Q5RA 4LGDE 3LW5H 3GLMA 4W7YA 4HM3A 1RFSA 1LT9C 4W80A 3C0DA 4QDDA 1UIIA 1QL2A 2E4PA 5TJHA 2E75C 1BSNA 1L0LG 1IZNB 5TISH 3JSVC 3CMEP 1EDLA 2XNXA 3V2RA 1KZUB 4WB4A 3L4FA 2HODA 3N7NA 2OYIC 1LT9B 3WUUA 5AW0B 5KJ7A 4H0LC 1L4AD 3AE2C 1GL2D 3C8VA 3GKEA 1KILB 1SJGA 4L75A 1URQD 2ZFCA 1K8AQ 2K9YA 2YFIA 3L71G 5AVSB 2WSCJ 2BEZF 1GU4A 3CX5I 1S5LH 5CCGA 3CWBJ 1VF5C 3CXHI 1L0ND 1S72P 1ZN5A 4ZKUA 4IFFA 1U57A 1O7PA 2H89C 2HMOA 3PP5A 2L91A 1DEBA 3HUSC 4IL6X 4HM1A 3II6A 1H0TA 5KTBA 5KLVK 3PRJA 3OW2O 1VF5B 2W90A 4UB8E 3E1RA 3VMGD 2Q5UA 4HM5A 1RQUA 1NU1E 4C7RA 2GA1A 1KQSO 4BRYB 4I1LA 4EI2A 3W68A 1E5WA 3OAKA 5K5GB 5KKZC 2IFNA 1NAFA 3SSUA 2P67A 1LT9A 4NBHD 2O3JA 2V7QH 1WQLA 2XV5A 1MFTA 2HMKA 4HM0A 2YVJB 4KT0J 1KILA 2H7HA 4WY4B 4IOIH 1EDJA 1RF0C 2C0XA 3TGUD 1T3JA 1WMKA 2Q3EA 2XR8A 1IO4A 1HVVA 2ZYAA 3AE1C 2AEMA 1FQTA 2OTKE 3P32A 4I7ZC 1FJKA 1QGKB 3IN6A 3TF5A 5GTHE 3H1ID 1L0NG 2D2CD 3P7KA 4DT0A 4AAYB 1SQPK 1LT1A 2BASA 4JYBA 3P8CE 2ZT9B 1UIXA 3RK3B 2XSHA 5KAIH 2R3CA 1EQ7A 1L0NJ 3H1LJ 5KJ7D 1L0LE 2A45I 3L70D 4BRYA 5CCHA 1S9KD 2FYNB 4GOFA 3KQGA 3N0QA 3AEBC 1FOSF 1AQ5A 1G8KB 5APWA 5CCGD 2B9BA 4B86A 5AW6B 3L73D 2WWWA 1CW5A 4HJGH 2IBZE 2PGDA 3I56P 1N7LA 1PZQA 3L71E 3GG2A 1ZV8A 3VYIA 4WY4A 4NPFX 3BCCJ 3USSA 2NVGA 2QIWA 2YNYA 2Y9YA 1P84E 3TDKA 3VP8A 2AEJA 5BVZA 1BCCG 3EN1A 3TGUG 3CCEP 2KIKA 3FOUA 1NGMB 1SQQD 3BRTB 3M9QA 1KTMA 1N8RQ 4KHXA 1RF0A 2P58A 1M56D
chains in the Genus database with same CATH topology
1G8JB 2DE6D 2NUKA 4HM2A 1NTZE 2FYUE 1RIEA 2BMQA 2YIUC 4HM4A 2HMJA 3L75E 2GBWA 5AEUA 3VCPA 1O7HA 4NBED 3GL2A 2HMNA 2JZAA 2D2CD 2NUMA 3CX5E 4AAYB 1KB9E 3VCAA 2QJYC 1O7PA 3D89A 2HMLA 4H0LD 3CXHE 2E75D 4NBDD 4NBFD 2BCCE 4HKVA 1O7WA 4QDFA 1ZRTE 1O7NA 2BMOA 2NVEA 2ZYLA 5KLVE 2HMOA 1NTKE 4QUQA 2DE5D 5AEWA 4PV1D 3TGUE 2XSHA 4HM1A 4P1BH 1L0LE 1SQQE 3CWBE 1UUWA 1ULIA 4QDFB 1PP9E 3GB4A 4OGQD 4QURA 4P1CH 3VMHD 1EG9A 2NVFA 3VMGD 3GL0A 2HMMA 4NBBD 2FYNC 1SQVE 3GCEA 2YFJA 4HM5A 1EZVE 1NU1E 1NYKA 3AZCA 2CKFA 4HM7A 4H44D 3N0QA 2E4QA 2XSOA 1NTME 2B1XA 4QUPA 3H1HE 3VMID 1G8KB 3EQQA 1BCCE 4HM6A 1BE3E 4HM3A 4EMJB 3L74E 1RFSA 1NDOA 3H1IE 3H1LE 1L0NE 1PPJE 1BGYE 3C0DA 2ZT9D 1JM1A 3GOBA 4PD4E 4QDDA 5HL4A 1KYOE 3GTEA 2B24A 5KKZC 1ULJA 4NBCD 2E4PA 4HM8A 4NB8D 2IBZE 2BMRA 3GZXA 3L72E 4QDCA 4NB9D 1VF5D 2E74D 4NBHD 3L71E 2YFLA 3DQYA 5CXMA 1WQLA 4H13D 2DE7D 1UUVA 1SQXE 2GBXA 2XRXA 2HMKA 4HM0A 2NVGA 2YVJB 3L70E 4NBGD 3H1JE 5BOKA 1P84E 1SQPE 1SQBE 2E76D 2QJKC 2QPZA 4D6TE 3GTSA 4AIVA 2QJPC 3EN1A 2A06E 1Q90C 2JO6A 4HJLA 2NWFA 4QCKA 4NBAD 3FOUA 2I7FA 4U3FE 1VM9A 3GKEA 3H1KE 2Q3WA 1VCKA 1SJGA 2XR8A 5KLIC 3GZYA 3BCCE 1O7MA 2YFIA 1FQTA 1O7GA 3L73E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8J B;  2DE6 D;  2NUK A;  4HM2 A;  1NTZ E;  2FYU E;  1RIE A;  2BMQ A;  2YIU C;  4HM4 A;  2HMJ A;  3L75 E;  2GBW A;  5AEU A;  3VCP A;  1O7H A;  4NBE D;  3GL2 A;  2HMN A;  2JZA A;  2D2C D;  2NUM A;  3CX5 E;  4AAY B;  1KB9 E;  3VCA A;  2QJY C;  1O7P A;  3D89 A;  2HML A;  4H0L D;  3CXH E;  2E75 D;  4NBD D;  4NBF D;  2BCC E;  4HKV A;  1O7W A;  4QDF A;  1ZRT E;  1O7N A;  2BMO A;  2NVE A;  2ZYL A;  5KLV E;  2HMO A;  1NTK E;  4QUQ A;  2DE5 D;  5AEW A;  4PV1 D;  3TGU E;  2XSH A;  4HM1 A;  4P1B H;  1L0L E;  1SQQ E;  3CWB E;  1UUW A;  1ULI A;  4QDF B;  1PP9 E;  3GB4 A;  4OGQ D;  4QUR A;  4P1C H;  3VMH D;  1EG9 A;  2NVF A;  3VMG D;  3GL0 A;  2HMM A;  4NBB D;  2FYN C;  1SQV E;  3GCE A;  2YFJ A;  4HM5 A;  1EZV E;  1NU1 E;  1NYK A;  3AZC A;  2CKF A;  4HM7 A;  4H44 D;  3N0Q A;  2E4Q A;  2XSO A;  1NTM E;  2B1X A;  4QUP A;  3H1H E;  3VMI D;  1G8K B;  3EQQ A;  1BCC E;  4HM6 A;  1BE3 E;  4HM3 A;  4EMJ B;  3L74 E;  1RFS A;  1NDO A;  3H1I E;  3H1L E;  1L0N E;  1PPJ E;  1BGY E;  3C0D A;  2ZT9 D;  1JM1 A;  3GOB A;  4PD4 E;  4QDD A;  5HL4 A;  1KYO E;  3GTE A;  2B24 A;  5KKZ C;  1ULJ A;  4NBC D;  2E4P A;  4HM8 A;  4NB8 D;  2IBZ E;  2BMR A;  3GZX A;  3L72 E;  4QDC A;  4NB9 D;  1VF5 D;  2E74 D;  4NBH D;  3L71 E;  2YFL A;  3DQY A;  5CXM A;  1WQL A;  4H13 D;  2DE7 D;  1UUV A;  1SQX E;  2GBX A;  2XRX A;  2HMK A;  4HM0 A;  2NVG A;  2YVJ B;  3L70 E;  4NBG D;  3H1J E;  5BOK A;  1P84 E;  1SQP E;  1SQB E;  2E76 D;  2QJK C;  2QPZ A;  4D6T E;  3GTS A;  4AIV A;  2QJP C;  3EN1 A;  2A06 E;  1Q90 C;  2JO6 A;  4HJL A;  2NWF A;  4QCK A;  4NBA D;  3FOU A;  2I7F A;  4U3F E;  1VM9 A;  3GKE A;  3H1K E;  2Q3W A;  1VCK A;  1SJG A;  2XR8 A;  5KLI C;  3GZY A;  3BCC E;  1O7M A;  2YFI A;  1FQT A;  1O7G A;  3L73 E; 
#chains in the Genus database with same CATH topology
 3TGU J;  2IZ0 A;  1G1I A;  2YIU B;  2J58 A;  1KB9 I;  1EZV I;  1KFM A;  3AEG C;  5AEU A;  4GIF A;  3H1I G;  1SQB D;  1SS1 A;  3RK2 C;  2E75 D;  2WIT A;  5M1B A;  1IJD B;  1AA0 A;  1EXJ A;  2GUS A;  3AED C;  3H1I J;  4AYC A;  1N73 C;  2IFM A;  1KMI Z;  2XDJ A;  4QUR A;  1JUN A;  3M91 A;  5AVW B;  2FYU K;  3L75 G;  4NBB D;  2PP6 A;  2KS1 B;  2PFX A;  5DJT B;  4Z1M H;  1YIT P;  3L70 J;  2E42 A;  1U7M A;  2B89 A;  1L4A C;  1GL2 C;  3F5H A;  1CZQ A;  2I1J A;  3CC2 P;  1JO5 A;  2BMR A;  2WSE H;  3OA7 A;  3H1K J;  1VF5 D;  1PP9 G;  4ASW A;  1Q7Y Q;  1E79 H;  2RMZ A;  1X22 A;  4WBA A;  2DE7 D;  3BRV B;  2WPV B;  5APY A;  1H89 A;  3L73 J;  2LXC B;  1FZC C;  5AVZ B;  5CCH D;  3V4W A;  2N9B A;  4HJL A;  4GT1 A;  5B5E E;  1SQQ G;  1LWU C;  5APU A;  1M1K Q;  2ZYG A;  3CC4 P;  1HWT C;  5TIS E;  1QLE D;  3S1K A;  3GF7 A;  1NU1 D;  2KK7 A;  1SQX D;  3B71 A;  3HD7 B;  2VRS A;  1SQQ J;  3TYY A;  2KI7 B;  2JWD A;  1Q81 Q;  3GL2 A;  1SQB G;  1JMM A;  2A06 G;  1LWU B;  2HML A;  2WSF H;  2BCC E;  2RN0 A;  3AEF C;  1NTK E;  1EC5 A;  2AXT H;  4K3A A;  2KS1 A;  4P1B H;  1FBM A;  1DD3 A;  2I1K A;  1LTA C;  4DOJ A;  3CL3 D;  1S5L E;  3A3Y B;  4TLF A;  4YPC A;  4R4M A;  3VN0 A;  3AZC A;  1BCC E;  1JM0 A;  1J1E B;  5B66 H;  1ZRT D;  2FBW C;  3M06 A;  2ZT9 D;  2CPS A;  3RK3 D;  2B24 A;  3JC2 2;  2J59 M;  4WVZ A;  4PJ0 H;  4HM8 A;  2N1T B;  1GK4 A;  4QDC A;  3V2P A;  3MP7 B;  4CPG A;  2OTL P;  2RH0 A;  1S3J A;  1BSH A;  3T97 B;  3TNU B;  2O01 J;  2M3B A;  3MTU E;  2G8Y A;  1J1D B;  1VDF A;  1DEE G;  3GW6 A;  2FY8 A;  2D2C C;  2LR2 A;  3GTS A;  1NTM K;  2P7J A;  3CX5 H;  3QH9 A;  5APX A;  3L74 G;  3CXH H;  4EYY Q;  2NWF A;  1L0L D;  4U3F E;  1VM9 A;  2WTY A;  2KZI A;  3HD7 A;  5KLI C;  3WU2 H;  2JR8 A;  3CLQ A;  4XA4 A;  4QMA A;  5KJ7 C;  2YMK A;  1SQX G;  1LWU A;  3SWY A;  1ZW0 A;  4N6J A;  3L75 E;  3GHG B;  1S9K E;  1OZH A;  1L2P A;  1FDO A;  2HLO A;  1SQP G;  2HMN A;  1FAV A;  1PGJ A;  1NU1 J;  1JY2 P;  2IBZ D;  5CCG C;  4L74 A;  4YXW H;  3RL0 C;  2NVE A;  1KV4 A;  3L71 D;  3M0A A;  1NHL A;  3PJS K;  2R3S A;  3MZW B;  1PP9 E;  3BVH A;  3WUV A;  2ZVO B;  2O1K A;  3F89 A;  1HTL C;  2K3R A;  2KB7 P;  4PD4 I;  2N1T A;  3FX0 A;  1VQ9 P;  2E76 B;  3RL0 B;  1EDK A;  1KC8 Q;  3Q2Y A;  1FJP A;  3T97 A;  5AW2 B;  3TNU A;  1VQN P;  5KAI E;  2WVR A;  1YBK A;  3D6Y A;  1FZB A;  1NWQ A;  3RK2 D;  1SQV D;  4RO0 A;  2FYZ A;  1KQF B;  3IFM A;  1IC2 A;  3VMZ A;  1K05 A;  2GUV A;  3JCU H;  1N86 A;  2ZXE B;  1VQK P;  1SQB E;  2QJK C;  3M9H A;  2IZ1 A;  3V2Q A;  2A06 E;  4EOT A;  3S9O A;  1FZE A;  3EWK A;  1KIL E;  1KIL C;  3MHV A;  3GHG A;  4PV1 B;  1QX8 A;  2FXO A;  3NTN A;  2FXP A;  4HM4 A;  1L0L J;  1OW8 A;  2QJK B;  1JY3 N;  2A45 H;  3H6P A;  5AVT B;  1HGZ A;  2NZ2 A;  3SWF A;  1HF9 A;  3AEA C;  3CI9 A;  5AVQ B;  2MJZ A;  2IBZ G;  2WPR A;  3LIE A;  2Q6Q A;  3ABV C;  1HGV A;  1KFN A;  3AE4 C;  5AVU B;  3FWN A;  1SFC C;  2FYU G;  3IR9 A;  3H32 B;  2NVF A;  3E1I A;  1P84 I;  1LTS C;  3L71 J;  4L73 A;  5APQ A;  4C7N B;  3GCE A;  3UIA A;  3HE4 B;  4KJM A;  5CCH C;  2R5D A;  3L74 E;  1NDO A;  5GTI H;  3QWO C;  3Q1M A;  1ULJ A;  2QG4 A;  1SFC B;  4BXL A;  1YJ9 P;  4XE5 B;  2L5G B;  2FFD B;  3CCJ P;  3MIW A;  5AVR B;  1RF1 B;  1SQV G;  1SQX E;  2XRX A;  3KHU A;  4L76 A;  2BCC D;  1SQP E;  4D6T E;  4WY4 C;  1KB9 H;  1NTK D;  4M3L A;  1MZ9 A;  1YJN P;  1T3U A;  2Q3W A;  2N1T D;  2WQY C;  1JB0 J;  1VQ6 P;  1XTG B;  1M7L A;  2OYH C;  1BDC A;  4OGQ B;  1OIP A;  2KZJ A;  3R2P A;  3H1J D;  1BCC D;  1FZA A;  2PAJ A;  1VQ7 P;  1JMB A;  3WUT A;  1PGO A;  1GD2 E;  1OVU A;  2O1J A;  5BU8 B;  1LJ2 A;  1ZRT E;  5AW3 B;  3H32 A;  2ZT9 C;  5L8R J;  3RK3 E;  2FXM A;  3RK3 C;  2DE5 D;  4C7N A;  1JNM A;  2OYH B;  3SWK A;  2JKV A;  1Z56 A;  3HE4 A;  2Y0D A;  1NTZ K;  1NH4 A;  5AW7 B;  3GL0 A;  3D71 A;  2FYN C;  1QVF O;  2GM4 A;  4U3F D;  4I2L C;  1SFC A;  1N7S B;  2O01 N;  3C9I A;  1YTZ T;  2FFD A;  1QVG O;  2JO1 A;  1PPJ E;  1BGY E;  4JF7 A;  3LW5 J;  1RF1 A;  2AXT E;  1Q86 Q;  1LGH B;  2YO3 A;  2Z4E A;  5CJ4 A;  2LKM A;  3L75 D;  1WT6 A;  4TT3 H;  4N3Y B;  3A7O A;  2JDI H;  1QL1 A;  5C39 A;  4OWF A;  1NOH A;  5BOK A;  2Y0C A;  1MKM A;  2BCC G;  1Q2N A;  4JBZ A;  2QA4 P;  1PL5 A;  2E76 D;  3RL0 D;  1HH0 A;  1NTK G;  2E5T A;  3CCR P;  3U1A A;  1DH3 A;  2JEE A;  3SFE C;  1PP9 D;  4PJ0 E;  2BCC J;  1MV8 A;  5BU5 A;  2PRR A;  1NTK J;  1S1C X;  3A2A A;  2FYU E;  2G3A A;  1AFO A;  2YIU C;  1FDM A;  1ZOY C;  1A02 F;  2I8D A;  3H1J G;  1LTB C;  1AQT A;  3MUD C;  1M57 D;  3CX5 E;  2OYH A;  2QJY B;  3CXH E;  1VQL P;  1FS0 E;  2E5Y A;  4HKV A;  2W83 C;  2BMO A;  1S5L X;  1BCC J;  4PV1 D;  2QM8 A;  3WU2 E;  2K88 A;  2QM7 A;  3M9B A;  3Q5S A;  4N78 E;  4WWI A;  3CCL P;  1Y47 A;  5E79 H;  4R4L A;  2O01 H;  3VMH D;  2FKW B;  4MN4 C;  4H13 B;  1SQV E;  1NKN A;  4GOD A;  2H43 A;  2A06 D;  3E7K A;  4U3F G;  1KYO I;  1X8Y A;  1KIL D;  1PFI A;  3CPW O;  3H1H E;  1VQ4 P;  4HYT B;  4EMJ B;  5KLV D;  2NPS B;  3V6I A;  5AW8 B;  2H88 C;  1ZR4 A;  1RE3 A;  3MGN A;  1GMJ A;  1HBW A;  2AXC A;  3CCS P;  2ZVN B;  2V7Q J;  1D7M A;  4UB8 H;  2C9N Y;  2NRG A;  1DIP A;  3L75 J;  2QJP B;  1Q90 C;  1JY3 O;  3WMM 0;  2C9L Y;  1AJY A;  3TK1 A;  3VMY A;  1SFC D;  3L72 D;  2N9Y B;  3IAO A;  2KYV A;  1K9M Q;  1LTG C;  1G8J B;  1IK9 A;  5AVX B;  3HD7 C;  3GF3 A;  3RGU A;  3N4X A;  3I5C A;  1PP9 J;  1JCD A;  3JCU E;  3L74 D;  3AE6 C;  1ZXG A;  3RBX A;  1YHQ P;  2CPB A;  2P10 A;  4A7P A;  3MUD A;  4PD4 H;  3NMD A;  3KXD A;  4GDO A;  1USD A;  2IPP A;  1NJI Q;  1TU3 F;  5APT A;  1ZME C;  4OGQ D;  1SP4 A;  1SQP D;  1LP1 B;  4LC1 A;  2HMM A;  4D6T D;  1M8O B;  4WY4 D;  2YFJ A;  3W67 A;  2IX7 C;  3V4Q A;  2CK3 H;  2NPS A;  1IFP A;  1NTM E;  2DW3 A;  1IFI A;  3VP9 A;  1CSB A;  1J1E C;  5KLV G;  1SQB J;  5HL4 A;  3FXE A;  3A0B H;  1GW4 A;  2IYO A;  2N1T C;  2ITA A;  5CXM A;  1XTC C;  3SFD C;  1G2C B;  1NYH A;  3CCU P;  2Y0E A;  1GU5 A;  1OVR A;  1W2B O;  3H1J E;  3KPE A;  1J1D C;  2W27 A;  3ZDM A;  3GMA A;  3RBZ A;  4NPE A;  5GTI E;  1H8A A;  1L0N K;  4IFM A;  1YJW P;  2WSC H;  3L72 G;  1H88 A;  1IFD A;  3P8M C;  1R5L A;  4Y28 J;  4IL6 H;  3GHG C;  3KYQ A;  2M8R A;  2W6A A;  2YXQ B;  1PPJ D;  1BGY D;  4H44 B;  2HYN A;  1KB9 E;  3VCA A;  3D89 A;  2KP8 A;  1KOR A;  4NBD D;  4ASV A;  1O7W A;  3B8E B;  3VTP C;  2ZYL A;  1OXZ A;  3L74 J;  4IFD K;  2KUB A;  2YKO A;  3A5T A;  1NTZ G;  1ULI A;  2JJL A;  2UWJ E;  1EG9 A;  3B5N C;  1A02 J;  4D6T G;  1JOC A;  4HH2 A;  3A0H H;  2QRX A;  2B1X A;  1SQX J;  3H25 A;  2E76 C;  1R8E A;  1BE3 E;  1SQP J;  1BDD A;  2R44 A;  3GOB A;  4D6T J;  2OTJ P;  1G2C A;  2JP3 A;  1T8Z A;  3IF4 A;  2FYU D;  3L37 A;  5KAF H;  1EDI A;  3GZX A;  5AVY B;  3CWB D;  3B5N B;  4YXD C;  4H13 D;  1K04 A;  2WSE J;  3CX5 D;  3G71 P;  3M0D C;  2SPZ A;  3O8Z A;  1G1J A;  3CXH D;  1SLQ A;  3CCM P;  1NKZ B;  1M1J B;  2ZYD A;  1FDI A;  4NBA D;  1MUU A;  2NPS D;  1NO4 A;  4N78 D;  2XZR A;  1GTW A;  5AVV B;  4PV1 C;  1FU1 A;  1O7G A;  4LLH A;  1J2J B;  2XND H;  2R5B A;  3H1H D;  1OW6 A;  1VL2 A;  3L36 A;  3CC7 P;  2WPS A;  3G3Z A;  1YTZ I;  1LTJ B;  1PPJ G;  1BGY G;  1JY2 N;  1ZLL A;  1KN7 A;  3AEE C;  1K73 Q;  1N2D C;  1VPC A;  3B4S A;  5KLV E;  2K1A A;  2WSF J;  3FXD A;  1BGY J;  5B5E H;  2KSJ A;  3D70 A;  3VMA A;  1AV1 A;  2E74 B;  1X9V A;  2M0B A;  2WT7 B;  1Q90 D;  2KNC B;  2XU6 A;  2CKF A;  4BWN A;  5AW1 B;  1FC2 C;  2BEQ D;  4HM6 A;  3HRN A;  3B5N A;  2IBZ I;  1RY3 A;  1T2K C;  2V4H A;  4NB8 D;  2E75 B;  3HD7 D;  1VQM P;  3L72 E;  3CWB G;  2FFD C;  1DD4 A;  1SQQ K;  5E79 E;  3VOP A;  4UB6 H;  4RKU J;  1M1J A;  1RF1 C;  2B87 B;  1IFM A;  2K37 A;  5AW4 B;  2W6B A;  1FOS E;  1U7J A;  1W2E A;  2P2U A;  2FYU J;  2OYI B;  1JCC A;  2HPC B;  1YI2 P;  3H1L D;  3K5B A;  4H0L B;  3M0D A;  4QCK A;  1ZR2 A;  1SQB K;  1VCK A;  2M3E A;  3EFG A;  3Q5P A;  1LTJ A;  1HJ0 A;  2W8Z A;  1LTI C;  1NTZ E;  1RIE A;  1NTM D;  4OGQ C;  3H1H G;  1R5S A;  3KDP B;  3VMX A;  1SQV J;  4K35 A;  3KZI H;  1RHZ B;  4O9B A;  3H1H J;  1KYO H;  4QUQ A;  3OJA B;  3HUS B;  2KLU A;  2WT7 A;  3G6E P;  3BCC D;  2KNC A;  1OVV A;  2R32 A;  2IDB A;  3Q3D A;  4QDF B;  2W6J H;  1GW3 A;  3MD0 A;  1FZF A;  3AE3 C;  1RH5 B;  2XKM A;  4ZNC A;  1NYK A;  4H44 D;  2XSO A;  2KOG A;  5CHX A;  4QUP A;  1JTH B;  1N7S C;  1W5C E;  4EDF A;  2Z5I A;  3VMI D;  1CI6 B;  2KXP B;  1PV3 A;  1X0T A;  1JM1 A;  4PD4 E;  5KKZ B;  1X79 B;  2B87 A;  2OYI A;  1YQ4 C;  2ZAE B;  5EFW B;  2YFL A;  2YKQ A;  2HPC A;  1USE A;  1KB9 D;  1EZV D;  3NFQ A;  2AEF A;  2QSI A;  4JYC A;  1RE3 C;  1NU1 K;  3S4R A;  1SQX K;  4AIV A;  3CCQ P;  5H2F H;  2JO6 A;  3H1L G;  2B88 A;  2OQQ A;  2I7F A;  1KYO D;  1RQV A;  3CMA P;  3A0B E;  1PIX A;  3B5N D;  1OX3 A;  2A45 G;  2JWA A;  4I7Z B;  1NTM G;  2YMY A;  2HMJ A;  1BE3 D;  2MKV A;  2J5U A;  3D6Z A;  5B66 E;  3HUS A;  1AVO A;  3CD6 P;  5CBN A;  2QJY C;  1Y9B A;  1NTM J;  1Y8A A;  4QDF A;  3H1K D;  1MFZ A;  5AEW A;  4HKZ H;  3BCC G;  1IK7 A;  3EQ2 A;  3CWB E;  1OW7 A;  1UUW A;  1JTH A;  1LTT C;  2ZJS E;  1CI6 A;  4H13 C;  3U1C A;  4C46 A;  1OFC X;  4IL6 E;  1OWA A;  4HM7 A;  2WPQ A;  2E4Q A;  3AE8 C;  3PHL A;  2HFE D;  1AVY A;  3HE5 B;  3H1J J;  3FWL A;  1NAY A;  3V5B A;  2NPS C;  2YKP A;  5DJU B;  1PGQ A;  1N7S A;  4NB9 D;  1VQO P;  2E74 D;  2HR3 A;  3AE5 C;  1L0L K;  1SVF A;  2OGU A;  2Z5H A;  1IFN A;  2C0W A;  1EZV G;  3A0H E;  4U7J A;  4NBG D;  4RJT A;  1S2E A;  5CBO A;  2YO2 A;  3V2N A;  1LNQ A;  2QJP C;  1QEX A;  3LID A;  1ZP0 C;  2ZXX A;  1JY2 O;  4U3F J;  5KAF E;  3GZY A;  1O7M A;  2DE6 D;  1IFJ A;  2K9J B;  1WRG A;  1HJB A;  3L70 G;  1GK6 A;  1DX7 A;  1BE3 G;  4YTP C;  3VCP A;  1GDT A;  2JZA A;  2RKL A;  3RK2 B;  1T2K D;  1Q82 Q;  2Q7C A;  4H0L D;  3BAS A;  4XFJ A;  2QEX P;  3BAT A;  1O7N A;  3H1K G;  3I55 P;  4AUW A;  1BE3 J;  3AE9 C;  1VQ5 P;  3L73 G;  1N73 B;  3HE5 A;  3EFF K;  2YXR B;  1YQ3 C;  1URQ C;  4AQR D;  1KQG B;  3O6Q B;  2M5A B;  1M90 Q;  4DZO A;  3ITK A;  1SQV K;  1EXI A;  3EQQ A;  2HG5 D;  3H1L E;  1L0N E;  1L4A B;  1GL2 B;  1NTZ D;  3PTZ A;  3FGA D;  1URQ B;  1RE4 C;  3PH0 A;  1YYC A;  3DQY A;  3L35 A;  1UUV A;  3AEC C;  4W7Z A;  1KD1 Q;  5AW5 B;  5GTH H;  1FZC B;  2OAR A;  3PLN A;  4DCK A;  3CCV P;  1VQP P;  1FZG A;  2K9J A;  4I6M C;  1YIJ P;  1OMI A;  4GOE A;  3BCC E;  3G4S P;  5KLV J;  4UB6 E;  1N7S D;  1O7H A;  4NBE D;  4RES B;  4H44 C;  4PD4 D;  5CMZ A;  2H8P D;  4NBF D;  1N73 A;  1NVO A;  3TGU E;  3O6Q A;  4Y99 C;  2M5A A;  4ZMD A;  1JEK A;  4HB1 A;  3G9R A;  4P1C H;  3L72 J;  2QVA A;  5AW9 B;  1PGP A;  1L4A A;  1EZV E;  1KQL A;  2Q1K A;  2WSS H;  4ZKP A;  1P84 H;  1GL2 A;  1HUC A;  5APV A;  1URQ A;  2Q9I A;  3KZI E;  1LP1 A;  3HTK B;  3P8C D;  4Y99 B;  3H1I E;  1KYO E;  3GTE A;  4JPZ B;  4NBC D;  1NTK K;  2E43 A;  1FZC A;  3RL0 g;  4DJG A;  2GBX A;  2WMM A;  2OYO A;  1NU1 G;  3L70 E;  1NTZ J;  1GZL A;  1RE4 A;  2D2C B;  2QPZ A;  1M1J C;  1T6A A;  2HOD B;  3H1K E;  5CJ0 A;  3R4Y A;  5KLI B;  2KLV A;  3L73 E;  4NPD A;  4EIJ A;  2NUK A;  2Q3I A;  2IYP A;  4HM2 A;  4GKG A;  3C1L A;  2BMQ A;  2QE7 H;  2POH A;  1VQ8 P;  2GBW A;  1P84 D;  3U59 A;  1LTJ C;  1JY3 P;  2NUM A;  4JQ0 D;  2WZ7 A;  5H2F E;  3NXS A;  2P1J A;  2LXB A;  5APS A;  1SQQ E;  2KSE A;  2Y9Z A;  2E74 C;  3GB4 A;  1S4X A;  4OVN F;  1FE6 A;  3HTK A;  4OH8 B;  3TSI A;  3AE7 C;  1H0T B;  3Q5R A;  4LGD E;  3LW5 H;  3GLM A;  4W7Y A;  4HM3 A;  1RFS A;  1LT9 C;  4W80 A;  3C0D A;  4QDD A;  1UII A;  1QL2 A;  2E4P A;  5TJH A;  2E75 C;  1BSN A;  1L0L G;  1IZN B;  5TIS H;  3JSV C;  3CME P;  1EDL A;  2XNX A;  3V2R A;  1KZU B;  4WB4 A;  3L4F A;  2HOD A;  3N7N A;  2OYI C;  1LT9 B;  3WUU A;  5AW0 B;  5KJ7 A;  4H0L C;  1L4A D;  3AE2 C;  1GL2 D;  3C8V A;  3GKE A;  1KIL B;  1SJG A;  4L75 A;  1URQ D;  2ZFC A;  1K8A Q;  2K9Y A;  2YFI A;  3L71 G;  5AVS B;  2WSC J;  2BEZ F;  1GU4 A;  3CX5 I;  1S5L H;  5CCG A;  3CWB J;  1VF5 C;  3CXH I;  1L0N D;  1S72 P;  1ZN5 A;  4ZKU A;  4IFF A;  1U57 A;  1O7P A;  2H89 C;  2HMO A;  3PP5 A;  2L91 A;  1DEB A;  3HUS C;  4IL6 X;  4HM1 A;  3II6 A;  1H0T A;  5KTB A;  5KLV K;  3PRJ A;  3OW2 O;  1VF5 B;  2W90 A;  4UB8 E;  3E1R A;  3VMG D;  2Q5U A;  4HM5 A;  1RQU A;  1NU1 E;  4C7R A;  2GA1 A;  1KQS O;  4BRY B;  4I1L A;  4EI2 A;  3W68 A;  1E5W A;  3OAK A;  5K5G B;  5KKZ C;  2IFN A;  1NAF A;  3SSU A;  2P67 A;  1LT9 A;  4NBH D;  2O3J A;  2V7Q H;  1WQL A;  2XV5 A;  1MFT A;  2HMK A;  4HM0 A;  2YVJ B;  4KT0 J;  1KIL A;  2H7H A;  4WY4 B;  4IOI H;  1EDJ A;  1RF0 C;  2C0X A;  3TGU D;  1T3J A;  1WMK A;  2Q3E A;  2XR8 A;  1IO4 A;  1HVV A;  2ZYA A;  3AE1 C;  2AEM A;  1FQT A;  2OTK E;  3P32 A;  4I7Z C;  1FJK A;  1QGK B;  3IN6 A;  3TF5 A;  5GTH E;  3H1I D;  1L0N G;  2D2C D;  3P7K A;  4DT0 A;  4AAY B;  1SQP K;  1LT1 A;  2BAS A;  4JYB A;  3P8C E;  2ZT9 B;  1UIX A;  3RK3 B;  2XSH A;  5KAI H;  2R3C A;  1EQ7 A;  1L0N J;  3H1L J;  5KJ7 D;  1L0L E;  2A45 I;  3L70 D;  4BRY A;  5CCH A;  1S9K D;  2FYN B;  4GOF A;  3KQG A;  3N0Q A;  3AEB C;  1FOS F;  1AQ5 A;  1G8K B;  5APW A;  5CCG D;  2B9B A;  4B86 A;  5AW6 B;  3L73 D;  2WWW A;  1CW5 A;  4HJG H;  2IBZ E;  2PGD A;  3I56 P;  1N7L A;  1PZQ A;  3L71 E;  3GG2 A;  1ZV8 A;  3VYI A;  4WY4 A;  4NPF X;  3BCC J;  3USS A;  2NVG A;  2QIW A;  2YNY A;  2Y9Y A;  1P84 E;  3TDK A;  3VP8 A;  2AEJ A;  5BVZ A;  1BCC G;  3EN1 A;  3TGU G;  3CCE P;  2KIK A;  3FOU A;  1NGM B;  1SQQ D;  3BRT B;  3M9Q A;  1KTM A;  1N8R Q;  4KHX A;  1RF0 A;  2P58 A;  1M56 D; 
#chains in the Genus database with same CATH homology
 1G8J B;  2DE6 D;  2NUK A;  4HM2 A;  1NTZ E;  2FYU E;  1RIE A;  2BMQ A;  2YIU C;  4HM4 A;  2HMJ A;  3L75 E;  2GBW A;  5AEU A;  3VCP A;  1O7H A;  4NBE D;  3GL2 A;  2HMN A;  2JZA A;  2D2C D;  2NUM A;  3CX5 E;  4AAY B;  1KB9 E;  3VCA A;  2QJY C;  1O7P A;  3D89 A;  2HML A;  4H0L D;  3CXH E;  2E75 D;  4NBD D;  4NBF D;  2BCC E;  4HKV A;  1O7W A;  4QDF A;  1ZRT E;  1O7N A;  2BMO A;  2NVE A;  2ZYL A;  5KLV E;  2HMO A;  1NTK E;  4QUQ A;  2DE5 D;  5AEW A;  4PV1 D;  3TGU E;  2XSH A;  4HM1 A;  4P1B H;  1L0L E;  1SQQ E;  3CWB E;  1UUW A;  1ULI A;  4QDF B;  1PP9 E;  3GB4 A;  4OGQ D;  4QUR A;  4P1C H;  3VMH D;  1EG9 A;  2NVF A;  3VMG D;  3GL0 A;  2HMM A;  4NBB D;  2FYN C;  1SQV E;  3GCE A;  2YFJ A;  4HM5 A;  1EZV E;  1NU1 E;  1NYK A;  3AZC A;  2CKF A;  4HM7 A;  4H44 D;  3N0Q A;  2E4Q A;  2XSO A;  1NTM E;  2B1X A;  4QUP A;  3H1H E;  3VMI D;  1G8K B;  3EQQ A;  1BCC E;  4HM6 A;  1BE3 E;  4HM3 A;  4EMJ B;  3L74 E;  1RFS A;  1NDO A;  3H1I E;  3H1L E;  1L0N E;  1PPJ E;  1BGY E;  3C0D A;  2ZT9 D;  1JM1 A;  3GOB A;  4PD4 E;  4QDD A;  5HL4 A;  1KYO E;  3GTE A;  2B24 A;  5KKZ C;  1ULJ A;  4NBC D;  2E4P A;  4HM8 A;  4NB8 D;  2IBZ E;  2BMR A;  3GZX A;  3L72 E;  4QDC A;  4NB9 D;  1VF5 D;  2E74 D;  4NBH D;  3L71 E;  2YFL A;  3DQY A;  5CXM A;  1WQL A;  4H13 D;  2DE7 D;  1UUV A;  1SQX E;  2GBX A;  2XRX A;  2HMK A;  4HM0 A;  2NVG A;  2YVJ B;  3L70 E;  4NBG D;  3H1J E;  5BOK A;  1P84 E;  1SQP E;  1SQB E;  2E76 D;  2QJK C;  2QPZ A;  4D6T E;  3GTS A;  4AIV A;  2QJP C;  3EN1 A;  2A06 E;  1Q90 C;  2JO6 A;  4HJL A;  2NWF A;  4QCK A;  4NBA D;  3FOU A;  2I7F A;  4U3F E;  1VM9 A;  3GKE A;  3H1K E;  2Q3W A;  1VCK A;  1SJG A;  2XR8 A;  5KLI C;  3GZY A;  3BCC E;  1O7M A;  2YFI A;  1FQT A;  1O7G A;  3L73 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...