1BE3E

Cytochrome bc1 complex from bovine
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 40
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1be3E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1be3E02
2HMJA 3VCAA 2XR8A 3EQQA 2BCCE 4HM5A 4QCKA 3VMGD 1SQQE 4HJLA 4U3FE 2NVGA 4QDFB 3FOUA 1SJGA 4NBED 3EN1A 2DE5D 5KLIC 1SQBE 4NBCD 2DE7D 3GZXA 2E76D 1ULJA 4QUPA 5AEUA 5AEWA 3BCCE 3H1HE 1BCCE 1FQTA 2BMQA 1O7GA 4HKVA 4NBFD 4HM7A 4P1BH 1BGYE 1PP9E 3CX5E 1RFSA 2QJYC 1SQVE 4NBAD 2E74D 4QDCA 2HMNA 3GOBA 4AIVA 1BE3E 2NVFA 3L75E 1ULIA 4NB8D 2E4QA 2JZAA 1NTKE 4NBHD 3L70E 2HMKA 1O7HA 1JM1A 2ZYLA 2IBZE 1O7WA 2YFIA 2ZT9D 1Q90C 4HM4A 2GBWA 1UUVA 3VMID 1P84E 4HM0A 3GL2A 3L72E 2NVEA 1KYOE 1NYKA 4P1CH 5KKZC 4OGQD 2XSHA 1EG9A 1G8JB 1KB9E 2XRXA 3H1LE 3GTSA 3CWBE 4EMJB 1WQLA 2E4PA 3H1JE 3N0QA 1PPJE 3GB4A 2GBXA 4QURA 3GZYA 3D89A 4QUQA 5CXMA 5BOKA 3VMHD 1VCKA 1NTZE 3GKEA 3L71E 3TGUE 1NDOA 2XSOA 1NTME 2YFJA 4QDDA 3VCPA 2NUMA 3AZCA 4NBDD 4PV1D 1O7MA 4NBBD 1O7NA 2CKFA 2B1XA 4QDFA 5HL4A 2YFLA 1SQPE 3DQYA 2YVJB 2Q3WA 3H1KE 4H0LD 4H44D 4HM2A 4NBGD 2YIUC 2DE6D 2NWFA 3L73E 2A06E 2HMLA 1G8KB 1UUWA 4HM1A 1L0LE 2QPZA 2BMRA 2HMMA 1SQXE 1O7PA 3CXHE 1VF5D 2QJPC 2JO6A 3H1IE 1ZRTE 2FYNC 4HM8A 3GCEA 2NUKA 4AAYB 5KLVE 2D2CD 3L74E 1VM9A 2QJKC 2B24A 2I7FA 4HM3A 4D6TE 3GL0A 1NU1E 3GTEA 1L0NE 2E75D 2HMOA 2BMOA 2FYUE 4PD4E 4H13D 1RIEA 3C0DA 4HM6A 4NB9D 1EZVE
chains in the Genus database with same CATH superfamily
1FZCA 1RY3A 1N7SD 1YHQP 2IDBA 4QUPA 3WUTA 2JR8A 1AQ5A 3FXDA 3CD6P 2RKLA 1AA0A 3AE2C 5KJ7D 1PP9D 1HJBA 1IK7A 1M1JC 1GL2A 4K3AA 1M90Q 2WSFJ 2E76B 2AXCA 5APQA 1DH3A 4UB8E 4UB6H 1BE3D 3QWOC 2FYUD 3VMAA 3H32B 2WVRA 3A0BE 1ZXGA 2AEJA 2ZXXA 3T97B 2KSJA 5AW1B 1PZQA 3GTSA 2O01N 3CWBE 2FYZA 2YKOA 4EMJB 1CI6B 2POHA 4TT3H 4ZNCA 1QL2A 3PH0A 1KILE 3KQGA 2IFNA 1NH4A 2GUSA 1TU3F 1O7NA 2K9JA 3CCMP 1FJPA 3TYYA 1FZEA 4HKZH 5AVRB 2M3EA 3M9HA 2QJPC 2WPRA 3EFGA 1NTZD 4D6TD 1VDFA 2BEZF 4PJ0E 4JBZA 3M9BA 1VF5C 1JY3N 3WMM0 1KN7A 3Q5SA 3MUDC 1DEEG 2BCCE 2Q3IA 4HJLA 1NKZB 5APXA 3ABVC 1L4AA 1URQD 1BGYD 2E74B 1FQTA 2WPSA 3B5ND 1QX8A 3G3ZA 2OQQA 1FU1A 2B87B 1URQC 1DEBA 1OW8A 5B5EH 2E4QA 4R4MA 1JOCA 1RF1B 3KPEA 1HVVA 1VQ8P 3D6YA 4I6MC 3H1IG 2PRRA 3KZIE 2CK3H 3G6EP 3H1HD 1VQ4P 2AXTE 3W67A 5KLIB 4P1CH 2PP6A 4HB1A 4C7NA 3TNUB 2QSIA 2M3BA 2B87A 1IFPA 3GB4A 1NOHA 2KK7A 1NTKG 3BATA 5AW5B 4JYBA 1NU1J 2B1XA 4AYCA 3CCRP 1NU1K 2WPQA 3TGUG 1NTZG 1AVOA 4HM1A 2V7QH 3L74D 2KLUA 2P58A 1J1EC 1NYHA 1OXZA 4L74A 5APTA 1N8RQ 1H8AA 1LTJC 3GL0A 2RH0A 1LTJA 1N86A 3F5HA 1EC5A 2Y0DA 1Q81Q 2XNDH 3CPWO 1SQQE 3L75D 4U3FE 3B71A 2VRSA 3A0BH 3TSIA 1VQ5P 5GTIE 3CCUP 1MUUA 2B9BA 3U59A 1ZLLA 3V2RA 2W6JH 1Y8AA 2NPSD 3P8MC 4DCKA 2ZJSE 3AE4C 1ZMEC 1LJ2A 1SFCB 1LTTC 1NTKK 1NTMK 1O7HA 5CBNA 1USDA 3WU2E 1QLED 1NWQA 4BRYB 5CCHD 2AXTH 3L70D 1KYOE 4Y28J 2DW3A 1BE3G 1NHLA 5M1BA 2R32A 3NFQA 1ZRTD 3H1ID 1SQVD 1OVVA 1R8EA 1VQ7P 1PPJE 2GBXA 2P7JA 3CC2P 1BCCJ 2WSSH 4EIJA 3V2QA 2G3AA 1LT9B 4JYCA 1YTZI 1HJ0A 4NBDD 4PV1D 4ASVA 2P2UA 1ZW0A 2ZYAA 2JKVA 3U1CA 2KZIA 1VQKP 1UUWA 1SVFA 2I1JA 3CCLP 2QJYB 3C1LA 1YTZT 4I7ZB 1PIXA 5APYA 1YJNP 1K05A 2YNYA 2QJKC 4OGQB 5BVZA 1YYCA 1NTZJ 2HMOA 3R2PA 1EZVE 3L4FA 2QA4P 1GU4A 1DX7A 3JCUE 1Q90D 1R5SA 2E76D 5AW7B 1JNMA 1Q7YQ 3VTPC 1KFMA 3CCSP 1K73Q 2E76C 4W7YA 3L75G 3L35A 2NVFA 5AVQB 1FBMA 5CJ4A 2A45H 2JP3A 1JO5A 3M0AA 3CC4P 1N7LA 2ZT9D 2YFIA 5AVYB 3GG2A 3GL2A 4N78D 3LW5J 1SS1A 4UB8H 3H1HJ 5C39A 4H13B 2XRXA 2W6AA 1EZVD 2KZJA 2Z4EA 1EXJA 2RN0A 1HGZA 1DIPA 3D89A 3IFMA 3H6PA 1SFCA 1KORA 1SQBD 5BOKA 1FE6A 1OX3A 2ZVNB 1S1CX 2IZ1A 4IL6E 1NTKD 1A02F 3HUSC 3M9QA 2YVJB 2OYOA 2YIUC 3D70A 1G8KB 5APUA 2OTKE 4NPFX 4ZKPA 1GW4A 2K1AA 2BCCG 2YKPA 3L71D 4K35A 2JO1A 4AAYB 2HYNA 2WT7B 1S72P 4OWFA 1NTKJ 3LIEA 2FYUE 1CI6A 3FWLA 4QDFB 1FZCC 1SJGA 1CW5A 2KB7P 3AE1C 2OYIA 2QM8A 5CMZA 4C7NB 4P1BH 1RF1C 3C9IA 2LXBA 5KLVJ 2R5DA 3E7KA 3L73D 2HMNA 3GOBA 3HTKB 1BSHA 4IL6H 3OW2O 2W90A 1H89A 1ULIA 2I8DA 2FXPA 4NBHD 1A02J 3N4XA 1GL2C 3HUSA 1AQTA 3TK1A 3VMID 3RK3C 2OYHB 2O01J 2NPSB 4IFMA 3AEAC 4H0LC 3A0HH 1FOSF 3FXEA 4OGQD 1EG9A 1GMJA 1JB0J 1SQVK 1JY2N 1WQLA 1FZAA 5AW0B 3CXHH 3GZYA 2A45G 2A45I 2C9LY 3TGUE 1LTIC 2KYVA 5AVWB 3MGNA 3V2NA 5KAFH 2CKFA 2LXCB 3O6QB 2P67A 5BU8B 2IPPA 1KILB 2ZXEB 3UIAA 1S5LE 4HM8A 3OAKA 3BCCD 4W80A 3GCEA 2H7HA 5KLVE 1SQPK 4Z1MH 2BEQD 4PJ0H 1HF9A 1KYOH 3GF3A 2BCCD 2G8YA 2K3RA 3H1HG 2J59M 3MIWA 4N78E 2DE7D 2Q9IA 2K9JB 1P84D 5AW4B 3L36A 2MKVA 1MFZA 2QG4A 2R3CA 1SQPG 4WY4D 1KQFB 1JTHA 2W83C 2FXOA 3RGUA 1LNQA 2E42A 2C9NY 5AW6B 4IOIH 1NGMB 3PTZA 1M7LA 2Y9ZA 1VF5B 1P84I 1FDMA 3PLNA 3SFDC 1O7WA 3S9OA 3T97A 3G71P 1QEXA 5DJUB 3RBXA 2LR2A 2HR3A 5AW8B 5K5GB 2E74C 1IFDA 1LT9C 5CCHC 2CPBA 1GK4A 1JTHB 5AVZB 5CCHA 3D6ZA 2WTYA 3VP8A 4Y99C 1HUCA 4QDDA 1NTME 3H1JJ 3L74J 1X9VA 2KSEA 5HL4A 2C0WA 1JCDA 1WRGA 2NWFA 4U7JA 3CCEP 1URQA 1IFMA 1EDJA 2HMMA 1MKMA 3B5NA 1VF5D 4HJGH 3CL3D 3AE7C 2H43A 5AVXB 2ZVOB 2J58A 1KD1Q 4HM3A 2KIKA 4PV1C 4PD4E 1RIEA 3C0DA 1JMMA 2WSCH 2UWJE 2E43A 3B5NB 2HMJA 3EQQA 4QCKA 4UB6E 2HODB 2O1KA 1EXIA 1LT9A 3S4RA 5CCGD 1O7GA 4H44B 3V5BA 1AFOA 1BGYE 1MFTA 3CX5E 3VYIA 2NRGA 2HPCB 1FDIA 3CX5D 1UIXA 2KXPB 1LTAC 1E5WA 1PL5A 1LTJB 3CWBD 2E5TA 2Q3EA 1ZOYC 1FOSE 1SQPD 4NPEA 1HH0A 1Q90C 4HM4A 1J2JB 2R3SA 2K9YA 4PD4D 4HM0A 1NO4A 2FXMA 3PP5A 1G1JA 2QVAA 2ZT9C 1VL2A 1LWUB 1LP1A 3HTKA 4PD4H 3Q2YA 3H1JE 3N0QA 3FGAD 3L71J 2BCCJ 5E79H 1YBKA 3BCCJ 2YIUB 2D2CB 2YXQB 1SFCC 3H1LG 4L75A 1OFCX 4N6JA 4NBBD 1YIJP 1T8ZA 4QDFA 3EFFK 2C0XA 4NBGD 1SFCD 3CXHI 3L73E 2YO2A 4C46A 3E1IA 1IFIA 5KTBA 2QPZA 2IBZG 3EWKA 1X8YA 3LW5H 2QM7A 3VP9A 1FS0E 1EZVI 1FZCB 4TLFA 2E5YA 1D7MA 1KMIZ 1KQLA 5CCGA 4HM5A 1LTGC 1FJKA 3USSA 2HG5D 5APVA 1KQGB 3RK3E 3EN1A 5AEUA 1UIIA 1VPCA 2Q5UA 3H1HE 3MD0A 3OA7A 4NBFD 1OIPA 1RFSA 2OYIC 1GL2B 2QJYC 5H2FE 1HTLC 2E74D 3CWBJ 2YKQA 3RK3B 4DJGA 1Z56A 2NPSC 1NTKE 4AUWA 3WUUA 4RESB 1IK9A 2WT7A 2FY8A 2GA1A 1PV3A 5KLVD 3L73J 3AEFC 2JEEA 2M0BA 4W7ZA 4WVZA 3PRJA 1YITP 3GF7A 1GL2D 5AW2B 2K37A 3GKEA 3AZCA 1S2EA 1KILC 1NU1G 4WB4A 3H1KE 1BDCA 5KLVG 2PFXA 2KNCA 3IR9A 1AV1A 1SQXK 2Q6QA 3CMEP 3BRTB 3L70J 1K8AQ 1YQ3C 4H13C 1S3JA 3P32A 1SQVJ 1CSBA 2O3JA 4H13D 4D6TG 4GOFA 3VOPA 2WSFH 3A0HE 1HWTC 1SQQJ 1SQBE 3HUSB 1JY2P 3A7OA 2W8ZA 2O01H 2QRXA 1JCCA 1T6AA 5H2FH 1NTMG 3Q5PA 1GD2E 1BCCG 4N3YB 1N73C 4GODA 3KXDA 5CBOA 1BDDA 2WWWA 1KQSO 3B4SA 1U7JA 1HGVA 4LGDE 1MV8A 3HD7D 3KYQA 5KLVK 1G8JB 3KZIH 2N9BA 4Y99B 3SWKA 1VQPP 5KAIE 4RO0A 3AEGC 3BASA 5CJ0A 3G4SP 1ZN5A 1YQ4C 3VCPA 2NUMA 4U3FJ 2YFLA 2OYHA 1NJIQ 3AE3C 2OYHC 2A06E 3HE5A 5TISE 3H1KD 1KZUB 4AQRD 3CCJP 1QVGO 4H0LB 4QMAA 3B5NC 1S4XA 3GMAA 3H1JG 2IZ0A 4IL6X 1M57D 1VQLP 3GTEA 3L72D 2BMOA 1VQ6P 3P8CD 3VN0A 2J5UA 4H44C 1E79H 2DE5D 4OH8B 1L2PA 4JQ0D 1X0TA 2QIWA 3GZXA 3H25A 2MJZA 3S1KA 1WMKA 4LLHA 1LP1B 1SLQA 1PPJD 1KYOD 4GIFA 1SQVE 3P7KA 4XA4A 3BRVB 1SQXD 2JWAA 5KAFE 4NB8D 2XDJA 5L8RJ 3I56P 2H8PD 5DJTB 3L72J 5AW9B 5AVVB 4A7PA 2FFDC 4C7RA 3MZWB 3L72E 4NPDA 2FYUK 2FFDA 4BRYA 3H1LD 5KKZC 1N2DC 3H1LE 2E4PA 1VQ9P 4YPCA 3KDPB 1KV4A 3CC7P 2M5AB 2B89A 1KB9I 3NTNA 2XSOA 2YFJA 5TISH 1M1KQ 3RK2B 1FZBA 4IFFA 3M0DA 3JCUH 3L71G 2WSEJ 1L0LE 1WT6A 1O7PA 2LKMA 1ZRTE 3H1IE 3L70G 3Q5RA 1XTGB 4JPZB 2WITA 1M56D 1EZVG 1SQVG 3A3YB 2I1KA 2KLVA 3VCAA 4ZMDA 2IBZI 1FC2C 1L4AC 1S9KE 3AE6C 2PGDA 1KILA 4O9BA 1HBWA 1N7SC 5B5EE 2BMQA 3EQ2A 3AEDC 2HFED 4QDCA 3SWFA 3FX0A 1GZLA 4WY4C 1Q86Q 1L0LD 4WY4A 1BGYG 1JM1A 1T2KC 3CX5H 2ZYLA 4PV1B 4WWIA 4DT0A 2NVEA 3RL0C 1H0TB 3L74G 4BWNA 4EYYQ 2XZRA 3WU2H 2R44A 2HPCA 3HD7C 2ZYGA 1PGJA 2V4HA 4YXDC 2IYPA 4QUQA 1H0TA 3RK3D 3CCQP 1N7SA 1W2EA 2FKWB 2OTJP 1N73A 1MZ9A 2DE6D 1KB9D 2Q7CA 1NU1D 4U3FD 4ZKUA 1SQQD 2BMRA 1LWUA 2ZT9B 1L0LG 1PFIA 2E75C 2FYNC 1LWUC 3H1KJ 1Q82Q 1KB9H 2NUKA 1OW7A 2D2CD 1W5CE 2WPVB 1GTWA 1NTMJ 3RL0g 2E75D 2M5AA 1KILD 1KFNA 1FZGA 3F89A 2ZYDA 2D2CC 1RE4C 2N1TA 5CCGC 3GLMA 3FOUA 3BCCG 4NBED 1M8OB 1PPJG 3MTUE 2AEFA 1ULJA 4GOEA 1BCCE 1N73B 1EDIA 1NAYA 3CI9A 2O1JA 2FYUG 2L91A 4CPGA 4AIVA 1BE3E 2KS1A 3CLQA 2AEMA 1NKNA 2JDIH 4PD4I 3GHGC 2YMYA 2HMKA 1PGPA 2NPSA 4EOTA 4IFDK 1NTMD 3IAOA 1ZV8A 3V2PA 3M0DC 2QEXP 2GBWA 5GTIH 1P84E 2Y0EA 2NZ2A 1GW3A 1PP9J 3CX5I 3D71A 1SQPJ 3O6QA 1J1DC 1IZNB 1KTMA 2OYIB 1EDLA 2XKMA 2H88C 2N1TC 1GDTA 5CXMA 1VCKA 5CHXA 1EQ7A 3LIDA 3CXHD 2KS1B 2W27A 1DD3A 1R5LA 2N1TD 2KI7B 3IF4A 3DQYA 1T3UA 4KJMA 1L4AD 3HE4A 3AECC 1L0NK 3CMAP 2IYOA 3GHGA 2KP8A 3TGUD 1M1JB 3O8ZA 3L73G 5AVSB 2B24A 4RJTA 3A5TA 1BGYJ 3PHLA 4HM6A 3II6A 2HODA 1S5LH 2Y0CA 1S9KD 1SQBJ 2NVGA 4YTPC 2Q1KA 1SQXG 3QH9A 4I1LA 3CCVP 2ZFCA 3TF5A 3BCCE 3V4WA 1RH5B 3VMYA 3WUVA 3VMZA 1PP9E 5TJHA 3TNUA 4LC1A 1YJ9P 1YI2P 4L76A 2FFDB 1L0NJ 1QL1A 4EDFA 1VQMP 4M3LA 5BU5A 5KKZB 1AVYA 1KYOI 1Q2NA 3CWBG 2PAJA 3V6IA 3MUDA 1BSNA 1NYKA 3SWYA 1RQVA 2OTLP 2QJPB 2XSHA 4HYTB 1CZQA 3OJAB 1BE3J 1KB9E 3GW6A 3I55P 3SFEC 2L5GB 3AE5C 3HRNA 1NVOA 3L71E 2XNXA 2IBZD 4H0LD 4HM2A 2JJLA 2WQYC 2KNCB 1W2BO 3B8EB 4WBAA 1IO4A 1SQXE 1URQB 3M06A 3RK2D 3CXHE 3NMDA 4KHXA 3L75J 1SQQG 5AVTB 1X22A 2A06G 2ITAA 1VM9A 3HE5B 1ZR4A 1IFNA 5GTHH 2OGUA 3HE4B 1L0NE 3ITKA 2SPZA 1U7MA 2R5BA 1IJDB 1N7SB 2GUVA 3VMGD 4DOJA 4I2LC 5KLIC 1OZHA 4MN4C 5AEWA 3NXSA 1RE3C 3KHUA 3AE9C 1RF1A 1RF0A 2V7QJ 1U57A 3C8VA 4BXLA 1SQBK 3AEEC 1GU5A 3L75E 4R4LA 3L72G 5KJ7C 1H88A 1OVRA 5KJ7A 3RL0B 5E79E 4L73A 2H89C 1G1IA 1JY3P 2CPSA 1UUVA 3FWNA 1L0ND 1RE4A 1VQOP 5GTHE 1AJYA 1FAVA 3Q1MA 3MHVA 1RHZB 2WZ7A 2WSEH 2XU6A 2IFMA 3HD7A 1IC2A 1ZR2A 4KT0J 3M91A 1NTZE 1NDOA 2XV5A 1RQUA 4JF7A 1QVFO 1EDKA 1O7MA 1LGHB 3H1KG 3R4YA 2E75B 1JY3O 2FYNB 3H1IJ 2RMZA 2HMLA 2QE7H 1OW6A 2YXRB 2Y9YA 2W6BA 4DZOA 1L0LK 1BCCD 4OVNF 3SSUA 1YJWP 4U3FG 4XE5B 3U1AA 4D6TE 1JM0A 4RKUJ 1X79B 1T3JA 4NB9D 1P84H 1LTBC 1OVUA 2Z5IA 3W68A 3G9RA 1SQBG 4NBCD 3BVHA 3RK2C 2YMKA 4HM7A 3GHGB 3Q3DA 1JUNA 4YXWH 3ZDMA 2P10A 4NBAD 3H1LJ 1IFJA 2YO3A 1G2CA 2JZAA 4GDOA 3VMXA 1SQQK 1K04A 4B86A 5EFWB 1SQXJ 1L4AB 4I7ZC 1LT1A 2N1TB 1OWAA 2A06D 1JY2O 2GM4A 2IX7C 2QJKB 3JSVC 2M8RA 1GK6A 4OGQC 1DD4A 3TGUJ 1USEA 2FBWC 3MP7B 1K9MQ 4WY4B 3VMHD 3AEBC 2Z5HA 1OMIA 1M1JA 2WMMA 2B88A 1RE3A 1RF0C 1QGKB 5B66H 1PGOA 4D6TJ 1L0LJ 1Y47A 3PJSK 3I5CA 2OARA 4EI2A 2BASA 1NTZK 1NU1E 3HD7B 1XTCC 5AVUB 1L0NG 1J1EB 1S5LX 2XR8A 1PP9G 3TDKA 3H32A 5APWA 2KUBA 1SP4A 2ZAEB 3L37A 2HLOA 4HKVA 5AW3B 3AE8C 1NAFA 3K5BA 2KOGA 4XFJA 1T2KD 2FYUJ 1JEKA 3L70E 2JWDA 4GT1A 3JC22 3RL0D 2IBZE 1JMBA 1LTSC 1FDOA 2K88A 2P1JA 1VQNP 3P8CE 2N9YB 4QURA 3N7NA 4ASWA 1G2CB 5APSA 1KC8Q 3V4QA 5B66E 1SQPE 4H44D 3IN6A 2Q3WA 3A2AA 2WSCJ 3E1RA 1PGQA 3RBZA 5KAIH 2JO6A 1Y9BA 4HH2A 4GKGA 1J1DB 3L74E 2I7FA 1FZFA 3H1JD 1ZP0C
chains in the Genus database with same CATH topology
2HMJA 3VCAA 2XR8A 3EQQA 2BCCE 4HM5A 4QCKA 3VMGD 1SQQE 4HJLA 4U3FE 2NVGA 4QDFB 3FOUA 1SJGA 4NBED 3EN1A 2DE5D 5KLIC 1SQBE 4NBCD 2DE7D 3GZXA 2E76D 1ULJA 4QUPA 5AEUA 5AEWA 3BCCE 3H1HE 1BCCE 1FQTA 2BMQA 1O7GA 4HKVA 4NBFD 4HM7A 4P1BH 1BGYE 1PP9E 3CX5E 1RFSA 2QJYC 1SQVE 4NBAD 2E74D 4QDCA 2HMNA 3GOBA 4AIVA 1BE3E 2NVFA 3L75E 1ULIA 4NB8D 2E4QA 2JZAA 1NTKE 4NBHD 3L70E 2HMKA 1O7HA 1JM1A 2ZYLA 2IBZE 1O7WA 2YFIA 2ZT9D 1Q90C 4HM4A 2GBWA 1UUVA 3VMID 1P84E 4HM0A 3GL2A 3L72E 2NVEA 1KYOE 1NYKA 4P1CH 5KKZC 4OGQD 2XSHA 1EG9A 1G8JB 1KB9E 2XRXA 3H1LE 3GTSA 3CWBE 4EMJB 1WQLA 2E4PA 3H1JE 3N0QA 1PPJE 3GB4A 2GBXA 4QURA 3GZYA 3D89A 4QUQA 5CXMA 5BOKA 3VMHD 1VCKA 1NTZE 3GKEA 3L71E 3TGUE 1NDOA 2XSOA 1NTME 2YFJA 4QDDA 3VCPA 2NUMA 3AZCA 4NBDD 4PV1D 1O7MA 4NBBD 1O7NA 2CKFA 2B1XA 4QDFA 5HL4A 2YFLA 1SQPE 3DQYA 2YVJB 2Q3WA 3H1KE 4H0LD 4H44D 4HM2A 4NBGD 2YIUC 2DE6D 2NWFA 3L73E 2A06E 2HMLA 1G8KB 1UUWA 4HM1A 1L0LE 2QPZA 2BMRA 2HMMA 1SQXE 1O7PA 3CXHE 1VF5D 2QJPC 2JO6A 3H1IE 1ZRTE 2FYNC 4HM8A 3GCEA 2NUKA 4AAYB 5KLVE 2D2CD 3L74E 1VM9A 2QJKC 2B24A 2I7FA 4HM3A 4D6TE 3GL0A 1NU1E 3GTEA 1L0NE 2E75D 2HMOA 2BMOA 2FYUE 4PD4E 4H13D 1RIEA 3C0DA 4HM6A 4NB9D 1EZVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMJ A;  3VCA A;  2XR8 A;  3EQQ A;  2BCC E;  4HM5 A;  4QCK A;  3VMG D;  1SQQ E;  4HJL A;  4U3F E;  2NVG A;  4QDF B;  3FOU A;  1SJG A;  4NBE D;  3EN1 A;  2DE5 D;  5KLI C;  1SQB E;  4NBC D;  2DE7 D;  3GZX A;  2E76 D;  1ULJ A;  4QUP A;  5AEU A;  5AEW A;  3BCC E;  3H1H E;  1BCC E;  1FQT A;  2BMQ A;  1O7G A;  4HKV A;  4NBF D;  4HM7 A;  4P1B H;  1BGY E;  1PP9 E;  3CX5 E;  1RFS A;  2QJY C;  1SQV E;  4NBA D;  2E74 D;  4QDC A;  2HMN A;  3GOB A;  4AIV A;  1BE3 E;  2NVF A;  3L75 E;  1ULI A;  4NB8 D;  2E4Q A;  2JZA A;  1NTK E;  4NBH D;  3L70 E;  2HMK A;  1O7H A;  1JM1 A;  2ZYL A;  2IBZ E;  1O7W A;  2YFI A;  2ZT9 D;  1Q90 C;  4HM4 A;  2GBW A;  1UUV A;  3VMI D;  1P84 E;  4HM0 A;  3GL2 A;  3L72 E;  2NVE A;  1KYO E;  1NYK A;  4P1C H;  5KKZ C;  4OGQ D;  2XSH A;  1EG9 A;  1G8J B;  1KB9 E;  2XRX A;  3H1L E;  3GTS A;  3CWB E;  4EMJ B;  1WQL A;  2E4P A;  3H1J E;  3N0Q A;  1PPJ E;  3GB4 A;  2GBX A;  4QUR A;  3GZY A;  3D89 A;  4QUQ A;  5CXM A;  5BOK A;  3VMH D;  1VCK A;  1NTZ E;  3GKE A;  3L71 E;  3TGU E;  1NDO A;  2XSO A;  1NTM E;  2YFJ A;  4QDD A;  3VCP A;  2NUM A;  3AZC A;  4NBD D;  4PV1 D;  1O7M A;  4NBB D;  1O7N A;  2CKF A;  2B1X A;  4QDF A;  5HL4 A;  2YFL A;  1SQP E;  3DQY A;  2YVJ B;  2Q3W A;  3H1K E;  4H0L D;  4H44 D;  4HM2 A;  4NBG D;  2YIU C;  2DE6 D;  2NWF A;  3L73 E;  2A06 E;  2HML A;  1G8K B;  1UUW A;  4HM1 A;  1L0L E;  2QPZ A;  2BMR A;  2HMM A;  1SQX E;  1O7P A;  3CXH E;  1VF5 D;  2QJP C;  2JO6 A;  3H1I E;  1ZRT E;  2FYN C;  4HM8 A;  3GCE A;  2NUK A;  4AAY B;  5KLV E;  2D2C D;  3L74 E;  1VM9 A;  2QJK C;  2B24 A;  2I7F A;  4HM3 A;  4D6T E;  3GL0 A;  1NU1 E;  3GTE A;  1L0N E;  2E75 D;  2HMO A;  2BMO A;  2FYU E;  4PD4 E;  4H13 D;  1RIE A;  3C0D A;  4HM6 A;  4NB9 D;  1EZV E; 
#chains in the Genus database with same CATH topology
 1FZC A;  1RY3 A;  1N7S D;  1YHQ P;  2IDB A;  4QUP A;  3WUT A;  2JR8 A;  1AQ5 A;  3FXD A;  3CD6 P;  2RKL A;  1AA0 A;  3AE2 C;  5KJ7 D;  1PP9 D;  1HJB A;  1IK7 A;  1M1J C;  1GL2 A;  4K3A A;  1M90 Q;  2WSF J;  2E76 B;  2AXC A;  5APQ A;  1DH3 A;  4UB8 E;  4UB6 H;  1BE3 D;  3QWO C;  2FYU D;  3VMA A;  3H32 B;  2WVR A;  3A0B E;  1ZXG A;  2AEJ A;  2ZXX A;  3T97 B;  2KSJ A;  5AW1 B;  1PZQ A;  3GTS A;  2O01 N;  3CWB E;  2FYZ A;  2YKO A;  4EMJ B;  1CI6 B;  2POH A;  4TT3 H;  4ZNC A;  1QL2 A;  3PH0 A;  1KIL E;  3KQG A;  2IFN A;  1NH4 A;  2GUS A;  1TU3 F;  1O7N A;  2K9J A;  3CCM P;  1FJP A;  3TYY A;  1FZE A;  4HKZ H;  5AVR B;  2M3E A;  3M9H A;  2QJP C;  2WPR A;  3EFG A;  1NTZ D;  4D6T D;  1VDF A;  2BEZ F;  4PJ0 E;  4JBZ A;  3M9B A;  1VF5 C;  1JY3 N;  3WMM 0;  1KN7 A;  3Q5S A;  3MUD C;  1DEE G;  2BCC E;  2Q3I A;  4HJL A;  1NKZ B;  5APX A;  3ABV C;  1L4A A;  1URQ D;  1BGY D;  2E74 B;  1FQT A;  2WPS A;  3B5N D;  1QX8 A;  3G3Z A;  2OQQ A;  1FU1 A;  2B87 B;  1URQ C;  1DEB A;  1OW8 A;  5B5E H;  2E4Q A;  4R4M A;  1JOC A;  1RF1 B;  3KPE A;  1HVV A;  1VQ8 P;  3D6Y A;  4I6M C;  3H1I G;  2PRR A;  3KZI E;  2CK3 H;  3G6E P;  3H1H D;  1VQ4 P;  2AXT E;  3W67 A;  5KLI B;  4P1C H;  2PP6 A;  4HB1 A;  4C7N A;  3TNU B;  2QSI A;  2M3B A;  2B87 A;  1IFP A;  3GB4 A;  1NOH A;  2KK7 A;  1NTK G;  3BAT A;  5AW5 B;  4JYB A;  1NU1 J;  2B1X A;  4AYC A;  3CCR P;  1NU1 K;  2WPQ A;  3TGU G;  1NTZ G;  1AVO A;  4HM1 A;  2V7Q H;  3L74 D;  2KLU A;  2P58 A;  1J1E C;  1NYH A;  1OXZ A;  4L74 A;  5APT A;  1N8R Q;  1H8A A;  1LTJ C;  3GL0 A;  2RH0 A;  1LTJ A;  1N86 A;  3F5H A;  1EC5 A;  2Y0D A;  1Q81 Q;  2XND H;  3CPW O;  1SQQ E;  3L75 D;  4U3F E;  3B71 A;  2VRS A;  3A0B H;  3TSI A;  1VQ5 P;  5GTI E;  3CCU P;  1MUU A;  2B9B A;  3U59 A;  1ZLL A;  3V2R A;  2W6J H;  1Y8A A;  2NPS D;  3P8M C;  4DCK A;  2ZJS E;  3AE4 C;  1ZME C;  1LJ2 A;  1SFC B;  1LTT C;  1NTK K;  1NTM K;  1O7H A;  5CBN A;  1USD A;  3WU2 E;  1QLE D;  1NWQ A;  4BRY B;  5CCH D;  2AXT H;  3L70 D;  1KYO E;  4Y28 J;  2DW3 A;  1BE3 G;  1NHL A;  5M1B A;  2R32 A;  3NFQ A;  1ZRT D;  3H1I D;  1SQV D;  1OVV A;  1R8E A;  1VQ7 P;  1PPJ E;  2GBX A;  2P7J A;  3CC2 P;  1BCC J;  2WSS H;  4EIJ A;  3V2Q A;  2G3A A;  1LT9 B;  4JYC A;  1YTZ I;  1HJ0 A;  4NBD D;  4PV1 D;  4ASV A;  2P2U A;  1ZW0 A;  2ZYA A;  2JKV A;  3U1C A;  2KZI A;  1VQK P;  1UUW A;  1SVF A;  2I1J A;  3CCL P;  2QJY B;  3C1L A;  1YTZ T;  4I7Z B;  1PIX A;  5APY A;  1YJN P;  1K05 A;  2YNY A;  2QJK C;  4OGQ B;  5BVZ A;  1YYC A;  1NTZ J;  2HMO A;  3R2P A;  1EZV E;  3L4F A;  2QA4 P;  1GU4 A;  1DX7 A;  3JCU E;  1Q90 D;  1R5S A;  2E76 D;  5AW7 B;  1JNM A;  1Q7Y Q;  3VTP C;  1KFM A;  3CCS P;  1K73 Q;  2E76 C;  4W7Y A;  3L75 G;  3L35 A;  2NVF A;  5AVQ B;  1FBM A;  5CJ4 A;  2A45 H;  2JP3 A;  1JO5 A;  3M0A A;  3CC4 P;  1N7L A;  2ZT9 D;  2YFI A;  5AVY B;  3GG2 A;  3GL2 A;  4N78 D;  3LW5 J;  1SS1 A;  4UB8 H;  3H1H J;  5C39 A;  4H13 B;  2XRX A;  2W6A A;  1EZV D;  2KZJ A;  2Z4E A;  1EXJ A;  2RN0 A;  1HGZ A;  1DIP A;  3D89 A;  3IFM A;  3H6P A;  1SFC A;  1KOR A;  1SQB D;  5BOK A;  1FE6 A;  1OX3 A;  2ZVN B;  1S1C X;  2IZ1 A;  4IL6 E;  1NTK D;  1A02 F;  3HUS C;  3M9Q A;  2YVJ B;  2OYO A;  2YIU C;  3D70 A;  1G8K B;  5APU A;  2OTK E;  4NPF X;  4ZKP A;  1GW4 A;  2K1A A;  2BCC G;  2YKP A;  3L71 D;  4K35 A;  2JO1 A;  4AAY B;  2HYN A;  2WT7 B;  1S72 P;  4OWF A;  1NTK J;  3LIE A;  2FYU E;  1CI6 A;  3FWL A;  4QDF B;  1FZC C;  1SJG A;  1CW5 A;  2KB7 P;  3AE1 C;  2OYI A;  2QM8 A;  5CMZ A;  4C7N B;  4P1B H;  1RF1 C;  3C9I A;  2LXB A;  5KLV J;  2R5D A;  3E7K A;  3L73 D;  2HMN A;  3GOB A;  3HTK B;  1BSH A;  4IL6 H;  3OW2 O;  2W90 A;  1H89 A;  1ULI A;  2I8D A;  2FXP A;  4NBH D;  1A02 J;  3N4X A;  1GL2 C;  3HUS A;  1AQT A;  3TK1 A;  3VMI D;  3RK3 C;  2OYH B;  2O01 J;  2NPS B;  4IFM A;  3AEA C;  4H0L C;  3A0H H;  1FOS F;  3FXE A;  4OGQ D;  1EG9 A;  1GMJ A;  1JB0 J;  1SQV K;  1JY2 N;  1WQL A;  1FZA A;  5AW0 B;  3CXH H;  3GZY A;  2A45 G;  2A45 I;  2C9L Y;  3TGU E;  1LTI C;  2KYV A;  5AVW B;  3MGN A;  3V2N A;  5KAF H;  2CKF A;  2LXC B;  3O6Q B;  2P67 A;  5BU8 B;  2IPP A;  1KIL B;  2ZXE B;  3UIA A;  1S5L E;  4HM8 A;  3OAK A;  3BCC D;  4W80 A;  3GCE A;  2H7H A;  5KLV E;  1SQP K;  4Z1M H;  2BEQ D;  4PJ0 H;  1HF9 A;  1KYO H;  3GF3 A;  2BCC D;  2G8Y A;  2K3R A;  3H1H G;  2J59 M;  3MIW A;  4N78 E;  2DE7 D;  2Q9I A;  2K9J B;  1P84 D;  5AW4 B;  3L36 A;  2MKV A;  1MFZ A;  2QG4 A;  2R3C A;  1SQP G;  4WY4 D;  1KQF B;  1JTH A;  2W83 C;  2FXO A;  3RGU A;  1LNQ A;  2E42 A;  2C9N Y;  5AW6 B;  4IOI H;  1NGM B;  3PTZ A;  1M7L A;  2Y9Z A;  1VF5 B;  1P84 I;  1FDM A;  3PLN A;  3SFD C;  1O7W A;  3S9O A;  3T97 A;  3G71 P;  1QEX A;  5DJU B;  3RBX A;  2LR2 A;  2HR3 A;  5AW8 B;  5K5G B;  2E74 C;  1IFD A;  1LT9 C;  5CCH C;  2CPB A;  1GK4 A;  1JTH B;  5AVZ B;  5CCH A;  3D6Z A;  2WTY A;  3VP8 A;  4Y99 C;  1HUC A;  4QDD A;  1NTM E;  3H1J J;  3L74 J;  1X9V A;  2KSE A;  5HL4 A;  2C0W A;  1JCD A;  1WRG A;  2NWF A;  4U7J A;  3CCE P;  1URQ A;  1IFM A;  1EDJ A;  2HMM A;  1MKM A;  3B5N A;  1VF5 D;  4HJG H;  3CL3 D;  3AE7 C;  2H43 A;  5AVX B;  2ZVO B;  2J58 A;  1KD1 Q;  4HM3 A;  2KIK A;  4PV1 C;  4PD4 E;  1RIE A;  3C0D A;  1JMM A;  2WSC H;  2UWJ E;  2E43 A;  3B5N B;  2HMJ A;  3EQQ A;  4QCK A;  4UB6 E;  2HOD B;  2O1K A;  1EXI A;  1LT9 A;  3S4R A;  5CCG D;  1O7G A;  4H44 B;  3V5B A;  1AFO A;  1BGY E;  1MFT A;  3CX5 E;  3VYI A;  2NRG A;  2HPC B;  1FDI A;  3CX5 D;  1UIX A;  2KXP B;  1LTA C;  1E5W A;  1PL5 A;  1LTJ B;  3CWB D;  2E5T A;  2Q3E A;  1ZOY C;  1FOS E;  1SQP D;  4NPE A;  1HH0 A;  1Q90 C;  4HM4 A;  1J2J B;  2R3S A;  2K9Y A;  4PD4 D;  4HM0 A;  1NO4 A;  2FXM A;  3PP5 A;  1G1J A;  2QVA A;  2ZT9 C;  1VL2 A;  1LWU B;  1LP1 A;  3HTK A;  4PD4 H;  3Q2Y A;  3H1J E;  3N0Q A;  3FGA D;  3L71 J;  2BCC J;  5E79 H;  1YBK A;  3BCC J;  2YIU B;  2D2C B;  2YXQ B;  1SFC C;  3H1L G;  4L75 A;  1OFC X;  4N6J A;  4NBB D;  1YIJ P;  1T8Z A;  4QDF A;  3EFF K;  2C0X A;  4NBG D;  1SFC D;  3CXH I;  3L73 E;  2YO2 A;  4C46 A;  3E1I A;  1IFI A;  5KTB A;  2QPZ A;  2IBZ G;  3EWK A;  1X8Y A;  3LW5 H;  2QM7 A;  3VP9 A;  1FS0 E;  1EZV I;  1FZC B;  4TLF A;  2E5Y A;  1D7M A;  1KMI Z;  1KQL A;  5CCG A;  4HM5 A;  1LTG C;  1FJK A;  3USS A;  2HG5 D;  5APV A;  1KQG B;  3RK3 E;  3EN1 A;  5AEU A;  1UII A;  1VPC A;  2Q5U A;  3H1H E;  3MD0 A;  3OA7 A;  4NBF D;  1OIP A;  1RFS A;  2OYI C;  1GL2 B;  2QJY C;  5H2F E;  1HTL C;  2E74 D;  3CWB J;  2YKQ A;  3RK3 B;  4DJG A;  1Z56 A;  2NPS C;  1NTK E;  4AUW A;  3WUU A;  4RES B;  1IK9 A;  2WT7 A;  2FY8 A;  2GA1 A;  1PV3 A;  5KLV D;  3L73 J;  3AEF C;  2JEE A;  2M0B A;  4W7Z A;  4WVZ A;  3PRJ A;  1YIT P;  3GF7 A;  1GL2 D;  5AW2 B;  2K37 A;  3GKE A;  3AZC A;  1S2E A;  1KIL C;  1NU1 G;  4WB4 A;  3H1K E;  1BDC A;  5KLV G;  2PFX A;  2KNC A;  3IR9 A;  1AV1 A;  1SQX K;  2Q6Q A;  3CME P;  3BRT B;  3L70 J;  1K8A Q;  1YQ3 C;  4H13 C;  1S3J A;  3P32 A;  1SQV J;  1CSB A;  2O3J A;  4H13 D;  4D6T G;  4GOF A;  3VOP A;  2WSF H;  3A0H E;  1HWT C;  1SQQ J;  1SQB E;  3HUS B;  1JY2 P;  3A7O A;  2W8Z A;  2O01 H;  2QRX A;  1JCC A;  1T6A A;  5H2F H;  1NTM G;  3Q5P A;  1GD2 E;  1BCC G;  4N3Y B;  1N73 C;  4GOD A;  3KXD A;  5CBO A;  1BDD A;  2WWW A;  1KQS O;  3B4S A;  1U7J A;  1HGV A;  4LGD E;  1MV8 A;  3HD7 D;  3KYQ A;  5KLV K;  1G8J B;  3KZI H;  2N9B A;  4Y99 B;  3SWK A;  1VQP P;  5KAI E;  4RO0 A;  3AEG C;  3BAS A;  5CJ0 A;  3G4S P;  1ZN5 A;  1YQ4 C;  3VCP A;  2NUM A;  4U3F J;  2YFL A;  2OYH A;  1NJI Q;  3AE3 C;  2OYH C;  2A06 E;  3HE5 A;  5TIS E;  3H1K D;  1KZU B;  4AQR D;  3CCJ P;  1QVG O;  4H0L B;  4QMA A;  3B5N C;  1S4X A;  3GMA A;  3H1J G;  2IZ0 A;  4IL6 X;  1M57 D;  1VQL P;  3GTE A;  3L72 D;  2BMO A;  1VQ6 P;  3P8C D;  3VN0 A;  2J5U A;  4H44 C;  1E79 H;  2DE5 D;  4OH8 B;  1L2P A;  4JQ0 D;  1X0T A;  2QIW A;  3GZX A;  3H25 A;  2MJZ A;  3S1K A;  1WMK A;  4LLH A;  1LP1 B;  1SLQ A;  1PPJ D;  1KYO D;  4GIF A;  1SQV E;  3P7K A;  4XA4 A;  3BRV B;  1SQX D;  2JWA A;  5KAF E;  4NB8 D;  2XDJ A;  5L8R J;  3I56 P;  2H8P D;  5DJT B;  3L72 J;  5AW9 B;  5AVV B;  4A7P A;  2FFD C;  4C7R A;  3MZW B;  3L72 E;  4NPD A;  2FYU K;  2FFD A;  4BRY A;  3H1L D;  5KKZ C;  1N2D C;  3H1L E;  2E4P A;  1VQ9 P;  4YPC A;  3KDP B;  1KV4 A;  3CC7 P;  2M5A B;  2B89 A;  1KB9 I;  3NTN A;  2XSO A;  2YFJ A;  5TIS H;  1M1K Q;  3RK2 B;  1FZB A;  4IFF A;  3M0D A;  3JCU H;  3L71 G;  2WSE J;  1L0L E;  1WT6 A;  1O7P A;  2LKM A;  1ZRT E;  3H1I E;  3L70 G;  3Q5R A;  1XTG B;  4JPZ B;  2WIT A;  1M56 D;  1EZV G;  1SQV G;  3A3Y B;  2I1K A;  2KLV A;  3VCA A;  4ZMD A;  2IBZ I;  1FC2 C;  1L4A C;  1S9K E;  3AE6 C;  2PGD A;  1KIL A;  4O9B A;  1HBW A;  1N7S C;  5B5E E;  2BMQ A;  3EQ2 A;  3AED C;  2HFE D;  4QDC A;  3SWF A;  3FX0 A;  1GZL A;  4WY4 C;  1Q86 Q;  1L0L D;  4WY4 A;  1BGY G;  1JM1 A;  1T2K C;  3CX5 H;  2ZYL A;  4PV1 B;  4WWI A;  4DT0 A;  2NVE A;  3RL0 C;  1H0T B;  3L74 G;  4BWN A;  4EYY Q;  2XZR A;  3WU2 H;  2R44 A;  2HPC A;  3HD7 C;  2ZYG A;  1PGJ A;  2V4H A;  4YXD C;  2IYP A;  4QUQ A;  1H0T A;  3RK3 D;  3CCQ P;  1N7S A;  1W2E A;  2FKW B;  2OTJ P;  1N73 A;  1MZ9 A;  2DE6 D;  1KB9 D;  2Q7C A;  1NU1 D;  4U3F D;  4ZKU A;  1SQQ D;  2BMR A;  1LWU A;  2ZT9 B;  1L0L G;  1PFI A;  2E75 C;  2FYN C;  1LWU C;  3H1K J;  1Q82 Q;  1KB9 H;  2NUK A;  1OW7 A;  2D2C D;  1W5C E;  2WPV B;  1GTW A;  1NTM J;  3RL0 g;  2E75 D;  2M5A A;  1KIL D;  1KFN A;  1FZG A;  3F89 A;  2ZYD A;  2D2C C;  1RE4 C;  2N1T A;  5CCG C;  3GLM A;  3FOU A;  3BCC G;  4NBE D;  1M8O B;  1PPJ G;  3MTU E;  2AEF A;  1ULJ A;  4GOE A;  1BCC E;  1N73 B;  1EDI A;  1NAY A;  3CI9 A;  2O1J A;  2FYU G;  2L91 A;  4CPG A;  4AIV A;  1BE3 E;  2KS1 A;  3CLQ A;  2AEM A;  1NKN A;  2JDI H;  4PD4 I;  3GHG C;  2YMY A;  2HMK A;  1PGP A;  2NPS A;  4EOT A;  4IFD K;  1NTM D;  3IAO A;  1ZV8 A;  3V2P A;  3M0D C;  2QEX P;  2GBW A;  5GTI H;  1P84 E;  2Y0E A;  2NZ2 A;  1GW3 A;  1PP9 J;  3CX5 I;  3D71 A;  1SQP J;  3O6Q A;  1J1D C;  1IZN B;  1KTM A;  2OYI B;  1EDL A;  2XKM A;  2H88 C;  2N1T C;  1GDT A;  5CXM A;  1VCK A;  5CHX A;  1EQ7 A;  3LID A;  3CXH D;  2KS1 B;  2W27 A;  1DD3 A;  1R5L A;  2N1T D;  2KI7 B;  3IF4 A;  3DQY A;  1T3U A;  4KJM A;  1L4A D;  3HE4 A;  3AEC C;  1L0N K;  3CMA P;  2IYO A;  3GHG A;  2KP8 A;  3TGU D;  1M1J B;  3O8Z A;  3L73 G;  5AVS B;  2B24 A;  4RJT A;  3A5T A;  1BGY J;  3PHL A;  4HM6 A;  3II6 A;  2HOD A;  1S5L H;  2Y0C A;  1S9K D;  1SQB J;  2NVG A;  4YTP C;  2Q1K A;  1SQX G;  3QH9 A;  4I1L A;  3CCV P;  2ZFC A;  3TF5 A;  3BCC E;  3V4W A;  1RH5 B;  3VMY A;  3WUV A;  3VMZ A;  1PP9 E;  5TJH A;  3TNU A;  4LC1 A;  1YJ9 P;  1YI2 P;  4L76 A;  2FFD B;  1L0N J;  1QL1 A;  4EDF A;  1VQM P;  4M3L A;  5BU5 A;  5KKZ B;  1AVY A;  1KYO I;  1Q2N A;  3CWB G;  2PAJ A;  3V6I A;  3MUD A;  1BSN A;  1NYK A;  3SWY A;  1RQV A;  2OTL P;  2QJP B;  2XSH A;  4HYT B;  1CZQ A;  3OJA B;  1BE3 J;  1KB9 E;  3GW6 A;  3I55 P;  3SFE C;  2L5G B;  3AE5 C;  3HRN A;  1NVO A;  3L71 E;  2XNX A;  2IBZ D;  4H0L D;  4HM2 A;  2JJL A;  2WQY C;  2KNC B;  1W2B O;  3B8E B;  4WBA A;  1IO4 A;  1SQX E;  1URQ B;  3M06 A;  3RK2 D;  3CXH E;  3NMD A;  4KHX A;  3L75 J;  1SQQ G;  5AVT B;  1X22 A;  2A06 G;  2ITA A;  1VM9 A;  3HE5 B;  1ZR4 A;  1IFN A;  5GTH H;  2OGU A;  3HE4 B;  1L0N E;  3ITK A;  2SPZ A;  1U7M A;  2R5B A;  1IJD B;  1N7S B;  2GUV A;  3VMG D;  4DOJ A;  4I2L C;  5KLI C;  1OZH A;  4MN4 C;  5AEW A;  3NXS A;  1RE3 C;  3KHU A;  3AE9 C;  1RF1 A;  1RF0 A;  2V7Q J;  1U57 A;  3C8V A;  4BXL A;  1SQB K;  3AEE C;  1GU5 A;  3L75 E;  4R4L A;  3L72 G;  5KJ7 C;  1H88 A;  1OVR A;  5KJ7 A;  3RL0 B;  5E79 E;  4L73 A;  2H89 C;  1G1I A;  1JY3 P;  2CPS A;  1UUV A;  3FWN A;  1L0N D;  1RE4 A;  1VQO P;  5GTH E;  1AJY A;  1FAV A;  3Q1M A;  3MHV A;  1RHZ B;  2WZ7 A;  2WSE H;  2XU6 A;  2IFM A;  3HD7 A;  1IC2 A;  1ZR2 A;  4KT0 J;  3M91 A;  1NTZ E;  1NDO A;  2XV5 A;  1RQU A;  4JF7 A;  1QVF O;  1EDK A;  1O7M A;  1LGH B;  3H1K G;  3R4Y A;  2E75 B;  1JY3 O;  2FYN B;  3H1I J;  2RMZ A;  2HML A;  2QE7 H;  1OW6 A;  2YXR B;  2Y9Y A;  2W6B A;  4DZO A;  1L0L K;  1BCC D;  4OVN F;  3SSU A;  1YJW P;  4U3F G;  4XE5 B;  3U1A A;  4D6T E;  1JM0 A;  4RKU J;  1X79 B;  1T3J A;  4NB9 D;  1P84 H;  1LTB C;  1OVU A;  2Z5I A;  3W68 A;  3G9R A;  1SQB G;  4NBC D;  3BVH A;  3RK2 C;  2YMK A;  4HM7 A;  3GHG B;  3Q3D A;  1JUN A;  4YXW H;  3ZDM A;  2P10 A;  4NBA D;  3H1L J;  1IFJ A;  2YO3 A;  1G2C A;  2JZA A;  4GDO A;  3VMX A;  1SQQ K;  1K04 A;  4B86 A;  5EFW B;  1SQX J;  1L4A B;  4I7Z C;  1LT1 A;  2N1T B;  1OWA A;  2A06 D;  1JY2 O;  2GM4 A;  2IX7 C;  2QJK B;  3JSV C;  2M8R A;  1GK6 A;  4OGQ C;  1DD4 A;  3TGU J;  1USE A;  2FBW C;  3MP7 B;  1K9M Q;  4WY4 B;  3VMH D;  3AEB C;  2Z5H A;  1OMI A;  1M1J A;  2WMM A;  2B88 A;  1RE3 A;  1RF0 C;  1QGK B;  5B66 H;  1PGO A;  4D6T J;  1L0L J;  1Y47 A;  3PJS K;  3I5C A;  2OAR A;  4EI2 A;  2BAS A;  1NTZ K;  1NU1 E;  3HD7 B;  1XTC C;  5AVU B;  1L0N G;  1J1E B;  1S5L X;  2XR8 A;  1PP9 G;  3TDK A;  3H32 A;  5APW A;  2KUB A;  1SP4 A;  2ZAE B;  3L37 A;  2HLO A;  4HKV A;  5AW3 B;  3AE8 C;  1NAF A;  3K5B A;  2KOG A;  4XFJ A;  1T2K D;  2FYU J;  1JEK A;  3L70 E;  2JWD A;  4GT1 A;  3JC2 2;  3RL0 D;  2IBZ E;  1JMB A;  1LTS C;  1FDO A;  2K88 A;  2P1J A;  1VQN P;  3P8C E;  2N9Y B;  4QUR A;  3N7N A;  4ASW A;  1G2C B;  5APS A;  1KC8 Q;  3V4Q A;  5B66 E;  1SQP E;  4H44 D;  3IN6 A;  2Q3W A;  3A2A A;  2WSC J;  3E1R A;  1PGQ A;  3RBZ A;  5KAI H;  2JO6 A;  1Y9B A;  4HH2 A;  4GKG A;  1J1D B;  3L74 E;  2I7F A;  1FZF A;  3H1J D;  1ZP0 C; 
#chains in the Genus database with same CATH homology
 2HMJ A;  3VCA A;  2XR8 A;  3EQQ A;  2BCC E;  4HM5 A;  4QCK A;  3VMG D;  1SQQ E;  4HJL A;  4U3F E;  2NVG A;  4QDF B;  3FOU A;  1SJG A;  4NBE D;  3EN1 A;  2DE5 D;  5KLI C;  1SQB E;  4NBC D;  2DE7 D;  3GZX A;  2E76 D;  1ULJ A;  4QUP A;  5AEU A;  5AEW A;  3BCC E;  3H1H E;  1BCC E;  1FQT A;  2BMQ A;  1O7G A;  4HKV A;  4NBF D;  4HM7 A;  4P1B H;  1BGY E;  1PP9 E;  3CX5 E;  1RFS A;  2QJY C;  1SQV E;  4NBA D;  2E74 D;  4QDC A;  2HMN A;  3GOB A;  4AIV A;  1BE3 E;  2NVF A;  3L75 E;  1ULI A;  4NB8 D;  2E4Q A;  2JZA A;  1NTK E;  4NBH D;  3L70 E;  2HMK A;  1O7H A;  1JM1 A;  2ZYL A;  2IBZ E;  1O7W A;  2YFI A;  2ZT9 D;  1Q90 C;  4HM4 A;  2GBW A;  1UUV A;  3VMI D;  1P84 E;  4HM0 A;  3GL2 A;  3L72 E;  2NVE A;  1KYO E;  1NYK A;  4P1C H;  5KKZ C;  4OGQ D;  2XSH A;  1EG9 A;  1G8J B;  1KB9 E;  2XRX A;  3H1L E;  3GTS A;  3CWB E;  4EMJ B;  1WQL A;  2E4P A;  3H1J E;  3N0Q A;  1PPJ E;  3GB4 A;  2GBX A;  4QUR A;  3GZY A;  3D89 A;  4QUQ A;  5CXM A;  5BOK A;  3VMH D;  1VCK A;  1NTZ E;  3GKE A;  3L71 E;  3TGU E;  1NDO A;  2XSO A;  1NTM E;  2YFJ A;  4QDD A;  3VCP A;  2NUM A;  3AZC A;  4NBD D;  4PV1 D;  1O7M A;  4NBB D;  1O7N A;  2CKF A;  2B1X A;  4QDF A;  5HL4 A;  2YFL A;  1SQP E;  3DQY A;  2YVJ B;  2Q3W A;  3H1K E;  4H0L D;  4H44 D;  4HM2 A;  4NBG D;  2YIU C;  2DE6 D;  2NWF A;  3L73 E;  2A06 E;  2HML A;  1G8K B;  1UUW A;  4HM1 A;  1L0L E;  2QPZ A;  2BMR A;  2HMM A;  1SQX E;  1O7P A;  3CXH E;  1VF5 D;  2QJP C;  2JO6 A;  3H1I E;  1ZRT E;  2FYN C;  4HM8 A;  3GCE A;  2NUK A;  4AAY B;  5KLV E;  2D2C D;  3L74 E;  1VM9 A;  2QJK C;  2B24 A;  2I7F A;  4HM3 A;  4D6T E;  3GL0 A;  1NU1 E;  3GTE A;  1L0N E;  2E75 D;  2HMO A;  2BMO A;  2FYU E;  4PD4 E;  4H13 D;  1RIE A;  3C0D A;  4HM6 A;  4NB9 D;  1EZV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...