1L0LE

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 28
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0lE02
3CXHE 2DE5D 3H1IE 5KLVE 3AZCA 2HMJA 2YFLA 1RIEA 4QURA 1G8JB 1EZVE 1P84E 1NTME 1BGYE 1SQQE 2HMLA 5KLIC 2B1XA 3VMID 1EG9A 1NYKA 1SQXE 3GL2A 2XSHA 2ZYLA 5KKZC 2NVFA 2E4PA 4HM1A 2QJYC 3TGUE 3D89A 4NBHD 2NUKA 4QUPA 1WQLA 2A06E 2JZAA 2E4QA 4HM6A 3VMHD 4AIVA 4NB9D 3BCCE 2E74D 3H1HE 1PPJE 4HJLA 3L74E 1SQBE 2NUMA 1JM1A 2IBZE 4QDFB 1UUVA 4NBDD 1BCCE 3GZXA 3H1LE 3L71E 2BMQA 2BCCE 3GZYA 2XRXA 2BMOA 2YVJB 2E76D 2B24A 4P1BH 1KYOE 3H1JE 1O7MA 3GL0A 4HKVA 3EN1A 1O7WA 1VF5D 4NB8D 3VCAA 2HMOA 2NVGA 4OGQD 5CXMA 1ZRTE 1SQPE 4AAYB 2YIUC 4QDFA 3CWBE 2DE6D 2DE7D 2YFJA 3CX5E 3GB4A 5AEUA 4U3FE 1NTZE 4NBCD 4QUQA 2I7FA 4EMJB 4PD4E 4HM3A 1VM9A 1SJGA 1O7PA 3L73E 4H0LD 4HM4A 4HM2A 4NBBD 1L0NE 2FYNC 3L72E 1UUWA 2YFIA 1NDOA 1NU1E 4QCKA 1O7GA 4HM5A 2FYUE 1FQTA 3GKEA 5AEWA 1PP9E 4H44D 1O7HA 3C0DA 1ULIA 2JO6A 2QJKC 2GBWA 1SQVE 4H13D 1BE3E 1ULJA 3VCPA 3EQQA 1NTKE 2HMKA 2QJPC 5HL4A 3L70E 4HM7A 4NBED 1VCKA 2D2CD 1L0LE 2HMNA 4D6TE 3VMGD 1G8KB 3GTEA 2ZT9D 4QDCA 4QDDA 4PV1D 2BMRA 2QPZA 2GBXA 2XR8A 1O7NA 2HMMA 3FOUA 2NWFA 3GTSA 3GCEA 1RFSA 2E75D 4HM0A 3L75E 2CKFA 3GOBA 2XSOA 4P1CH 4NBGD 3N0QA 3DQYA 4HM8A 1KB9E 4NBAD 5BOKA 3H1KE 4NBFD 2NVEA 1Q90C 2Q3WA
chains in the Genus database with same CATH superfamily
1K73Q 1EXJA 1JCCA 3EQ2A 3CWBJ 3VMXA 2V7QJ 1YI2P 3L70J 2N1TB 1N7LA 1XTGB 1SFCB 1AV1A 3VMID 2QM7A 1OW6A 2JEEA 1NYKA 4H13C 4YXWH 3CLQA 4HM6A 1JCDA 1G2CB 3OA7A 1YTZT 4PD4D 1JMBA 1M1JA 2FY8A 2KB7P 5TISH 1BDCA 1JTHB 3HUSA 3CX5E 4GKGA 3AE4C 3MGNA 1MFTA 3P7KA 2HPCB 3BCCJ 1S5LE 3HD7D 1L0LD 2KXPB 1M1JC 1IZNB 2WWWA 5BVZA 1BE3E 3HUSC 2HMKA 1FOSF 2QJPC 1L0NK 1SQQG 1VQKP 3F5HA 2C9NY 2N1TD 3OAKA 4H0LB 2KSEA 3W67A 4D6TE 1SFCD 4QDCA 1X22A 2H7HA 4PJ0E 1EDJA 3A0HH 4K35A 2KLVA 2XSOA 4NBGD 2KSJA 2NVEA 5GTIH 2W6JH 2Y0DA 4U3FD 1CW5A 2YNYA 4BRYB 1L0ND 2IZ0A 2B1XA 3H32A 4PD4I 4UB8H 3GHGA 5KKZC 1KILE 3TGUE 3U59A 2NPSA 4R4LA 5KTBA 1IK7A 1TU3F 2QJKB 3AEFC 1PPJE 4IL6H 1EQ7A 5KJ7A 3VP8A 1HTLC 2QIWA 3PP5A 3LW5J 1DEEG 2R5BA 2P67A 4W7ZA 2FYNB 4P1BH 1NHLA 4NB8D 1FZFA 1L0LG 2LKMA 1FJPA 1SQPE 3GHGC 4ASWA 1SQQJ 2GUSA 2KS1B 4Y99B 2A45G 3MP7B 2A45I 1O7PA 4H0LD 3JCUH 5KJ7C 1KB9D 1Q90D 3L72E 1S3JA 2G3AA 1DIPA 5CCGD 2LR2A 3GKEA 1QLED 1O7HA 1E79H 5KLIB 2FXOA 1HGVA 1A02J 1A02F 1VDFA 1J1EC 4KJMA 3RL0g 2HYNA 2QM8A 3RBZA 2BASA 2WZ7A 1RY3A 3CCSP 3FX0A 2Q3IA 1E5WA 3CC2P 5APUA 1JY2N 3AE3C 1OFCX 2WT7A 3M9BA 1T2KD 2W27A 4KT0J 2N9YB 2E43A 3TGUG 1RIEA 3VOPA 1HVVA 3RK3B 2HR3A 3LW5H 3CMAP 1NTZG 2IBZD 1L0LJ 4IFDK 1MUUA 2E4PA 2JWDA 2BCCD 1N86A 3M06A 1KILA 1RE4A 1U7MA 1Q81Q 3M9QA 4NB9D 3S4RA 2D2CC 2YO2A 3Q5PA 3A3YB 4QDFB 1EXIA 1BCCE 4AYCA 4PV1C 4HKZH 1SQXK 1WRGA 3KZIH 2E75C 4UB6E 5H2FE 2HMOA 2Y9ZA 2YIUC 3F89A 3L72G 3ZDMA 2JR8A 1KILC 1RE4C 3IAOA 1BSHA 3TNUA 2W83C 2OQQA 4NPEA 1J1DB 4ASVA 5AVRB 4PD4H 1GK6A 1QL1A 4H44D 2Q3EA 1VF5B 1SQVE 1ZLLA 2L5GB 1SQXD 2R44A 3CMEP 2Y9YA 1KV4A 1AQTA 3TGUJ 3VMZA 2FYZA 1VQOP 1Y8AA 1GK4A 3BVHA 1NTZJ 3VMGD 4MN4C 2GBXA 1URQA 5AVUB 4OGQC 3VTPC 4L73A 2XNDH 1JB0J 1RF1A 2IBZI 2Y0CA 1VQ8P 3W68A 5AW4B 2A45H 1R8EA 1VQMP 1GW3A 1IFMA 2JO1A 2R5DA 2GUVA 1L2PA 2LXCB 3H1IE 2HMJA 2ZJSE 1EZVE 2ZT9B 3H1LD 2HG5D 1SLQA 2QJYC 1LTIC 3L72J 5AW6B 1RF1C 1NU1G 4M3LA 2E74D 1XTCC 2OYIA 1UUVA 5TISE 4NPDA 1Q82Q 4WBAA 1N7SB 1ZN5A 4Z1MH 1FDMA 3A2AA 1FU1A 2B24A 1PFIA 1VF5D 1RQUA 2FFDB 3GLMA 2NVGA 3MUDA 1LTBC 1YQ3C 2RMZA 5TJHA 4YXDC 2R32A 4HM2A 3Q5SA 2XNXA 1LTJA 2AEJA 2FYUE 2O3JA 1LWUA 1FQTA 5CCHA 2KIKA 4C7NB 2CPSA 2B87B 2W6BA 2RKLA 1UIXA 3S1KA 5AVZB 1LP1A 3L70E 3IFMA 1VCKA 3A0BH 3A0HE 4C46A 4RJTA 3I56P 2OTLP 1KB9H 2A06G 2ZT9D 3AE8C 1LTJC 3FOUA 1OW7A 5GTIE 3BRTB 3H1LG 1NU1J 3H1IG 3L71G 2I1KA 1P84D 1IC2A 3AE7C 5BOKA 1L4AA 4UB8E 1OX3A 1N7SD 1T6AA 1ZV8A 1N73C 1HUCA 4W7YA 1ZXGA 2LXBA 1IO4A 2AEMA 4EOTA 2HMLA 1NH4A 4WY4A 4IL6E 1JY3N 3B5NB 4WVZA 1M1JB 2FXMA 2JZAA 3RL0B 1S9KD 2KK7A 5BU5A 3BCCE 4HJLA 1AA0A 3HUSB 1L4AC 2QJPB 1YYCA 1PGQA 2R3SA 1NTMK 3V5BA 4AUWA 3GZYA 3L35A 3K5BA 3L73D 2H43A 2G8YA 4GDOA 1JY2P 3SFDC 2OARA 4WY4C 3R4YA 3JCUE 3II6A 1SQBK 2GA1A 3SSUA 1PP9D 1T3JA 3SWFA 3LIEA 2XZRA 2YFIA 1OIPA 3H1LJ 3H1IJ 3L71J 5GTHH 2HODA 3V4QA 1NTMD 3VCPA 3EQQA 3T97B 1P84I 4RKUJ 3L4FA 3L75D 2HMNA 1D7MA 3HE4B 3CXHD 3B5ND 5KLVD 3Q2YA 1NTKK 3RL0D 3V2RA 2M3EA 1VQ9P 1JEKA 3H32B 2NPSB 3CPWO 4EYYQ 1FZEA 5CMZA 1EC5A 3KDPB 3H1HD 3C1LA 1SQQE 2Z5IA 2K9JB 2IZ1A 1M8OB 3QWOC 3CC4P 1GU5A 4NBHD 2I1JA 3CL3D 3KZIE 4EI2A 3AECC 1PP9G 2IPPA 1GZLA 1Q86Q 1GW4A 4XA4A 3GL0A 1LTSC 2J59M 3CCMP 4N78D 3RK2C 1KQLA 4PD4E 2C9LY 4HM4A 3PH0A 2H88C 2E42A 1NDOA 1QGKB 3NMDA 3USSA 3H1KG 2ZYAA 3CC7P 1T3UA 1AJYA 2WTYA 3CXHI 5KLVG 2YXRB 1NVOA 3TSIA 5HL4A 1LGHB 3AEEC 1GL2D 1L0LE 3O6QA 2E76C 2WT7B 5APQA 5AVTB 1VQ5P 4O9BA 2QVAA 3TYYA 5B66E 4P1CH 5APYA 1BGYD 2KI7B 1PP9J 3CX5D 2DE5D 2WPRA 3O8ZA 2QG4A 2H89C 2YKOA 5AVQB 1DD4A 4ZMDA 4QUPA 2VRSA 2E4QA 4AIVA 1JMMA 1P84H 4EDFA 1N8RQ 3L75J 1BE3D 3HE5A 1SP4A 3VMYA 3H1KJ 4LLHA 1GDTA 1CSBA 4K3AA 3TNUB 1JY2O 4DZOA 2ZXXA 3EN1A 5KLVJ 4D6TD 2P2UA 1LNQA 1UIIA 4OGQB 1GU4A 1PZQA 2DE6D 3KXDA 1NTZE 4EMJB 4Y28J 1VM9A 1HGZA 1KFMA 2KOGA 3OW2O 1JY3P 1K05A 1SQPK 2WITA 1ULIA 3G6EP 3A0BE 1ZR4A 1URQB 1ZR2A 2QJYB 3N4XA 3FWLA 1BGYG 3G4SP 4N6JA 1FJKA 4HB1A 3HD7A 3AE6C 2V4HA 3GTEA 1PPJD 4QDDA 2RH0A 2HLOA 3H6PA 1CI6A 4GODA 3EFGA 2KZIA 4YPCA 4HM8A 2N1TA 1SQPD 2OYHB 3Q3DA 3HD7C 4U3FG 2OYIB 2L91A 1FZCC 3CXHH 3GL2A 5E79H 2XSHA 1L0NG 4ZNCA 3D89A 3H1JD 5CHXA 1YTZI 1VQNP 2N1TC 2IBZE 1SFCC 3FGAD 2IFNA 2BMQA 2BCCE 5KAIH 2XRXA 2PAJA 3G3ZA 4HKVA 1YHQP 1LTJB 2ZYDA 1URQD 1LWUB 5EFWB 1BGYJ 2DE7D 2HPCA 1NOHA 3Q1MA 1KD1Q 2IFMA 2P7JA 2K37A 1PV3A 5GTHE 1DD3A 4WWIA 1NU1E 1X9VA 1KB9I 1S1CX 5AEWA 1WT6A 3GF7A 1Q2NA 1IJDB 2IDBA 4TLFA 1ULJA 2XV5A 4KHXA 4L75A 1LTAC 3OJAB 4I1LA 5CCGA 1PGPA 1W2BO 1H8AA 4U3FJ 1L4AB 1OVUA 1BCCD 1O7NA 1SQVK 1L0NJ 1KORA 5AVYB 2CKFA 1RH5B 4WY4B 4H0LC 1S5LX 1Q90C 3WMM0 1KFNA 1LJ2A 3ABVC 3RGUA 5CCGC 2Q7CA 3RK3D 4QURA 1K8AQ 1OMIA 2B89A 2KNCB 4HM1A 2IBZG 5CCHD 2JDIH 2A06E 3IF4A 2WSSH 1IFIA 1LT9B 2BCCG 3D6YA 1ZMEC 1SQVD 3P8CE 4XFJA 3C8VA 3H1LE 1ZOYC 3L71E 3CX5H 2PP6A 1IFPA 3E1RA 1G1JA 1JM0A 4TT3H 5AVSB 1USDA 4DCKA 1S5LH 1T2KC 2HODB 4HM3A 4NBBD 1EDIA 2FYNC 4I7ZB 4I6MC 1VL2A 2M8RA 1JY3O 1AFOA 3WU2H 2BEZF 2P1JA 2Q1KA 3C0DA 2JO6A 2GBWA 1EZVD 3CCVP 3V6IA 3FWNA 1OZHA 1H0TA 1IFNA 2O01H 5AW8B 1MKMA 1SQXG 2FYUK 3UIAA 1ZW0A 2XR8A 4RO0A 1DEBA 3B4SA 3GCEA 3CCEP 1PL5A 5AW0B 1DX7A 2BCCJ 2OGUA 1SVFA 3RK2B 1NJIQ 4H13B 3A5TA 4HJGH 1LT1A 1MFZA 1OVVA 1N73A 4DT0A 1FAVA 5CBOA 1OXZA 3L74D 1VQPP 1P84E 4H44C 1U57A 2XU6A 4U7JA 2FYUD 1WQLA 3VMAA 2HFED 1S2EA 2YKQA 4LC1A 2R3CA 1ZRTD 4L74A 1QEXA 1QX8A 4NBDD 4BXLA 3CWBD 3M9HA 5AVXB 4IFFA 2CK3H 1M90Q 5DJTB 2XKMA 2E76B 1O7MA 3B8EB 4IOIH 5AEUA 1Y47A 1SQXJ 1HF9A 3L73E 2MKVA 2SPZA 1KMIZ 3MTUE 1R5SA 1HBWA 3KHUA 1PP9E 4JBZA 4H13D 5AW2B 2Y0EA 2E74C 2W90A 2J58A 4DJGA 2BMRA 1VF5C 4JPZB 1HH0A 3ITKA 3L74G 3PJSK 3GG2A 3L75E 2OTJP 5M1BA 5KKZB 4NBAD 3H1KE 1M57D 3G9RA 2ZYGA 3AEAC 2YKPA 2BEQD 3CXHE 5E79E 5KLVE 4NPFX 1RE3A 5AW9B 1J2JB 1SQBD 1G8JB 3CD6P 3R2PA 3HE5B 2NUKA 1KYOD 1N7SA 3GHGB 1AVYA 3H1HE 1R5LA 1IK9A 4OH8B 3SWYA 2ZT9C 1SQQK 3N7NA 5CJ4A 1RE3C 4OWFA 4RESB 1VQ6P 5AVWB 3VCAA 2QA4P 3S9OA 3L73G 3CCQP 2I8DA 2WSCJ 2Z5HA 3CCJP 1N7SC 2QE7H 5KAFH 4C7NA 3CCLP 1J1EB 1NTKD 1YIJP 2RN0A 3L74J 1FZGA 3A7OA 1SQQD 4L76A 2M5AA 3VP9A 2QRXA 1CI6B 1NTMG 2M3BA 2GM4A 2O1KA 4NBED 1SS1A 1PGJA 3L75G 3Q5RA 2E5YA 4C7RA 1AVOA 2NWFA 1SQBG 4HM0A 3P32A 1FDOA 3N0QA 3SFEC 1L0LK 2NPSD 4NBFD 1KN7A 1KYOI 2P58A 2Q3WA 2K1AA 1M56D 1IFDA 2D2CB 2YFLA 3B5NA 5KJ7D 3H25A 3AE1C 2Q5UA 3FXEA 1BGYE 2KUBA 4PV1B 3L73J 1KQFB 2YMYA 3H1HG 3I55P 2E75B 1EDLA 2WSCH 2YIUB 3TDKA 1HJBA 1JM1A 3HTKA 3WUTA 1KILB 3V2PA 2WSEJ 3B5NC 1NTKG 2PGDA 1JO5A 3RL0C 3NFQA 3MD0A 3KQGA 4AAYB 1X0TA 3PLNA 1NTMJ 4GOEA 3GB4A 4U3FE 4QUQA 2CPBA 3U1CA 2KP8A 3WU2E 4HH2A 4IL6X 1L0NE 5APSA 1YJWP 1UUWA 3TK1A 2V7QH 1CZQA 1NO4A 1SQBJ 1MZ9A 5B5EH 2K3RA 1X79B 3T97A 1WMKA 1NTZK 1ZP0C 1NAYA 3HE4A 4B86A 1RF0A 4HM7A 3M0AA 2D2CD 1USEA 5AW1B 3BASA 4PV1D 2QPZA 1QL2A 3H1HJ 2E75D 1NGMB 3GOBA 2ZVNB 1GL2A 2DW3A 1KB9E 3NTNA 1T8ZA 4ZKUA 1RF1B 1KILD 3TGUD 2WPQA 1FZAA 1RQVA 1RF0C 2K9JA 3CCRP 1NAFA 1NTZD 4JQ0D 2UWJE 4GT1A 1NTKJ 1G1IA 2WSEH 4DOJA 3CX5I 1FZCA 2O01N 2OYOA 3AEDC 3BRVB 3L36A 5L8RJ 3CI9A 2NPSC 3IN6A 4W80A 3VMHD 4WB4A 1GL2C 1NWQA 1KQGB 4LGDE 1SFCA 2PFXA 3MZWB 3GZXA 1BE3G 2YVJB 3H1JE 3L72D 2AXTH 4YTPC 4OGQD 3V4WA 5APWA 2J5UA 3L37A 4D6TG 2Q6QA 1G2CA 2YFJA 4EIJA 1KYOH 2I7FA 2QSIA 2E5TA 1K04A 2H8PD 4JYCA 1GD2E 1VQLP 1H0TB 2ZFCA 5APTA 1JTHA 4QCKA 4HM5A 1MV8A 1M7LA 1JNMA 1GTWA 1Q7YQ 4H44B 4JF7A 3G71P 3MHVA 1NU1K 1EDKA 1LP1B 3EWKA 3VYIA 1N73B 1PPJG 3GTSA 2K88A 3KPEA 1N2DC 5AW5B 1IFJA 1YBKA 3AEGC 2M0BA 1BE3J 1SQPG 4R4MA 3D70A 4A7PA 1Y9BA 1SQXE 2ZYLA 4D6TJ 3V2NA 1NU1D 4XE5B 3EFFK 3VN0A 2AXCA 2Q9IA 3RK3E 1JOCA 2O01J 3GF3A 2E74B 3H1JG 3WUVA 2WQYC 4OVNF 4BRYA 2IYPA 3I5CA 3U1AA 1H89A 1FS0E 2ZXEB 2BMOA 2P10A 1NKNA 1BDDA 1LTGC 5KAFE 3AEBC 1BSNA 1SJGA 1YITP 2C0WA 1S72P 4GIFA 3TF5A 2KS1A 1FE6A 3PTZA 1OVRA 1DH3A 2QJKC 1KTMA 3PHLA 1KC8Q 3B71A 2PRRA 2WVRA 1SQPJ 2A06D 5B66H 2Z4EA 1L4AD 1G8KB 3P8CD 1URQC 3H1ID 3L71D 1HWTC 3AE5C 1RFSA 1NYHA 1BCCG 4Y99C 2KLUA 2OYHA 4WY4D 3PRJA 3H1JJ 3C9IA 3M91A 4GOFA 4PJ0H 3M0DA 2MJZA 2WSFJ 4CPGA 1FDIA 3AZCA 4IFMA 2YMKA 2O1JA 5KLIC 1FBMA 2XDJA 3GMAA 1Z56A 2KYVA 2NVFA 2NRGA 2W8ZA 2OYHC 1JUNA 2IX7C 2POHA 3L74E 2NUMA 3M0DC 2OYIC 1SQVG 5DJUB 3IR9A 1K9MQ 3AE9C 3LIDA 1RHZB 1O7WA 1VPCA 1HJ0A 1GMJA 3AE2C 1ZRTE 5CBNA 1X8YA 3CWBE 4QDFA 3MUDC 1W2EA 2B9BA 4BWNA 5B5EE 3RK3C 1PGOA 3E7KA 2M5AB 1OWAA 3RBXA 2WMMA 4ZKPA 3L70D 1O7GA 3JSVC 2ITAA 2N9BA 3WUUA 1BCCJ 1LWUC 2AEFA 1S9KE 5CCHC 2K9YA 2B88A 1EZVG 1EZVI 1YJNP 1KZUB 5AW7B 1YJ9P 2WSFH 2JP3A 1FC2C 2JWAA 4I2LC 2HMMA 3O6QB 5APVA 2WPVB 3RK2D 2KZJA 1J1DC 2NZ2A 4AQRD 1SQVJ 3KYQA 3FXDA 1U7JA 2KNCA 3HRNA 3BCCD 3HTKB 1NTME 1FOSE 1LT9A 1M1KQ 1EG9A 3CCUP 1LTTC 3P8MC 5AW3B 1QVFO 5AVVB 1OW8A 2FYUG 5KLVK 3V2QA 1SQBE 5BU8B 2AXTE 1AQ5A 5APXA 3GW6A 3CWBG 3NXSA 1YQ4C 2E76D 2YO3A 3D6ZA 2ZVOB 1KYOE 3BATA 3L70G 3D71A 3SWKA 2FBWC 2ZAEB 1LT9C 5CXMA 4JYBA 1KQSO 4HYTB 4NBCD 5KAIE 1QVGO 4UB6H 5H2FH 2OTKE 2QEXP 3E1IA 4QMAA 2FFDA 1NKZB 3H1KD 1H88A 2JKVA 5C39A 5K5GB 3QH9A 2YXQB 4N3YB 2WPSA 1NTKE 4I7ZC 1PIXA 1FZBA 2C0XA 1GL2B 3JC22 1S4XA 5CJ0A 2FFDC 4N78E 2B87A 3BCCG 2JJLA 3HD7B 1VQ7P 2FKWB 2IYOA 2FXPA 1FZCB 3DQYA 2FYUJ 1W5CE 1VQ4P 2W6AA 3MIWA
chains in the Genus database with same CATH topology
3CXHE 2DE5D 3H1IE 5KLVE 3AZCA 2HMJA 2YFLA 1RIEA 4QURA 1G8JB 1EZVE 1P84E 1NTME 1BGYE 1SQQE 2HMLA 5KLIC 2B1XA 3VMID 1EG9A 1NYKA 1SQXE 3GL2A 2XSHA 2ZYLA 5KKZC 2NVFA 2E4PA 4HM1A 2QJYC 3TGUE 3D89A 4NBHD 2NUKA 4QUPA 1WQLA 2A06E 2JZAA 2E4QA 4HM6A 3VMHD 4AIVA 4NB9D 3BCCE 2E74D 3H1HE 1PPJE 4HJLA 3L74E 1SQBE 2NUMA 1JM1A 2IBZE 4QDFB 1UUVA 4NBDD 1BCCE 3GZXA 3H1LE 3L71E 2BMQA 2BCCE 3GZYA 2XRXA 2BMOA 2YVJB 2E76D 2B24A 4P1BH 1KYOE 3H1JE 1O7MA 3GL0A 4HKVA 3EN1A 1O7WA 1VF5D 4NB8D 3VCAA 2HMOA 2NVGA 4OGQD 5CXMA 1ZRTE 1SQPE 4AAYB 2YIUC 4QDFA 3CWBE 2DE6D 2DE7D 2YFJA 3CX5E 3GB4A 5AEUA 4U3FE 1NTZE 4NBCD 4QUQA 2I7FA 4EMJB 4PD4E 4HM3A 1VM9A 1SJGA 1O7PA 3L73E 4H0LD 4HM4A 4HM2A 4NBBD 1L0NE 2FYNC 3L72E 1UUWA 2YFIA 1NDOA 1NU1E 4QCKA 1O7GA 4HM5A 2FYUE 1FQTA 3GKEA 5AEWA 1PP9E 4H44D 1O7HA 3C0DA 1ULIA 2JO6A 2QJKC 2GBWA 1SQVE 4H13D 1BE3E 1ULJA 3VCPA 3EQQA 1NTKE 2HMKA 2QJPC 5HL4A 3L70E 4HM7A 4NBED 1VCKA 2D2CD 1L0LE 2HMNA 4D6TE 3VMGD 1G8KB 3GTEA 2ZT9D 4QDCA 4QDDA 4PV1D 2BMRA 2QPZA 2GBXA 2XR8A 1O7NA 2HMMA 3FOUA 2NWFA 3GTSA 3GCEA 1RFSA 2E75D 4HM0A 3L75E 2CKFA 3GOBA 2XSOA 4P1CH 4NBGD 3N0QA 3DQYA 4HM8A 1KB9E 4NBAD 5BOKA 3H1KE 4NBFD 2NVEA 1Q90C 2Q3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH E;  2DE5 D;  3H1I E;  5KLV E;  3AZC A;  2HMJ A;  2YFL A;  1RIE A;  4QUR A;  1G8J B;  1EZV E;  1P84 E;  1NTM E;  1BGY E;  1SQQ E;  2HML A;  5KLI C;  2B1X A;  3VMI D;  1EG9 A;  1NYK A;  1SQX E;  3GL2 A;  2XSH A;  2ZYL A;  5KKZ C;  2NVF A;  2E4P A;  4HM1 A;  2QJY C;  3TGU E;  3D89 A;  4NBH D;  2NUK A;  4QUP A;  1WQL A;  2A06 E;  2JZA A;  2E4Q A;  4HM6 A;  3VMH D;  4AIV A;  4NB9 D;  3BCC E;  2E74 D;  3H1H E;  1PPJ E;  4HJL A;  3L74 E;  1SQB E;  2NUM A;  1JM1 A;  2IBZ E;  4QDF B;  1UUV A;  4NBD D;  1BCC E;  3GZX A;  3H1L E;  3L71 E;  2BMQ A;  2BCC E;  3GZY A;  2XRX A;  2BMO A;  2YVJ B;  2E76 D;  2B24 A;  4P1B H;  1KYO E;  3H1J E;  1O7M A;  3GL0 A;  4HKV A;  3EN1 A;  1O7W A;  1VF5 D;  4NB8 D;  3VCA A;  2HMO A;  2NVG A;  4OGQ D;  5CXM A;  1ZRT E;  1SQP E;  4AAY B;  2YIU C;  4QDF A;  3CWB E;  2DE6 D;  2DE7 D;  2YFJ A;  3CX5 E;  3GB4 A;  5AEU A;  4U3F E;  1NTZ E;  4NBC D;  4QUQ A;  2I7F A;  4EMJ B;  4PD4 E;  4HM3 A;  1VM9 A;  1SJG A;  1O7P A;  3L73 E;  4H0L D;  4HM4 A;  4HM2 A;  4NBB D;  1L0N E;  2FYN C;  3L72 E;  1UUW A;  2YFI A;  1NDO A;  1NU1 E;  4QCK A;  1O7G A;  4HM5 A;  2FYU E;  1FQT A;  3GKE A;  5AEW A;  1PP9 E;  4H44 D;  1O7H A;  3C0D A;  1ULI A;  2JO6 A;  2QJK C;  2GBW A;  1SQV E;  4H13 D;  1BE3 E;  1ULJ A;  3VCP A;  3EQQ A;  1NTK E;  2HMK A;  2QJP C;  5HL4 A;  3L70 E;  4HM7 A;  4NBE D;  1VCK A;  2D2C D;  1L0L E;  2HMN A;  4D6T E;  3VMG D;  1G8K B;  3GTE A;  2ZT9 D;  4QDC A;  4QDD A;  4PV1 D;  2BMR A;  2QPZ A;  2GBX A;  2XR8 A;  1O7N A;  2HMM A;  3FOU A;  2NWF A;  3GTS A;  3GCE A;  1RFS A;  2E75 D;  4HM0 A;  3L75 E;  2CKF A;  3GOB A;  2XSO A;  4P1C H;  4NBG D;  3N0Q A;  3DQY A;  4HM8 A;  1KB9 E;  4NBA D;  5BOK A;  3H1K E;  4NBF D;  2NVE A;  1Q90 C;  2Q3W A; 
#chains in the Genus database with same CATH topology
 1K73 Q;  1EXJ A;  1JCC A;  3EQ2 A;  3CWB J;  3VMX A;  2V7Q J;  1YI2 P;  3L70 J;  2N1T B;  1N7L A;  1XTG B;  1SFC B;  1AV1 A;  3VMI D;  2QM7 A;  1OW6 A;  2JEE A;  1NYK A;  4H13 C;  4YXW H;  3CLQ A;  4HM6 A;  1JCD A;  1G2C B;  3OA7 A;  1YTZ T;  4PD4 D;  1JMB A;  1M1J A;  2FY8 A;  2KB7 P;  5TIS H;  1BDC A;  1JTH B;  3HUS A;  3CX5 E;  4GKG A;  3AE4 C;  3MGN A;  1MFT A;  3P7K A;  2HPC B;  3BCC J;  1S5L E;  3HD7 D;  1L0L D;  2KXP B;  1M1J C;  1IZN B;  2WWW A;  5BVZ A;  1BE3 E;  3HUS C;  2HMK A;  1FOS F;  2QJP C;  1L0N K;  1SQQ G;  1VQK P;  3F5H A;  2C9N Y;  2N1T D;  3OAK A;  4H0L B;  2KSE A;  3W67 A;  4D6T E;  1SFC D;  4QDC A;  1X22 A;  2H7H A;  4PJ0 E;  1EDJ A;  3A0H H;  4K35 A;  2KLV A;  2XSO A;  4NBG D;  2KSJ A;  2NVE A;  5GTI H;  2W6J H;  2Y0D A;  4U3F D;  1CW5 A;  2YNY A;  4BRY B;  1L0N D;  2IZ0 A;  2B1X A;  3H32 A;  4PD4 I;  4UB8 H;  3GHG A;  5KKZ C;  1KIL E;  3TGU E;  3U59 A;  2NPS A;  4R4L A;  5KTB A;  1IK7 A;  1TU3 F;  2QJK B;  3AEF C;  1PPJ E;  4IL6 H;  1EQ7 A;  5KJ7 A;  3VP8 A;  1HTL C;  2QIW A;  3PP5 A;  3LW5 J;  1DEE G;  2R5B A;  2P67 A;  4W7Z A;  2FYN B;  4P1B H;  1NHL A;  4NB8 D;  1FZF A;  1L0L G;  2LKM A;  1FJP A;  1SQP E;  3GHG C;  4ASW A;  1SQQ J;  2GUS A;  2KS1 B;  4Y99 B;  2A45 G;  3MP7 B;  2A45 I;  1O7P A;  4H0L D;  3JCU H;  5KJ7 C;  1KB9 D;  1Q90 D;  3L72 E;  1S3J A;  2G3A A;  1DIP A;  5CCG D;  2LR2 A;  3GKE A;  1QLE D;  1O7H A;  1E79 H;  5KLI B;  2FXO A;  1HGV A;  1A02 J;  1A02 F;  1VDF A;  1J1E C;  4KJM A;  3RL0 g;  2HYN A;  2QM8 A;  3RBZ A;  2BAS A;  2WZ7 A;  1RY3 A;  3CCS P;  3FX0 A;  2Q3I A;  1E5W A;  3CC2 P;  5APU A;  1JY2 N;  3AE3 C;  1OFC X;  2WT7 A;  3M9B A;  1T2K D;  2W27 A;  4KT0 J;  2N9Y B;  2E43 A;  3TGU G;  1RIE A;  3VOP A;  1HVV A;  3RK3 B;  2HR3 A;  3LW5 H;  3CMA P;  1NTZ G;  2IBZ D;  1L0L J;  4IFD K;  1MUU A;  2E4P A;  2JWD A;  2BCC D;  1N86 A;  3M06 A;  1KIL A;  1RE4 A;  1U7M A;  1Q81 Q;  3M9Q A;  4NB9 D;  3S4R A;  2D2C C;  2YO2 A;  3Q5P A;  3A3Y B;  4QDF B;  1EXI A;  1BCC E;  4AYC A;  4PV1 C;  4HKZ H;  1SQX K;  1WRG A;  3KZI H;  2E75 C;  4UB6 E;  5H2F E;  2HMO A;  2Y9Z A;  2YIU C;  3F89 A;  3L72 G;  3ZDM A;  2JR8 A;  1KIL C;  1RE4 C;  3IAO A;  1BSH A;  3TNU A;  2W83 C;  2OQQ A;  4NPE A;  1J1D B;  4ASV A;  5AVR B;  4PD4 H;  1GK6 A;  1QL1 A;  4H44 D;  2Q3E A;  1VF5 B;  1SQV E;  1ZLL A;  2L5G B;  1SQX D;  2R44 A;  3CME P;  2Y9Y A;  1KV4 A;  1AQT A;  3TGU J;  3VMZ A;  2FYZ A;  1VQO P;  1Y8A A;  1GK4 A;  3BVH A;  1NTZ J;  3VMG D;  4MN4 C;  2GBX A;  1URQ A;  5AVU B;  4OGQ C;  3VTP C;  4L73 A;  2XND H;  1JB0 J;  1RF1 A;  2IBZ I;  2Y0C A;  1VQ8 P;  3W68 A;  5AW4 B;  2A45 H;  1R8E A;  1VQM P;  1GW3 A;  1IFM A;  2JO1 A;  2R5D A;  2GUV A;  1L2P A;  2LXC B;  3H1I E;  2HMJ A;  2ZJS E;  1EZV E;  2ZT9 B;  3H1L D;  2HG5 D;  1SLQ A;  2QJY C;  1LTI C;  3L72 J;  5AW6 B;  1RF1 C;  1NU1 G;  4M3L A;  2E74 D;  1XTC C;  2OYI A;  1UUV A;  5TIS E;  4NPD A;  1Q82 Q;  4WBA A;  1N7S B;  1ZN5 A;  4Z1M H;  1FDM A;  3A2A A;  1FU1 A;  2B24 A;  1PFI A;  1VF5 D;  1RQU A;  2FFD B;  3GLM A;  2NVG A;  3MUD A;  1LTB C;  1YQ3 C;  2RMZ A;  5TJH A;  4YXD C;  2R32 A;  4HM2 A;  3Q5S A;  2XNX A;  1LTJ A;  2AEJ A;  2FYU E;  2O3J A;  1LWU A;  1FQT A;  5CCH A;  2KIK A;  4C7N B;  2CPS A;  2B87 B;  2W6B A;  2RKL A;  1UIX A;  3S1K A;  5AVZ B;  1LP1 A;  3L70 E;  3IFM A;  1VCK A;  3A0B H;  3A0H E;  4C46 A;  4RJT A;  3I56 P;  2OTL P;  1KB9 H;  2A06 G;  2ZT9 D;  3AE8 C;  1LTJ C;  3FOU A;  1OW7 A;  5GTI E;  3BRT B;  3H1L G;  1NU1 J;  3H1I G;  3L71 G;  2I1K A;  1P84 D;  1IC2 A;  3AE7 C;  5BOK A;  1L4A A;  4UB8 E;  1OX3 A;  1N7S D;  1T6A A;  1ZV8 A;  1N73 C;  1HUC A;  4W7Y A;  1ZXG A;  2LXB A;  1IO4 A;  2AEM A;  4EOT A;  2HML A;  1NH4 A;  4WY4 A;  4IL6 E;  1JY3 N;  3B5N B;  4WVZ A;  1M1J B;  2FXM A;  2JZA A;  3RL0 B;  1S9K D;  2KK7 A;  5BU5 A;  3BCC E;  4HJL A;  1AA0 A;  3HUS B;  1L4A C;  2QJP B;  1YYC A;  1PGQ A;  2R3S A;  1NTM K;  3V5B A;  4AUW A;  3GZY A;  3L35 A;  3K5B A;  3L73 D;  2H43 A;  2G8Y A;  4GDO A;  1JY2 P;  3SFD C;  2OAR A;  4WY4 C;  3R4Y A;  3JCU E;  3II6 A;  1SQB K;  2GA1 A;  3SSU A;  1PP9 D;  1T3J A;  3SWF A;  3LIE A;  2XZR A;  2YFI A;  1OIP A;  3H1L J;  3H1I J;  3L71 J;  5GTH H;  2HOD A;  3V4Q A;  1NTM D;  3VCP A;  3EQQ A;  3T97 B;  1P84 I;  4RKU J;  3L4F A;  3L75 D;  2HMN A;  1D7M A;  3HE4 B;  3CXH D;  3B5N D;  5KLV D;  3Q2Y A;  1NTK K;  3RL0 D;  3V2R A;  2M3E A;  1VQ9 P;  1JEK A;  3H32 B;  2NPS B;  3CPW O;  4EYY Q;  1FZE A;  5CMZ A;  1EC5 A;  3KDP B;  3H1H D;  3C1L A;  1SQQ E;  2Z5I A;  2K9J B;  2IZ1 A;  1M8O B;  3QWO C;  3CC4 P;  1GU5 A;  4NBH D;  2I1J A;  3CL3 D;  3KZI E;  4EI2 A;  3AEC C;  1PP9 G;  2IPP A;  1GZL A;  1Q86 Q;  1GW4 A;  4XA4 A;  3GL0 A;  1LTS C;  2J59 M;  3CCM P;  4N78 D;  3RK2 C;  1KQL A;  4PD4 E;  2C9L Y;  4HM4 A;  3PH0 A;  2H88 C;  2E42 A;  1NDO A;  1QGK B;  3NMD A;  3USS A;  3H1K G;  2ZYA A;  3CC7 P;  1T3U A;  1AJY A;  2WTY A;  3CXH I;  5KLV G;  2YXR B;  1NVO A;  3TSI A;  5HL4 A;  1LGH B;  3AEE C;  1GL2 D;  1L0L E;  3O6Q A;  2E76 C;  2WT7 B;  5APQ A;  5AVT B;  1VQ5 P;  4O9B A;  2QVA A;  3TYY A;  5B66 E;  4P1C H;  5APY A;  1BGY D;  2KI7 B;  1PP9 J;  3CX5 D;  2DE5 D;  2WPR A;  3O8Z A;  2QG4 A;  2H89 C;  2YKO A;  5AVQ B;  1DD4 A;  4ZMD A;  4QUP A;  2VRS A;  2E4Q A;  4AIV A;  1JMM A;  1P84 H;  4EDF A;  1N8R Q;  3L75 J;  1BE3 D;  3HE5 A;  1SP4 A;  3VMY A;  3H1K J;  4LLH A;  1GDT A;  1CSB A;  4K3A A;  3TNU B;  1JY2 O;  4DZO A;  2ZXX A;  3EN1 A;  5KLV J;  4D6T D;  2P2U A;  1LNQ A;  1UII A;  4OGQ B;  1GU4 A;  1PZQ A;  2DE6 D;  3KXD A;  1NTZ E;  4EMJ B;  4Y28 J;  1VM9 A;  1HGZ A;  1KFM A;  2KOG A;  3OW2 O;  1JY3 P;  1K05 A;  1SQP K;  2WIT A;  1ULI A;  3G6E P;  3A0B E;  1ZR4 A;  1URQ B;  1ZR2 A;  2QJY B;  3N4X A;  3FWL A;  1BGY G;  3G4S P;  4N6J A;  1FJK A;  4HB1 A;  3HD7 A;  3AE6 C;  2V4H A;  3GTE A;  1PPJ D;  4QDD A;  2RH0 A;  2HLO A;  3H6P A;  1CI6 A;  4GOD A;  3EFG A;  2KZI A;  4YPC A;  4HM8 A;  2N1T A;  1SQP D;  2OYH B;  3Q3D A;  3HD7 C;  4U3F G;  2OYI B;  2L91 A;  1FZC C;  3CXH H;  3GL2 A;  5E79 H;  2XSH A;  1L0N G;  4ZNC A;  3D89 A;  3H1J D;  5CHX A;  1YTZ I;  1VQN P;  2N1T C;  2IBZ E;  1SFC C;  3FGA D;  2IFN A;  2BMQ A;  2BCC E;  5KAI H;  2XRX A;  2PAJ A;  3G3Z A;  4HKV A;  1YHQ P;  1LTJ B;  2ZYD A;  1URQ D;  1LWU B;  5EFW B;  1BGY J;  2DE7 D;  2HPC A;  1NOH A;  3Q1M A;  1KD1 Q;  2IFM A;  2P7J A;  2K37 A;  1PV3 A;  5GTH E;  1DD3 A;  4WWI A;  1NU1 E;  1X9V A;  1KB9 I;  1S1C X;  5AEW A;  1WT6 A;  3GF7 A;  1Q2N A;  1IJD B;  2IDB A;  4TLF A;  1ULJ A;  2XV5 A;  4KHX A;  4L75 A;  1LTA C;  3OJA B;  4I1L A;  5CCG A;  1PGP A;  1W2B O;  1H8A A;  4U3F J;  1L4A B;  1OVU A;  1BCC D;  1O7N A;  1SQV K;  1L0N J;  1KOR A;  5AVY B;  2CKF A;  1RH5 B;  4WY4 B;  4H0L C;  1S5L X;  1Q90 C;  3WMM 0;  1KFN A;  1LJ2 A;  3ABV C;  3RGU A;  5CCG C;  2Q7C A;  3RK3 D;  4QUR A;  1K8A Q;  1OMI A;  2B89 A;  2KNC B;  4HM1 A;  2IBZ G;  5CCH D;  2JDI H;  2A06 E;  3IF4 A;  2WSS H;  1IFI A;  1LT9 B;  2BCC G;  3D6Y A;  1ZME C;  1SQV D;  3P8C E;  4XFJ A;  3C8V A;  3H1L E;  1ZOY C;  3L71 E;  3CX5 H;  2PP6 A;  1IFP A;  3E1R A;  1G1J A;  1JM0 A;  4TT3 H;  5AVS B;  1USD A;  4DCK A;  1S5L H;  1T2K C;  2HOD B;  4HM3 A;  4NBB D;  1EDI A;  2FYN C;  4I7Z B;  4I6M C;  1VL2 A;  2M8R A;  1JY3 O;  1AFO A;  3WU2 H;  2BEZ F;  2P1J A;  2Q1K A;  3C0D A;  2JO6 A;  2GBW A;  1EZV D;  3CCV P;  3V6I A;  3FWN A;  1OZH A;  1H0T A;  1IFN A;  2O01 H;  5AW8 B;  1MKM A;  1SQX G;  2FYU K;  3UIA A;  1ZW0 A;  2XR8 A;  4RO0 A;  1DEB A;  3B4S A;  3GCE A;  3CCE P;  1PL5 A;  5AW0 B;  1DX7 A;  2BCC J;  2OGU A;  1SVF A;  3RK2 B;  1NJI Q;  4H13 B;  3A5T A;  4HJG H;  1LT1 A;  1MFZ A;  1OVV A;  1N73 A;  4DT0 A;  1FAV A;  5CBO A;  1OXZ A;  3L74 D;  1VQP P;  1P84 E;  4H44 C;  1U57 A;  2XU6 A;  4U7J A;  2FYU D;  1WQL A;  3VMA A;  2HFE D;  1S2E A;  2YKQ A;  4LC1 A;  2R3C A;  1ZRT D;  4L74 A;  1QEX A;  1QX8 A;  4NBD D;  4BXL A;  3CWB D;  3M9H A;  5AVX B;  4IFF A;  2CK3 H;  1M90 Q;  5DJT B;  2XKM A;  2E76 B;  1O7M A;  3B8E B;  4IOI H;  5AEU A;  1Y47 A;  1SQX J;  1HF9 A;  3L73 E;  2MKV A;  2SPZ A;  1KMI Z;  3MTU E;  1R5S A;  1HBW A;  3KHU A;  1PP9 E;  4JBZ A;  4H13 D;  5AW2 B;  2Y0E A;  2E74 C;  2W90 A;  2J58 A;  4DJG A;  2BMR A;  1VF5 C;  4JPZ B;  1HH0 A;  3ITK A;  3L74 G;  3PJS K;  3GG2 A;  3L75 E;  2OTJ P;  5M1B A;  5KKZ B;  4NBA D;  3H1K E;  1M57 D;  3G9R A;  2ZYG A;  3AEA C;  2YKP A;  2BEQ D;  3CXH E;  5E79 E;  5KLV E;  4NPF X;  1RE3 A;  5AW9 B;  1J2J B;  1SQB D;  1G8J B;  3CD6 P;  3R2P A;  3HE5 B;  2NUK A;  1KYO D;  1N7S A;  3GHG B;  1AVY A;  3H1H E;  1R5L A;  1IK9 A;  4OH8 B;  3SWY A;  2ZT9 C;  1SQQ K;  3N7N A;  5CJ4 A;  1RE3 C;  4OWF A;  4RES B;  1VQ6 P;  5AVW B;  3VCA A;  2QA4 P;  3S9O A;  3L73 G;  3CCQ P;  2I8D A;  2WSC J;  2Z5H A;  3CCJ P;  1N7S C;  2QE7 H;  5KAF H;  4C7N A;  3CCL P;  1J1E B;  1NTK D;  1YIJ P;  2RN0 A;  3L74 J;  1FZG A;  3A7O A;  1SQQ D;  4L76 A;  2M5A A;  3VP9 A;  2QRX A;  1CI6 B;  1NTM G;  2M3B A;  2GM4 A;  2O1K A;  4NBE D;  1SS1 A;  1PGJ A;  3L75 G;  3Q5R A;  2E5Y A;  4C7R A;  1AVO A;  2NWF A;  1SQB G;  4HM0 A;  3P32 A;  1FDO A;  3N0Q A;  3SFE C;  1L0L K;  2NPS D;  4NBF D;  1KN7 A;  1KYO I;  2P58 A;  2Q3W A;  2K1A A;  1M56 D;  1IFD A;  2D2C B;  2YFL A;  3B5N A;  5KJ7 D;  3H25 A;  3AE1 C;  2Q5U A;  3FXE A;  1BGY E;  2KUB A;  4PV1 B;  3L73 J;  1KQF B;  2YMY A;  3H1H G;  3I55 P;  2E75 B;  1EDL A;  2WSC H;  2YIU B;  3TDK A;  1HJB A;  1JM1 A;  3HTK A;  3WUT A;  1KIL B;  3V2P A;  2WSE J;  3B5N C;  1NTK G;  2PGD A;  1JO5 A;  3RL0 C;  3NFQ A;  3MD0 A;  3KQG A;  4AAY B;  1X0T A;  3PLN A;  1NTM J;  4GOE A;  3GB4 A;  4U3F E;  4QUQ A;  2CPB A;  3U1C A;  2KP8 A;  3WU2 E;  4HH2 A;  4IL6 X;  1L0N E;  5APS A;  1YJW P;  1UUW A;  3TK1 A;  2V7Q H;  1CZQ A;  1NO4 A;  1SQB J;  1MZ9 A;  5B5E H;  2K3R A;  1X79 B;  3T97 A;  1WMK A;  1NTZ K;  1ZP0 C;  1NAY A;  3HE4 A;  4B86 A;  1RF0 A;  4HM7 A;  3M0A A;  2D2C D;  1USE A;  5AW1 B;  3BAS A;  4PV1 D;  2QPZ A;  1QL2 A;  3H1H J;  2E75 D;  1NGM B;  3GOB A;  2ZVN B;  1GL2 A;  2DW3 A;  1KB9 E;  3NTN A;  1T8Z A;  4ZKU A;  1RF1 B;  1KIL D;  3TGU D;  2WPQ A;  1FZA A;  1RQV A;  1RF0 C;  2K9J A;  3CCR P;  1NAF A;  1NTZ D;  4JQ0 D;  2UWJ E;  4GT1 A;  1NTK J;  1G1I A;  2WSE H;  4DOJ A;  3CX5 I;  1FZC A;  2O01 N;  2OYO A;  3AED C;  3BRV B;  3L36 A;  5L8R J;  3CI9 A;  2NPS C;  3IN6 A;  4W80 A;  3VMH D;  4WB4 A;  1GL2 C;  1NWQ A;  1KQG B;  4LGD E;  1SFC A;  2PFX A;  3MZW B;  3GZX A;  1BE3 G;  2YVJ B;  3H1J E;  3L72 D;  2AXT H;  4YTP C;  4OGQ D;  3V4W A;  5APW A;  2J5U A;  3L37 A;  4D6T G;  2Q6Q A;  1G2C A;  2YFJ A;  4EIJ A;  1KYO H;  2I7F A;  2QSI A;  2E5T A;  1K04 A;  2H8P D;  4JYC A;  1GD2 E;  1VQL P;  1H0T B;  2ZFC A;  5APT A;  1JTH A;  4QCK A;  4HM5 A;  1MV8 A;  1M7L A;  1JNM A;  1GTW A;  1Q7Y Q;  4H44 B;  4JF7 A;  3G71 P;  3MHV A;  1NU1 K;  1EDK A;  1LP1 B;  3EWK A;  3VYI A;  1N73 B;  1PPJ G;  3GTS A;  2K88 A;  3KPE A;  1N2D C;  5AW5 B;  1IFJ A;  1YBK A;  3AEG C;  2M0B A;  1BE3 J;  1SQP G;  4R4M A;  3D70 A;  4A7P A;  1Y9B A;  1SQX E;  2ZYL A;  4D6T J;  3V2N A;  1NU1 D;  4XE5 B;  3EFF K;  3VN0 A;  2AXC A;  2Q9I A;  3RK3 E;  1JOC A;  2O01 J;  3GF3 A;  2E74 B;  3H1J G;  3WUV A;  2WQY C;  4OVN F;  4BRY A;  2IYP A;  3I5C A;  3U1A A;  1H89 A;  1FS0 E;  2ZXE B;  2BMO A;  2P10 A;  1NKN A;  1BDD A;  1LTG C;  5KAF E;  3AEB C;  1BSN A;  1SJG A;  1YIT P;  2C0W A;  1S72 P;  4GIF A;  3TF5 A;  2KS1 A;  1FE6 A;  3PTZ A;  1OVR A;  1DH3 A;  2QJK C;  1KTM A;  3PHL A;  1KC8 Q;  3B71 A;  2PRR A;  2WVR A;  1SQP J;  2A06 D;  5B66 H;  2Z4E A;  1L4A D;  1G8K B;  3P8C D;  1URQ C;  3H1I D;  3L71 D;  1HWT C;  3AE5 C;  1RFS A;  1NYH A;  1BCC G;  4Y99 C;  2KLU A;  2OYH A;  4WY4 D;  3PRJ A;  3H1J J;  3C9I A;  3M91 A;  4GOF A;  4PJ0 H;  3M0D A;  2MJZ A;  2WSF J;  4CPG A;  1FDI A;  3AZC A;  4IFM A;  2YMK A;  2O1J A;  5KLI C;  1FBM A;  2XDJ A;  3GMA A;  1Z56 A;  2KYV A;  2NVF A;  2NRG A;  2W8Z A;  2OYH C;  1JUN A;  2IX7 C;  2POH A;  3L74 E;  2NUM A;  3M0D C;  2OYI C;  1SQV G;  5DJU B;  3IR9 A;  1K9M Q;  3AE9 C;  3LID A;  1RHZ B;  1O7W A;  1VPC A;  1HJ0 A;  1GMJ A;  3AE2 C;  1ZRT E;  5CBN A;  1X8Y A;  3CWB E;  4QDF A;  3MUD C;  1W2E A;  2B9B A;  4BWN A;  5B5E E;  3RK3 C;  1PGO A;  3E7K A;  2M5A B;  1OWA A;  3RBX A;  2WMM A;  4ZKP A;  3L70 D;  1O7G A;  3JSV C;  2ITA A;  2N9B A;  3WUU A;  1BCC J;  1LWU C;  2AEF A;  1S9K E;  5CCH C;  2K9Y A;  2B88 A;  1EZV G;  1EZV I;  1YJN P;  1KZU B;  5AW7 B;  1YJ9 P;  2WSF H;  2JP3 A;  1FC2 C;  2JWA A;  4I2L C;  2HMM A;  3O6Q B;  5APV A;  2WPV B;  3RK2 D;  2KZJ A;  1J1D C;  2NZ2 A;  4AQR D;  1SQV J;  3KYQ A;  3FXD A;  1U7J A;  2KNC A;  3HRN A;  3BCC D;  3HTK B;  1NTM E;  1FOS E;  1LT9 A;  1M1K Q;  1EG9 A;  3CCU P;  1LTT C;  3P8M C;  5AW3 B;  1QVF O;  5AVV B;  1OW8 A;  2FYU G;  5KLV K;  3V2Q A;  1SQB E;  5BU8 B;  2AXT E;  1AQ5 A;  5APX A;  3GW6 A;  3CWB G;  3NXS A;  1YQ4 C;  2E76 D;  2YO3 A;  3D6Z A;  2ZVO B;  1KYO E;  3BAT A;  3L70 G;  3D71 A;  3SWK A;  2FBW C;  2ZAE B;  1LT9 C;  5CXM A;  4JYB A;  1KQS O;  4HYT B;  4NBC D;  5KAI E;  1QVG O;  4UB6 H;  5H2F H;  2OTK E;  2QEX P;  3E1I A;  4QMA A;  2FFD A;  1NKZ B;  3H1K D;  1H88 A;  2JKV A;  5C39 A;  5K5G B;  3QH9 A;  2YXQ B;  4N3Y B;  2WPS A;  1NTK E;  4I7Z C;  1PIX A;  1FZB A;  2C0X A;  1GL2 B;  3JC2 2;  1S4X A;  5CJ0 A;  2FFD C;  4N78 E;  2B87 A;  3BCC G;  2JJL A;  3HD7 B;  1VQ7 P;  2FKW B;  2IYO A;  2FXP A;  1FZC B;  3DQY A;  2FYU J;  1W5C E;  1VQ4 P;  2W6A A;  3MIW A; 
#chains in the Genus database with same CATH homology
 3CXH E;  2DE5 D;  3H1I E;  5KLV E;  3AZC A;  2HMJ A;  2YFL A;  1RIE A;  4QUR A;  1G8J B;  1EZV E;  1P84 E;  1NTM E;  1BGY E;  1SQQ E;  2HML A;  5KLI C;  2B1X A;  3VMI D;  1EG9 A;  1NYK A;  1SQX E;  3GL2 A;  2XSH A;  2ZYL A;  5KKZ C;  2NVF A;  2E4P A;  4HM1 A;  2QJY C;  3TGU E;  3D89 A;  4NBH D;  2NUK A;  4QUP A;  1WQL A;  2A06 E;  2JZA A;  2E4Q A;  4HM6 A;  3VMH D;  4AIV A;  4NB9 D;  3BCC E;  2E74 D;  3H1H E;  1PPJ E;  4HJL A;  3L74 E;  1SQB E;  2NUM A;  1JM1 A;  2IBZ E;  4QDF B;  1UUV A;  4NBD D;  1BCC E;  3GZX A;  3H1L E;  3L71 E;  2BMQ A;  2BCC E;  3GZY A;  2XRX A;  2BMO A;  2YVJ B;  2E76 D;  2B24 A;  4P1B H;  1KYO E;  3H1J E;  1O7M A;  3GL0 A;  4HKV A;  3EN1 A;  1O7W A;  1VF5 D;  4NB8 D;  3VCA A;  2HMO A;  2NVG A;  4OGQ D;  5CXM A;  1ZRT E;  1SQP E;  4AAY B;  2YIU C;  4QDF A;  3CWB E;  2DE6 D;  2DE7 D;  2YFJ A;  3CX5 E;  3GB4 A;  5AEU A;  4U3F E;  1NTZ E;  4NBC D;  4QUQ A;  2I7F A;  4EMJ B;  4PD4 E;  4HM3 A;  1VM9 A;  1SJG A;  1O7P A;  3L73 E;  4H0L D;  4HM4 A;  4HM2 A;  4NBB D;  1L0N E;  2FYN C;  3L72 E;  1UUW A;  2YFI A;  1NDO A;  1NU1 E;  4QCK A;  1O7G A;  4HM5 A;  2FYU E;  1FQT A;  3GKE A;  5AEW A;  1PP9 E;  4H44 D;  1O7H A;  3C0D A;  1ULI A;  2JO6 A;  2QJK C;  2GBW A;  1SQV E;  4H13 D;  1BE3 E;  1ULJ A;  3VCP A;  3EQQ A;  1NTK E;  2HMK A;  2QJP C;  5HL4 A;  3L70 E;  4HM7 A;  4NBE D;  1VCK A;  2D2C D;  1L0L E;  2HMN A;  4D6T E;  3VMG D;  1G8K B;  3GTE A;  2ZT9 D;  4QDC A;  4QDD A;  4PV1 D;  2BMR A;  2QPZ A;  2GBX A;  2XR8 A;  1O7N A;  2HMM A;  3FOU A;  2NWF A;  3GTS A;  3GCE A;  1RFS A;  2E75 D;  4HM0 A;  3L75 E;  2CKF A;  3GOB A;  2XSO A;  4P1C H;  4NBG D;  3N0Q A;  3DQY A;  4HM8 A;  1KB9 E;  4NBA D;  5BOK A;  3H1K E;  4NBF D;  2NVE A;  1Q90 C;  2Q3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...