1L0LE

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 28
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0lE02
1L0LE 3L73E 3EN1A 2FYNC 3GKEA 1L0NE 4P1BH 2XR8A 4NBED 2Q3WA 4QDFB 3VMHD 3H1JE 2GBXA 2NVGA 4AIVA 3GZXA 2BMRA 1SQXE 3EQQA 4P1CH 3D89A 1RIEA 1ULJA 4HM0A 4AAYB 3L72E 4NBAD 3H1IE 3BCCE 1EG9A 3VCAA 3L75E 3GOBA 4H0LD 4QUQA 3VMGD 4OGQD 4NBCD 3GL0A 3GZYA 3L71E 2ZT9D 5KLIC 2YFLA 4HM4A 4H44D 4HKVA 3N0QA 1BGYE 2XSOA 4HM8A 1ZRTE 5CXMA 5BOKA 4QUPA 2GBWA 1O7NA 2ZYLA 2FYUE 4D6TE 3VCPA 1SQVE 4HM2A 3C0DA 2HMKA 4NBHD 1BE3E 3H1KE 2DE6D 4NB9D 4EMJB 1NU1E 2D2CD 2QJPC 1G8JB 1O7GA 3AZCA 4NB8D 4QCKA 3GL2A 2E74D 2DE5D 1SJGA 2HMJA 3CWBE 3H1HE 2YFIA 2HMOA 2HMNA 3GB4A 1Q90C 1ULIA 2NUMA 1WQLA 1RFSA 1FQTA 2DE7D 2XSHA 2BMOA 4HM1A 3L74E 1SQBE 2E4QA 2B1XA 5AEWA 3GTSA 2A06E 1O7MA 2E75D 1JM1A 3VMID 4NBFD 4HM7A 5AEUA 1NTME 1NTZE 4QDCA 5KLVE 1UUWA 1EZVE 2NVEA 2QPZA 4HM5A 3GCEA 2BCCE 4QDFA 2NUKA 4QURA 1G8KB 5KKZC 1O7PA 1VCKA 1P84E 2I7FA 2XRXA 4HJLA 4HM6A 3L70E 4HM3A 3CXHE 2BMQA 1NYKA 4PD4E 2QJKC 2HMMA 4NBBD 2YVJB 4H13D 3TGUE 2IBZE 1VM9A 2QJYC 2NVFA 4PV1D 1O7HA 2JZAA 2E76D 1SQQE 2JO6A 3FOUA 2YIUC 4NBDD 2E4PA 3H1LE 1NTKE 1O7WA 2CKFA 3DQYA 1VF5D 1PP9E 3CX5E 2HMLA 1UUVA 4U3FE 1SQPE 1KB9E 1KYOE 1PPJE 2B24A 3GTEA 2YFJA 5HL4A 4NBGD 1BCCE 4QDDA 2NWFA 1NDOA
chains in the Genus database with same CATH superfamily
2WSCJ 1LTJA 3D6ZA 3L37A 2OYHC 1HJ0A 3D6YA 4U7JA 3HUSA 3H1JE 2NVGA 2PAJA 2QIWA 1GK6A 2WSFJ 3BCCE 3H1IE 2K9JA 4H44B 4N3YB 3CCQP 2E75B 1BE3J 2ZT9D 5TISH 3IN6A 1NU1K 1GZLA 2CPSA 1RF0C 1SFCD 2KS1B 1D7MA 2ZYLA 1U57A 1FBMA 2VRSA 2JP3A 1QL2A 2N9YB 3CWBD 1KTMA 2ZT9C 3GG2A 2Q3IA 5EFWB 3CX5D 2DE5D 1RF1B 1IK7A 2XV5A 5BU8B 1W2BO 1AFOA 1WQLA 1SQVD 1VF5B 1SQBE 1LTSC 3G71P 2KI7B 1RE4C 1ZP0C 1QL1A 1CI6A 3V2NA 2H88C 4LGDE 2QJYB 2PRRA 3H1HJ 4XA4A 2NVEA 1DIPA 4QDFA 1VL2A 1SQPK 3CXHE 1LGHB 3OW2O 2E76C 2XNXA 3PJSK 4AYCA 2FFDC 3H1LE 4EDFA 2AXTH 3HUSC 3H25A 3NTNA 4RJTA 1FZFA 3MIWA 3SSUA 3L73G 3B5NC 1GU5A 1DX7A 1KFNA 1AVYA 2NRGA 2R5BA 3JSVC 4L73A 1N7SD 3CCVP 4PV1C 3LIEA 1X9VA 4NBAD 5H2FE 4KT0J 4L75A 2JWAA 3VMYA 3MHVA 5BOKA 3OJAB 4WB4A 3EWKA 1K9MQ 4GOFA 2QRXA 3F89A 1LTIC 2BCCJ 3H1KE 2K9JB 3RL0g 1O7GA 1RE3C 1JNMA 3I5CA 4UB8E 5KAFE 1SQVJ 3E1IA 1MZ9A 2N1TC 5CCGA 4XE5B 1SS1A 2O1KA 3L73J 1SQQK 3CC2P 3KXDA 1Q7YQ 2FBWC 1EDIA 2HYNA 2XU6A 5KKZC 3C9IA 1ZR2A 5AW1B 4HJLA 3NXSA 3TNUA 1SQXD 1M8OB 2QJKC 1IFPA 1PL5A 2HPCA 3P8MC 4I1LA 1SQPE 4I2LC 1KQGB 3M0DC 1PPJD 1QLED 3VMXA 3UIAA 1YTZI 3RGUA 2Q5UA 1ULJA 3R2PA 1YTZT 1VQ8P 1IZNB 1OW6A 2FYNB 3B8EB 3GZYA 2BEQD 3KHUA 4PD4H 3MUDA 4LLHA 1BGYE 2Z5IA 1ZRTE 2DW3A 2H7HA 4ZKPA 3VYIA 2WSCH 2M3EA 1L0LD 4PJ0E 2R44A 1X0TA 3TK1A 3H32B 4NBHD 3L71J 1KYOD 2E74D 2K3RA 3B5NB 4KJMA 3CCJP 3T97A 2WSFH 3E1RA 2N1TD 3A3YB 3FWNA 3NFQA 4YXDC 2IPPA 1EZVE 1JCDA 1T3UA 1BGYG 3RK3C 1SQPJ 3IR9A 3H1LJ 2YVJB 5E79H 2I1KA 2QA4P 3AE2C 1O7HA 4YXWH 1JB0J 2E4PA 1S2EA 3H1LG 4IL6H 1PZQA 2CKFA 2LKMA 2M5AB 2Z4EA 5AW9B 3G9RA 2QSIA 3GW6A 1NDOA 5AVTB 3L73E 2P2UA 5C39A 1JO5A 1JUNA 3L74J 3IF4A 4QDFB 3KYQA 3HTKB 1EZVI 1LWUB 4HM0A 4AAYB 1EDJA 3VCAA 3BRVB 1J1EC 2PP6A 1N7LA 2YFLA 4JPZB 2QE7H 1HWTC 1NH4A 1PPJG 4O9BA 1S9KE 3C0DA 1BCCD 2HODA 2W6AA 4C7NB 2KSEA 5AVVB 2ZXEB 2QG4A 1Q81Q 2E5YA 1GU4A 1FU1A 3CC4P 3HE4B 1P84H 5M1BA 2A06E 3AEFC 4JF7A 1OIPA 1YI2P 1KN7A 4H13B 1LTBC 1M1KQ 1LTGC 1XTCC 3GCEA 2BCCE 4GT1A 1PV3A 1KD1Q 1LTAC 1JOCA 2POHA 1NTZG 1GL2D 1VQNP 3W68A 1UUVA 3N4XA 1AVOA 3MD0A 1LT1A 1YJWP 3L70G 1NTKD 3GHGA 1P84I 1SQQD 1GW3A 2OYHA 2ZJSE 1T3JA 3H32A 2FYUK 1KV4A 3FX0A 3L75E 4TLFA 4H0LD 3HD7A 1VQ7P 5TISE 3JCUH 5AW2B 2RKLA 2QM7A 3AE6C 2C0WA 2HPCB 4D6TJ 3L71G 5CCHC 1L0ND 3M9HA 3FWLA 1M7LA 5DJUB 2W83C 1L0LG 2FYUG 1LJ2A 1BE3E 1NTMK 4QCKA 3BCCJ 2P67A 1FDMA 3BRTB 2YKQA 3P8CE 2A45H 4EYYQ 1SFCB 1RFSA 3H1HG 1S9KD 1RF1C 1T2KD 1JY3N 2ZT9B 1ZMEC 4UB6E 2E75D 2R3CA 1YHQP 2O01N 4C7NA 3TDKA 1S1CX 4OVNF 2Q6QA 1L4AA 3RK3B 1FE6A 4N78D 3AE9C 1PFIA 2KB7P 1S3JA 3VP9A 4HB1A 1GK4A 1T6AA 1L0NK 4H0LC 3S1KA 5KAIE 3H1JG 2JKVA 3N7NA 5AVWB 1PP9E 1BCCG 1URQA 1NU1D 3H1IJ 1VQPP 4QDDA 5APQA 4HJGH 2WPQA 4OGQC 4Y99C 1K8AQ 1NYHA 3D71A 3AEEC 1NGMB 1H88A 2BMRA 3KPEA 1U7MA 4U3FJ 4QUQA 4PD4I 5KLIC 2Q1KA 1K05A 3RL0B 2J58A 5CXMA 3V4QA 2GBWA 1HBWA 2QJPB 1Y47A 2XNDH 2E43A 1M1JB 2WQYC 2B87B 2I8DA 1MKMA 2IZ0A 1NU1E 2D2CD 1G8JB 1NTZK 2QEXP 2KZIA 2UWJE 1PP9D 3M0AA 1SVFA 4UB8H 2B88A 3V4WA 5KAFH 3VOPA 4GKGA 1L4AC 1FZBA 3HE5A 2KOGA 2ZVOB 3O6QA 4PD4D 3QH9A 1L0NG 3OA7A 1M1JC 4EI2A 1BGYD 3KDPB 1NHLA 3V2RA 4EOTA 1AA0A 1URQC 1SP4A 1SFCC 2JO1A 2OARA 1YJNP 4ZMDA 3JCUE 1GTWA 5H2FH 1VQ4P 5KLVK 2YIUC 3K5BA 3P8CD 4R4MA 2N1TB 1PPJE 3I56P 1GMJA 1DD3A 2I1JA 2AXCA 2H8PD 1CI6B 4TT3H 3HD7D 1N86A 2QJKB 1L0NE 2O3JA 3CPWO 5GTHH 3MTUE 4N78E 3WU2H 5APXA 3H1KG 1H0TA 4MN4C 3VMGD 3QWOC 2OYIA 2KLVA 4HM4A 5TJHA 3CXHH 4QUPA 2ZYAA 2XDJA 3FXDA 1T2KC 4DCKA 4YTPC 1USDA 1VPCA 3L72J 3GL2A 3AE8C 4OWFA 4M3LA 1OVUA 1LWUA 2WPRA 2XSHA 1ZN5A 2FFDA 3GTSA 3VMID 4PV1B 1IFDA 2LXBA 3CLQA 1PGQA 4UB6H 2B87A 5B5EE 1KILB 3L75D 5B66E 5APYA 1O7PA 4EIJA 1M57D 1AQ5A 1BSNA 3TGUJ 2NVFA 1OMIA 1SQQE 1RF1A 1NTKE 1KB9I 1IK9A 3DQYA 2RH0A 1SQPG 3AECC 2OGUA 1SQQJ 3II6A 4P1BH 1OZHA 2XR8A 3CL3D 4NBED 3ZDMA 3IAOA 3EQQA 4GODA 4C7RA 3CXHD 2Z5HA 2WZ7A 1SQBG 2BCCD 2NPSA 3GOBA 5AW8B 1JMMA 2QM8A 4HKVA 1E79H 4D6TG 1X8YA 1NKZB 3O6QB 3L74G 3VCPA 3M9QA 1EC5A 4H13C 2D2CB 4GIFA 1HGVA 3GHGB 3Q5PA 1H8AA 1PGPA 2IX7C 2YFIA 4B86A 2HMNA 2G3AA 3HRNA 1VQKP 4Z1MH 3MP7B 1JY2N 1JEKA 2R5DA 2V4HA 1VQ5P 3VN0A 3WU2E 1EZVD 2IFMA 2V7QH 4JYBA 3GF3A 1NYKA 4PD4E 1E5WA 1S4XA 4NBBD 2JJLA 2YNYA 1YIJP 1FJPA 2E76D 4L76A 4U3FG 2KNCB 4GOEA 1OW8A 1VF5D 1N73B 2B24A 3GTEA 1SQXK 2Y0DA 1RQVA 2O01H 3BASA 1AJYA 4LC1A 1Q82Q 1VQ9P 2OTLP 1RH5B 4K35A 1QVGO 3Q5SA 2WTYA 2C9NY 3M9BA 3WUTA 3CI9A 3TNUB 1GW4A 3GLMA 2H89C 1EG9A 5CCHA 3AEGC 3AE5C 3GL0A 3MGNA 2YKPA 1N8RQ 2B9BA 1JY2P 2N9BA 1LT9B 4H44D 1S5LE 2M5AA 2YMKA 1JCCA 1RY3A 1UIIA 1O7NA 1N73C 1N7SA 2MJZA 1Y8AA 3Q1MA 1CZQA 3H1HD 4Y99B 2QJPC 3VTPC 1YQ3C 1YQ4C 1SJGA 3KZIE 3HTKA 3H6PA 3GB4A 5KKZB 1KB9H 1DEEG 2OYIC 5BU5A 5KLIB 1ZR4A 2O1JA 4H0LB 4NBFD 1L0LJ 2OYOA 4L74A 2WT7A 5AW6B 3CWBJ 3L71D 3SWFA 2HLOA 3L70E 5AVUB 1LTJC 5CCGC 4JQ0D 3Q5RA 5AVXB 1FZCA 5AW4B 4NPFX 2K1AA 1LP1A 3HE4A 1NTKG 3FGAD 5KJ7A 2YKOA 1BE3D 5HL4A 2Y0CA 4HM5A 1SQPD 2W6JH 2IDBA 1LTJB 3CC7P 2JEEA 3V2PA 2KP8A 3GZXA 1SQXE 2FY8A 1N73A 2Q7CA 2WMMA 2J59M 3G4SP 1BDDA 1FOSF 4IFDK 2PGDA 1FAVA 1ZXGA 4WWIA 2A45G 3CMEP 4NPDA 2WSEH 1SQBK 1YJ9P 1MV8A 5APVA 1FDOA 3U1CA 4EMJB 2QVAA 1OXZA 4R4LA 1NKNA 1G2CA 5AW5B 3S9OA 3PH0A 3Q3DA 4YPCA 1S72P 3A2AA 5B5EH 1LT9C 2ZFCA 3IFMA 1KILC 3CX5I 4XFJA 2ZVNB 1JM1A 2NZ2A 5CHXA 5APSA 1UUWA 1KC8Q 2KYVA 3VMAA 2M8RA 3RBZA 4QURA 4DZOA 2FXPA 3SWYA 1KILE 1FC2C 2A06D 2J5UA 2MKVA 3WMM0 2NPSC 2W27A 3TGUE 3TF5A 2YO3A 4PV1D 1SQBJ 3F5HA 1OFCX 3I55P 3CX5E 2K88A 1URQD 2HR3A 1W5CE 2KS1A 1BCCE 1G1JA 4BRYA 1J1DC 4W7ZA 1VDFA 4AUWA 3NMDA 3H1LD 1IFNA 4NPEA 1HH0A 3CXHI 1FZCB 3CX5H 1L4AD 1WMKA 1YBKA 3HUSB 1NVOA 2YO2A 3D89A 4ZNCA 1JTHA 1NU1G 2JDIH 5CCGD 2OTJP 3H1JD 1R5LA 1J1EB 2M3BA 2IYPA 4WY4D 2O01J 2AXTE 1SQBD 1Z56A 3L73D 4IL6X 1SQVE 2P58A 1USEA 2WWWA 2HODB 3L36A 4OH8B 2P10A 2OQQA 1FJKA 3CWBE 4WY4B 4CPGA 2BMOA 3GMAA 3L72G 3AE1C 1L0NJ 2W8ZA 1VQOP 2G8YA 1LWUC 4QDCA 5KLVE 1HUCA 5GTHE 1JY2O 3BCCD 3H1ID 1L4AB 4HKZH 1M56D 3BATA 3H1JJ 2A45I 1HGZA 3D70A 5K5GB 2IBZE 3L75G 2YXRB 2JO6A 4PJ0H 4NBDD 5CCHD 1KYOI 5KJ7D 1BDCA 4IL6E 3CWBG 3M06A 1GD2E 1KYOE 1J2JB 2YFJA 1FDIA 1CSBA 1WRGA 2NWFA 3RL0C 1L0LE 3EN1A 4BXLA 5GTIE 2Y0EA 1NWQA 5CJ4A 1EQ7A 3GKEA 2FYUJ 1ZRTD 3LIDA 3VMHD 4AIVA 1DH3A 1BCCJ 1NU1J 4OGQB 2L5GB 1FZGA 2KNCA 3LW5H 3N0QA 3AE7C 3B4SA 4AQRD 2FYZA 2W90A 5KAIH 1HJBA 2K9YA 2ZAEB 5APWA 3HD7C 2BEZF 3BCCG 1JTHB 2FXMA 3RK2D 5E79E 3A0BH 1Y9BA 3C8VA 1SQXJ 2FKWB 1ULIA 3PLNA 2GUVA 3A0BE 5KJ7C 2V7QJ 2YMYA 4WBAA 3Q2YA 4HM1A 2B1XA 2FYUD 3CCSP 1H0TB 1FZAA 1OVVA 4HM7A 2KSJA 1AQTA 4IFFA 3WUVA 2WSEJ 3RK3D 4W7YA 2NUKA 1G8KB 1PP9J 1N7SB 1EDLA 2I7FA 2KZJA 2ITAA 1VQMP 1RE3A 4I7ZB 2WPVB 3L74D 3TGUG 3FOUA 1OX3A 1DD4A 2IZ1A 2N1TA 3HE5B 3G3ZA 5AVSB 5AW7B 3H1KD 3ITKA 3SWKA 1CW5A 1OWAA 3TSIA 2FXOA 4BWNA 3W67A 2WT7B 3EFGA 4I6MC 1ZW0A 1IO4A 1AV1A 1IC2A 1EZVG 1MUUA 2H43A 2GBXA 3WUUA 3SFDC 1L0LK 1NJIQ 3AEDC 3RK3E 2CPBA 2IYOA 1NTMJ 3PRJA 2IFNA 2C9LY 2W6BA 3FXEA 1R8EA 4D6TE 2HFED 2WPSA 1IFJA 4HM2A 1EXJA 3U1AA 4BRYB 2RN0A 2AEMA 3H1KJ 5CBOA 5GTIH 4NB8D 2Q9IA 1RE4A 3V6IA 5AVRB 2Q3EA 2PFXA 1A02J 2NUMA 1KYOH 1M90Q 1FQTA 1Q90D 2Y9YA 3KZIH 2KXPB 4W80A 1JMBA 4QMAA 1GL2B 2AEJA 1VQLP 1H89A 1N2DC 1NTZE 3VMZA 1IFMA 4RESB 4A7PA 4ZKUA 4ASWA 2KUBA 5KLVJ 2XRXA 3VP8A 3PP5A 4H13D 2QJYC 1JY3P 3GHGC 1PIXA 5BVZA 5AVQB 5AW3B 4U3FE 3OAKA 2FFDB 1FZCC 2A06G 3GF7A 1XTGB 2C0XA 2E76B 3RK2B 5AVZB 4IFMA 1IFIA 1QVFO 2Q3WA 3B5NA 1RQUA 3JC22 3T97B 2KIKA 1LNQA 1MFZA 1NO4A 2P1JA 3L72E 1P84D 1ZV8A 3E7KA 1BE3G 2NPSB 1RHZB 3A7OA 4OGQD 3AEBC 5KLVD 5AW0B 2IBZI 5B66H 4WY4C 4HM8A 2JWDA 4K3AA 1FOSE 2Y9ZA 3M91A 3CD6P 2WVRA 4RO0A 2WSSH 2YXQB 4N6JA 5L8RJ 1KZUB 1PGOA 4U3FD 3AZCA 2HMJA 2HMOA 4DOJA 3MZWB 2DE7D 3EFFK 2E42A 1VQ6P 5AEWA 2E4QA 1W2EA 2E75C 3H1IG 5APTA 3LW5J 2OTKE 1NTMG 2YIUB 3A5TA 2D2CC 1GL2C 1KILA 4I7ZC 3USSA 3ABVC 4ASVA 1EDKA 1S5LX 1NTMD 1HTLC 1P84E 3AEAC 3L72D 5CMZA 1N7SC 4HM3A 3KQGA 2M0BA 2OYHB 1J1DB 2ZYGA 3M0DA 2JR8A 3S4RA 1PGJA 2R32A 1YYCA 3B5ND 3CCMP 2E74B 1KQSO 3EQ2A 4D6TD 1G1IA 3A0HE 2BASA 2FYNC 1QX8A 3TYYA 1SQQG 4H44C 3CCUP 1FS0E 1NTKK 5KTBA 3TGUD 5CBNA 2GA1A 1KQLA 1QEXA 3CCEP 3B71A 4P1CH 1KILD 4IOIH 1RIEA 4HYTB 2RMZA 1U7JA 1SLQA 4NBCD 2GUSA 1NTKJ 1LP1B 1NTZD 1QGKB 3AE4C 2AEFA 2KK7A 3MUDC 2HMKA 1HVVA 1L2PA 1KMIZ 3PHLA 4DT0A 1M1JA 3RBXA 1KB9D 1OVRA 2DE6D 4NB9D 2WITA 3O8ZA 1SFCA 3C1LA 4HH2A 1URQB 3L35A 3L74E 1BSHA 1X79B 5CJ0A 4JBZA 5APUA 2CK3H 1K04A 5AEUA 3SFEC 3CCRP 3L70J 1WT6A 2QPZA 1Q86Q 1EXIA 4HM6A 2BMQA 2XZRA 3V5BA 1KQFB 5AVYB 3RK2C 1T8ZA 1YITP 3HD7B 2JZAA 1A02F 4DJGA 1O7WA 4GDOA 2HMLA 2LR2A 1NOHA 1KB9E 3L75J 4NBGD 4Y28J 3CCLP 1Q2NA 2LXCB 1FZEA 3G6EP 4KHXA 1NAFA 5DJTB 1KFMA 3L70D 2K37A 3A0HH 4WVZA 1S5LH 1DEBA 3L71E 1LT9A 2OYIB 2XKMA 1JY3O 2B89A 3P32A 2XSOA 3R4YA 1K73Q 2FYUE 3P7KA 1R5SA 1BGYJ 1IJDB 1LTTC 1SQVG 1OW7A 1KORA 1ZLLA 3H1HE 1RF0A 2E74C 2R3SA 1Q90C 2BCCG 4RKUJ 2IBZD 1SQVK 1ZOYC 4C46A 1GDTA 3RL0D 1UIXA 2IBZG 3U59A 1O7MA 4JYCA 2SPZA 2NPSD 2ZYDA 1NTME 2HG5D 1JM0A 1X22A 1NAYA 2P7JA 1VF5C 3CMAP 5KLVG 3AE3C 2KLUA 1VCKA 1NTZJ 2E5TA 3L4FA 1HF9A 2ZXXA 1SQXG 2HMMA 2GM4A 2L91A 3V2QA 1VM9A 3PTZA 1G2CB 1PP9G 3BVHA 4WY4A 1GL2A 1TU3F 1MFTA
chains in the Genus database with same CATH topology
1L0LE 3L73E 3EN1A 2FYNC 3GKEA 1L0NE 4P1BH 2XR8A 4NBED 2Q3WA 4QDFB 3VMHD 3H1JE 2GBXA 2NVGA 4AIVA 3GZXA 2BMRA 1SQXE 3EQQA 4P1CH 3D89A 1RIEA 1ULJA 4HM0A 4AAYB 3L72E 4NBAD 3H1IE 3BCCE 1EG9A 3VCAA 3L75E 3GOBA 4H0LD 4QUQA 3VMGD 4OGQD 4NBCD 3GL0A 3GZYA 3L71E 2ZT9D 5KLIC 2YFLA 4HM4A 4H44D 4HKVA 3N0QA 1BGYE 2XSOA 4HM8A 1ZRTE 5CXMA 5BOKA 4QUPA 2GBWA 1O7NA 2ZYLA 2FYUE 4D6TE 3VCPA 1SQVE 4HM2A 3C0DA 2HMKA 4NBHD 1BE3E 3H1KE 2DE6D 4NB9D 4EMJB 1NU1E 2D2CD 2QJPC 1G8JB 1O7GA 3AZCA 4NB8D 4QCKA 3GL2A 2E74D 2DE5D 1SJGA 2HMJA 3CWBE 3H1HE 2YFIA 2HMOA 2HMNA 3GB4A 1Q90C 1ULIA 2NUMA 1WQLA 1RFSA 1FQTA 2DE7D 2XSHA 2BMOA 4HM1A 3L74E 1SQBE 2E4QA 2B1XA 5AEWA 3GTSA 2A06E 1O7MA 2E75D 1JM1A 3VMID 4NBFD 4HM7A 5AEUA 1NTME 1NTZE 4QDCA 5KLVE 1UUWA 1EZVE 2NVEA 2QPZA 4HM5A 3GCEA 2BCCE 4QDFA 2NUKA 4QURA 1G8KB 5KKZC 1O7PA 1VCKA 1P84E 2I7FA 2XRXA 4HJLA 4HM6A 3L70E 4HM3A 3CXHE 2BMQA 1NYKA 4PD4E 2QJKC 2HMMA 4NBBD 2YVJB 4H13D 3TGUE 2IBZE 1VM9A 2QJYC 2NVFA 4PV1D 1O7HA 2JZAA 2E76D 1SQQE 2JO6A 3FOUA 2YIUC 4NBDD 2E4PA 3H1LE 1NTKE 1O7WA 2CKFA 3DQYA 1VF5D 1PP9E 3CX5E 2HMLA 1UUVA 4U3FE 1SQPE 1KB9E 1KYOE 1PPJE 2B24A 3GTEA 2YFJA 5HL4A 4NBGD 1BCCE 4QDDA 2NWFA 1NDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L E;  3L73 E;  3EN1 A;  2FYN C;  3GKE A;  1L0N E;  4P1B H;  2XR8 A;  4NBE D;  2Q3W A;  4QDF B;  3VMH D;  3H1J E;  2GBX A;  2NVG A;  4AIV A;  3GZX A;  2BMR A;  1SQX E;  3EQQ A;  4P1C H;  3D89 A;  1RIE A;  1ULJ A;  4HM0 A;  4AAY B;  3L72 E;  4NBA D;  3H1I E;  3BCC E;  1EG9 A;  3VCA A;  3L75 E;  3GOB A;  4H0L D;  4QUQ A;  3VMG D;  4OGQ D;  4NBC D;  3GL0 A;  3GZY A;  3L71 E;  2ZT9 D;  5KLI C;  2YFL A;  4HM4 A;  4H44 D;  4HKV A;  3N0Q A;  1BGY E;  2XSO A;  4HM8 A;  1ZRT E;  5CXM A;  5BOK A;  4QUP A;  2GBW A;  1O7N A;  2ZYL A;  2FYU E;  4D6T E;  3VCP A;  1SQV E;  4HM2 A;  3C0D A;  2HMK A;  4NBH D;  1BE3 E;  3H1K E;  2DE6 D;  4NB9 D;  4EMJ B;  1NU1 E;  2D2C D;  2QJP C;  1G8J B;  1O7G A;  3AZC A;  4NB8 D;  4QCK A;  3GL2 A;  2E74 D;  2DE5 D;  1SJG A;  2HMJ A;  3CWB E;  3H1H E;  2YFI A;  2HMO A;  2HMN A;  3GB4 A;  1Q90 C;  1ULI A;  2NUM A;  1WQL A;  1RFS A;  1FQT A;  2DE7 D;  2XSH A;  2BMO A;  4HM1 A;  3L74 E;  1SQB E;  2E4Q A;  2B1X A;  5AEW A;  3GTS A;  2A06 E;  1O7M A;  2E75 D;  1JM1 A;  3VMI D;  4NBF D;  4HM7 A;  5AEU A;  1NTM E;  1NTZ E;  4QDC A;  5KLV E;  1UUW A;  1EZV E;  2NVE A;  2QPZ A;  4HM5 A;  3GCE A;  2BCC E;  4QDF A;  2NUK A;  4QUR A;  1G8K B;  5KKZ C;  1O7P A;  1VCK A;  1P84 E;  2I7F A;  2XRX A;  4HJL A;  4HM6 A;  3L70 E;  4HM3 A;  3CXH E;  2BMQ A;  1NYK A;  4PD4 E;  2QJK C;  2HMM A;  4NBB D;  2YVJ B;  4H13 D;  3TGU E;  2IBZ E;  1VM9 A;  2QJY C;  2NVF A;  4PV1 D;  1O7H A;  2JZA A;  2E76 D;  1SQQ E;  2JO6 A;  3FOU A;  2YIU C;  4NBD D;  2E4P A;  3H1L E;  1NTK E;  1O7W A;  2CKF A;  3DQY A;  1VF5 D;  1PP9 E;  3CX5 E;  2HML A;  1UUV A;  4U3F E;  1SQP E;  1KB9 E;  1KYO E;  1PPJ E;  2B24 A;  3GTE A;  2YFJ A;  5HL4 A;  4NBG D;  1BCC E;  4QDD A;  2NWF A;  1NDO A; 
#chains in the Genus database with same CATH topology
 2WSC J;  1LTJ A;  3D6Z A;  3L37 A;  2OYH C;  1HJ0 A;  3D6Y A;  4U7J A;  3HUS A;  3H1J E;  2NVG A;  2PAJ A;  2QIW A;  1GK6 A;  2WSF J;  3BCC E;  3H1I E;  2K9J A;  4H44 B;  4N3Y B;  3CCQ P;  2E75 B;  1BE3 J;  2ZT9 D;  5TIS H;  3IN6 A;  1NU1 K;  1GZL A;  2CPS A;  1RF0 C;  1SFC D;  2KS1 B;  1D7M A;  2ZYL A;  1U57 A;  1FBM A;  2VRS A;  2JP3 A;  1QL2 A;  2N9Y B;  3CWB D;  1KTM A;  2ZT9 C;  3GG2 A;  2Q3I A;  5EFW B;  3CX5 D;  2DE5 D;  1RF1 B;  1IK7 A;  2XV5 A;  5BU8 B;  1W2B O;  1AFO A;  1WQL A;  1SQV D;  1VF5 B;  1SQB E;  1LTS C;  3G71 P;  2KI7 B;  1RE4 C;  1ZP0 C;  1QL1 A;  1CI6 A;  3V2N A;  2H88 C;  4LGD E;  2QJY B;  2PRR A;  3H1H J;  4XA4 A;  2NVE A;  1DIP A;  4QDF A;  1VL2 A;  1SQP K;  3CXH E;  1LGH B;  3OW2 O;  2E76 C;  2XNX A;  3PJS K;  4AYC A;  2FFD C;  3H1L E;  4EDF A;  2AXT H;  3HUS C;  3H25 A;  3NTN A;  4RJT A;  1FZF A;  3MIW A;  3SSU A;  3L73 G;  3B5N C;  1GU5 A;  1DX7 A;  1KFN A;  1AVY A;  2NRG A;  2R5B A;  3JSV C;  4L73 A;  1N7S D;  3CCV P;  4PV1 C;  3LIE A;  1X9V A;  4NBA D;  5H2F E;  4KT0 J;  4L75 A;  2JWA A;  3VMY A;  3MHV A;  5BOK A;  3OJA B;  4WB4 A;  3EWK A;  1K9M Q;  4GOF A;  2QRX A;  3F89 A;  1LTI C;  2BCC J;  3H1K E;  2K9J B;  3RL0 g;  1O7G A;  1RE3 C;  1JNM A;  3I5C A;  4UB8 E;  5KAF E;  1SQV J;  3E1I A;  1MZ9 A;  2N1T C;  5CCG A;  4XE5 B;  1SS1 A;  2O1K A;  3L73 J;  1SQQ K;  3CC2 P;  3KXD A;  1Q7Y Q;  2FBW C;  1EDI A;  2HYN A;  2XU6 A;  5KKZ C;  3C9I A;  1ZR2 A;  5AW1 B;  4HJL A;  3NXS A;  3TNU A;  1SQX D;  1M8O B;  2QJK C;  1IFP A;  1PL5 A;  2HPC A;  3P8M C;  4I1L A;  1SQP E;  4I2L C;  1KQG B;  3M0D C;  1PPJ D;  1QLE D;  3VMX A;  3UIA A;  1YTZ I;  3RGU A;  2Q5U A;  1ULJ A;  3R2P A;  1YTZ T;  1VQ8 P;  1IZN B;  1OW6 A;  2FYN B;  3B8E B;  3GZY A;  2BEQ D;  3KHU A;  4PD4 H;  3MUD A;  4LLH A;  1BGY E;  2Z5I A;  1ZRT E;  2DW3 A;  2H7H A;  4ZKP A;  3VYI A;  2WSC H;  2M3E A;  1L0L D;  4PJ0 E;  2R44 A;  1X0T A;  3TK1 A;  3H32 B;  4NBH D;  3L71 J;  1KYO D;  2E74 D;  2K3R A;  3B5N B;  4KJM A;  3CCJ P;  3T97 A;  2WSF H;  3E1R A;  2N1T D;  3A3Y B;  3FWN A;  3NFQ A;  4YXD C;  2IPP A;  1EZV E;  1JCD A;  1T3U A;  1BGY G;  3RK3 C;  1SQP J;  3IR9 A;  3H1L J;  2YVJ B;  5E79 H;  2I1K A;  2QA4 P;  3AE2 C;  1O7H A;  4YXW H;  1JB0 J;  2E4P A;  1S2E A;  3H1L G;  4IL6 H;  1PZQ A;  2CKF A;  2LKM A;  2M5A B;  2Z4E A;  5AW9 B;  3G9R A;  2QSI A;  3GW6 A;  1NDO A;  5AVT B;  3L73 E;  2P2U A;  5C39 A;  1JO5 A;  1JUN A;  3L74 J;  3IF4 A;  4QDF B;  3KYQ A;  3HTK B;  1EZV I;  1LWU B;  4HM0 A;  4AAY B;  1EDJ A;  3VCA A;  3BRV B;  1J1E C;  2PP6 A;  1N7L A;  2YFL A;  4JPZ B;  2QE7 H;  1HWT C;  1NH4 A;  1PPJ G;  4O9B A;  1S9K E;  3C0D A;  1BCC D;  2HOD A;  2W6A A;  4C7N B;  2KSE A;  5AVV B;  2ZXE B;  2QG4 A;  1Q81 Q;  2E5Y A;  1GU4 A;  1FU1 A;  3CC4 P;  3HE4 B;  1P84 H;  5M1B A;  2A06 E;  3AEF C;  4JF7 A;  1OIP A;  1YI2 P;  1KN7 A;  4H13 B;  1LTB C;  1M1K Q;  1LTG C;  1XTC C;  3GCE A;  2BCC E;  4GT1 A;  1PV3 A;  1KD1 Q;  1LTA C;  1JOC A;  2POH A;  1NTZ G;  1GL2 D;  1VQN P;  3W68 A;  1UUV A;  3N4X A;  1AVO A;  3MD0 A;  1LT1 A;  1YJW P;  3L70 G;  1NTK D;  3GHG A;  1P84 I;  1SQQ D;  1GW3 A;  2OYH A;  2ZJS E;  1T3J A;  3H32 A;  2FYU K;  1KV4 A;  3FX0 A;  3L75 E;  4TLF A;  4H0L D;  3HD7 A;  1VQ7 P;  5TIS E;  3JCU H;  5AW2 B;  2RKL A;  2QM7 A;  3AE6 C;  2C0W A;  2HPC B;  4D6T J;  3L71 G;  5CCH C;  1L0N D;  3M9H A;  3FWL A;  1M7L A;  5DJU B;  2W83 C;  1L0L G;  2FYU G;  1LJ2 A;  1BE3 E;  1NTM K;  4QCK A;  3BCC J;  2P67 A;  1FDM A;  3BRT B;  2YKQ A;  3P8C E;  2A45 H;  4EYY Q;  1SFC B;  1RFS A;  3H1H G;  1S9K D;  1RF1 C;  1T2K D;  1JY3 N;  2ZT9 B;  1ZME C;  4UB6 E;  2E75 D;  2R3C A;  1YHQ P;  2O01 N;  4C7N A;  3TDK A;  1S1C X;  4OVN F;  2Q6Q A;  1L4A A;  3RK3 B;  1FE6 A;  4N78 D;  3AE9 C;  1PFI A;  2KB7 P;  1S3J A;  3VP9 A;  4HB1 A;  1GK4 A;  1T6A A;  1L0N K;  4H0L C;  3S1K A;  5KAI E;  3H1J G;  2JKV A;  3N7N A;  5AVW B;  1PP9 E;  1BCC G;  1URQ A;  1NU1 D;  3H1I J;  1VQP P;  4QDD A;  5APQ A;  4HJG H;  2WPQ A;  4OGQ C;  4Y99 C;  1K8A Q;  1NYH A;  3D71 A;  3AEE C;  1NGM B;  1H88 A;  2BMR A;  3KPE A;  1U7M A;  4U3F J;  4QUQ A;  4PD4 I;  5KLI C;  2Q1K A;  1K05 A;  3RL0 B;  2J58 A;  5CXM A;  3V4Q A;  2GBW A;  1HBW A;  2QJP B;  1Y47 A;  2XND H;  2E43 A;  1M1J B;  2WQY C;  2B87 B;  2I8D A;  1MKM A;  2IZ0 A;  1NU1 E;  2D2C D;  1G8J B;  1NTZ K;  2QEX P;  2KZI A;  2UWJ E;  1PP9 D;  3M0A A;  1SVF A;  4UB8 H;  2B88 A;  3V4W A;  5KAF H;  3VOP A;  4GKG A;  1L4A C;  1FZB A;  3HE5 A;  2KOG A;  2ZVO B;  3O6Q A;  4PD4 D;  3QH9 A;  1L0N G;  3OA7 A;  1M1J C;  4EI2 A;  1BGY D;  3KDP B;  1NHL A;  3V2R A;  4EOT A;  1AA0 A;  1URQ C;  1SP4 A;  1SFC C;  2JO1 A;  2OAR A;  1YJN P;  4ZMD A;  3JCU E;  1GTW A;  5H2F H;  1VQ4 P;  5KLV K;  2YIU C;  3K5B A;  3P8C D;  4R4M A;  2N1T B;  1PPJ E;  3I56 P;  1GMJ A;  1DD3 A;  2I1J A;  2AXC A;  2H8P D;  1CI6 B;  4TT3 H;  3HD7 D;  1N86 A;  2QJK B;  1L0N E;  2O3J A;  3CPW O;  5GTH H;  3MTU E;  4N78 E;  3WU2 H;  5APX A;  3H1K G;  1H0T A;  4MN4 C;  3VMG D;  3QWO C;  2OYI A;  2KLV A;  4HM4 A;  5TJH A;  3CXH H;  4QUP A;  2ZYA A;  2XDJ A;  3FXD A;  1T2K C;  4DCK A;  4YTP C;  1USD A;  1VPC A;  3L72 J;  3GL2 A;  3AE8 C;  4OWF A;  4M3L A;  1OVU A;  1LWU A;  2WPR A;  2XSH A;  1ZN5 A;  2FFD A;  3GTS A;  3VMI D;  4PV1 B;  1IFD A;  2LXB A;  3CLQ A;  1PGQ A;  4UB6 H;  2B87 A;  5B5E E;  1KIL B;  3L75 D;  5B66 E;  5APY A;  1O7P A;  4EIJ A;  1M57 D;  1AQ5 A;  1BSN A;  3TGU J;  2NVF A;  1OMI A;  1SQQ E;  1RF1 A;  1NTK E;  1KB9 I;  1IK9 A;  3DQY A;  2RH0 A;  1SQP G;  3AEC C;  2OGU A;  1SQQ J;  3II6 A;  4P1B H;  1OZH A;  2XR8 A;  3CL3 D;  4NBE D;  3ZDM A;  3IAO A;  3EQQ A;  4GOD A;  4C7R A;  3CXH D;  2Z5H A;  2WZ7 A;  1SQB G;  2BCC D;  2NPS A;  3GOB A;  5AW8 B;  1JMM A;  2QM8 A;  4HKV A;  1E79 H;  4D6T G;  1X8Y A;  1NKZ B;  3O6Q B;  3L74 G;  3VCP A;  3M9Q A;  1EC5 A;  4H13 C;  2D2C B;  4GIF A;  1HGV A;  3GHG B;  3Q5P A;  1H8A A;  1PGP A;  2IX7 C;  2YFI A;  4B86 A;  2HMN A;  2G3A A;  3HRN A;  1VQK P;  4Z1M H;  3MP7 B;  1JY2 N;  1JEK A;  2R5D A;  2V4H A;  1VQ5 P;  3VN0 A;  3WU2 E;  1EZV D;  2IFM A;  2V7Q H;  4JYB A;  3GF3 A;  1NYK A;  4PD4 E;  1E5W A;  1S4X A;  4NBB D;  2JJL A;  2YNY A;  1YIJ P;  1FJP A;  2E76 D;  4L76 A;  4U3F G;  2KNC B;  4GOE A;  1OW8 A;  1VF5 D;  1N73 B;  2B24 A;  3GTE A;  1SQX K;  2Y0D A;  1RQV A;  2O01 H;  3BAS A;  1AJY A;  4LC1 A;  1Q82 Q;  1VQ9 P;  2OTL P;  1RH5 B;  4K35 A;  1QVG O;  3Q5S A;  2WTY A;  2C9N Y;  3M9B A;  3WUT A;  3CI9 A;  3TNU B;  1GW4 A;  3GLM A;  2H89 C;  1EG9 A;  5CCH A;  3AEG C;  3AE5 C;  3GL0 A;  3MGN A;  2YKP A;  1N8R Q;  2B9B A;  1JY2 P;  2N9B A;  1LT9 B;  4H44 D;  1S5L E;  2M5A A;  2YMK A;  1JCC A;  1RY3 A;  1UII A;  1O7N A;  1N73 C;  1N7S A;  2MJZ A;  1Y8A A;  3Q1M A;  1CZQ A;  3H1H D;  4Y99 B;  2QJP C;  3VTP C;  1YQ3 C;  1YQ4 C;  1SJG A;  3KZI E;  3HTK A;  3H6P A;  3GB4 A;  5KKZ B;  1KB9 H;  1DEE G;  2OYI C;  5BU5 A;  5KLI B;  1ZR4 A;  2O1J A;  4H0L B;  4NBF D;  1L0L J;  2OYO A;  4L74 A;  2WT7 A;  5AW6 B;  3CWB J;  3L71 D;  3SWF A;  2HLO A;  3L70 E;  5AVU B;  1LTJ C;  5CCG C;  4JQ0 D;  3Q5R A;  5AVX B;  1FZC A;  5AW4 B;  4NPF X;  2K1A A;  1LP1 A;  3HE4 A;  1NTK G;  3FGA D;  5KJ7 A;  2YKO A;  1BE3 D;  5HL4 A;  2Y0C A;  4HM5 A;  1SQP D;  2W6J H;  2IDB A;  1LTJ B;  3CC7 P;  2JEE A;  3V2P A;  2KP8 A;  3GZX A;  1SQX E;  2FY8 A;  1N73 A;  2Q7C A;  2WMM A;  2J59 M;  3G4S P;  1BDD A;  1FOS F;  4IFD K;  2PGD A;  1FAV A;  1ZXG A;  4WWI A;  2A45 G;  3CME P;  4NPD A;  2WSE H;  1SQB K;  1YJ9 P;  1MV8 A;  5APV A;  1FDO A;  3U1C A;  4EMJ B;  2QVA A;  1OXZ A;  4R4L A;  1NKN A;  1G2C A;  5AW5 B;  3S9O A;  3PH0 A;  3Q3D A;  4YPC A;  1S72 P;  3A2A A;  5B5E H;  1LT9 C;  2ZFC A;  3IFM A;  1KIL C;  3CX5 I;  4XFJ A;  2ZVN B;  1JM1 A;  2NZ2 A;  5CHX A;  5APS A;  1UUW A;  1KC8 Q;  2KYV A;  3VMA A;  2M8R A;  3RBZ A;  4QUR A;  4DZO A;  2FXP A;  3SWY A;  1KIL E;  1FC2 C;  2A06 D;  2J5U A;  2MKV A;  3WMM 0;  2NPS C;  2W27 A;  3TGU E;  3TF5 A;  2YO3 A;  4PV1 D;  1SQB J;  3F5H A;  1OFC X;  3I55 P;  3CX5 E;  2K88 A;  1URQ D;  2HR3 A;  1W5C E;  2KS1 A;  1BCC E;  1G1J A;  4BRY A;  1J1D C;  4W7Z A;  1VDF A;  4AUW A;  3NMD A;  3H1L D;  1IFN A;  4NPE A;  1HH0 A;  3CXH I;  1FZC B;  3CX5 H;  1L4A D;  1WMK A;  1YBK A;  3HUS B;  1NVO A;  2YO2 A;  3D89 A;  4ZNC A;  1JTH A;  1NU1 G;  2JDI H;  5CCG D;  2OTJ P;  3H1J D;  1R5L A;  1J1E B;  2M3B A;  2IYP A;  4WY4 D;  2O01 J;  2AXT E;  1SQB D;  1Z56 A;  3L73 D;  4IL6 X;  1SQV E;  2P58 A;  1USE A;  2WWW A;  2HOD B;  3L36 A;  4OH8 B;  2P10 A;  2OQQ A;  1FJK A;  3CWB E;  4WY4 B;  4CPG A;  2BMO A;  3GMA A;  3L72 G;  3AE1 C;  1L0N J;  2W8Z A;  1VQO P;  2G8Y A;  1LWU C;  4QDC A;  5KLV E;  1HUC A;  5GTH E;  1JY2 O;  3BCC D;  3H1I D;  1L4A B;  4HKZ H;  1M56 D;  3BAT A;  3H1J J;  2A45 I;  1HGZ A;  3D70 A;  5K5G B;  2IBZ E;  3L75 G;  2YXR B;  2JO6 A;  4PJ0 H;  4NBD D;  5CCH D;  1KYO I;  5KJ7 D;  1BDC A;  4IL6 E;  3CWB G;  3M06 A;  1GD2 E;  1KYO E;  1J2J B;  2YFJ A;  1FDI A;  1CSB A;  1WRG A;  2NWF A;  3RL0 C;  1L0L E;  3EN1 A;  4BXL A;  5GTI E;  2Y0E A;  1NWQ A;  5CJ4 A;  1EQ7 A;  3GKE A;  2FYU J;  1ZRT D;  3LID A;  3VMH D;  4AIV A;  1DH3 A;  1BCC J;  1NU1 J;  4OGQ B;  2L5G B;  1FZG A;  2KNC A;  3LW5 H;  3N0Q A;  3AE7 C;  3B4S A;  4AQR D;  2FYZ A;  2W90 A;  5KAI H;  1HJB A;  2K9Y A;  2ZAE B;  5APW A;  3HD7 C;  2BEZ F;  3BCC G;  1JTH B;  2FXM A;  3RK2 D;  5E79 E;  3A0B H;  1Y9B A;  3C8V A;  1SQX J;  2FKW B;  1ULI A;  3PLN A;  2GUV A;  3A0B E;  5KJ7 C;  2V7Q J;  2YMY A;  4WBA A;  3Q2Y A;  4HM1 A;  2B1X A;  2FYU D;  3CCS P;  1H0T B;  1FZA A;  1OVV A;  4HM7 A;  2KSJ A;  1AQT A;  4IFF A;  3WUV A;  2WSE J;  3RK3 D;  4W7Y A;  2NUK A;  1G8K B;  1PP9 J;  1N7S B;  1EDL A;  2I7F A;  2KZJ A;  2ITA A;  1VQM P;  1RE3 A;  4I7Z B;  2WPV B;  3L74 D;  3TGU G;  3FOU A;  1OX3 A;  1DD4 A;  2IZ1 A;  2N1T A;  3HE5 B;  3G3Z A;  5AVS B;  5AW7 B;  3H1K D;  3ITK A;  3SWK A;  1CW5 A;  1OWA A;  3TSI A;  2FXO A;  4BWN A;  3W67 A;  2WT7 B;  3EFG A;  4I6M C;  1ZW0 A;  1IO4 A;  1AV1 A;  1IC2 A;  1EZV G;  1MUU A;  2H43 A;  2GBX A;  3WUU A;  3SFD C;  1L0L K;  1NJI Q;  3AED C;  3RK3 E;  2CPB A;  2IYO A;  1NTM J;  3PRJ A;  2IFN A;  2C9L Y;  2W6B A;  3FXE A;  1R8E A;  4D6T E;  2HFE D;  2WPS A;  1IFJ A;  4HM2 A;  1EXJ A;  3U1A A;  4BRY B;  2RN0 A;  2AEM A;  3H1K J;  5CBO A;  5GTI H;  4NB8 D;  2Q9I A;  1RE4 A;  3V6I A;  5AVR B;  2Q3E A;  2PFX A;  1A02 J;  2NUM A;  1KYO H;  1M90 Q;  1FQT A;  1Q90 D;  2Y9Y A;  3KZI H;  2KXP B;  4W80 A;  1JMB A;  4QMA A;  1GL2 B;  2AEJ A;  1VQL P;  1H89 A;  1N2D C;  1NTZ E;  3VMZ A;  1IFM A;  4RES B;  4A7P A;  4ZKU A;  4ASW A;  2KUB A;  5KLV J;  2XRX A;  3VP8 A;  3PP5 A;  4H13 D;  2QJY C;  1JY3 P;  3GHG C;  1PIX A;  5BVZ A;  5AVQ B;  5AW3 B;  4U3F E;  3OAK A;  2FFD B;  1FZC C;  2A06 G;  3GF7 A;  1XTG B;  2C0X A;  2E76 B;  3RK2 B;  5AVZ B;  4IFM A;  1IFI A;  1QVF O;  2Q3W A;  3B5N A;  1RQU A;  3JC2 2;  3T97 B;  2KIK A;  1LNQ A;  1MFZ A;  1NO4 A;  2P1J A;  3L72 E;  1P84 D;  1ZV8 A;  3E7K A;  1BE3 G;  2NPS B;  1RHZ B;  3A7O A;  4OGQ D;  3AEB C;  5KLV D;  5AW0 B;  2IBZ I;  5B66 H;  4WY4 C;  4HM8 A;  2JWD A;  4K3A A;  1FOS E;  2Y9Z A;  3M91 A;  3CD6 P;  2WVR A;  4RO0 A;  2WSS H;  2YXQ B;  4N6J A;  5L8R J;  1KZU B;  1PGO A;  4U3F D;  3AZC A;  2HMJ A;  2HMO A;  4DOJ A;  3MZW B;  2DE7 D;  3EFF K;  2E42 A;  1VQ6 P;  5AEW A;  2E4Q A;  1W2E A;  2E75 C;  3H1I G;  5APT A;  3LW5 J;  2OTK E;  1NTM G;  2YIU B;  3A5T A;  2D2C C;  1GL2 C;  1KIL A;  4I7Z C;  3USS A;  3ABV C;  4ASV A;  1EDK A;  1S5L X;  1NTM D;  1HTL C;  1P84 E;  3AEA C;  3L72 D;  5CMZ A;  1N7S C;  4HM3 A;  3KQG A;  2M0B A;  2OYH B;  1J1D B;  2ZYG A;  3M0D A;  2JR8 A;  3S4R A;  1PGJ A;  2R32 A;  1YYC A;  3B5N D;  3CCM P;  2E74 B;  1KQS O;  3EQ2 A;  4D6T D;  1G1I A;  3A0H E;  2BAS A;  2FYN C;  1QX8 A;  3TYY A;  1SQQ G;  4H44 C;  3CCU P;  1FS0 E;  1NTK K;  5KTB A;  3TGU D;  5CBN A;  2GA1 A;  1KQL A;  1QEX A;  3CCE P;  3B71 A;  4P1C H;  1KIL D;  4IOI H;  1RIE A;  4HYT B;  2RMZ A;  1U7J A;  1SLQ A;  4NBC D;  2GUS A;  1NTK J;  1LP1 B;  1NTZ D;  1QGK B;  3AE4 C;  2AEF A;  2KK7 A;  3MUD C;  2HMK A;  1HVV A;  1L2P A;  1KMI Z;  3PHL A;  4DT0 A;  1M1J A;  3RBX A;  1KB9 D;  1OVR A;  2DE6 D;  4NB9 D;  2WIT A;  3O8Z A;  1SFC A;  3C1L A;  4HH2 A;  1URQ B;  3L35 A;  3L74 E;  1BSH A;  1X79 B;  5CJ0 A;  4JBZ A;  5APU A;  2CK3 H;  1K04 A;  5AEU A;  3SFE C;  3CCR P;  3L70 J;  1WT6 A;  2QPZ A;  1Q86 Q;  1EXI A;  4HM6 A;  2BMQ A;  2XZR A;  3V5B A;  1KQF B;  5AVY B;  3RK2 C;  1T8Z A;  1YIT P;  3HD7 B;  2JZA A;  1A02 F;  4DJG A;  1O7W A;  4GDO A;  2HML A;  2LR2 A;  1NOH A;  1KB9 E;  3L75 J;  4NBG D;  4Y28 J;  3CCL P;  1Q2N A;  2LXC B;  1FZE A;  3G6E P;  4KHX A;  1NAF A;  5DJT B;  1KFM A;  3L70 D;  2K37 A;  3A0H H;  4WVZ A;  1S5L H;  1DEB A;  3L71 E;  1LT9 A;  2OYI B;  2XKM A;  1JY3 O;  2B89 A;  3P32 A;  2XSO A;  3R4Y A;  1K73 Q;  2FYU E;  3P7K A;  1R5S A;  1BGY J;  1IJD B;  1LTT C;  1SQV G;  1OW7 A;  1KOR A;  1ZLL A;  3H1H E;  1RF0 A;  2E74 C;  2R3S A;  1Q90 C;  2BCC G;  4RKU J;  2IBZ D;  1SQV K;  1ZOY C;  4C46 A;  1GDT A;  3RL0 D;  1UIX A;  2IBZ G;  3U59 A;  1O7M A;  4JYC A;  2SPZ A;  2NPS D;  2ZYD A;  1NTM E;  2HG5 D;  1JM0 A;  1X22 A;  1NAY A;  2P7J A;  1VF5 C;  3CMA P;  5KLV G;  3AE3 C;  2KLU A;  1VCK A;  1NTZ J;  2E5T A;  3L4F A;  1HF9 A;  2ZXX A;  1SQX G;  2HMM A;  2GM4 A;  2L91 A;  3V2Q A;  1VM9 A;  3PTZ A;  1G2C B;  1PP9 G;  3BVH A;  4WY4 A;  1GL2 A;  1TU3 F;  1MFT A; 
#chains in the Genus database with same CATH homology
 1L0L E;  3L73 E;  3EN1 A;  2FYN C;  3GKE A;  1L0N E;  4P1B H;  2XR8 A;  4NBE D;  2Q3W A;  4QDF B;  3VMH D;  3H1J E;  2GBX A;  2NVG A;  4AIV A;  3GZX A;  2BMR A;  1SQX E;  3EQQ A;  4P1C H;  3D89 A;  1RIE A;  1ULJ A;  4HM0 A;  4AAY B;  3L72 E;  4NBA D;  3H1I E;  3BCC E;  1EG9 A;  3VCA A;  3L75 E;  3GOB A;  4H0L D;  4QUQ A;  3VMG D;  4OGQ D;  4NBC D;  3GL0 A;  3GZY A;  3L71 E;  2ZT9 D;  5KLI C;  2YFL A;  4HM4 A;  4H44 D;  4HKV A;  3N0Q A;  1BGY E;  2XSO A;  4HM8 A;  1ZRT E;  5CXM A;  5BOK A;  4QUP A;  2GBW A;  1O7N A;  2ZYL A;  2FYU E;  4D6T E;  3VCP A;  1SQV E;  4HM2 A;  3C0D A;  2HMK A;  4NBH D;  1BE3 E;  3H1K E;  2DE6 D;  4NB9 D;  4EMJ B;  1NU1 E;  2D2C D;  2QJP C;  1G8J B;  1O7G A;  3AZC A;  4NB8 D;  4QCK A;  3GL2 A;  2E74 D;  2DE5 D;  1SJG A;  2HMJ A;  3CWB E;  3H1H E;  2YFI A;  2HMO A;  2HMN A;  3GB4 A;  1Q90 C;  1ULI A;  2NUM A;  1WQL A;  1RFS A;  1FQT A;  2DE7 D;  2XSH A;  2BMO A;  4HM1 A;  3L74 E;  1SQB E;  2E4Q A;  2B1X A;  5AEW A;  3GTS A;  2A06 E;  1O7M A;  2E75 D;  1JM1 A;  3VMI D;  4NBF D;  4HM7 A;  5AEU A;  1NTM E;  1NTZ E;  4QDC A;  5KLV E;  1UUW A;  1EZV E;  2NVE A;  2QPZ A;  4HM5 A;  3GCE A;  2BCC E;  4QDF A;  2NUK A;  4QUR A;  1G8K B;  5KKZ C;  1O7P A;  1VCK A;  1P84 E;  2I7F A;  2XRX A;  4HJL A;  4HM6 A;  3L70 E;  4HM3 A;  3CXH E;  2BMQ A;  1NYK A;  4PD4 E;  2QJK C;  2HMM A;  4NBB D;  2YVJ B;  4H13 D;  3TGU E;  2IBZ E;  1VM9 A;  2QJY C;  2NVF A;  4PV1 D;  1O7H A;  2JZA A;  2E76 D;  1SQQ E;  2JO6 A;  3FOU A;  2YIU C;  4NBD D;  2E4P A;  3H1L E;  1NTK E;  1O7W A;  2CKF A;  3DQY A;  1VF5 D;  1PP9 E;  3CX5 E;  2HML A;  1UUV A;  4U3F E;  1SQP E;  1KB9 E;  1KYO E;  1PPJ E;  2B24 A;  3GTE A;  2YFJ A;  5HL4 A;  4NBG D;  1BCC E;  4QDD A;  2NWF A;  1NDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...