1L0LE

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 28
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0lE02
1O7HA 4HM7A 2HMMA 5KLVE 2NUKA 3EN1A 4P1CH 4NB9D 3L70E 1BGYE 4QURA 4NBBD 3CXHE 2E4PA 2XRXA 4HM6A 1G8JB 1G8KB 3GL2A 4NBCD 2QJPC 4NBHD 2NWFA 3H1HE 4QDCA 2QJKC 2YFIA 3H1IE 1SJGA 2Q3WA 4QDFA 2YFJA 1L0NE 4NBGD 4H13D 2DE7D 4QUPA 2GBXA 1JM1A 3GTEA 2GBWA 3GKEA 1ZRTE 2E76D 1BCCE 1UUWA 4AAYB 1NDOA 2NVFA 2YFLA 3L74E 2BMRA 2QPZA 2B24A 1VF5D 4HKVA 3GTSA 3GL0A 4HM4A 1WQLA 2HMKA 2QJYC 3VCAA 1SQQE 1NYKA 4HJLA 4AIVA 1SQVE 2E74D 4NBDD 3DQYA 1O7WA 3L71E 1O7PA 1Q90C 1SQPE 1RIEA 3GZXA 4HM8A 3GOBA 2I7FA 2JZAA 3GCEA 3BCCE 4HM5A 3CX5E 1ULJA 2D2CD 2NUMA 4HM1A 1BE3E 2DE6D 1FQTA 3GB4A 3L73E 1SQBE 3N0QA 5AEUA 5KLIC 3D89A 4NBED 4H44D 2BMQA 4P1BH 5KKZC 1EG9A 2NVEA 3H1JE 5CXMA 5BOKA 3VMID 1KYOE 1O7MA 2B1XA 4NB8D 2ZT9D 3CWBE 2HMJA 2FYNC 2NVGA 1UUVA 2ZYLA 1NTME 2A06E 3L72E 1RFSA 2BCCE 4PD4E 4HM2A 3C0DA 2XSOA 3GZYA 1NU1E 3FOUA 1VM9A 4H0LD 2HMOA 1PPJE 2XSHA 3L75E 1KB9E 2E75D 2YVJB 4NBFD 2FYUE 4PV1D 4HM3A 3TGUE 1NTZE 2HMNA 1EZVE 2IBZE 5HL4A 2DE5D 4QCKA 4QUQA 5AEWA 2HMLA 1P84E 4EMJB 1VCKA 3VMHD 2XR8A 2YIUC 3H1LE 4QDFB 1ULIA 4NBAD 1L0LE 2JO6A 3EQQA 2BMOA 3VMGD 3H1KE 3AZCA 1PP9E 4OGQD 1SQXE 4U3FE 4HM0A 2CKFA 4D6TE 4QDDA 1NTKE 2E4QA 3VCPA 1O7NA 1O7GA
chains in the Genus database with same CATH superfamily
4OWFA 1LTSC 1N7SD 3A2AA 2E75B 5GTHE 2M3BA 2NWFA 3BASA 2K88A 1Y47A 2N9YB 1YQ4C 1JTHA 1LTIC 2W90A 4OH8B 2QA4P 2LR2A 1KC8Q 1H89A 3A5TA 1JMBA 2WPQA 3M9BA 2M8RA 4L76A 5KAFE 1QGKB 1IO4A 2HFED 1HJBA 3C8VA 1EQ7A 4D6TG 2E74D 3PP5A 3IF4A 5AW6B 1WRGA 4WY4A 3V4QA 2OYOA 1M57D 3R4YA 1BE3J 1Q2NA 1LWUA 1DIPA 2A45G 1L4AA 1PIXA 2ZYDA 1T2KC 1P84D 4DT0A 2A45I 2K3RA 4PD4H 2XU6A 4H0LD 4U3FD 1VDFA 1FOSE 3B5NB 2Q5UA 2FYUJ 3VMAA 1VQ6P 3FX0A 3TGUJ 1FOSF 3PJSK 4LLHA 4QDFB 3AE1C 2P7JA 3GF7A 4GDOA 3H1LJ 2P10A 1E5WA 4EIJA 4IFFA 1L0ND 4BRYA 1O7HA 3JSVC 2HMMA 1BDCA 4P1CH 3A0HH 2NUKA 2OGUA 2NZ2A 2KK7A 4NBCD 1Y8AA 4NPFX 4NBHD 3RBXA 1NU1G 2ZAEB 1RQVA 5AVRB 1G2CB 2M0BA 2D2CC 1NAYA 3H1HJ 5BU5A 2Z4EA 1K04A 4WVZA 4R4MA 3VMYA 1VQNP 1JM1A 2KS1B 1FZGA 3CCMP 1UUWA 2M5AB 1OXZA 1X0TA 2BMRA 3EQ2A 1SQBD 4CPGA 1MV8A 4PV1B 3TYYA 3H32B 4RKUJ 5B5EH 3K5BA 2W6AA 4YXWH 3D70A 2V4HA 3VCAA 3L75G 1SQVE 1FS0E 2O1KA 1Q90C 4IL6H 2BCCD 1Z56A 3JCUE 3CX5E 3GG2A 2OYIA 2KOGA 2KUBA 1H8AA 1NWQA 4H13C 4OGQC 5AW0B 5CXMA 3H1JJ 3L72E 1RFSA 3RK2D 1VQ9P 3H1KD 3SWKA 1PP9D 2QVAA 3SFEC 3CXHI 1KB9H 2KI7B 5TJHA 4I1LA 1LT1A 5KLVD 3D71A 1KILC 3LW5H 4QUQA 3AEGC 3VMHD 1FU1A 1BE3G 1EXJA 2OYHB 1N86A 3OJAB 2K9JA 1OVRA 1RF1B 1VF5C 1U57A 4HM7A 1ZN5A 4GOEA 3AEBC 2HPCA 1IK7A 1S5LX 4ZNCA 4NPEA 1KD1Q 5CCGD 1SQVK 1FZEA 3RK3C 2FYUG 3M0DC 2KLVA 2WSEH 3TGUG 3VYIA 2WZ7A 1EZVG 2IBZG 4NBGD 1IFDA 1EZVI 2IBZI 3VN0A 1GL2C 2LXCB 3H1LG 1X9VA 3HTKB 4XE5B 3T97A 3GTSA 3GL0A 3BVHA 3B8EB 3AECC 1GMJA 3NFQA 4RJTA 1CZQA 1LT9A 1RIEA 2Y9YA 4PD4D 3AE2C 3H1HG 2O01N 2QM7A 1FJKA 1CI6A 1LWUC 4N78D 2G8YA 1L2PA 2JEEA 4UB6H 1H88A 1L4AC 4NB8D 3CWBE 2FYNC 2NVGA 1NGMB 1JY2P 2QG4A 3AEFC 2Q1KA 1M1JB 2E75D 3HE4A 4HKZH 2YMKA 2G3AA 1KORA 1OVUA 5M1BA 5AEWA 3CCVP 3NTNA 1AQ5A 4NBAD 1VQPP 2E76C 2CK3H 4UB8E 3L36A 3H1JG 4JPZB 3RL0g 3HD7C 2NRGA 3EFGA 1NTKJ 2A06G 2JWDA 5E79H 1N73B 4W80A 1GW4A 1VQLP 3IFMA 5AW4B 1PV3A 3L35A 2WPRA 4KHXA 1VQMP 4QUPA 3CPWO 1JCDA 1T3JA 3P8CD 4H0LB 3CCQP 3AE6C 3L74J 2HMKA 4Z1MH 3GHGB 5AW2B 1SQQJ 3WU2E 1A02J 3MHVA 2QEXP 1D7MA 3BCCE 4HM5A 1NOHA 3M9QA 5APWA 1KB9D 1QL2A 2K1AA 4WWIA 3L73E 1RE4C 4NBED 1KYOH 1LTJB 3FXEA 2MJZA 3B71A 1LJ2A 1S3JA 2YKPA 1EC5A 1IC2A 1NTMJ 2R44A 5K5GB 3M0AA 3SWYA 4AQRD 1PGPA 1S9KD 1YJ9P 4HM3A 1NTZE 2QRXA 2KNCA 3MTUE 1BGYD 1WMKA 1OFCX 2NPSD 3VMZA 4XFJA 3BATA 1NHLA 1ULIA 1FZAA 1L0LE 1LGHB 3GF3A 1YTZI 1Q86Q 4C7NB 2SPZA 2OYIB 1YTZT 2YKOA 2N1TC 2E4QA 1FAVA 2XKMA 3UIAA 3O6QA 4PJ0H 2LXBA 3TSIA 1IFNA 3GL2A 2QJPC 2R3CA 2P58A 1ZR4A 1IFIA 1SJGA 1VQ5P 3H1IJ 1HVVA 4GKGA 4I6MC 3RK2B 2YXQB 1YI2P 5AVUB 2ZVNB 1EXIA 4HM4A 1QVGO 1NTKG 2OARA 1USDA 4Y99B 3L71J 3VTPC 3GOBA 1IFMA 2JZAA 1SQPJ 2BEQD 1AVOA 1M1KQ 4HM1A 5CMZA 3II6A 1NTZK 1FQTA 2E5TA 2FFDB 3G4SP 4C46A 1R5SA 1RQUA 3FXDA 4BWNA 5KKZC 3AE3C 2WSSH 1L0LK 4AUWA 3A0BE 1EDLA 1S2EA 3L74G 3U1CA 3HE5A 4MN4C 4D6TD 2HYNA 3L75E 1SQQG 1OIPA 1OMIA 2Y0CA 5AW3B 5HL4A 2O1JA 2P2UA 1P84E 2XR8A 5APUA 2QSIA 1HGVA 1USEA 4U3FE 3E1RA 2W83C 1SQXJ 2PGDA 5TISH 3VCPA 1VQ4P 1JCCA 2IZ0A 1NTMG 3CXHE 2E4PA 2B9BA 3L70J 1G8KB 4IFDK 1QVFO 5EFWB 1QEXA 3VMXA 2JP3A 3H25A 1L0NE 1RF0C 2XV5A 2HODA 3GKEA 3D6ZA 2YFLA 1BCCJ 1BSHA 3M0DA 3RL0B 4AIVA 1X22A 1YYCA 1GL2A 2XNXA 2FXOA 1NU1D 5APTA 2YIUB 1SQBE 2RKLA 2AXTH 5KLIC 3S4RA 4WY4D 2JWAA 5BOKA 3P32A 1N7SA 3WUTA 3A7OA 5KAIE 1NVOA 2Q3IA 4WB4A 2BCCE 3FOUA 1VM9A 1SFCB 1K9MQ 2YNYA 4TT3H 3L75D 3L71G 2B87B 1OX3A 3CLQA 4ASVA 1SQPG 3B5NC 2I1JA 2WSCH 1L0NK 2PAJA 3H1KE 3AZCA 1PP9E 4ASWA 2VRSA 1LP1A 5KJ7D 1OVVA 1JY2O 2K37A 1KQSO 5KLVE 3EN1A 1FZFA 2FBWC 3CXHD 3P8MC 1QL1A 4JYCA 1OW7A 2H8PD 2YXRB 3CX5H 2DE7D 4W7YA 3HD7A 1KQLA 2GBXA 1BE3D 1SQBK 3CCLP 3CL3D 4R4LA 2NVFA 1KYOI 2QPZA 3HUSC 1SQXG 1K05A 2PP6A 3AEDC 4HJLA 4PV1C 5AW8B 1O7WA 1URQC 1IK9A 3L70G 2NPSB 3PRJA 2N9BA 1YQ3C 1G1IA 2FYUD 4DJGA 1KZUB 3N0QA 3TGUD 3M06A 4H44D 1EZVD 1IJDB 2B88A 2IBZD 5APSA 3H1LD 1BCCG 1UUVA 2Z5IA 2WT7B 4PD4E 1H0TA 2ZVOB 1PGJA 5KLVK 1RE4A 2D2CB 1LTAC 2GM4A 2DE5D 1JUNA 4HYTB 2AEJA 4N78E 3H1HD 3CCSP 1UIXA 2ZYGA 3I55P 2KSEA 2OYHC 3C9IA 4NPDA 2XZRA 1RF1C 1ZRTD 4QURA 3FWNA 2IYPA 2XRXA 4BXLA 3OAKA 3TDKA 2KSJA 2OTKE 2POHA 2FKWB 1PPJG 1AQTA 4DZOA 3Q3DA 1QLED 2WSCJ 4K35A 4LGDE 3KQGA 2N1TA 3KDPB 2JDIH 4OGQB 5H2FH 1CW5A 2I8DA 5CCHD 3V4WA 1WQLA 3H1JD 3KPEA 4NBDD 2PFXA 3CMEP 5B66E 1SQVJ 2A06D 1KILB 4IL6E 5CJ0A 2HG5D 3RBZA 1J1DB 1JM0A 3P8CE 3H6PA 3FGAD 1YJNP 1VF5B 2J5UA 2ZT9D 4EOTA 4UB8H 1MKMA 1N7SC 3L72J 3GZYA 4HJGH 1Q82Q 3ZDMA 1X8YA 1KB9E 2KP8A 3NXSA 1M1JC 4EYYQ 3G9RA 2HMNA 3RK3B 3D6YA 1XTGB 3MUDC 1JTHB 3CCRP 2XDJA 1N7LA 2O3JA 3A3YB 1OW6A 1PL5A 3V2RA 3F89A 3G3ZA 3KZIH 5AVXB 4QDDA 1ZMEC 1R8EA 1GZLA 4O9BA 1S9KE 1S4XA 1NO4A 2H88C 2E74C 2IDBA 1BGYE 4NBBD 2WPVB 3F5HA 3RL0D 3IN6A 2KZIA 2OTJP 1DEBA 1JY3P 1N73C 4WY4B 2QJKC 2YO2A 1M56D 1J2JB 1JEKA 3E7KA 1GK4A 3N7NA 1S5LH 1LWUB 1N8RQ 1FZCA 1L4AB 4HKVA 3C1LA 3O8ZA 1NYHA 1JB0J 4H0LC 3USSA 1MUUA 3CC7P 5GTIH 1SFCD 4HM8A 1RF0A 3GHGC 5AW9B 3MD0A 2NUMA 1MFZA 1J1EC 3AE7C 5AEUA 1JY2N 2E76B 1VQ7P 3GMAA 3VMID 4UB6E 3CWBJ 4BRYB 4I7ZB 4HM2A 2C9LY 1ZXGA 5AVVB 1NTKD 1KN7A 2M3EA 1RH5B 1JY3N 1SQVG 5CBOA 4RESB 4KT0J 1FBMA 3SSUA 3MZWB 3CI9A 3CX5I 2JO6A 2BMOA 1FE6A 1U7MA 1T2KD 4HM0A 3IR9A 2UWJE 4D6TE 1DH3A 3LIEA 1U7JA 2WQYC 3B5NA 2GA1A 3L72G 3L74D 1KFMA 3V2PA 1G8JB 1QX8A 5E79E 1M8OB 4IFMA 2K9YA 1KILE 2KZJA 4H44B 3WMM0 5CJ4A 1SQQD 1H0TB 4EI2A 1AV1A 4QDFA 1NJIQ 5AVQB 1CSBA 2WMMA 1S72P 1BSNA 3MGNA 3RK2C 1JOCA 2QJYC 2V7QJ 4GIFA 1DEEG 3MP7B 2GUVA 1G2CA 1VQOP 1NTMD 3L4FA 2D2CD 3BCCJ 4N6JA 1FDOA 3HUSA 1P84H 3L73J 2M5AA 2C0XA 2FFDC 1KYOE 3H32A 2K9JB 1URQA 5L8RJ 4B86A 3W68A 1NU1E 5CCGC 2HPCB 1KQFB 1Q90D 2YMYA 4IOIH 1KV4A 2IPPA 4HB1A 2R5BA 2WSFH 1NTZJ 1Y9BA 2KLUA 1VCKA 3G6EP 1VQKP 1Q81Q 2J59M 3VMGD 1L0LJ 1SVFA 4OGQD 5AW7B 3T97B 4GT1A 3I5CA 4QMAA 1FJPA 3CWBG 2BEZF 4NB9D 5GTHH 4HM6A 4PJ0E 4GODA 1LT9B 1GTWA 3EFFK 4XA4A 1NAFA 1KILD 2YFIA 4YTPC 3L71D 2R32A 2ZT9B 1SQPD 2OYHA 5DJTB 1CI6B 1VL2A 5KAFH 1RF1A 1KTMA 1NDOA 2E5YA 2DW3A 1VF5D 1FZCC 1N2DC 5AVWB 2E75C 4JQ0D 1AFOA 2RMZA 4A7PA 3HE4B 1NU1K 3CCUP 2Y9ZA 3RK3D 3PHLA 1BE3E 1YJWP 2O01J 1MFTA 1ZR2A 4YXDC 3HTKA 1HUCA 1GL2D 3KYQA 1MZ9A 2HMJA 1KYOD 3V2QA 4M3LA 1T3UA 4W7ZA 1R5LA 1SQXD 2FYUE 1NH4A 2WPSA 3L75J 3TGUE 3L37A 2JKVA 1AA0A 3L70D 1SFCC 1EZVE 3H1IG 2IBZE 2L91A 3BCCG 2WTYA 3H1LE 1GU4A 3L73G 3EQQA 2IFNA 3U59A 4U7JA 1L4AD 4U3FJ 1M1JA 5TISE 5APVA 2FY8A 1BCCD 3KHUA 4I2LC 2ZYAA 3MUDA 1BDDA 2BASA 1SP4A 3AE9C 3Q5PA 3H1HE 2WSFJ 1AJYA 2JR8A 1NTZG 2Q3WA 2KYVA 3QH9A 2W27A 5KLIB 2CPSA 2IZ1A 1L0NJ 1S1CX 1HGZA 2GBWA 1G1JA 1ZRTE 2E76D 1ZOYC 4AAYB 1L0LG 4IL6X 2B24A 3HD7D 3AE8C 1N73A 3BRTB 5CHXA 2LKMA 1IZNB 2RH0A 3M9HA 2W8ZA 2Q6QA 3JCUH 4L75A 2P1JA 5APQA 1GW3A 1JY3O 1KFNA 1ULJA 2FYUK 2KNCB 3WUUA 2NPSC 1PPJD 3S1KA 1T6AA 4HH2A 3D89A 2AXTE 3TF5A 1SQBJ 4P1BH 1LTGC 5KJ7A 3H1JE 1K73Q 1TU3F 2A06E 2QIWA 5AW5B 3GHGA 4JF7A 2IX7C 2BCCJ 3O6QB 2HMOA 3AEEC 4NBFD 2ZXXA 2XNDH 2AEFA 3VP8A 4QCKA 2HMLA 1XTCC 2R5DA 3ITKA 1LTTC 4L73A 1PZQA 1LTJA 5AVSB 3W67A 3I56P 1W5CE 1RY3A 2I1KA 3H1KJ 2CKFA 1PP9J 3HUSB 3FWLA 5KLVJ 1URQB 3N4XA 3LIDA 2IFMA 3V2NA 5B66H 3P7KA 4ZKPA 1RE3C 1HF9A 2P67A 2MKVA 3MIWA 1ZLLA 2C0WA 4C7NA 1YHQP 1P84I 1SLQA 1LNQA 3A0HE 1E79H 3RGUA 2N1TD 4U3FG 4OVNF 3HE5B 3PLNA 3S9OA 1W2BO 2C9NY 1DX7A 5AVYB 1YITP 1DD3A 2DE6D 4ZKUA 4H13B 2H89C 4TLFA 3VOPA 1LTBC 1PFIA 1J1DC 1L0NG 1GDTA 5B5EE 1O7MA 2B1XA 2FXPA 3M91A 4WBAA 2XSHA 2KIKA 1HJ0A 1JO5A 1M90Q 2FFDA 4EMJB 3V6IA 3WUVA 3SWFA 1M7LA 1IFJA 1YIJP 1SQBG 5CCHA 2HODB 2H43A 5CCGA 1OW8A 1NTKE 4ZMDA 3TNUA 3OW2O 2BCCG 5AVTB 3CC4P 2AEMA 3V5BA 1HWTC 2HLOA 1SQVD 1GL2B 2WWWA 1GD2E 4WY4C 1HBWA 3CX5D 5H2FE 2ZFCA 3L74E 3H1KG 2V7QH 5C39A 1PP9G 1Q7YQ 1N7SB 1SQQE 3WU2H 1K8AQ 5KLVG 3PH0A 3IAOA 3L72D 2B89A 3GCEA 1A02F 2YKQA 1OZHA 4K3AA 1WT6A 2FYNB 1ZP0C 2NVEA 2ZJSE 1JNMA 5KJ7C 3NMDA 1NTME 1JMMA 1LP1B 2E74B 1NTKK 3C0DA 3AEAC 1NKNA 4I7ZC 4JYBA 5BU8B 2QJKB 2E43A 1YBKA 1NKZB 3Q2YA 2Z5HA 3LW5J 1T8ZA 3AE4C 3HD7B 3SFDC 2A45H 1IFPA 5AW1B 3U1AA 5APYA 1FDMA 1LTJC 3KZIE 1EDKA 1O7NA 1KQGB 1HTLC 1VPCA 2YO3A 1SFCA 2JJLA 2PRRA 1BGYJ 3G71P 2Q7CA 1HH0A 1EDJA 1SQQK 2B87A 5BVZA 2QE7H 4PD4I 4QDCA 4GOFA 3H1IE 4AYCA 1J1EB 2W6JH 3B5ND 3BRVB 2WSEJ 4H44C 3HRNA 3GW6A 1S5LE 2OYIC 2QM8A 1FZBA 5APXA 3CMAP 3QWOC 3B4SA 5KTBA 1NYKA 1NTMK 3DQYA 3CWBD 3L71E 1OWAA 1SQPE 5GTIE 3GZXA 1ZW0A 3Q5SA 4L74A 2I7FA 2KB7P 2O01H 1UIIA 3GB4A 1PGQA 3EWKA 2Q9IA 1X79B 4DOJA 3CC2P 2BMQA 4C7RA 2RN0A 3A0BH 2E42A 2WVRA 1FDIA 5CBNA 2XSOA 3RK3E 2Y0EA 2Y0DA 2NPSA 4Y99C 4PV1D 2YVJB 1URQD 2KS1A 1VQ8P 2GUSA 2ZXEB 2FYZA 3R2PA 2WITA 2Q3EA 2W6BA 3GLMA 1RHZB 3TK1A 2N1TB 3CD6P 2L5GB 1SQXE 5CCHC 4KJMA 2OQQA 2WT7A 5DJUB 4N3YB 4D6TJ 1O7GA 3CCEP 2QJPB 2QJYB 3CXHH 3L70E 1EDIA 1SS1A 3Q5RA 2CPBA 3CCJP 1KB9I 1SQPK 1LT9C 2YFJA 3H1ID 4H13D 4RO0A 4Y28J 1KMIZ 3Q1MA 3BCCD 2J58A 3GTEA 1BCCE 2ZT9C 2AXCA 3L73D 3E1IA 1RE3A 3OA7A 1O7PA 1BGYG 1DD4A 1AVYA 1GK6A 3TNUB 1ZV8A 3JC22 4JBZA 5KKZB 3AE5C 1W2EA 3VP9A 2KXPB 2JO1A 1NTZD 5AVZB 1GU5A 3KXDA 1EG9A 2R3SA 2ITAA 5KAIH 2ZYLA 1L0LD 4YPCA 1SQXK 2OTLP 2FXMA 2IYOA 1PGOA 3RL0C 4LC1A 1PPJE 1FC2C 3PTZA 1NU1J 2H7HA 4DCKA 1KILA 4EDFA 2YIUC 2HR3A 1FZCB 3ABVC
chains in the Genus database with same CATH topology
1O7HA 4HM7A 2HMMA 5KLVE 2NUKA 3EN1A 4P1CH 4NB9D 3L70E 1BGYE 4QURA 4NBBD 3CXHE 2E4PA 2XRXA 4HM6A 1G8JB 1G8KB 3GL2A 4NBCD 2QJPC 4NBHD 2NWFA 3H1HE 4QDCA 2QJKC 2YFIA 3H1IE 1SJGA 2Q3WA 4QDFA 2YFJA 1L0NE 4NBGD 4H13D 2DE7D 4QUPA 2GBXA 1JM1A 3GTEA 2GBWA 3GKEA 1ZRTE 2E76D 1BCCE 1UUWA 4AAYB 1NDOA 2NVFA 2YFLA 3L74E 2BMRA 2QPZA 2B24A 1VF5D 4HKVA 3GTSA 3GL0A 4HM4A 1WQLA 2HMKA 2QJYC 3VCAA 1SQQE 1NYKA 4HJLA 4AIVA 1SQVE 2E74D 4NBDD 3DQYA 1O7WA 3L71E 1O7PA 1Q90C 1SQPE 1RIEA 3GZXA 4HM8A 3GOBA 2I7FA 2JZAA 3GCEA 3BCCE 4HM5A 3CX5E 1ULJA 2D2CD 2NUMA 4HM1A 1BE3E 2DE6D 1FQTA 3GB4A 3L73E 1SQBE 3N0QA 5AEUA 5KLIC 3D89A 4NBED 4H44D 2BMQA 4P1BH 5KKZC 1EG9A 2NVEA 3H1JE 5CXMA 5BOKA 3VMID 1KYOE 1O7MA 2B1XA 4NB8D 2ZT9D 3CWBE 2HMJA 2FYNC 2NVGA 1UUVA 2ZYLA 1NTME 2A06E 3L72E 1RFSA 2BCCE 4PD4E 4HM2A 3C0DA 2XSOA 3GZYA 1NU1E 3FOUA 1VM9A 4H0LD 2HMOA 1PPJE 2XSHA 3L75E 1KB9E 2E75D 2YVJB 4NBFD 2FYUE 4PV1D 4HM3A 3TGUE 1NTZE 2HMNA 1EZVE 2IBZE 5HL4A 2DE5D 4QCKA 4QUQA 5AEWA 2HMLA 1P84E 4EMJB 1VCKA 3VMHD 2XR8A 2YIUC 3H1LE 4QDFB 1ULIA 4NBAD 1L0LE 2JO6A 3EQQA 2BMOA 3VMGD 3H1KE 3AZCA 1PP9E 4OGQD 1SQXE 4U3FE 4HM0A 2CKFA 4D6TE 4QDDA 1NTKE 2E4QA 3VCPA 1O7NA 1O7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H A;  4HM7 A;  2HMM A;  5KLV E;  2NUK A;  3EN1 A;  4P1C H;  4NB9 D;  3L70 E;  1BGY E;  4QUR A;  4NBB D;  3CXH E;  2E4P A;  2XRX A;  4HM6 A;  1G8J B;  1G8K B;  3GL2 A;  4NBC D;  2QJP C;  4NBH D;  2NWF A;  3H1H E;  4QDC A;  2QJK C;  2YFI A;  3H1I E;  1SJG A;  2Q3W A;  4QDF A;  2YFJ A;  1L0N E;  4NBG D;  4H13 D;  2DE7 D;  4QUP A;  2GBX A;  1JM1 A;  3GTE A;  2GBW A;  3GKE A;  1ZRT E;  2E76 D;  1BCC E;  1UUW A;  4AAY B;  1NDO A;  2NVF A;  2YFL A;  3L74 E;  2BMR A;  2QPZ A;  2B24 A;  1VF5 D;  4HKV A;  3GTS A;  3GL0 A;  4HM4 A;  1WQL A;  2HMK A;  2QJY C;  3VCA A;  1SQQ E;  1NYK A;  4HJL A;  4AIV A;  1SQV E;  2E74 D;  4NBD D;  3DQY A;  1O7W A;  3L71 E;  1O7P A;  1Q90 C;  1SQP E;  1RIE A;  3GZX A;  4HM8 A;  3GOB A;  2I7F A;  2JZA A;  3GCE A;  3BCC E;  4HM5 A;  3CX5 E;  1ULJ A;  2D2C D;  2NUM A;  4HM1 A;  1BE3 E;  2DE6 D;  1FQT A;  3GB4 A;  3L73 E;  1SQB E;  3N0Q A;  5AEU A;  5KLI C;  3D89 A;  4NBE D;  4H44 D;  2BMQ A;  4P1B H;  5KKZ C;  1EG9 A;  2NVE A;  3H1J E;  5CXM A;  5BOK A;  3VMI D;  1KYO E;  1O7M A;  2B1X A;  4NB8 D;  2ZT9 D;  3CWB E;  2HMJ A;  2FYN C;  2NVG A;  1UUV A;  2ZYL A;  1NTM E;  2A06 E;  3L72 E;  1RFS A;  2BCC E;  4PD4 E;  4HM2 A;  3C0D A;  2XSO A;  3GZY A;  1NU1 E;  3FOU A;  1VM9 A;  4H0L D;  2HMO A;  1PPJ E;  2XSH A;  3L75 E;  1KB9 E;  2E75 D;  2YVJ B;  4NBF D;  2FYU E;  4PV1 D;  4HM3 A;  3TGU E;  1NTZ E;  2HMN A;  1EZV E;  2IBZ E;  5HL4 A;  2DE5 D;  4QCK A;  4QUQ A;  5AEW A;  2HML A;  1P84 E;  4EMJ B;  1VCK A;  3VMH D;  2XR8 A;  2YIU C;  3H1L E;  4QDF B;  1ULI A;  4NBA D;  1L0L E;  2JO6 A;  3EQQ A;  2BMO A;  3VMG D;  3H1K E;  3AZC A;  1PP9 E;  4OGQ D;  1SQX E;  4U3F E;  4HM0 A;  2CKF A;  4D6T E;  4QDD A;  1NTK E;  2E4Q A;  3VCP A;  1O7N A;  1O7G A; 
#chains in the Genus database with same CATH topology
 4OWF A;  1LTS C;  1N7S D;  3A2A A;  2E75 B;  5GTH E;  2M3B A;  2NWF A;  3BAS A;  2K88 A;  1Y47 A;  2N9Y B;  1YQ4 C;  1JTH A;  1LTI C;  2W90 A;  4OH8 B;  2QA4 P;  2LR2 A;  1KC8 Q;  1H89 A;  3A5T A;  1JMB A;  2WPQ A;  3M9B A;  2M8R A;  4L76 A;  5KAF E;  1QGK B;  1IO4 A;  2HFE D;  1HJB A;  3C8V A;  1EQ7 A;  4D6T G;  2E74 D;  3PP5 A;  3IF4 A;  5AW6 B;  1WRG A;  4WY4 A;  3V4Q A;  2OYO A;  1M57 D;  3R4Y A;  1BE3 J;  1Q2N A;  1LWU A;  1DIP A;  2A45 G;  1L4A A;  1PIX A;  2ZYD A;  1T2K C;  1P84 D;  4DT0 A;  2A45 I;  2K3R A;  4PD4 H;  2XU6 A;  4H0L D;  4U3F D;  1VDF A;  1FOS E;  3B5N B;  2Q5U A;  2FYU J;  3VMA A;  1VQ6 P;  3FX0 A;  3TGU J;  1FOS F;  3PJS K;  4LLH A;  4QDF B;  3AE1 C;  2P7J A;  3GF7 A;  4GDO A;  3H1L J;  2P10 A;  1E5W A;  4EIJ A;  4IFF A;  1L0N D;  4BRY A;  1O7H A;  3JSV C;  2HMM A;  1BDC A;  4P1C H;  3A0H H;  2NUK A;  2OGU A;  2NZ2 A;  2KK7 A;  4NBC D;  1Y8A A;  4NPF X;  4NBH D;  3RBX A;  1NU1 G;  2ZAE B;  1RQV A;  5AVR B;  1G2C B;  2M0B A;  2D2C C;  1NAY A;  3H1H J;  5BU5 A;  2Z4E A;  1K04 A;  4WVZ A;  4R4M A;  3VMY A;  1VQN P;  1JM1 A;  2KS1 B;  1FZG A;  3CCM P;  1UUW A;  2M5A B;  1OXZ A;  1X0T A;  2BMR A;  3EQ2 A;  1SQB D;  4CPG A;  1MV8 A;  4PV1 B;  3TYY A;  3H32 B;  4RKU J;  5B5E H;  3K5B A;  2W6A A;  4YXW H;  3D70 A;  2V4H A;  3VCA A;  3L75 G;  1SQV E;  1FS0 E;  2O1K A;  1Q90 C;  4IL6 H;  2BCC D;  1Z56 A;  3JCU E;  3CX5 E;  3GG2 A;  2OYI A;  2KOG A;  2KUB A;  1H8A A;  1NWQ A;  4H13 C;  4OGQ C;  5AW0 B;  5CXM A;  3H1J J;  3L72 E;  1RFS A;  3RK2 D;  1VQ9 P;  3H1K D;  3SWK A;  1PP9 D;  2QVA A;  3SFE C;  3CXH I;  1KB9 H;  2KI7 B;  5TJH A;  4I1L A;  1LT1 A;  5KLV D;  3D71 A;  1KIL C;  3LW5 H;  4QUQ A;  3AEG C;  3VMH D;  1FU1 A;  1BE3 G;  1EXJ A;  2OYH B;  1N86 A;  3OJA B;  2K9J A;  1OVR A;  1RF1 B;  1VF5 C;  1U57 A;  4HM7 A;  1ZN5 A;  4GOE A;  3AEB C;  2HPC A;  1IK7 A;  1S5L X;  4ZNC A;  4NPE A;  1KD1 Q;  5CCG D;  1SQV K;  1FZE A;  3RK3 C;  2FYU G;  3M0D C;  2KLV A;  2WSE H;  3TGU G;  3VYI A;  2WZ7 A;  1EZV G;  2IBZ G;  4NBG D;  1IFD A;  1EZV I;  2IBZ I;  3VN0 A;  1GL2 C;  2LXC B;  3H1L G;  1X9V A;  3HTK B;  4XE5 B;  3T97 A;  3GTS A;  3GL0 A;  3BVH A;  3B8E B;  3AEC C;  1GMJ A;  3NFQ A;  4RJT A;  1CZQ A;  1LT9 A;  1RIE A;  2Y9Y A;  4PD4 D;  3AE2 C;  3H1H G;  2O01 N;  2QM7 A;  1FJK A;  1CI6 A;  1LWU C;  4N78 D;  2G8Y A;  1L2P A;  2JEE A;  4UB6 H;  1H88 A;  1L4A C;  4NB8 D;  3CWB E;  2FYN C;  2NVG A;  1NGM B;  1JY2 P;  2QG4 A;  3AEF C;  2Q1K A;  1M1J B;  2E75 D;  3HE4 A;  4HKZ H;  2YMK A;  2G3A A;  1KOR A;  1OVU A;  5M1B A;  5AEW A;  3CCV P;  3NTN A;  1AQ5 A;  4NBA D;  1VQP P;  2E76 C;  2CK3 H;  4UB8 E;  3L36 A;  3H1J G;  4JPZ B;  3RL0 g;  3HD7 C;  2NRG A;  3EFG A;  1NTK J;  2A06 G;  2JWD A;  5E79 H;  1N73 B;  4W80 A;  1GW4 A;  1VQL P;  3IFM A;  5AW4 B;  1PV3 A;  3L35 A;  2WPR A;  4KHX A;  1VQM P;  4QUP A;  3CPW O;  1JCD A;  1T3J A;  3P8C D;  4H0L B;  3CCQ P;  3AE6 C;  3L74 J;  2HMK A;  4Z1M H;  3GHG B;  5AW2 B;  1SQQ J;  3WU2 E;  1A02 J;  3MHV A;  2QEX P;  1D7M A;  3BCC E;  4HM5 A;  1NOH A;  3M9Q A;  5APW A;  1KB9 D;  1QL2 A;  2K1A A;  4WWI A;  3L73 E;  1RE4 C;  4NBE D;  1KYO H;  1LTJ B;  3FXE A;  2MJZ A;  3B71 A;  1LJ2 A;  1S3J A;  2YKP A;  1EC5 A;  1IC2 A;  1NTM J;  2R44 A;  5K5G B;  3M0A A;  3SWY A;  4AQR D;  1PGP A;  1S9K D;  1YJ9 P;  4HM3 A;  1NTZ E;  2QRX A;  2KNC A;  3MTU E;  1BGY D;  1WMK A;  1OFC X;  2NPS D;  3VMZ A;  4XFJ A;  3BAT A;  1NHL A;  1ULI A;  1FZA A;  1L0L E;  1LGH B;  3GF3 A;  1YTZ I;  1Q86 Q;  4C7N B;  2SPZ A;  2OYI B;  1YTZ T;  2YKO A;  2N1T C;  2E4Q A;  1FAV A;  2XKM A;  3UIA A;  3O6Q A;  4PJ0 H;  2LXB A;  3TSI A;  1IFN A;  3GL2 A;  2QJP C;  2R3C A;  2P58 A;  1ZR4 A;  1IFI A;  1SJG A;  1VQ5 P;  3H1I J;  1HVV A;  4GKG A;  4I6M C;  3RK2 B;  2YXQ B;  1YI2 P;  5AVU B;  2ZVN B;  1EXI A;  4HM4 A;  1QVG O;  1NTK G;  2OAR A;  1USD A;  4Y99 B;  3L71 J;  3VTP C;  3GOB A;  1IFM A;  2JZA A;  1SQP J;  2BEQ D;  1AVO A;  1M1K Q;  4HM1 A;  5CMZ A;  3II6 A;  1NTZ K;  1FQT A;  2E5T A;  2FFD B;  3G4S P;  4C46 A;  1R5S A;  1RQU A;  3FXD A;  4BWN A;  5KKZ C;  3AE3 C;  2WSS H;  1L0L K;  4AUW A;  3A0B E;  1EDL A;  1S2E A;  3L74 G;  3U1C A;  3HE5 A;  4MN4 C;  4D6T D;  2HYN A;  3L75 E;  1SQQ G;  1OIP A;  1OMI A;  2Y0C A;  5AW3 B;  5HL4 A;  2O1J A;  2P2U A;  1P84 E;  2XR8 A;  5APU A;  2QSI A;  1HGV A;  1USE A;  4U3F E;  3E1R A;  2W83 C;  1SQX J;  2PGD A;  5TIS H;  3VCP A;  1VQ4 P;  1JCC A;  2IZ0 A;  1NTM G;  3CXH E;  2E4P A;  2B9B A;  3L70 J;  1G8K B;  4IFD K;  1QVF O;  5EFW B;  1QEX A;  3VMX A;  2JP3 A;  3H25 A;  1L0N E;  1RF0 C;  2XV5 A;  2HOD A;  3GKE A;  3D6Z A;  2YFL A;  1BCC J;  1BSH A;  3M0D A;  3RL0 B;  4AIV A;  1X22 A;  1YYC A;  1GL2 A;  2XNX A;  2FXO A;  1NU1 D;  5APT A;  2YIU B;  1SQB E;  2RKL A;  2AXT H;  5KLI C;  3S4R A;  4WY4 D;  2JWA A;  5BOK A;  3P32 A;  1N7S A;  3WUT A;  3A7O A;  5KAI E;  1NVO A;  2Q3I A;  4WB4 A;  2BCC E;  3FOU A;  1VM9 A;  1SFC B;  1K9M Q;  2YNY A;  4TT3 H;  3L75 D;  3L71 G;  2B87 B;  1OX3 A;  3CLQ A;  4ASV A;  1SQP G;  3B5N C;  2I1J A;  2WSC H;  1L0N K;  2PAJ A;  3H1K E;  3AZC A;  1PP9 E;  4ASW A;  2VRS A;  1LP1 A;  5KJ7 D;  1OVV A;  1JY2 O;  2K37 A;  1KQS O;  5KLV E;  3EN1 A;  1FZF A;  2FBW C;  3CXH D;  3P8M C;  1QL1 A;  4JYC A;  1OW7 A;  2H8P D;  2YXR B;  3CX5 H;  2DE7 D;  4W7Y A;  3HD7 A;  1KQL A;  2GBX A;  1BE3 D;  1SQB K;  3CCL P;  3CL3 D;  4R4L A;  2NVF A;  1KYO I;  2QPZ A;  3HUS C;  1SQX G;  1K05 A;  2PP6 A;  3AED C;  4HJL A;  4PV1 C;  5AW8 B;  1O7W A;  1URQ C;  1IK9 A;  3L70 G;  2NPS B;  3PRJ A;  2N9B A;  1YQ3 C;  1G1I A;  2FYU D;  4DJG A;  1KZU B;  3N0Q A;  3TGU D;  3M06 A;  4H44 D;  1EZV D;  1IJD B;  2B88 A;  2IBZ D;  5APS A;  3H1L D;  1BCC G;  1UUV A;  2Z5I A;  2WT7 B;  4PD4 E;  1H0T A;  2ZVO B;  1PGJ A;  5KLV K;  1RE4 A;  2D2C B;  1LTA C;  2GM4 A;  2DE5 D;  1JUN A;  4HYT B;  2AEJ A;  4N78 E;  3H1H D;  3CCS P;  1UIX A;  2ZYG A;  3I55 P;  2KSE A;  2OYH C;  3C9I A;  4NPD A;  2XZR A;  1RF1 C;  1ZRT D;  4QUR A;  3FWN A;  2IYP A;  2XRX A;  4BXL A;  3OAK A;  3TDK A;  2KSJ A;  2OTK E;  2POH A;  2FKW B;  1PPJ G;  1AQT A;  4DZO A;  3Q3D A;  1QLE D;  2WSC J;  4K35 A;  4LGD E;  3KQG A;  2N1T A;  3KDP B;  2JDI H;  4OGQ B;  5H2F H;  1CW5 A;  2I8D A;  5CCH D;  3V4W A;  1WQL A;  3H1J D;  3KPE A;  4NBD D;  2PFX A;  3CME P;  5B66 E;  1SQV J;  2A06 D;  1KIL B;  4IL6 E;  5CJ0 A;  2HG5 D;  3RBZ A;  1J1D B;  1JM0 A;  3P8C E;  3H6P A;  3FGA D;  1YJN P;  1VF5 B;  2J5U A;  2ZT9 D;  4EOT A;  4UB8 H;  1MKM A;  1N7S C;  3L72 J;  3GZY A;  4HJG H;  1Q82 Q;  3ZDM A;  1X8Y A;  1KB9 E;  2KP8 A;  3NXS A;  1M1J C;  4EYY Q;  3G9R A;  2HMN A;  3RK3 B;  3D6Y A;  1XTG B;  3MUD C;  1JTH B;  3CCR P;  2XDJ A;  1N7L A;  2O3J A;  3A3Y B;  1OW6 A;  1PL5 A;  3V2R A;  3F89 A;  3G3Z A;  3KZI H;  5AVX B;  4QDD A;  1ZME C;  1R8E A;  1GZL A;  4O9B A;  1S9K E;  1S4X A;  1NO4 A;  2H88 C;  2E74 C;  2IDB A;  1BGY E;  4NBB D;  2WPV B;  3F5H A;  3RL0 D;  3IN6 A;  2KZI A;  2OTJ P;  1DEB A;  1JY3 P;  1N73 C;  4WY4 B;  2QJK C;  2YO2 A;  1M56 D;  1J2J B;  1JEK A;  3E7K A;  1GK4 A;  3N7N A;  1S5L H;  1LWU B;  1N8R Q;  1FZC A;  1L4A B;  4HKV A;  3C1L A;  3O8Z A;  1NYH A;  1JB0 J;  4H0L C;  3USS A;  1MUU A;  3CC7 P;  5GTI H;  1SFC D;  4HM8 A;  1RF0 A;  3GHG C;  5AW9 B;  3MD0 A;  2NUM A;  1MFZ A;  1J1E C;  3AE7 C;  5AEU A;  1JY2 N;  2E76 B;  1VQ7 P;  3GMA A;  3VMI D;  4UB6 E;  3CWB J;  4BRY B;  4I7Z B;  4HM2 A;  2C9L Y;  1ZXG A;  5AVV B;  1NTK D;  1KN7 A;  2M3E A;  1RH5 B;  1JY3 N;  1SQV G;  5CBO A;  4RES B;  4KT0 J;  1FBM A;  3SSU A;  3MZW B;  3CI9 A;  3CX5 I;  2JO6 A;  2BMO A;  1FE6 A;  1U7M A;  1T2K D;  4HM0 A;  3IR9 A;  2UWJ E;  4D6T E;  1DH3 A;  3LIE A;  1U7J A;  2WQY C;  3B5N A;  2GA1 A;  3L72 G;  3L74 D;  1KFM A;  3V2P A;  1G8J B;  1QX8 A;  5E79 E;  1M8O B;  4IFM A;  2K9Y A;  1KIL E;  2KZJ A;  4H44 B;  3WMM 0;  5CJ4 A;  1SQQ D;  1H0T B;  4EI2 A;  1AV1 A;  4QDF A;  1NJI Q;  5AVQ B;  1CSB A;  2WMM A;  1S72 P;  1BSN A;  3MGN A;  3RK2 C;  1JOC A;  2QJY C;  2V7Q J;  4GIF A;  1DEE G;  3MP7 B;  2GUV A;  1G2C A;  1VQO P;  1NTM D;  3L4F A;  2D2C D;  3BCC J;  4N6J A;  1FDO A;  3HUS A;  1P84 H;  3L73 J;  2M5A A;  2C0X A;  2FFD C;  1KYO E;  3H32 A;  2K9J B;  1URQ A;  5L8R J;  4B86 A;  3W68 A;  1NU1 E;  5CCG C;  2HPC B;  1KQF B;  1Q90 D;  2YMY A;  4IOI H;  1KV4 A;  2IPP A;  4HB1 A;  2R5B A;  2WSF H;  1NTZ J;  1Y9B A;  2KLU A;  1VCK A;  3G6E P;  1VQK P;  1Q81 Q;  2J59 M;  3VMG D;  1L0L J;  1SVF A;  4OGQ D;  5AW7 B;  3T97 B;  4GT1 A;  3I5C A;  4QMA A;  1FJP A;  3CWB G;  2BEZ F;  4NB9 D;  5GTH H;  4HM6 A;  4PJ0 E;  4GOD A;  1LT9 B;  1GTW A;  3EFF K;  4XA4 A;  1NAF A;  1KIL D;  2YFI A;  4YTP C;  3L71 D;  2R32 A;  2ZT9 B;  1SQP D;  2OYH A;  5DJT B;  1CI6 B;  1VL2 A;  5KAF H;  1RF1 A;  1KTM A;  1NDO A;  2E5Y A;  2DW3 A;  1VF5 D;  1FZC C;  1N2D C;  5AVW B;  2E75 C;  4JQ0 D;  1AFO A;  2RMZ A;  4A7P A;  3HE4 B;  1NU1 K;  3CCU P;  2Y9Z A;  3RK3 D;  3PHL A;  1BE3 E;  1YJW P;  2O01 J;  1MFT A;  1ZR2 A;  4YXD C;  3HTK A;  1HUC A;  1GL2 D;  3KYQ A;  1MZ9 A;  2HMJ A;  1KYO D;  3V2Q A;  4M3L A;  1T3U A;  4W7Z A;  1R5L A;  1SQX D;  2FYU E;  1NH4 A;  2WPS A;  3L75 J;  3TGU E;  3L37 A;  2JKV A;  1AA0 A;  3L70 D;  1SFC C;  1EZV E;  3H1I G;  2IBZ E;  2L91 A;  3BCC G;  2WTY A;  3H1L E;  1GU4 A;  3L73 G;  3EQQ A;  2IFN A;  3U59 A;  4U7J A;  1L4A D;  4U3F J;  1M1J A;  5TIS E;  5APV A;  2FY8 A;  1BCC D;  3KHU A;  4I2L C;  2ZYA A;  3MUD A;  1BDD A;  2BAS A;  1SP4 A;  3AE9 C;  3Q5P A;  3H1H E;  2WSF J;  1AJY A;  2JR8 A;  1NTZ G;  2Q3W A;  2KYV A;  3QH9 A;  2W27 A;  5KLI B;  2CPS A;  2IZ1 A;  1L0N J;  1S1C X;  1HGZ A;  2GBW A;  1G1J A;  1ZRT E;  2E76 D;  1ZOY C;  4AAY B;  1L0L G;  4IL6 X;  2B24 A;  3HD7 D;  3AE8 C;  1N73 A;  3BRT B;  5CHX A;  2LKM A;  1IZN B;  2RH0 A;  3M9H A;  2W8Z A;  2Q6Q A;  3JCU H;  4L75 A;  2P1J A;  5APQ A;  1GW3 A;  1JY3 O;  1KFN A;  1ULJ A;  2FYU K;  2KNC B;  3WUU A;  2NPS C;  1PPJ D;  3S1K A;  1T6A A;  4HH2 A;  3D89 A;  2AXT E;  3TF5 A;  1SQB J;  4P1B H;  1LTG C;  5KJ7 A;  3H1J E;  1K73 Q;  1TU3 F;  2A06 E;  2QIW A;  5AW5 B;  3GHG A;  4JF7 A;  2IX7 C;  2BCC J;  3O6Q B;  2HMO A;  3AEE C;  4NBF D;  2ZXX A;  2XND H;  2AEF A;  3VP8 A;  4QCK A;  2HML A;  1XTC C;  2R5D A;  3ITK A;  1LTT C;  4L73 A;  1PZQ A;  1LTJ A;  5AVS B;  3W67 A;  3I56 P;  1W5C E;  1RY3 A;  2I1K A;  3H1K J;  2CKF A;  1PP9 J;  3HUS B;  3FWL A;  5KLV J;  1URQ B;  3N4X A;  3LID A;  2IFM A;  3V2N A;  5B66 H;  3P7K A;  4ZKP A;  1RE3 C;  1HF9 A;  2P67 A;  2MKV A;  3MIW A;  1ZLL A;  2C0W A;  4C7N A;  1YHQ P;  1P84 I;  1SLQ A;  1LNQ A;  3A0H E;  1E79 H;  3RGU A;  2N1T D;  4U3F G;  4OVN F;  3HE5 B;  3PLN A;  3S9O A;  1W2B O;  2C9N Y;  1DX7 A;  5AVY B;  1YIT P;  1DD3 A;  2DE6 D;  4ZKU A;  4H13 B;  2H89 C;  4TLF A;  3VOP A;  1LTB C;  1PFI A;  1J1D C;  1L0N G;  1GDT A;  5B5E E;  1O7M A;  2B1X A;  2FXP A;  3M91 A;  4WBA A;  2XSH A;  2KIK A;  1HJ0 A;  1JO5 A;  1M90 Q;  2FFD A;  4EMJ B;  3V6I A;  3WUV A;  3SWF A;  1M7L A;  1IFJ A;  1YIJ P;  1SQB G;  5CCH A;  2HOD B;  2H43 A;  5CCG A;  1OW8 A;  1NTK E;  4ZMD A;  3TNU A;  3OW2 O;  2BCC G;  5AVT B;  3CC4 P;  2AEM A;  3V5B A;  1HWT C;  2HLO A;  1SQV D;  1GL2 B;  2WWW A;  1GD2 E;  4WY4 C;  1HBW A;  3CX5 D;  5H2F E;  2ZFC A;  3L74 E;  3H1K G;  2V7Q H;  5C39 A;  1PP9 G;  1Q7Y Q;  1N7S B;  1SQQ E;  3WU2 H;  1K8A Q;  5KLV G;  3PH0 A;  3IAO A;  3L72 D;  2B89 A;  3GCE A;  1A02 F;  2YKQ A;  1OZH A;  4K3A A;  1WT6 A;  2FYN B;  1ZP0 C;  2NVE A;  2ZJS E;  1JNM A;  5KJ7 C;  3NMD A;  1NTM E;  1JMM A;  1LP1 B;  2E74 B;  1NTK K;  3C0D A;  3AEA C;  1NKN A;  4I7Z C;  4JYB A;  5BU8 B;  2QJK B;  2E43 A;  1YBK A;  1NKZ B;  3Q2Y A;  2Z5H A;  3LW5 J;  1T8Z A;  3AE4 C;  3HD7 B;  3SFD C;  2A45 H;  1IFP A;  5AW1 B;  3U1A A;  5APY A;  1FDM A;  1LTJ C;  3KZI E;  1EDK A;  1O7N A;  1KQG B;  1HTL C;  1VPC A;  2YO3 A;  1SFC A;  2JJL A;  2PRR A;  1BGY J;  3G71 P;  2Q7C A;  1HH0 A;  1EDJ A;  1SQQ K;  2B87 A;  5BVZ A;  2QE7 H;  4PD4 I;  4QDC A;  4GOF A;  3H1I E;  4AYC A;  1J1E B;  2W6J H;  3B5N D;  3BRV B;  2WSE J;  4H44 C;  3HRN A;  3GW6 A;  1S5L E;  2OYI C;  2QM8 A;  1FZB A;  5APX A;  3CMA P;  3QWO C;  3B4S A;  5KTB A;  1NYK A;  1NTM K;  3DQY A;  3CWB D;  3L71 E;  1OWA A;  1SQP E;  5GTI E;  3GZX A;  1ZW0 A;  3Q5S A;  4L74 A;  2I7F A;  2KB7 P;  2O01 H;  1UII A;  3GB4 A;  1PGQ A;  3EWK A;  2Q9I A;  1X79 B;  4DOJ A;  3CC2 P;  2BMQ A;  4C7R A;  2RN0 A;  3A0B H;  2E42 A;  2WVR A;  1FDI A;  5CBN A;  2XSO A;  3RK3 E;  2Y0E A;  2Y0D A;  2NPS A;  4Y99 C;  4PV1 D;  2YVJ B;  1URQ D;  2KS1 A;  1VQ8 P;  2GUS A;  2ZXE B;  2FYZ A;  3R2P A;  2WIT A;  2Q3E A;  2W6B A;  3GLM A;  1RHZ B;  3TK1 A;  2N1T B;  3CD6 P;  2L5G B;  1SQX E;  5CCH C;  4KJM A;  2OQQ A;  2WT7 A;  5DJU B;  4N3Y B;  4D6T J;  1O7G A;  3CCE P;  2QJP B;  2QJY B;  3CXH H;  3L70 E;  1EDI A;  1SS1 A;  3Q5R A;  2CPB A;  3CCJ P;  1KB9 I;  1SQP K;  1LT9 C;  2YFJ A;  3H1I D;  4H13 D;  4RO0 A;  4Y28 J;  1KMI Z;  3Q1M A;  3BCC D;  2J58 A;  3GTE A;  1BCC E;  2ZT9 C;  2AXC A;  3L73 D;  3E1I A;  1RE3 A;  3OA7 A;  1O7P A;  1BGY G;  1DD4 A;  1AVY A;  1GK6 A;  3TNU B;  1ZV8 A;  3JC2 2;  4JBZ A;  5KKZ B;  3AE5 C;  1W2E A;  3VP9 A;  2KXP B;  2JO1 A;  1NTZ D;  5AVZ B;  1GU5 A;  3KXD A;  1EG9 A;  2R3S A;  2ITA A;  5KAI H;  2ZYL A;  1L0L D;  4YPC A;  1SQX K;  2OTL P;  2FXM A;  2IYO A;  1PGO A;  3RL0 C;  4LC1 A;  1PPJ E;  1FC2 C;  3PTZ A;  1NU1 J;  2H7H A;  4DCK A;  1KIL A;  4EDF A;  2YIU C;  2HR3 A;  1FZC B;  3ABV C; 
#chains in the Genus database with same CATH homology
 1O7H A;  4HM7 A;  2HMM A;  5KLV E;  2NUK A;  3EN1 A;  4P1C H;  4NB9 D;  3L70 E;  1BGY E;  4QUR A;  4NBB D;  3CXH E;  2E4P A;  2XRX A;  4HM6 A;  1G8J B;  1G8K B;  3GL2 A;  4NBC D;  2QJP C;  4NBH D;  2NWF A;  3H1H E;  4QDC A;  2QJK C;  2YFI A;  3H1I E;  1SJG A;  2Q3W A;  4QDF A;  2YFJ A;  1L0N E;  4NBG D;  4H13 D;  2DE7 D;  4QUP A;  2GBX A;  1JM1 A;  3GTE A;  2GBW A;  3GKE A;  1ZRT E;  2E76 D;  1BCC E;  1UUW A;  4AAY B;  1NDO A;  2NVF A;  2YFL A;  3L74 E;  2BMR A;  2QPZ A;  2B24 A;  1VF5 D;  4HKV A;  3GTS A;  3GL0 A;  4HM4 A;  1WQL A;  2HMK A;  2QJY C;  3VCA A;  1SQQ E;  1NYK A;  4HJL A;  4AIV A;  1SQV E;  2E74 D;  4NBD D;  3DQY A;  1O7W A;  3L71 E;  1O7P A;  1Q90 C;  1SQP E;  1RIE A;  3GZX A;  4HM8 A;  3GOB A;  2I7F A;  2JZA A;  3GCE A;  3BCC E;  4HM5 A;  3CX5 E;  1ULJ A;  2D2C D;  2NUM A;  4HM1 A;  1BE3 E;  2DE6 D;  1FQT A;  3GB4 A;  3L73 E;  1SQB E;  3N0Q A;  5AEU A;  5KLI C;  3D89 A;  4NBE D;  4H44 D;  2BMQ A;  4P1B H;  5KKZ C;  1EG9 A;  2NVE A;  3H1J E;  5CXM A;  5BOK A;  3VMI D;  1KYO E;  1O7M A;  2B1X A;  4NB8 D;  2ZT9 D;  3CWB E;  2HMJ A;  2FYN C;  2NVG A;  1UUV A;  2ZYL A;  1NTM E;  2A06 E;  3L72 E;  1RFS A;  2BCC E;  4PD4 E;  4HM2 A;  3C0D A;  2XSO A;  3GZY A;  1NU1 E;  3FOU A;  1VM9 A;  4H0L D;  2HMO A;  1PPJ E;  2XSH A;  3L75 E;  1KB9 E;  2E75 D;  2YVJ B;  4NBF D;  2FYU E;  4PV1 D;  4HM3 A;  3TGU E;  1NTZ E;  2HMN A;  1EZV E;  2IBZ E;  5HL4 A;  2DE5 D;  4QCK A;  4QUQ A;  5AEW A;  2HML A;  1P84 E;  4EMJ B;  1VCK A;  3VMH D;  2XR8 A;  2YIU C;  3H1L E;  4QDF B;  1ULI A;  4NBA D;  1L0L E;  2JO6 A;  3EQQ A;  2BMO A;  3VMG D;  3H1K E;  3AZC A;  1PP9 E;  4OGQ D;  1SQX E;  4U3F E;  4HM0 A;  2CKF A;  4D6T E;  4QDD A;  1NTK E;  2E4Q A;  3VCP A;  1O7N A;  1O7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...