1L0LE

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 28
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1l0lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1l0lE02
3H1KE 1O7GA 3GL2A 4HM0A 1O7HA 3DQYA 1NTME 4NBFD 3H1JE 3CXHE 1BGYE 3L71E 2NWFA 2A06E 1SQVE 1UUWA 1G8JB 4HM3A 5AEUA 2FYUE 4QDCA 1FQTA 3H1HE 1NYKA 5CXMA 1KB9E 4AIVA 2FYNC 2NUKA 1SQQE 2YIUC 2E74D 4QCKA 2GBXA 1NDOA 3VCAA 1NU1E 3GZYA 2E75D 3CWBE 4HJLA 2JO6A 2HMJA 4H0LD 4HM6A 4NBGD 1PP9E 1UUVA 4H13D 3L72E 4P1BH 1SJGA 1EZVE 1VM9A 3GB4A 3AZCA 4QUQA 3GL0A 1BCCE 3GKEA 3BCCE 4HM2A 1NTKE 1JM1A 3EN1A 1EG9A 3L73E 1O7WA 2BMOA 2HMNA 5AEWA 2NVGA 1ULJA 2NVFA 4HM5A 4NBED 1L0LE 2YFLA 2NUMA 4PV1D 3GTEA 4NBHD 2Q3WA 1ZRTE 4U3FE 1RIEA 4NBAD 1KYOE 5BOKA 2XR8A 2HMMA 4H44D 4AAYB 4NB9D 2ZT9D 1SQPE 3TGUE 4EMJB 2BMRA 4PD4E 2QPZA 1VF5D 3GCEA 5KLIC 3VMID 2B24A 2QJPC 4NBDD 2DE6D 1P84E 3H1LE 1ULIA 4HM8A 1PPJE 2HMKA 4NBBD 5HL4A 4NBCD 1O7NA 4HM7A 1WQLA 4QUPA 3VMHD 3GTSA 4QDFA 2D2CD 4HKVA 3EQQA 3L75E 2BMQA 1NTZE 1L0NE 2YVJB 2ZYLA 4HM1A 2I7FA 5KKZC 2DE5D 3FOUA 3C0DA 2XSOA 3CX5E 4NB8D 3VMGD 1RFSA 3GZXA 4QURA 2YFIA 2XRXA 2YFJA 4QDDA 4P1CH 3N0QA 4HM4A 1SQXE 5KLVE 2E4QA 2BCCE 2NVEA 2QJKC 3L70E 3VCPA 1G8KB 4OGQD 1Q90C 1O7PA 2HMLA 4QDFB 2IBZE 2HMOA 2QJYC 1BE3E 1VCKA 1O7MA 2DE7D 2CKFA 2JZAA 4D6TE 3L74E 2GBWA 3GOBA 2XSHA 1SQBE 3H1IE 2E4PA 2E76D 3D89A 2B1XA
chains in the Genus database with same CATH superfamily
5KKZB 2FYZA 2N1TC 4NBFD 2A45H 3H32B 4A7PA 2HG5D 2ZT9B 1FJKA 5APVA 1G8JB 2FYUE 5AVZB 4HKZH 5APUA 5TISH 2PRRA 1VF5C 1Q2NA 1NDOA 3TNUB 3TYYA 3H6PA 3RL0D 5TJHA 1LTJA 1LTGC 1GL2B 4H0LD 3CXHD 1M56D 4I7ZC 5CCHA 3KPEA 1KQGB 2E43A 2M5AA 3M0DA 4H0LC 4IFFA 1AVYA 3S1KA 3S4RA 1KMIZ 5KAIE 2P10A 1NU1J 5BOKA 1FBMA 3WU2H 2Y0EA 2LXBA 2JKVA 1JCDA 5KLIC 1G1JA 3H1ID 4HM8A 1DX7A 3RBZA 4EI2A 1FDMA 3MD0A 4AQRD 3P32A 2LR2A 3VMXA 1AVOA 3H1KD 3U1AA 1WQLA 4XFJA 1SQBJ 1FU1A 4DT0A 1VL2A 1YTZI 3CL3D 4K3AA 2AEMA 1JCCA 5CBNA 2NZ2A 2OGUA 3A0HH 2YFIA 3HRNA 4UB8H 1SQQG 5KLVJ 2W6BA 1L4AD 4HM4A 2A45I 3E1IA 3C1LA 3VCPA 5CCHD 1KTMA 1FZAA 5APTA 4D6TE 1VQOP 3HE4B 4JBZA 3G9RA 1CZQA 5DJUB 1SFCB 3Q1MA 2POHA 2E75B 3CI9A 1KB9H 3KDPB 3AEBC 2RKLA 3GHGB 1L2PA 5CXMA 1LTJC 4AIVA 2O01N 1SQQE 2H88C 1SQPD 2WITA 2WMMA 4C7RA 1S2EA 3VMAA 4U3FJ 3CWBE 2W8ZA 2IZ0A 4GOFA 1UUVA 4C7NB 2HLOA 2FFDA 5CJ4A 3A0BE 3L35A 3L73G 4L74A 2PP6A 2KYVA 2P7JA 1RF0A 2M8RA 1SQPE 2E76C 2D2CC 1JY3N 1VF5D 1LTAC 3OJAB 1S5LH 1IFNA 1L0LD 2W90A 1ULIA 1SQVJ 3M06A 3B5NB 2AXTH 3TSIA 3H25A 1FZFA 1ZMEC 2D2CD 5KLIB 4D6TD 2C0XA 3OW2O 4IOIH 3IN6A 3PHLA 1U7JA 5AW7B 4QDDA 2B87B 2NRGA 5AVYB 2YO3A 1SQXJ 3H1LD 1JB0J 1VQMP 1L4AA 3N7NA 1Q90C 3CD6P 1O7PA 3FWLA 1HTLC 1L0NJ 2FXPA 3CCRP 4N6JA 1YBKA 1WRGA 2J5UA 1A02J 3TNUA 3E7KA 1LTIC 4H13C 1KZUB 4HJGH 2E74D 1DIPA 1X79B 1E79H 3GZYA 4PJ0E 1HF9A 1S3JA 3GF7A 3M0AA 3CCEP 1N73B 3T97B 1PP9E 2IYOA 2OARA 2GUSA 1URQA 3HE5B 2V7QJ 1YITP 1RF1B 1DH3A 1EG9A 4PD4D 3A0HE 1LWUA 5CBOA 1KILA 1KB9D 4NBHD 3MIWA 2IBZI 1BCCD 3H1JD 2VRSA 1ZXGA 3AE8C 2OYIC 3L72D 1TU3F 1GZLA 2YNYA 2QPZA 3BRTB 1N86A 4WY4B 3VYIA 4H13B 5GTIH 2MJZA 4Y99C 2FXMA 4IL6H 1GL2D 4H0LB 2WSEJ 3P8MC 4YXDC 1SQVD 1BGYG 2I7FA 2DE5D 3V2QA 4KT0J 3U59A 2IBZG 3W67A 3MP7B 3O6QA 1SQXD 3AE2C 1FS0E 1EDJA 1OMIA 1YQ3C 2M0BA 3PP5A 3L71E 4HM3A 1PIXA 1J1DB 1NYKA 2E5TA 1RE4A 1HJ0A 3A7OA 1GMJA 1K05A 1EDLA 1FC2C 3L71D 3H1LG 1MUUA 3D71A 3L72E 3CCUP 4PV1B 1SVFA 2WVRA 4Y28J 1FOSE 2YKQA 2IFNA 3SWFA 2O01H 1FZCA 1VQPP 4WY4A 1EZVD 1VQ4P 1RE3A 4NBAD 4LLHA 3LW5J 2Q1KA 2M3BA 4L73A 1QX8A 1DEEG 2L91A 2AEJA 3M91A 2BMRA 5DJTB 5GTIE 2KNCB 2B24A 4XE5B 1LWUB 2QIWA 2ZYAA 3EQ2A 3H1JJ 1G1IA 1NH4A 3OAKA 4HM7A 2G3AA 3FGAD 3AE4C 4WY4C 1OVVA 1GL2C 3P7KA 2L5GB 4QURA 2V7QH 1KFNA 2NPSD 2UWJE 3B8EB 3NXSA 3D6YA 2NPSA 1URQD 1K8AQ 1DD3A 1M1KQ 1HH0A 3M9HA 4N78D 4QMAA 1RF1C 2WSFJ 1Z56A 5AW8B 4Z1MH 1OVRA 1FJPA 5AVWB 3HUSB 2FYNC 1SQVG 1M1JA 4UB8E 4KHXA 1KORA 2BCCD 2JO1A 3HTKA 1HUCA 4WBAA 5E79H 3EFFK 1ZN5A 5E79E 1NAYA 3WUVA 2HMJA 3BATA 3GL0A 1QLED 3L73J 3GKEA 3BCCD 5AW5B 1L0NK 2IDBA 2ITAA 3VMYA 2K1AA 2Q6QA 1H88A 1QVGO 1N7SC 4EIJA 1EQ7A 1GD2E 1JUNA 2Q3WA 1M1JC 1Q86Q 2XU6A 1L0LG 4U3FG 2M3EA 3MTUE 1YJNP 2WSCH 2FYUJ 3M9QA 3SWKA 3L74G 1KILB 4ZKUA 1M57D 4WB4A 1PPJG 4HKVA 1G2CB 1PP9D 1SQQK 3CX5E 3H1HD 1VQ8P 1P84D 4OH8B 2K9JA 2KLUA 1FDIA 1X0TA 3GHGA 2OYHC 2BASA 3CLQA 2IYPA 2N1TA 3L74E 3A5TA 4NPDA 1GW4A 3LW5H 1BGYE 2BEQD 3H1KG 1KV4A 3CXHH 1BE3D 2YIUB 1NTMG 4B86A 4EOTA 4IL6X 3FXEA 1KQFB 1NHLA 3WUUA 2J58A 2JO6A 2R32A 2XNDH 1LGHB 1SLQA 1T3UA 4AYCA 1NOHA 2XKMA 1NU1K 2Y9YA 1JMMA 5C39A 1S1CX 1BCCJ 1U7MA 2QEXP 2LKMA 3L72J 2ZXEB 1NYHA 3AEAC 1L0LE 1CI6B 2XV5A 1AA0A 1PGPA 1LP1B 1PV3A 3H1HJ 3FWNA 3R4YA 2K9YA 1IFJA 1KQLA 1NTZE 2YVJB 4IL6E 2RN0A 1T8ZA 1K9MQ 1N73C 2KIKA 4XA4A 1VQNP 1EDIA 3HUSC 3FOUA 1JY2N 1LT9B 1SP4A 3CXHI 1S72P 5KTBA 2C9LY 3TGUG 3O8ZA 1G8KB 1L4AC 4EDFA 3VN0A 2GA1A 5AW0B 4U3FD 2KZJA 4BRYB 3HD7A 1P84I 1LT9C 1NTME 2XNXA 2ZAEB 3CXHE 1UUWA 2WSCJ 2H7HA 4GIFA 1LJ2A 3KHUA 1RF1A 3A2AA 2GBXA 3VTPC 4PJ0H 1IJDB 2WZ7A 3VCAA 1NTZD 4GODA 1SFCD 2K37A 2R5DA 3AZCA 3VOPA 1J1EC 3BCCE 1EZVG 1SQBD 3BVHA 3B5NC 1BCCG 3CX5H 1GK4A 2OYOA 1BDDA 3RL0g 2YFLA 3V2PA 1NO4A 5KLVD 2M5AB 3F89A 3NMDA 4IFMA 3ABVC 2B9BA 1GU4A 3CC7P 1IZNB 1J2JB 2AEFA 3H1KJ 3GTSA 1MFZA 3SSUA 2JP3A 1KILC 1E5WA 2ZXXA 1L0NE 3L75E 3CCSP 3IF4A 2JR8A 3I56P 2YMKA 1KYOI 3P8CE 3V4WA 1SQBK 2JWDA 1QVFO 1RE4C 3RK2C 2QJKC 2FKWB 1S9KD 1RH5B 4BRYA 1NTMK 4W80A 1GTWA 1NTZJ 4OVNF 1HJBA 1OW8A 3H1IE 1LWUC 4DJGA 3SWYA 3LIDA 1N7SD 5AVTB 1JMBA 1RHZB 3RL0B 1W5CE 1EXJA 1OW6A 2Z5IA 1ZLLA 1K73Q 2E42A 2Y9ZA 4QCKA 1VPCA 3AE9C 5L8RJ 3JSVC 2KB7P 1ZOYC 1L0LJ 3GMAA 3BCCG 2H43A 4P1BH 1EZVE 1KFMA 3VMZA 2ZYDA 1USDA 2AXTE 3LIEA 4HM2A 5APQA 4YPCA 1UIIA 4ZKPA 2SPZA 1M1JB 2P2UA 1SQVK 1CSBA 2IPPA 1W2EA 1N7LA 1HWTC 3WMM0 4AAYB 2CK3H 1SQQJ 3P8CD 1LTTC 5CHXA 4LC1A 3HD7D 5HL4A 4I1LA 1OIPA 3M9BA 2WQYC 3VMHD 2W83C 4D6TJ 2KSEA 1YI2P 2CPBA 2FYUK 1IFDA 4UB6H 1R5LA 2QE7H 1RE3C 3O6QB 3AE5C 4RKUJ 1YJWP 3G4SP 2FXOA 2O1KA 3L70E 1NKZB 4OGQD 2C0WA 3RK2D 1JNMA 2IBZE 2XSHA 2H8PD 1AV1A 1O7HA 3CX5I 2A06E 2GUVA 2IFMA 2KOGA 3BASA 3RK3C 2NUKA 4MN4C 3WUTA 2B89A 3L70G 1IK9A 1DD4A 1VQ5P 4IFDK 3H32A 4NBGD 3B4SA 4GKGA 2WPRA 1KYOD 1GW3A 1NTKJ 1U57A 3L73E 1H0TA 1NJIQ 5EFWB 1ULJA 2D2CB 2NUMA 2Q3IA 1JEKA 1XTGB 3AE1C 1KB9I 5APXA 1HBWA 3V6IA 1N73A 1KILE 1RF0C 3E1RA 5GTHE 1RQUA 4JQ0D 2QG4A 5AW3B 4PV1C 1Q81Q 1H89A 1S5LE 4NBBD 2JJLA 2YMYA 4OWFA 2H89C 4JYCA 1NWQA 1JTHA 1LT1A 5CCGC 1KN7A 1JY2O 2J59M 1LTBC 3CMEP 2OYIB 4GT1A 1NTZK 3MGNA 2N9YB 2MKVA 2QJYC 2LXCB 1A02F 3IR9A 1KQSO 1BE3G 3D89A 2YO2A 2WTYA 1O7GA 3CCJP 2OTLP 2KS1A 3L73D 2NWFA 2FBWC 4I2LC 1FQTA 3KYQA 3PTZA 1JY3O 2OQQA 3L36A 1PP9G 2R5BA 2PFXA 1X9VA 1YHQP 4HJLA 4HM6A 3HE5A 3GB4A 3D6ZA 1OVUA 3CC4P 2WWWA 2PAJA 2BMOA 3H1JG 3GW6A 2YXQB 2B88A 2HODB 4HM5A 1EC5A 4YXWH 3GHGC 2OYHA 3GF3A 3Q5PA 1OW7A 2YKPA 5CCHC 2E75C 5B5EE 4PD4E 3VMID 1FZBA 2OYIA 3M0DC 1QL1A 1KYOH 1QL2A 2XZRA 3K5BA 3FXDA 4ASWA 1FZGA 1VDFA 5CMZA 5KAIH 3C0DA 1MZ9A 3V2NA 2E76B 3A3YB 2CPSA 1IFPA 2NVEA 5B66H 2Q5UA 1NAFA 5BVZA 3NFQA 3S9OA 2OTKE 2QJKB 1SQPK 1OXZA 1BE3E 3KZIE 2CKFA 2R3SA 1T3JA 3L75J 1HGZA 3H1KE 3G3ZA 5AVQB 2HFED 3GL2A 2PGDA 3CCQP 3IFMA 1FE6A 5BU5A 3PH0A 2I8DA 3CPWO 1KILD 2ZVOB 1WT6A 5KAFH 1VQLP 2O1JA 3N4XA 2QRXA 4I7ZB 4TT3H 1OWAA 3BCCJ 3R2PA 1LTJB 3V4QA 1L4AB 4GDOA 4RO0A 4JPZB 2E74B 1DEBA 1Y8AA 4NBED 1J1EB 4W7YA 5M1BA 4ZNCA 1GL2A 1JY2P 1H0TB 3AEFC 1Q90D 3GCEA 2A06D 1PL5A 1Q82Q 2HMKA 1NTZG 3H1IG 2E74C 1M7LA 2RMZA 3L75D 3CWBD 5APYA 1VQ7P 2ZYLA 1NKNA 1ZR4A 1JM0A 1BE3J 4L75A 1XTCC 1QEXA 3JC22 4PD4H 1SQXE 2BCCE 2ZJSE 5KLVG 2JZAA 4H44B 2E4PA 3AE3C 2WSEH 5KJ7D 2FYUG 5KJ7A 4TLFA 1SQVE 3Q2YA 3FX0A 2DW3A 2YIUC 4K35A 4WWIA 3TK1A 3F5HA 1N7SA 1VQKP 1URQC 1SQPG 5CCGA 4R4MA 3AE6C 4L76A 4M3LA 5AW2B 1LNQA 5AVSB 1BCCE 4QUQA 4I6MC 4DZOA 2QSIA 1O7WA 3PJSK 2NVGA 2GM4A 2RH0A 1NTKG 5H2FH 1AFOA 1HVVA 3CWBJ 4U3FE 3CCLP 1PGQA 2ZYGA 2HMMA 1CW5A 2QJPB 2ZT9D 2JDIH 4EMJB 3AECC 1IO4A 1NVOA 1Q7YQ 2K88A 4H44C 1H8AA 1O7NA 4GOEA 2O01J 1SQXK 3L74J 4HM1A 4OGQC 1ZR2A 2XDJA 1AQTA 3KXDA 4WVZA 1L0NG 1YYCA 1IFIA 2BCCG 2KLVA 3VMGD 3GZXA 1LTSC 5GTHH 4P1CH 1AJYA 2V4HA 4QDFB 4JF7A 2KI7B 2DE7D 3GOBA 1J1DC 2B1XA 5AVRB 3G6EP 3DQYA 3L70D 2E5YA 1IC2A 2K9JB 1T2KC 3SFEC 4QDCA 1IFMA 1URQB 2WT7A 3CWBG 5AVUB 3I55P 1PGJA 3MUDC 1NU1E 1G2CA 3USSA 1T2KD 4W7ZA 4O9BA 4OGQB 2I1KA 2WSFH 1JY3P 3L4FA 2P67A 1VM9A 2KXPB 1SQBG 1MKMA 2WT7B 3EFGA 1PPJD 3RK3E 3D70A 1FZCC 5B66E 1NTKE 1JM1A 2YXRB 1JO5A 2ZVNB 2WPQA 1P84H 2KZIA 1X8YA 3ZDMA 4NPEA 2NVFA 2Z4EA 1YIJP 4PV1D 1ZRTE 1FZEA 2NPSC 1ZV8A 1P84E 3TDKA 3G71P 2O3JA 2FYNB 4U7JA 3CX5D 1OZHA 1QGKB 1YTZT 1JTHB 1R8EA 4KJMA 3HTKB 1LP1A 2BMQA 2WSSH 2HYNA 2R44A 1RFSA 3A0BH 2XRXA 3L70J 3RGUA 5TISE 3HUSA 2E4QA 4ZMDA 1KD1Q 3B5NA 3HD7B 5APWA 5AW4B 2HMLA 1GDTA 1GK6A 2QVAA 2KSJA 1ZRTD 3TF5A 3JCUE 1EXIA 2NPSB 3QWOC 1PFIA 3H1JE 1L0LK 3H1LJ 5AEUA 2Y0DA 1KB9E 3TGUJ 1T6AA 3ITKA 1VF5B 1L0ND 1N2DC 2JWAA 4JYBA 1EZVI 2AXCA 3KZIH 1BSHA 4D6TG 3KQGA 3C8VA 5BU8B 1K04A 2OYHB 2WPSA 2HODA 2IZ1A 2QA4P 1CI6A 3CCVP 1RIEA 1SFCA 1KYOE 2YKOA 2KK7A 4NB9D 5H2FE 4DCKA 3RBXA 2QJPC 4NBDD 2DE6D 1VQ6P 3OA7A 5B5EH 3L71J 1JOCA 1MV8A 3L75G 5AW9B 2QJYB 4QUPA 3Q5RA 1M8OB 3H1IJ 3RK2B 3T97A 2JEEA 3L74D 4YTPC 1SFCC 1RQVA 2R3CA 1FAVA 4RJTA 4NB8D 2KP8A 2BCCJ 1PGOA 1UIXA 3N0QA 2ZFCA 3V5BA 1HGVA 3AEGC 1SQQD 1MFTA 2HMOA 3UIAA 2N1TB 1X22A 2KS1B 4HM0A 4ASVA 1SS1A 4HH2A 2HPCA 4DOJA 3I5CA 4Y99B 5KAFE 1AQ5A 3CCMP 4CPGA 2HR3A 2QM8A 2E75D 5KLVK 5K5GB 3V2RA 3IAOA 3TGUD 1W2BO 4H13D 3PRJA 1FDOA 1NTKD 3EN1A 4HYTB 5AEWA 2I1JA 3C9IA 1PP9J 2IBZD 4C46A 2W6JH 4UB6E 1WMKA 1NU1D 3GTEA 3RK3B 2WPVB 3MZWB 4R4LA 3VP9A 3CC2P 2Z5HA 3W68A 4C7NA 3L37A 3VP8A 1SQXG 1OFCX 2FFDC 4LGDE 1R5SA 1S5LX 1NTMJ 3BRVB 3GLMA 4NBCD 3SFDC 2N9BA 2FY8A 2OTJP 4QDFA 3EQQA 4PD4I 1NTKK 3Q3DA 5KKZC 4N78E 5KJ7C 1ZW0A 3AE7C 3RL0C 4BWNA 2YFJA 4HB1A 1BGYD 3B5ND 2BEZF 1M90Q 1EDKA 4BXLA 2FYUD 1VCKA 1O7MA 2HPCB 2GBWA 3HD7C 2E76D 3QH9A 2A06G 1KC8Q 2P58A 1FZCB 4N3YB 2B87A 1OX3A 2QM7A 1BSNA 3GG2A 3H1HE 1USEA 1SQPJ 5APSA 1S4XA 2P1JA 3AEEC 2A45G 1Y9BA 4AUWA 2W27A 1PZQA 1NGMB 1GU5A 1SJGA 1YQ4C 3EWKA 2KNCA 1YJ9P 2HMNA 3L71G 4NPFX 3MHVA 1N8RQ 2ZT9C 3JCUH 2Q3EA 1BDCA 3H1HG 1Y47A 1S9KE 2FFDB 1D7MA 2Q9IA 1IK7A 3Q5SA 4EYYQ 5CJ0A 2XR8A 3B71A 4H44D 2W6AA 3TGUE 3U1CA 1LT9A 2G8YA 2Q7CA 1N7SB 3H1LE 3L72G 1BGYJ 5AW6B 5AVVB 1PPJE 3RK3D 1FOSF 3CMAP 2K3RA 2KUBA 1RY3A 2Y0CA 1NTMD 1VQ9P 3NTNA 2XSOA 3AEDC 3PLNA 2N1TD 2C9NY 4WY4D 5AVXB 5KLVE 3II6A 1ZP0C 5CCGD 1NU1G 3WU2E 3MUDA 5AW1B 2IX7C 3HE4A 1SQBE 4RESB
chains in the Genus database with same CATH topology
3H1KE 1O7GA 3GL2A 4HM0A 1O7HA 3DQYA 1NTME 4NBFD 3H1JE 3CXHE 1BGYE 3L71E 2NWFA 2A06E 1SQVE 1UUWA 1G8JB 4HM3A 5AEUA 2FYUE 4QDCA 1FQTA 3H1HE 1NYKA 5CXMA 1KB9E 4AIVA 2FYNC 2NUKA 1SQQE 2YIUC 2E74D 4QCKA 2GBXA 1NDOA 3VCAA 1NU1E 3GZYA 2E75D 3CWBE 4HJLA 2JO6A 2HMJA 4H0LD 4HM6A 4NBGD 1PP9E 1UUVA 4H13D 3L72E 4P1BH 1SJGA 1EZVE 1VM9A 3GB4A 3AZCA 4QUQA 3GL0A 1BCCE 3GKEA 3BCCE 4HM2A 1NTKE 1JM1A 3EN1A 1EG9A 3L73E 1O7WA 2BMOA 2HMNA 5AEWA 2NVGA 1ULJA 2NVFA 4HM5A 4NBED 1L0LE 2YFLA 2NUMA 4PV1D 3GTEA 4NBHD 2Q3WA 1ZRTE 4U3FE 1RIEA 4NBAD 1KYOE 5BOKA 2XR8A 2HMMA 4H44D 4AAYB 4NB9D 2ZT9D 1SQPE 3TGUE 4EMJB 2BMRA 4PD4E 2QPZA 1VF5D 3GCEA 5KLIC 3VMID 2B24A 2QJPC 4NBDD 2DE6D 1P84E 3H1LE 1ULIA 4HM8A 1PPJE 2HMKA 4NBBD 5HL4A 4NBCD 1O7NA 4HM7A 1WQLA 4QUPA 3VMHD 3GTSA 4QDFA 2D2CD 4HKVA 3EQQA 3L75E 2BMQA 1NTZE 1L0NE 2YVJB 2ZYLA 4HM1A 2I7FA 5KKZC 2DE5D 3FOUA 3C0DA 2XSOA 3CX5E 4NB8D 3VMGD 1RFSA 3GZXA 4QURA 2YFIA 2XRXA 2YFJA 4QDDA 4P1CH 3N0QA 4HM4A 1SQXE 5KLVE 2E4QA 2BCCE 2NVEA 2QJKC 3L70E 3VCPA 1G8KB 4OGQD 1Q90C 1O7PA 2HMLA 4QDFB 2IBZE 2HMOA 2QJYC 1BE3E 1VCKA 1O7MA 2DE7D 2CKFA 2JZAA 4D6TE 3L74E 2GBWA 3GOBA 2XSHA 1SQBE 3H1IE 2E4PA 2E76D 3D89A 2B1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K E;  1O7G A;  3GL2 A;  4HM0 A;  1O7H A;  3DQY A;  1NTM E;  4NBF D;  3H1J E;  3CXH E;  1BGY E;  3L71 E;  2NWF A;  2A06 E;  1SQV E;  1UUW A;  1G8J B;  4HM3 A;  5AEU A;  2FYU E;  4QDC A;  1FQT A;  3H1H E;  1NYK A;  5CXM A;  1KB9 E;  4AIV A;  2FYN C;  2NUK A;  1SQQ E;  2YIU C;  2E74 D;  4QCK A;  2GBX A;  1NDO A;  3VCA A;  1NU1 E;  3GZY A;  2E75 D;  3CWB E;  4HJL A;  2JO6 A;  2HMJ A;  4H0L D;  4HM6 A;  4NBG D;  1PP9 E;  1UUV A;  4H13 D;  3L72 E;  4P1B H;  1SJG A;  1EZV E;  1VM9 A;  3GB4 A;  3AZC A;  4QUQ A;  3GL0 A;  1BCC E;  3GKE A;  3BCC E;  4HM2 A;  1NTK E;  1JM1 A;  3EN1 A;  1EG9 A;  3L73 E;  1O7W A;  2BMO A;  2HMN A;  5AEW A;  2NVG A;  1ULJ A;  2NVF A;  4HM5 A;  4NBE D;  1L0L E;  2YFL A;  2NUM A;  4PV1 D;  3GTE A;  4NBH D;  2Q3W A;  1ZRT E;  4U3F E;  1RIE A;  4NBA D;  1KYO E;  5BOK A;  2XR8 A;  2HMM A;  4H44 D;  4AAY B;  4NB9 D;  2ZT9 D;  1SQP E;  3TGU E;  4EMJ B;  2BMR A;  4PD4 E;  2QPZ A;  1VF5 D;  3GCE A;  5KLI C;  3VMI D;  2B24 A;  2QJP C;  4NBD D;  2DE6 D;  1P84 E;  3H1L E;  1ULI A;  4HM8 A;  1PPJ E;  2HMK A;  4NBB D;  5HL4 A;  4NBC D;  1O7N A;  4HM7 A;  1WQL A;  4QUP A;  3VMH D;  3GTS A;  4QDF A;  2D2C D;  4HKV A;  3EQQ A;  3L75 E;  2BMQ A;  1NTZ E;  1L0N E;  2YVJ B;  2ZYL A;  4HM1 A;  2I7F A;  5KKZ C;  2DE5 D;  3FOU A;  3C0D A;  2XSO A;  3CX5 E;  4NB8 D;  3VMG D;  1RFS A;  3GZX A;  4QUR A;  2YFI A;  2XRX A;  2YFJ A;  4QDD A;  4P1C H;  3N0Q A;  4HM4 A;  1SQX E;  5KLV E;  2E4Q A;  2BCC E;  2NVE A;  2QJK C;  3L70 E;  3VCP A;  1G8K B;  4OGQ D;  1Q90 C;  1O7P A;  2HML A;  4QDF B;  2IBZ E;  2HMO A;  2QJY C;  1BE3 E;  1VCK A;  1O7M A;  2DE7 D;  2CKF A;  2JZA A;  4D6T E;  3L74 E;  2GBW A;  3GOB A;  2XSH A;  1SQB E;  3H1I E;  2E4P A;  2E76 D;  3D89 A;  2B1X A; 
#chains in the Genus database with same CATH topology
 5KKZ B;  2FYZ A;  2N1T C;  4NBF D;  2A45 H;  3H32 B;  4A7P A;  2HG5 D;  2ZT9 B;  1FJK A;  5APV A;  1G8J B;  2FYU E;  5AVZ B;  4HKZ H;  5APU A;  5TIS H;  2PRR A;  1VF5 C;  1Q2N A;  1NDO A;  3TNU B;  3TYY A;  3H6P A;  3RL0 D;  5TJH A;  1LTJ A;  1LTG C;  1GL2 B;  4H0L D;  3CXH D;  1M56 D;  4I7Z C;  5CCH A;  3KPE A;  1KQG B;  2E43 A;  2M5A A;  3M0D A;  4H0L C;  4IFF A;  1AVY A;  3S1K A;  3S4R A;  1KMI Z;  5KAI E;  2P10 A;  1NU1 J;  5BOK A;  1FBM A;  3WU2 H;  2Y0E A;  2LXB A;  2JKV A;  1JCD A;  5KLI C;  1G1J A;  3H1I D;  4HM8 A;  1DX7 A;  3RBZ A;  4EI2 A;  1FDM A;  3MD0 A;  4AQR D;  3P32 A;  2LR2 A;  3VMX A;  1AVO A;  3H1K D;  3U1A A;  1WQL A;  4XFJ A;  1SQB J;  1FU1 A;  4DT0 A;  1VL2 A;  1YTZ I;  3CL3 D;  4K3A A;  2AEM A;  1JCC A;  5CBN A;  2NZ2 A;  2OGU A;  3A0H H;  2YFI A;  3HRN A;  4UB8 H;  1SQQ G;  5KLV J;  2W6B A;  1L4A D;  4HM4 A;  2A45 I;  3E1I A;  3C1L A;  3VCP A;  5CCH D;  1KTM A;  1FZA A;  5APT A;  4D6T E;  1VQO P;  3HE4 B;  4JBZ A;  3G9R A;  1CZQ A;  5DJU B;  1SFC B;  3Q1M A;  2POH A;  2E75 B;  3CI9 A;  1KB9 H;  3KDP B;  3AEB C;  2RKL A;  3GHG B;  1L2P A;  5CXM A;  1LTJ C;  4AIV A;  2O01 N;  1SQQ E;  2H88 C;  1SQP D;  2WIT A;  2WMM A;  4C7R A;  1S2E A;  3VMA A;  4U3F J;  3CWB E;  2W8Z A;  2IZ0 A;  4GOF A;  1UUV A;  4C7N B;  2HLO A;  2FFD A;  5CJ4 A;  3A0B E;  3L35 A;  3L73 G;  4L74 A;  2PP6 A;  2KYV A;  2P7J A;  1RF0 A;  2M8R A;  1SQP E;  2E76 C;  2D2C C;  1JY3 N;  1VF5 D;  1LTA C;  3OJA B;  1S5L H;  1IFN A;  1L0L D;  2W90 A;  1ULI A;  1SQV J;  3M06 A;  3B5N B;  2AXT H;  3TSI A;  3H25 A;  1FZF A;  1ZME C;  2D2C D;  5KLI B;  4D6T D;  2C0X A;  3OW2 O;  4IOI H;  3IN6 A;  3PHL A;  1U7J A;  5AW7 B;  4QDD A;  2B87 B;  2NRG A;  5AVY B;  2YO3 A;  1SQX J;  3H1L D;  1JB0 J;  1VQM P;  1L4A A;  3N7N A;  1Q90 C;  3CD6 P;  1O7P A;  3FWL A;  1HTL C;  1L0N J;  2FXP A;  3CCR P;  4N6J A;  1YBK A;  1WRG A;  2J5U A;  1A02 J;  3TNU A;  3E7K A;  1LTI C;  4H13 C;  1KZU B;  4HJG H;  2E74 D;  1DIP A;  1X79 B;  1E79 H;  3GZY A;  4PJ0 E;  1HF9 A;  1S3J A;  3GF7 A;  3M0A A;  3CCE P;  1N73 B;  3T97 B;  1PP9 E;  2IYO A;  2OAR A;  2GUS A;  1URQ A;  3HE5 B;  2V7Q J;  1YIT P;  1RF1 B;  1DH3 A;  1EG9 A;  4PD4 D;  3A0H E;  1LWU A;  5CBO A;  1KIL A;  1KB9 D;  4NBH D;  3MIW A;  2IBZ I;  1BCC D;  3H1J D;  2VRS A;  1ZXG A;  3AE8 C;  2OYI C;  3L72 D;  1TU3 F;  1GZL A;  2YNY A;  2QPZ A;  3BRT B;  1N86 A;  4WY4 B;  3VYI A;  4H13 B;  5GTI H;  2MJZ A;  4Y99 C;  2FXM A;  4IL6 H;  1GL2 D;  4H0L B;  2WSE J;  3P8M C;  4YXD C;  1SQV D;  1BGY G;  2I7F A;  2DE5 D;  3V2Q A;  4KT0 J;  3U59 A;  2IBZ G;  3W67 A;  3MP7 B;  3O6Q A;  1SQX D;  3AE2 C;  1FS0 E;  1EDJ A;  1OMI A;  1YQ3 C;  2M0B A;  3PP5 A;  3L71 E;  4HM3 A;  1PIX A;  1J1D B;  1NYK A;  2E5T A;  1RE4 A;  1HJ0 A;  3A7O A;  1GMJ A;  1K05 A;  1EDL A;  1FC2 C;  3L71 D;  3H1L G;  1MUU A;  3D71 A;  3L72 E;  3CCU P;  4PV1 B;  1SVF A;  2WVR A;  4Y28 J;  1FOS E;  2YKQ A;  2IFN A;  3SWF A;  2O01 H;  1FZC A;  1VQP P;  4WY4 A;  1EZV D;  1VQ4 P;  1RE3 A;  4NBA D;  4LLH A;  3LW5 J;  2Q1K A;  2M3B A;  4L73 A;  1QX8 A;  1DEE G;  2L91 A;  2AEJ A;  3M91 A;  2BMR A;  5DJT B;  5GTI E;  2KNC B;  2B24 A;  4XE5 B;  1LWU B;  2QIW A;  2ZYA A;  3EQ2 A;  3H1J J;  1G1I A;  1NH4 A;  3OAK A;  4HM7 A;  2G3A A;  3FGA D;  3AE4 C;  4WY4 C;  1OVV A;  1GL2 C;  3P7K A;  2L5G B;  4QUR A;  2V7Q H;  1KFN A;  2NPS D;  2UWJ E;  3B8E B;  3NXS A;  3D6Y A;  2NPS A;  1URQ D;  1K8A Q;  1DD3 A;  1M1K Q;  1HH0 A;  3M9H A;  4N78 D;  4QMA A;  1RF1 C;  2WSF J;  1Z56 A;  5AW8 B;  4Z1M H;  1OVR A;  1FJP A;  5AVW B;  3HUS B;  2FYN C;  1SQV G;  1M1J A;  4UB8 E;  4KHX A;  1KOR A;  2BCC D;  2JO1 A;  3HTK A;  1HUC A;  4WBA A;  5E79 H;  3EFF K;  1ZN5 A;  5E79 E;  1NAY A;  3WUV A;  2HMJ A;  3BAT A;  3GL0 A;  1QLE D;  3L73 J;  3GKE A;  3BCC D;  5AW5 B;  1L0N K;  2IDB A;  2ITA A;  3VMY A;  2K1A A;  2Q6Q A;  1H88 A;  1QVG O;  1N7S C;  4EIJ A;  1EQ7 A;  1GD2 E;  1JUN A;  2Q3W A;  1M1J C;  1Q86 Q;  2XU6 A;  1L0L G;  4U3F G;  2M3E A;  3MTU E;  1YJN P;  2WSC H;  2FYU J;  3M9Q A;  3SWK A;  3L74 G;  1KIL B;  4ZKU A;  1M57 D;  4WB4 A;  1PPJ G;  4HKV A;  1G2C B;  1PP9 D;  1SQQ K;  3CX5 E;  3H1H D;  1VQ8 P;  1P84 D;  4OH8 B;  2K9J A;  2KLU A;  1FDI A;  1X0T A;  3GHG A;  2OYH C;  2BAS A;  3CLQ A;  2IYP A;  2N1T A;  3L74 E;  3A5T A;  4NPD A;  1GW4 A;  3LW5 H;  1BGY E;  2BEQ D;  3H1K G;  1KV4 A;  3CXH H;  1BE3 D;  2YIU B;  1NTM G;  4B86 A;  4EOT A;  4IL6 X;  3FXE A;  1KQF B;  1NHL A;  3WUU A;  2J58 A;  2JO6 A;  2R32 A;  2XND H;  1LGH B;  1SLQ A;  1T3U A;  4AYC A;  1NOH A;  2XKM A;  1NU1 K;  2Y9Y A;  1JMM A;  5C39 A;  1S1C X;  1BCC J;  1U7M A;  2QEX P;  2LKM A;  3L72 J;  2ZXE B;  1NYH A;  3AEA C;  1L0L E;  1CI6 B;  2XV5 A;  1AA0 A;  1PGP A;  1LP1 B;  1PV3 A;  3H1H J;  3FWN A;  3R4Y A;  2K9Y A;  1IFJ A;  1KQL A;  1NTZ E;  2YVJ B;  4IL6 E;  2RN0 A;  1T8Z A;  1K9M Q;  1N73 C;  2KIK A;  4XA4 A;  1VQN P;  1EDI A;  3HUS C;  3FOU A;  1JY2 N;  1LT9 B;  1SP4 A;  3CXH I;  1S72 P;  5KTB A;  2C9L Y;  3TGU G;  3O8Z A;  1G8K B;  1L4A C;  4EDF A;  3VN0 A;  2GA1 A;  5AW0 B;  4U3F D;  2KZJ A;  4BRY B;  3HD7 A;  1P84 I;  1LT9 C;  1NTM E;  2XNX A;  2ZAE B;  3CXH E;  1UUW A;  2WSC J;  2H7H A;  4GIF A;  1LJ2 A;  3KHU A;  1RF1 A;  3A2A A;  2GBX A;  3VTP C;  4PJ0 H;  1IJD B;  2WZ7 A;  3VCA A;  1NTZ D;  4GOD A;  1SFC D;  2K37 A;  2R5D A;  3AZC A;  3VOP A;  1J1E C;  3BCC E;  1EZV G;  1SQB D;  3BVH A;  3B5N C;  1BCC G;  3CX5 H;  1GK4 A;  2OYO A;  1BDD A;  3RL0 g;  2YFL A;  3V2P A;  1NO4 A;  5KLV D;  2M5A B;  3F89 A;  3NMD A;  4IFM A;  3ABV C;  2B9B A;  1GU4 A;  3CC7 P;  1IZN B;  1J2J B;  2AEF A;  3H1K J;  3GTS A;  1MFZ A;  3SSU A;  2JP3 A;  1KIL C;  1E5W A;  2ZXX A;  1L0N E;  3L75 E;  3CCS P;  3IF4 A;  2JR8 A;  3I56 P;  2YMK A;  1KYO I;  3P8C E;  3V4W A;  1SQB K;  2JWD A;  1QVF O;  1RE4 C;  3RK2 C;  2QJK C;  2FKW B;  1S9K D;  1RH5 B;  4BRY A;  1NTM K;  4W80 A;  1GTW A;  1NTZ J;  4OVN F;  1HJB A;  1OW8 A;  3H1I E;  1LWU C;  4DJG A;  3SWY A;  3LID A;  1N7S D;  5AVT B;  1JMB A;  1RHZ B;  3RL0 B;  1W5C E;  1EXJ A;  1OW6 A;  2Z5I A;  1ZLL A;  1K73 Q;  2E42 A;  2Y9Z A;  4QCK A;  1VPC A;  3AE9 C;  5L8R J;  3JSV C;  2KB7 P;  1ZOY C;  1L0L J;  3GMA A;  3BCC G;  2H43 A;  4P1B H;  1EZV E;  1KFM A;  3VMZ A;  2ZYD A;  1USD A;  2AXT E;  3LIE A;  4HM2 A;  5APQ A;  4YPC A;  1UII A;  4ZKP A;  2SPZ A;  1M1J B;  2P2U A;  1SQV K;  1CSB A;  2IPP A;  1W2E A;  1N7L A;  1HWT C;  3WMM 0;  4AAY B;  2CK3 H;  1SQQ J;  3P8C D;  1LTT C;  5CHX A;  4LC1 A;  3HD7 D;  5HL4 A;  4I1L A;  1OIP A;  3M9B A;  2WQY C;  3VMH D;  2W83 C;  4D6T J;  2KSE A;  1YI2 P;  2CPB A;  2FYU K;  1IFD A;  4UB6 H;  1R5L A;  2QE7 H;  1RE3 C;  3O6Q B;  3AE5 C;  4RKU J;  1YJW P;  3G4S P;  2FXO A;  2O1K A;  3L70 E;  1NKZ B;  4OGQ D;  2C0W A;  3RK2 D;  1JNM A;  2IBZ E;  2XSH A;  2H8P D;  1AV1 A;  1O7H A;  3CX5 I;  2A06 E;  2GUV A;  2IFM A;  2KOG A;  3BAS A;  3RK3 C;  2NUK A;  4MN4 C;  3WUT A;  2B89 A;  3L70 G;  1IK9 A;  1DD4 A;  1VQ5 P;  4IFD K;  3H32 A;  4NBG D;  3B4S A;  4GKG A;  2WPR A;  1KYO D;  1GW3 A;  1NTK J;  1U57 A;  3L73 E;  1H0T A;  1NJI Q;  5EFW B;  1ULJ A;  2D2C B;  2NUM A;  2Q3I A;  1JEK A;  1XTG B;  3AE1 C;  1KB9 I;  5APX A;  1HBW A;  3V6I A;  1N73 A;  1KIL E;  1RF0 C;  3E1R A;  5GTH E;  1RQU A;  4JQ0 D;  2QG4 A;  5AW3 B;  4PV1 C;  1Q81 Q;  1H89 A;  1S5L E;  4NBB D;  2JJL A;  2YMY A;  4OWF A;  2H89 C;  4JYC A;  1NWQ A;  1JTH A;  1LT1 A;  5CCG C;  1KN7 A;  1JY2 O;  2J59 M;  1LTB C;  3CME P;  2OYI B;  4GT1 A;  1NTZ K;  3MGN A;  2N9Y B;  2MKV A;  2QJY C;  2LXC B;  1A02 F;  3IR9 A;  1KQS O;  1BE3 G;  3D89 A;  2YO2 A;  2WTY A;  1O7G A;  3CCJ P;  2OTL P;  2KS1 A;  3L73 D;  2NWF A;  2FBW C;  4I2L C;  1FQT A;  3KYQ A;  3PTZ A;  1JY3 O;  2OQQ A;  3L36 A;  1PP9 G;  2R5B A;  2PFX A;  1X9V A;  1YHQ P;  4HJL A;  4HM6 A;  3HE5 A;  3GB4 A;  3D6Z A;  1OVU A;  3CC4 P;  2WWW A;  2PAJ A;  2BMO A;  3H1J G;  3GW6 A;  2YXQ B;  2B88 A;  2HOD B;  4HM5 A;  1EC5 A;  4YXW H;  3GHG C;  2OYH A;  3GF3 A;  3Q5P A;  1OW7 A;  2YKP A;  5CCH C;  2E75 C;  5B5E E;  4PD4 E;  3VMI D;  1FZB A;  2OYI A;  3M0D C;  1QL1 A;  1KYO H;  1QL2 A;  2XZR A;  3K5B A;  3FXD A;  4ASW A;  1FZG A;  1VDF A;  5CMZ A;  5KAI H;  3C0D A;  1MZ9 A;  3V2N A;  2E76 B;  3A3Y B;  2CPS A;  1IFP A;  2NVE A;  5B66 H;  2Q5U A;  1NAF A;  5BVZ A;  3NFQ A;  3S9O A;  2OTK E;  2QJK B;  1SQP K;  1OXZ A;  1BE3 E;  3KZI E;  2CKF A;  2R3S A;  1T3J A;  3L75 J;  1HGZ A;  3H1K E;  3G3Z A;  5AVQ B;  2HFE D;  3GL2 A;  2PGD A;  3CCQ P;  3IFM A;  1FE6 A;  5BU5 A;  3PH0 A;  2I8D A;  3CPW O;  1KIL D;  2ZVO B;  1WT6 A;  5KAF H;  1VQL P;  2O1J A;  3N4X A;  2QRX A;  4I7Z B;  4TT3 H;  1OWA A;  3BCC J;  3R2P A;  1LTJ B;  3V4Q A;  1L4A B;  4GDO A;  4RO0 A;  4JPZ B;  2E74 B;  1DEB A;  1Y8A A;  4NBE D;  1J1E B;  4W7Y A;  5M1B A;  4ZNC A;  1GL2 A;  1JY2 P;  1H0T B;  3AEF C;  1Q90 D;  3GCE A;  2A06 D;  1PL5 A;  1Q82 Q;  2HMK A;  1NTZ G;  3H1I G;  2E74 C;  1M7L A;  2RMZ A;  3L75 D;  3CWB D;  5APY A;  1VQ7 P;  2ZYL A;  1NKN A;  1ZR4 A;  1JM0 A;  1BE3 J;  4L75 A;  1XTC C;  1QEX A;  3JC2 2;  4PD4 H;  1SQX E;  2BCC E;  2ZJS E;  5KLV G;  2JZA A;  4H44 B;  2E4P A;  3AE3 C;  2WSE H;  5KJ7 D;  2FYU G;  5KJ7 A;  4TLF A;  1SQV E;  3Q2Y A;  3FX0 A;  2DW3 A;  2YIU C;  4K35 A;  4WWI A;  3TK1 A;  3F5H A;  1N7S A;  1VQK P;  1URQ C;  1SQP G;  5CCG A;  4R4M A;  3AE6 C;  4L76 A;  4M3L A;  5AW2 B;  1LNQ A;  5AVS B;  1BCC E;  4QUQ A;  4I6M C;  4DZO A;  2QSI A;  1O7W A;  3PJS K;  2NVG A;  2GM4 A;  2RH0 A;  1NTK G;  5H2F H;  1AFO A;  1HVV A;  3CWB J;  4U3F E;  3CCL P;  1PGQ A;  2ZYG A;  2HMM A;  1CW5 A;  2QJP B;  2ZT9 D;  2JDI H;  4EMJ B;  3AEC C;  1IO4 A;  1NVO A;  1Q7Y Q;  2K88 A;  4H44 C;  1H8A A;  1O7N A;  4GOE A;  2O01 J;  1SQX K;  3L74 J;  4HM1 A;  4OGQ C;  1ZR2 A;  2XDJ A;  1AQT A;  3KXD A;  4WVZ A;  1L0N G;  1YYC A;  1IFI A;  2BCC G;  2KLV A;  3VMG D;  3GZX A;  1LTS C;  5GTH H;  4P1C H;  1AJY A;  2V4H A;  4QDF B;  4JF7 A;  2KI7 B;  2DE7 D;  3GOB A;  1J1D C;  2B1X A;  5AVR B;  3G6E P;  3DQY A;  3L70 D;  2E5Y A;  1IC2 A;  2K9J B;  1T2K C;  3SFE C;  4QDC A;  1IFM A;  1URQ B;  2WT7 A;  3CWB G;  5AVU B;  3I55 P;  1PGJ A;  3MUD C;  1NU1 E;  1G2C A;  3USS A;  1T2K D;  4W7Z A;  4O9B A;  4OGQ B;  2I1K A;  2WSF H;  1JY3 P;  3L4F A;  2P67 A;  1VM9 A;  2KXP B;  1SQB G;  1MKM A;  2WT7 B;  3EFG A;  1PPJ D;  3RK3 E;  3D70 A;  1FZC C;  5B66 E;  1NTK E;  1JM1 A;  2YXR B;  1JO5 A;  2ZVN B;  2WPQ A;  1P84 H;  2KZI A;  1X8Y A;  3ZDM A;  4NPE A;  2NVF A;  2Z4E A;  1YIJ P;  4PV1 D;  1ZRT E;  1FZE A;  2NPS C;  1ZV8 A;  1P84 E;  3TDK A;  3G71 P;  2O3J A;  2FYN B;  4U7J A;  3CX5 D;  1OZH A;  1QGK B;  1YTZ T;  1JTH B;  1R8E A;  4KJM A;  3HTK B;  1LP1 A;  2BMQ A;  2WSS H;  2HYN A;  2R44 A;  1RFS A;  3A0B H;  2XRX A;  3L70 J;  3RGU A;  5TIS E;  3HUS A;  2E4Q A;  4ZMD A;  1KD1 Q;  3B5N A;  3HD7 B;  5APW A;  5AW4 B;  2HML A;  1GDT A;  1GK6 A;  2QVA A;  2KSJ A;  1ZRT D;  3TF5 A;  3JCU E;  1EXI A;  2NPS B;  3QWO C;  1PFI A;  3H1J E;  1L0L K;  3H1L J;  5AEU A;  2Y0D A;  1KB9 E;  3TGU J;  1T6A A;  3ITK A;  1VF5 B;  1L0N D;  1N2D C;  2JWA A;  4JYB A;  1EZV I;  2AXC A;  3KZI H;  1BSH A;  4D6T G;  3KQG A;  3C8V A;  5BU8 B;  1K04 A;  2OYH B;  2WPS A;  2HOD A;  2IZ1 A;  2QA4 P;  1CI6 A;  3CCV P;  1RIE A;  1SFC A;  1KYO E;  2YKO A;  2KK7 A;  4NB9 D;  5H2F E;  4DCK A;  3RBX A;  2QJP C;  4NBD D;  2DE6 D;  1VQ6 P;  3OA7 A;  5B5E H;  3L71 J;  1JOC A;  1MV8 A;  3L75 G;  5AW9 B;  2QJY B;  4QUP A;  3Q5R A;  1M8O B;  3H1I J;  3RK2 B;  3T97 A;  2JEE A;  3L74 D;  4YTP C;  1SFC C;  1RQV A;  2R3C A;  1FAV A;  4RJT A;  4NB8 D;  2KP8 A;  2BCC J;  1PGO A;  1UIX A;  3N0Q A;  2ZFC A;  3V5B A;  1HGV A;  3AEG C;  1SQQ D;  1MFT A;  2HMO A;  3UIA A;  2N1T B;  1X22 A;  2KS1 B;  4HM0 A;  4ASV A;  1SS1 A;  4HH2 A;  2HPC A;  4DOJ A;  3I5C A;  4Y99 B;  5KAF E;  1AQ5 A;  3CCM P;  4CPG A;  2HR3 A;  2QM8 A;  2E75 D;  5KLV K;  5K5G B;  3V2R A;  3IAO A;  3TGU D;  1W2B O;  4H13 D;  3PRJ A;  1FDO A;  1NTK D;  3EN1 A;  4HYT B;  5AEW A;  2I1J A;  3C9I A;  1PP9 J;  2IBZ D;  4C46 A;  2W6J H;  4UB6 E;  1WMK A;  1NU1 D;  3GTE A;  3RK3 B;  2WPV B;  3MZW B;  4R4L A;  3VP9 A;  3CC2 P;  2Z5H A;  3W68 A;  4C7N A;  3L37 A;  3VP8 A;  1SQX G;  1OFC X;  2FFD C;  4LGD E;  1R5S A;  1S5L X;  1NTM J;  3BRV B;  3GLM A;  4NBC D;  3SFD C;  2N9B A;  2FY8 A;  2OTJ P;  4QDF A;  3EQQ A;  4PD4 I;  1NTK K;  3Q3D A;  5KKZ C;  4N78 E;  5KJ7 C;  1ZW0 A;  3AE7 C;  3RL0 C;  4BWN A;  2YFJ A;  4HB1 A;  1BGY D;  3B5N D;  2BEZ F;  1M90 Q;  1EDK A;  4BXL A;  2FYU D;  1VCK A;  1O7M A;  2HPC B;  2GBW A;  3HD7 C;  2E76 D;  3QH9 A;  2A06 G;  1KC8 Q;  2P58 A;  1FZC B;  4N3Y B;  2B87 A;  1OX3 A;  2QM7 A;  1BSN A;  3GG2 A;  3H1H E;  1USE A;  1SQP J;  5APS A;  1S4X A;  2P1J A;  3AEE C;  2A45 G;  1Y9B A;  4AUW A;  2W27 A;  1PZQ A;  1NGM B;  1GU5 A;  1SJG A;  1YQ4 C;  3EWK A;  2KNC A;  1YJ9 P;  2HMN A;  3L71 G;  4NPF X;  3MHV A;  1N8R Q;  2ZT9 C;  3JCU H;  2Q3E A;  1BDC A;  3H1H G;  1Y47 A;  1S9K E;  2FFD B;  1D7M A;  2Q9I A;  1IK7 A;  3Q5S A;  4EYY Q;  5CJ0 A;  2XR8 A;  3B71 A;  4H44 D;  2W6A A;  3TGU E;  3U1C A;  1LT9 A;  2G8Y A;  2Q7C A;  1N7S B;  3H1L E;  3L72 G;  1BGY J;  5AW6 B;  5AVV B;  1PPJ E;  3RK3 D;  1FOS F;  3CMA P;  2K3R A;  2KUB A;  1RY3 A;  2Y0C A;  1NTM D;  1VQ9 P;  3NTN A;  2XSO A;  3AED C;  3PLN A;  2N1T D;  2C9N Y;  4WY4 D;  5AVX B;  5KLV E;  3II6 A;  1ZP0 C;  5CCG D;  1NU1 G;  3WU2 E;  3MUD A;  5AW1 B;  2IX7 C;  3HE4 A;  1SQB E;  4RES B; 
#chains in the Genus database with same CATH homology
 3H1K E;  1O7G A;  3GL2 A;  4HM0 A;  1O7H A;  3DQY A;  1NTM E;  4NBF D;  3H1J E;  3CXH E;  1BGY E;  3L71 E;  2NWF A;  2A06 E;  1SQV E;  1UUW A;  1G8J B;  4HM3 A;  5AEU A;  2FYU E;  4QDC A;  1FQT A;  3H1H E;  1NYK A;  5CXM A;  1KB9 E;  4AIV A;  2FYN C;  2NUK A;  1SQQ E;  2YIU C;  2E74 D;  4QCK A;  2GBX A;  1NDO A;  3VCA A;  1NU1 E;  3GZY A;  2E75 D;  3CWB E;  4HJL A;  2JO6 A;  2HMJ A;  4H0L D;  4HM6 A;  4NBG D;  1PP9 E;  1UUV A;  4H13 D;  3L72 E;  4P1B H;  1SJG A;  1EZV E;  1VM9 A;  3GB4 A;  3AZC A;  4QUQ A;  3GL0 A;  1BCC E;  3GKE A;  3BCC E;  4HM2 A;  1NTK E;  1JM1 A;  3EN1 A;  1EG9 A;  3L73 E;  1O7W A;  2BMO A;  2HMN A;  5AEW A;  2NVG A;  1ULJ A;  2NVF A;  4HM5 A;  4NBE D;  1L0L E;  2YFL A;  2NUM A;  4PV1 D;  3GTE A;  4NBH D;  2Q3W A;  1ZRT E;  4U3F E;  1RIE A;  4NBA D;  1KYO E;  5BOK A;  2XR8 A;  2HMM A;  4H44 D;  4AAY B;  4NB9 D;  2ZT9 D;  1SQP E;  3TGU E;  4EMJ B;  2BMR A;  4PD4 E;  2QPZ A;  1VF5 D;  3GCE A;  5KLI C;  3VMI D;  2B24 A;  2QJP C;  4NBD D;  2DE6 D;  1P84 E;  3H1L E;  1ULI A;  4HM8 A;  1PPJ E;  2HMK A;  4NBB D;  5HL4 A;  4NBC D;  1O7N A;  4HM7 A;  1WQL A;  4QUP A;  3VMH D;  3GTS A;  4QDF A;  2D2C D;  4HKV A;  3EQQ A;  3L75 E;  2BMQ A;  1NTZ E;  1L0N E;  2YVJ B;  2ZYL A;  4HM1 A;  2I7F A;  5KKZ C;  2DE5 D;  3FOU A;  3C0D A;  2XSO A;  3CX5 E;  4NB8 D;  3VMG D;  1RFS A;  3GZX A;  4QUR A;  2YFI A;  2XRX A;  2YFJ A;  4QDD A;  4P1C H;  3N0Q A;  4HM4 A;  1SQX E;  5KLV E;  2E4Q A;  2BCC E;  2NVE A;  2QJK C;  3L70 E;  3VCP A;  1G8K B;  4OGQ D;  1Q90 C;  1O7P A;  2HML A;  4QDF B;  2IBZ E;  2HMO A;  2QJY C;  1BE3 E;  1VCK A;  1O7M A;  2DE7 D;  2CKF A;  2JZA A;  4D6T E;  3L74 E;  2GBW A;  3GOB A;  2XSH A;  1SQB E;  3H1I E;  2E4P A;  2E76 D;  3D89 A;  2B1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...