3H1HE

Cytochrome bc1 complex from chicken
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 40
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1hE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1hE02
2XRXA 2NVEA 2DE6D 3D89A 2DE7D 2B1XA 2HMLA 4D6TE 2YFIA 2ZYLA 4QCKA 4NBED 2NVGA 2BMRA 3GTEA 1L0NE 3AZCA 2Q3WA 1PP9E 4QUQA 3L72E 1NTME 1SJGA 1ULJA 3DQYA 4NBGD 2GBXA 4HM7A 4PV1D 1UUVA 2NUMA 4AIVA 5KLIC 4NBHD 2YFJA 3GL0A 3VMID 4H0LD 2I7FA 1BE3E 4HM4A 3FOUA 1O7MA 5AEWA 4HM1A 2ZT9D 3GZXA 2FYNC 3L75E 3H1LE 2QJPC 2HMKA 4HM8A 4OGQD 4AAYB 2NVFA 3N0QA 4QUPA 3VCPA 2JZAA 3EQQA 1O7WA 4HJLA 5BOKA 3H1HE 3L74E 1VF5D 3GOBA 1SQPE 1KYOE 4QDDA 3GKEA 4P1CH 4HM3A 2DE5D 2QJYC 2E4PA 2QPZA 1ZRTE 1BCCE 4QDFB 1RIEA 4NBAD 1SQVE 2FYUE 1O7HA 1EG9A 3VMGD 1NTZE 1VM9A 5AEUA 2GBWA 4HKVA 1UUWA 2YVJB 2IBZE 3H1IE 3L70E 3BCCE 2BMOA 2YFLA 1NU1E 1WQLA 1NDOA 1G8JB 1VCKA 1O7PA 2HMMA 2HMNA 1PPJE 1BGYE 3H1JE 3TGUE 4H44D 4HM0A 2E75D 4NBFD 4NBCD 4NBDD 4QURA 2HMJA 2E74D 3VCAA 5KLVE 2BMQA 2YIUC 4QDCA 4HM2A 4HM6A 1SQQE 2XR8A 2D2CD 4EMJB 2CKFA 1KB9E 3EN1A 3GCEA 5KKZC 2BCCE 3GL2A 3GTSA 4NB8D 2HMOA 2QJKC 3H1KE 3L71E 1JM1A 3GZYA 1O7NA 2E76D 1P84E 3CX5E 4U3FE 2JO6A 1NYKA 3GB4A 2NUKA 1L0LE 3VMHD 1O7GA 3CWBE 4P1BH 3L73E 4QDFA 2NWFA 1SQXE 2XSHA 2A06E 4NB9D 4HM5A 1FQTA 4NBBD 3CXHE 4PD4E 4H13D 2E4QA 5CXMA 1NTKE 2B24A 1G8KB 3C0DA 1ULIA 1EZVE 1SQBE 5HL4A 2XSOA 1Q90C 1RFSA
chains in the Genus database with same CATH superfamily
2AEFA 1NYHA 3RL0g 2ITAA 3V5BA 3AECC 3CXHD 3RL0B 1X0TA 3MUDA 1NKZB 3CC4P 3L71G 1L0LD 1FJPA 3AE2C 1GMJA 4ZKUA 2PRRA 2K9JA 1WT6A 1Q82Q 4LC1A 4WWIA 1LTJB 4QUPA 2H88C 1NAYA 5GTIH 4U7JA 1NTMD 3WMM0 1P84H 2WSFJ 4H44B 3FXEA 1LTJA 1MUUA 1SQVE 1K05A 2MKVA 4LGDE 2P2UA 3P32A 1QLED 3TNUA 1LTTC 3P8MC 1VCKA 1PPJE 1OVUA 3JC22 1SQXD 2E75D 5APYA 1GU5A 3RGUA 1YIJP 4JPZB 1FAVA 5AW1B 1FZGA 3H1HG 5AVXB 1GZLA 3OJAB 1OWAA 3CCLP 2E76D 1BSNA 2Y0DA 4IFMA 3CWBE 1AV1A 1KORA 1NOHA 4L75A 4BXLA 2CPSA 4H13D 3A0HE 2B24A 3IAOA 3H1JG 1ULIA 2V7QJ 5AW9B 2XDJA 4M3LA 4WVZA 1L0NE 2BEZF 2RN0A 2WITA 3ABVC 4U3FG 1ULJA 4NBGD 3A2AA 1N7SA 1YHQP 1X22A 4HM4A 1KQSO 2JJLA 1USEA 4EI2A 2YO2A 2IPPA 2IZ0A 1GW4A 4QDDA 4XFJA 4IFDK 1RH5B 3M9QA 1DIPA 1RF0A 1FJKA 1EG9A 1VM9A 1J2JB 3CMAP 5AVTB 2W83C 4WY4D 5KLVK 2R5DA 3H32B 1KQLA 1UIIA 1DEEG 2WTYA 5CCHC 3L75J 3PRJA 1YTZI 1QL1A 2XZRA 3D71A 1BDDA 3TSIA 2WSEH 1SQBJ 2HLOA 1JTHA 2NUKA 2QE7H 4N78E 1L0LE 2HODA 1RE3C 1EDJA 2P7JA 3P8CE 1KN7A 3BCCJ 3C8VA 3RK2D 4C7NA 4PD4E 1NTMJ 1T3UA 1GD2E 2JEEA 4NPEA 2KUBA 1LT1A 5CCHD 3HTKA 5CCGD 3HD7B 1EXIA 1AFOA 1OVVA 5B66E 2DE7D 1YJ9P 2YFIA 5AVWB 2NVGA 4WY4A 2M5AA 3SWFA 2IBZG 3L70G 2YFJA 3B5NC 5AW3B 1KILC 1JOCA 4R4LA 3NFQA 3D6YA 3E1RA 2B88A 4HM8A 1KTMA 3N0QA 1PP9G 1SQQD 3H1IG 1ZN5A 1LT9A 1RY3A 3VCPA 3H1HE 3GOBA 1RF1C 3PJSK 1L0ND 3CCMP 1IFNA 1S1CX 5B5EE 1O7HA 1CI6B 1N7LA 5KJ7A 1QVFO 4W7ZA 2HMNA 1BGYE 4DJGA 1DD4A 2QIWA 1JY2P 3CWBD 3CD6P 4HM2A 1YQ4C 2IDBA 4YTPC 2HMOA 3BVHA 2NPSB 2W27A 3H1HJ 2FFDC 5CJ4A 5AW5B 1KFMA 3CX5E 2L91A 2RKLA 3O6QA 1JY3O 2YXQB 4H0LC 3MD0A 2WSSH 1SQVG 4C7NB 2GUVA 1PPJD 2Q6QA 3GG2A 1J1EB 3TGUG 4DZOA 2BCCJ 1JEKA 2JR8A 2AXTH 1RF1B 1SQVD 1FDMA 5AVVB 2O01H 2B89A 4PD4D 2QJPB 3P8CD 3L73D 1NTME 1W2EA 3B5NB 2RMZA 1KQFB 4N78D 3G6EP 2VRSA 1WMKA 2PP6A 1OZHA 2R44A 2ZT9B 2M8RA 3T97B 2G3AA 3VMXA 3HD7C 3CCJP 1O7WA 1SFCB 3Q5RA 4RO0A 2CK3H 1U7JA 4GOFA 3BCCD 5CHXA 5AEUA 1K73Q 2QA4P 1K8AQ 2O1JA 1UUWA 1EZVD 1H89A 2LXCB 2YFLA 1JMBA 2OYOA 2HMMA 2QSIA 2KK7A 2QJKB 3LIEA 2ZYGA 1VF5B 3KZIE 1LTAC 2YIUB 3IFMA 1T3JA 1RE4C 2WT7B 3RK3E 1P84E 1Q86Q 1AQ5A 2JO6A 2KI7B 2M5AB 1ZXGA 1NTKJ 4GOEA 3V4QA 1NGMB 4NPDA 3U59A 1L4AC 4OGQC 1GL2A 2QJYB 1J1EC 5CXMA 1RQUA 1JMMA 2A45G 3HE5B 3WU2H 1NTZD 1XTCC 4JYBA 2XRXA 2DE6D 4QCKA 2D2CC 2ZYLA 4GIFA 1FZFA 4NPFX 1LTSC 3AZCA 5KLVJ 1KB9I 1MFZA 4QUQA 4Z1MH 4BWNA 3VMID 3CMEP 3FOUA 3CWBJ 2NZ2A 1IFPA 3MZWB 4DOJA 4BRYA 1SLQA 2HFED 3EQQA 4JF7A 1N8RQ 5AW2B 3VN0A 1SQPJ 2QEXP 1SQPE 3EFGA 5L8RJ 2Z5HA 1OFCX 1SQVK 3JCUH 1L0NG 1X9VA 1GL2B 1PGJA 3AE7C 2IBZE 3L70E 3LW5J 3HUSA 1LWUB 3OAKA 4H13C 3AE8C 5APSA 1FZAA 3KYQA 2Q7CA 1SQBG 2QM7A 4LLHA 4I1LA 1ZW0A 4NBFD 2AEJA 2JKVA 2WPSA 1AVOA 1KILB 2E5YA 3GTSA 1GDTA 3TYYA 3AEBC 1N73A 3GB4A 3LW5H 1PZQA 1FBMA 3PP5A 1LWUC 4AYCA 5KKZB 2NWFA 2A06E 5E79H 4GDOA 3CXHE 2WWWA 2RH0A 1KC8Q 2WPRA 4ZMDA 1U57A 1OW8A 2ZFCA 3II6A 1PPJG 2HPCA 2W6AA 3B4SA 2KSEA 2N9YB 1S5LX 3FWNA 3GTEA 2GA1A 2WPVB 2GM4A 1IFMA 1BE3E 3TF5A 3L71D 4JBZA 1NU1K 1ZV8A 3H1LE 1NTMG 2C9NY 2P58A 1BCCJ 1VF5D 3L74E 1LTBC 2ZYDA 2B9BA 1YQ3C 1NO4A 3H1JD 1W5CE 2QJYC 3BRVB 1FC2C 5CCGA 2YNYA 2H89C 1M1JA 1GK4A 1A02F 2CPBA 2BASA 3N4XA 1KB9H 2K3RA 2KXPB 4DT0A 4HJGH 1WQLA 3R2PA 1EXJA 4HM0A 1PP9J 2YIUC 3S4RA 1AVYA 1URQB 2BCCE 1EDKA 3EWKA 2J58A 1VQ4P 2QJKC 2P1JA 2OYIC 2HR3A 1S9KD 2WQYC 3Q5SA 3B5ND 1S5LH 1YI2P 1DEBA 1Y9BA 3N7NA 4Y99B 2OTLP 4GKGA 2KS1B 2M3EA 3OA7A 4D6TD 3CPWO 2FXPA 1PGQA 2LKMA 4GT1A 4WBAA 3RBXA 1QGKB 5APWA 3GHGC 1JCDA 2H43A 1BE3J 2M3BA 2LXBA 1VDFA 3KQGA 3A5TA 2OYHA 3A7OA 2R3SA 3CLQA 5GTIE 4I6MC 4QMAA 2I7FA 3L75D 1HF9A 1KQGB 2W90A 5APTA 2QJPC 1FZCA 1EDLA 4AAYB 3MUDC 2YKOA 2I1JA 3O6QB 3TGUJ 1H0TA 3V6IA 2FKWB 2A45H 2OYIB 1RQVA 1DD3A 4HM3A 1PV3A 2LR2A 3AE1C 1R8EA 1ZRTE 3RL0D 3AEAC 4EDFA 3FX0A 1LNQA 3AE3C 2IX7C 1GTWA 3SFDC 3CC2P 3H1KG 3AEEC 1SFCA 1LTJC 1L0LG 1Q90D 3VCAA 1KZUB 5KJ7D 1IJDB 1KB9E 3GCEA 3ZDMA 4NB8D 1HVVA 1SVFA 3H1KE 5CMZA 2KLVA 4ASVA 4PV1C 3M91A 4U3FE 3F89A 5AW7B 3RL0C 1NTZG 1AJYA 5KTBA 1W2BO 4OH8B 3TDKA 2KOGA 3V4WA 1SQBE 2E75C 5HL4A 4UB8H 2QVAA 3K5BA 3KZIH 1S2EA 4OVNF 2WSCJ 1PP9E 4RJTA 3L72E 2E76C 1RHZB 1FZBA 3I56P 3CCRP 1SQPG 2NPSA 2FY8A 3AE6C 1JO5A 5KLVG 2Z5IA 2HMKA 2ZVOB 4IFFA 2NVFA 1LTIC 2FYNB 3BATA 2ZXXA 2I1KA 1N7SC 1JUNA 5KAFH 1BCCE 3CCUP 1NU1D 1S3JA 4YPCA 1VQLP 2FYUD 2BMOA 1FS0E 3BASA 1M57D 1L0NJ 2HMJA 3OW2O 5GTHH 2XU6A 3WUUA 2O1KA 2D2CD 3L74G 3L37A 2O3JA 3GL2A 1MZ9A 3L73J 3WUVA 3GZYA 3KHUA 1YITP 3IR9A 1KILD 4QDFA 3JCUE 5CBNA 1DH3A 1X8YA 2AXCA 1CSBA 2XSOA 1FOSF 1VQ6P 1RE3A 1GW3A 2V4HA 1SQXG 3G71P 1FU1A 2B1XA 1M8OB 1BE3G 5DJTB 2BMRA 2E5TA 2R32A 1KYOD 1NWQA 1S72P 5AVZB 2ZVNB 1L0NK 3L35A 1VQOP 3GZXA 3JSVC 1AA0A 4IL6X 1KYOE 1L0LJ 2UWJE 1KILA 1PGPA 2IFNA 2DE5D 3PLNA 4K35A 5BU8B 4D6TG 3SWKA 2QG4A 2C0XA 1SQQG 3H1ID 1QEXA 1LT9C 1IK7A 3I55P 2FBWC 1RF1A 2AXTE 2E43A 3TGUE 1HUCA 1NTZJ 3G9RA 3KPEA 3IF4A 5KLVE 2XV5A 2XR8A 1BGYJ 4EMJB 3QH9A 1Q7YQ 1JM1A 4I7ZC 1EZVI 4BRYB 2YKPA 1VQPP 3D70A 1SQXK 3M0DA 2W6JH 4UB8E 5TISE 1O7GA 2N9BA 2NRGA 2K9YA 1FDIA 2ZT9C 3VP9A 1URQC 2XSHA 4XA4A 3CCVP 1NTKE 2FYUK 3TK1A 1EQ7A 4K3AA 1Y47A 5TJHA 4H44C 5CBOA 4Y28J 3AEDC 1NJIQ 1NTKD 2PGDA 3D89A 4IL6H 1G1JA 2IYPA 1VQ9P 5K5GB 1SFCD 1FE6A 3GL0A 1N86A 3V2RA 2ZXEB 4W7YA 3L72J 2ZT9D 2KSJA 1URQD 2Y9YA 2Q3IA 1A02J 1M56D 3AEFC 4PD4H 5KLVD 2N1TB 2B87B 1K04A 3TNUB 5KAIH 1D7MA 4TT3H 3QWOC 2E4PA 2OYHB 1JY2O 2OGUA 2JP3A 1EDIA 3MIWA 2KP8A 1GK6A 3VMGD 2YXRB 3HD7A 1SQBD 2N1TC 5CJ0A 1JM0A 3WUTA 5AW8B 3Q5PA 1G2CA 3CI9A 1M1KQ 2KNCB 1LJ2A 3PHLA 4HM6A 3L75G 2Z4EA 4U3FD 2ZJSE 5APQA 1LGHB 2DW3A 4HKZH 2BEQD 4RESB 2NPSD 2A45I 4AQRD 2JWAA 3H6PA 1QX8A 4L74A 2QRXA 1HGVA 5B5EH 1SQPK 3S1KA 4I2LC 3BCCG 1RE4A 3GF3A 1G8KB 1P84I 4O9BA 1NAFA 1GU4A 1HBWA 2FYUG 1WRGA 4MN4C 2HMLA 1L4AA 3H1IJ 3O8ZA 3SWYA 1GL2C 4IOIH 2P67A 3D6ZA 1JY2N 1BSHA 3CL3D 5KAFE 5AEWA 1HGZA 1QVGO 3SSUA 5BOKA 3KDPB 3UIAA 1ZLLA 3EFFK 3E7KA 2YKQA 3L70J 3Q3DA 1H0TB 4P1CH 1HTLC 4QDFB 1FOSE 4NBAD 1NTKK 2FYUE 1GL2D 4AUWA 1EC5A 4D6TJ 2WSCH 1SQQJ 2E42A 2O01N 1CI6A 3RK2B 2FYZA 2WPQA 2Y0CA 5APVA 4QDCA 5AVQB 2MJZA 2WSEJ 2HG5D 1L4AB 4OGQB 3HUSC 4PD4I 2YO3A 1BGYG 1S4XA 1SQVJ 3PH0A 3L72D 3VP8A 1IZNB 3P7KA 2PAJA 3G4SP 1OMIA 3TGUD 1NU1G 5AVRB 1USDA 1JTHB 3AE9C 3CX5I 1N73C 4WY4B 1N7SD 1IC2A 2KIKA 2KLUA 3A0BE 4NBED 3L36A 3HRNA 3H1LJ 2J59M 3L74D 2KYVA 1UUVA 3FWLA 1OXZA 5KLIC 2XKMA 1TU3F 2P10A 3GW6A 1L2PA 1O7MA 1DX7A 1N2DC 2FYNC 1HJBA 1RF0C 1LP1B 1YYCA 1ZOYC 1T6AA 3L72G 2G8YA 4L73A 2JZAA 4HJLA 1UIXA 4A7PA 1JB0J 2OTJP 2POHA 1LTGC 1SQXJ 3VYIA 4ZKPA 5M1BA 3HE4B 5CCHA 5AW4B 2SPZA 2Q3EA 1HJ0A 2GBWA 2Q9IA 1FDOA 1R5SA 1PIXA 1NDOA 1G8JB 3HE5A 1AQTA 1O7PA 4HB1A 2Q1KA 4WB4A 5CCGC 5C39A 1KILE 3A3YB 1U7MA 2E76B 1NTMK 2K1AA 4PV1B 3VMHD 5APUA 4EYYQ 1YJWP 1HH0A 2HYNA 1NTKG 4NB9D 1PGOA 4IL6E 1FQTA 4N6JA 3AE5C 4WY4C 1N73B 2OYIA 4PJ0H 3C0DA 1JCCA 1L0LK 3CC7P 3KXDA 3B5NA 1SP4A 1E79H 4L76A 4CPGA 1IFIA 4D6TE 3C1LA 3MTUE 4N3YB 2FYUJ 1SQPD 4HM7A 3IN6A 4JQ0D 4NBHD 3CWBG 1NTZK 1J1DB 1S9KE 2XNXA 3R4YA 3FXDA 3T97A 5TISH 4ASWA 3W67A 1Y8AA 4YXWH 3RK2C 5KJ7C 2K88A 2BCCG 2KZJA 2KZIA 2IBZI 3CXHH 2E74B 5APXA 1CZQA 5EFWB 1KD1Q 2J5UA 3EQ2A 3GMAA 2O01J 1FZCC 1NTZE 2Q5UA 5BVZA 3H1IE 3GF7A 1IO4A 1BDCA 2FFDA 3H1JE 4I7ZB 3VMAA 4YXDC 2E74D 2K37A 2BMQA 2JWDA 1Q2NA 1NU1J 1NHLA 1Z56A 2R3CA 3EN1A 1P84D 1CW5A 3H1KD 2XNDH 1QL2A 3Q2YA 1KB9D 1SFCC 3AEGC 2H8PD 1T8ZA 3GLMA 5KAIE 1M1JB 2OTKE 1LT9B 3NXSA 1SS1A 2I8DA 3GHGB 3A0BH 3H1LG 2V7QH 3HD7D 1EZVE 2E74C 1Q90C 4Y99C 3L71J 2NVEA 1PFIA 1ZRTD 4KHXA 1E5WA 3PTZA 1KFNA 5AVYB 1BCCG 2WMMA 2IZ1A 2A06D 1LP1A 1MKMA 2N1TD 3VOPA 1VQ8P 5H2FH 4PV1D 2ZAEB 1JY3P 2WVRA 3CX5H 1NKNA 1HWTC 3ITKA 2Y9ZA 1S5LE 3L75E 2A06G 2C9LY 4H0LB 2WZ7A 2HPCB 3E1IA 2YMKA 3RBZA 2HODB 3F5HA 3HE4A 2NPSC 3CCSP 1OIPA 4KJMA 3CCEP 5GTHE 1ZMEC 4JYCA 2GUSA 3A0HH 1NU1E 1BCCD 4W80A 3BRTB 1X79B 3H32A 3H1JJ 4HH2A 1MFTA 1OVRA 1IFDA 5KKZC 3CXHI 4TLFA 1NVOA 5AW6B 1XTGB 4KT0J 2BCCD 3M06A 4HYTB 1VQ5P 1Q81Q 4P1BH 4B86A 4GODA 3M9BA 1PP9D 5AVSB 3B8EB 4HM5A 3NMDA 1BGYD 1R5LA 2FXMA 1VQKP 2ZYAA 1N7SB 4UB6E 3U1CA 4H13B 2R5BA 3M0AA 1SQBK 1SQQK 3VMZA 3DQYA 3H1HD 2GBXA 5KLIB 4AIVA 1KYOH 1VL2A 1NH4A 2WSFH 1MV8A 3H25A 1M90Q 1YJNP 1BE3D 1L4AD 4OGQD 4U3FJ 4RKUJ 5BU5A 3S9OA 3H1KJ 2OARA 2E75B 3GKEA 2AEMA 2IYOA 3WU2E 2FXOA 2QPZA 3MP7B 1YTZT 3Q1MA 1IK9A 5E79E 3V2QA 1M7LA 3BCCE 5DJUB 2WT7A 1EZVG 1VPCA 2KB7P 1KMIZ 4H44D 4NBDD 1H8AA 3MGNA 1OX3A 1LWUA 1YBKA 5B66H 3HUSB 3HTKB 2CKFA 2YMYA 5AVUB 3L4FA 4EOTA 4PJ0E 1G2CB 1NYKA 2D2CB 1IFJA 3L73E 3V2NA 5AW0B 2E4QA 3VMYA 1VF5C 2L5GB 5H2FE 2M0BA 3MHVA 3I5CA 1JY3N 2IBZD 3L70D 3M0DC 2JO1A 2IFMA 1VQ7P 1URQA 2H7HA 1JNMA 2Q3WA 1PL5A 4XE5B 1SJGA 2OQQA 2NUMA 4UB6H 3CX5D 2JDIH 4H0LD 3CCQP 4C7RA 1KV4A 3RK3B 4HM1A 1M1JC 1H88A 2PFXA 3LIDA 1OW7A 2K9JB 3RK3C 3AE4C 1T2KD 4C46A 2W8ZA 1KYOI 2B87A 2Y0EA 1ZR2A 1VQNP 3V2PA 1RIEA 4ZNCA 2KNCA 4HKVA 2YVJB 3C9IA 2W6BA 3FGAD 3B71A 3VTPC 3NTNA 4OWFA 1G1IA 4NBCD 4QURA 1K9MQ 4R4MA 1FZCB 3L73G 3W68A 1SQQE 4EIJA 2N1TA 1ZP0C 3RK3D 3H1LD 1FZEA 1T2KC 3G3ZA 3L74J 3L71E 1O7NA 1OW6A 3M9HA 2FFDB 3GHGA 4DCKA 1ZR4A 1SQXE 3USSA 1VQMP 4NBBD 1J1DC 2OYHC 3SFEC 3U1AA 2QM8A 2C0WA 2KS1A 1RFSA
chains in the Genus database with same CATH topology
2XRXA 2NVEA 2DE6D 3D89A 2DE7D 2B1XA 2HMLA 4D6TE 2YFIA 2ZYLA 4QCKA 4NBED 2NVGA 2BMRA 3GTEA 1L0NE 3AZCA 2Q3WA 1PP9E 4QUQA 3L72E 1NTME 1SJGA 1ULJA 3DQYA 4NBGD 2GBXA 4HM7A 4PV1D 1UUVA 2NUMA 4AIVA 5KLIC 4NBHD 2YFJA 3GL0A 3VMID 4H0LD 2I7FA 1BE3E 4HM4A 3FOUA 1O7MA 5AEWA 4HM1A 2ZT9D 3GZXA 2FYNC 3L75E 3H1LE 2QJPC 2HMKA 4HM8A 4OGQD 4AAYB 2NVFA 3N0QA 4QUPA 3VCPA 2JZAA 3EQQA 1O7WA 4HJLA 5BOKA 3H1HE 3L74E 1VF5D 3GOBA 1SQPE 1KYOE 4QDDA 3GKEA 4P1CH 4HM3A 2DE5D 2QJYC 2E4PA 2QPZA 1ZRTE 1BCCE 4QDFB 1RIEA 4NBAD 1SQVE 2FYUE 1O7HA 1EG9A 3VMGD 1NTZE 1VM9A 5AEUA 2GBWA 4HKVA 1UUWA 2YVJB 2IBZE 3H1IE 3L70E 3BCCE 2BMOA 2YFLA 1NU1E 1WQLA 1NDOA 1G8JB 1VCKA 1O7PA 2HMMA 2HMNA 1PPJE 1BGYE 3H1JE 3TGUE 4H44D 4HM0A 2E75D 4NBFD 4NBCD 4NBDD 4QURA 2HMJA 2E74D 3VCAA 5KLVE 2BMQA 2YIUC 4QDCA 4HM2A 4HM6A 1SQQE 2XR8A 2D2CD 4EMJB 2CKFA 1KB9E 3EN1A 3GCEA 5KKZC 2BCCE 3GL2A 3GTSA 4NB8D 2HMOA 2QJKC 3H1KE 3L71E 1JM1A 3GZYA 1O7NA 2E76D 1P84E 3CX5E 4U3FE 2JO6A 1NYKA 3GB4A 2NUKA 1L0LE 3VMHD 1O7GA 3CWBE 4P1BH 3L73E 4QDFA 2NWFA 1SQXE 2XSHA 2A06E 4NB9D 4HM5A 1FQTA 4NBBD 3CXHE 4PD4E 4H13D 2E4QA 5CXMA 1NTKE 2B24A 1G8KB 3C0DA 1ULIA 1EZVE 1SQBE 5HL4A 2XSOA 1Q90C 1RFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRX A;  2NVE A;  2DE6 D;  3D89 A;  2DE7 D;  2B1X A;  2HML A;  4D6T E;  2YFI A;  2ZYL A;  4QCK A;  4NBE D;  2NVG A;  2BMR A;  3GTE A;  1L0N E;  3AZC A;  2Q3W A;  1PP9 E;  4QUQ A;  3L72 E;  1NTM E;  1SJG A;  1ULJ A;  3DQY A;  4NBG D;  2GBX A;  4HM7 A;  4PV1 D;  1UUV A;  2NUM A;  4AIV A;  5KLI C;  4NBH D;  2YFJ A;  3GL0 A;  3VMI D;  4H0L D;  2I7F A;  1BE3 E;  4HM4 A;  3FOU A;  1O7M A;  5AEW A;  4HM1 A;  2ZT9 D;  3GZX A;  2FYN C;  3L75 E;  3H1L E;  2QJP C;  2HMK A;  4HM8 A;  4OGQ D;  4AAY B;  2NVF A;  3N0Q A;  4QUP A;  3VCP A;  2JZA A;  3EQQ A;  1O7W A;  4HJL A;  5BOK A;  3H1H E;  3L74 E;  1VF5 D;  3GOB A;  1SQP E;  1KYO E;  4QDD A;  3GKE A;  4P1C H;  4HM3 A;  2DE5 D;  2QJY C;  2E4P A;  2QPZ A;  1ZRT E;  1BCC E;  4QDF B;  1RIE A;  4NBA D;  1SQV E;  2FYU E;  1O7H A;  1EG9 A;  3VMG D;  1NTZ E;  1VM9 A;  5AEU A;  2GBW A;  4HKV A;  1UUW A;  2YVJ B;  2IBZ E;  3H1I E;  3L70 E;  3BCC E;  2BMO A;  2YFL A;  1NU1 E;  1WQL A;  1NDO A;  1G8J B;  1VCK A;  1O7P A;  2HMM A;  2HMN A;  1PPJ E;  1BGY E;  3H1J E;  3TGU E;  4H44 D;  4HM0 A;  2E75 D;  4NBF D;  4NBC D;  4NBD D;  4QUR A;  2HMJ A;  2E74 D;  3VCA A;  5KLV E;  2BMQ A;  2YIU C;  4QDC A;  4HM2 A;  4HM6 A;  1SQQ E;  2XR8 A;  2D2C D;  4EMJ B;  2CKF A;  1KB9 E;  3EN1 A;  3GCE A;  5KKZ C;  2BCC E;  3GL2 A;  3GTS A;  4NB8 D;  2HMO A;  2QJK C;  3H1K E;  3L71 E;  1JM1 A;  3GZY A;  1O7N A;  2E76 D;  1P84 E;  3CX5 E;  4U3F E;  2JO6 A;  1NYK A;  3GB4 A;  2NUK A;  1L0L E;  3VMH D;  1O7G A;  3CWB E;  4P1B H;  3L73 E;  4QDF A;  2NWF A;  1SQX E;  2XSH A;  2A06 E;  4NB9 D;  4HM5 A;  1FQT A;  4NBB D;  3CXH E;  4PD4 E;  4H13 D;  2E4Q A;  5CXM A;  1NTK E;  2B24 A;  1G8K B;  3C0D A;  1ULI A;  1EZV E;  1SQB E;  5HL4 A;  2XSO A;  1Q90 C;  1RFS A; 
#chains in the Genus database with same CATH topology
 2AEF A;  1NYH A;  3RL0 g;  2ITA A;  3V5B A;  3AEC C;  3CXH D;  3RL0 B;  1X0T A;  3MUD A;  1NKZ B;  3CC4 P;  3L71 G;  1L0L D;  1FJP A;  3AE2 C;  1GMJ A;  4ZKU A;  2PRR A;  2K9J A;  1WT6 A;  1Q82 Q;  4LC1 A;  4WWI A;  1LTJ B;  4QUP A;  2H88 C;  1NAY A;  5GTI H;  4U7J A;  1NTM D;  3WMM 0;  1P84 H;  2WSF J;  4H44 B;  3FXE A;  1LTJ A;  1MUU A;  1SQV E;  1K05 A;  2MKV A;  4LGD E;  2P2U A;  3P32 A;  1QLE D;  3TNU A;  1LTT C;  3P8M C;  1VCK A;  1PPJ E;  1OVU A;  3JC2 2;  1SQX D;  2E75 D;  5APY A;  1GU5 A;  3RGU A;  1YIJ P;  4JPZ B;  1FAV A;  5AW1 B;  1FZG A;  3H1H G;  5AVX B;  1GZL A;  3OJA B;  1OWA A;  3CCL P;  2E76 D;  1BSN A;  2Y0D A;  4IFM A;  3CWB E;  1AV1 A;  1KOR A;  1NOH A;  4L75 A;  4BXL A;  2CPS A;  4H13 D;  3A0H E;  2B24 A;  3IAO A;  3H1J G;  1ULI A;  2V7Q J;  5AW9 B;  2XDJ A;  4M3L A;  4WVZ A;  1L0N E;  2BEZ F;  2RN0 A;  2WIT A;  3ABV C;  4U3F G;  1ULJ A;  4NBG D;  3A2A A;  1N7S A;  1YHQ P;  1X22 A;  4HM4 A;  1KQS O;  2JJL A;  1USE A;  4EI2 A;  2YO2 A;  2IPP A;  2IZ0 A;  1GW4 A;  4QDD A;  4XFJ A;  4IFD K;  1RH5 B;  3M9Q A;  1DIP A;  1RF0 A;  1FJK A;  1EG9 A;  1VM9 A;  1J2J B;  3CMA P;  5AVT B;  2W83 C;  4WY4 D;  5KLV K;  2R5D A;  3H32 B;  1KQL A;  1UII A;  1DEE G;  2WTY A;  5CCH C;  3L75 J;  3PRJ A;  1YTZ I;  1QL1 A;  2XZR A;  3D71 A;  1BDD A;  3TSI A;  2WSE H;  1SQB J;  2HLO A;  1JTH A;  2NUK A;  2QE7 H;  4N78 E;  1L0L E;  2HOD A;  1RE3 C;  1EDJ A;  2P7J A;  3P8C E;  1KN7 A;  3BCC J;  3C8V A;  3RK2 D;  4C7N A;  4PD4 E;  1NTM J;  1T3U A;  1GD2 E;  2JEE A;  4NPE A;  2KUB A;  1LT1 A;  5CCH D;  3HTK A;  5CCG D;  3HD7 B;  1EXI A;  1AFO A;  1OVV A;  5B66 E;  2DE7 D;  1YJ9 P;  2YFI A;  5AVW B;  2NVG A;  4WY4 A;  2M5A A;  3SWF A;  2IBZ G;  3L70 G;  2YFJ A;  3B5N C;  5AW3 B;  1KIL C;  1JOC A;  4R4L A;  3NFQ A;  3D6Y A;  3E1R A;  2B88 A;  4HM8 A;  1KTM A;  3N0Q A;  1PP9 G;  1SQQ D;  3H1I G;  1ZN5 A;  1LT9 A;  1RY3 A;  3VCP A;  3H1H E;  3GOB A;  1RF1 C;  3PJS K;  1L0N D;  3CCM P;  1IFN A;  1S1C X;  5B5E E;  1O7H A;  1CI6 B;  1N7L A;  5KJ7 A;  1QVF O;  4W7Z A;  2HMN A;  1BGY E;  4DJG A;  1DD4 A;  2QIW A;  1JY2 P;  3CWB D;  3CD6 P;  4HM2 A;  1YQ4 C;  2IDB A;  4YTP C;  2HMO A;  3BVH A;  2NPS B;  2W27 A;  3H1H J;  2FFD C;  5CJ4 A;  5AW5 B;  1KFM A;  3CX5 E;  2L91 A;  2RKL A;  3O6Q A;  1JY3 O;  2YXQ B;  4H0L C;  3MD0 A;  2WSS H;  1SQV G;  4C7N B;  2GUV A;  1PPJ D;  2Q6Q A;  3GG2 A;  1J1E B;  3TGU G;  4DZO A;  2BCC J;  1JEK A;  2JR8 A;  2AXT H;  1RF1 B;  1SQV D;  1FDM A;  5AVV B;  2O01 H;  2B89 A;  4PD4 D;  2QJP B;  3P8C D;  3L73 D;  1NTM E;  1W2E A;  3B5N B;  2RMZ A;  1KQF B;  4N78 D;  3G6E P;  2VRS A;  1WMK A;  2PP6 A;  1OZH A;  2R44 A;  2ZT9 B;  2M8R A;  3T97 B;  2G3A A;  3VMX A;  3HD7 C;  3CCJ P;  1O7W A;  1SFC B;  3Q5R A;  4RO0 A;  2CK3 H;  1U7J A;  4GOF A;  3BCC D;  5CHX A;  5AEU A;  1K73 Q;  2QA4 P;  1K8A Q;  2O1J A;  1UUW A;  1EZV D;  1H89 A;  2LXC B;  2YFL A;  1JMB A;  2OYO A;  2HMM A;  2QSI A;  2KK7 A;  2QJK B;  3LIE A;  2ZYG A;  1VF5 B;  3KZI E;  1LTA C;  2YIU B;  3IFM A;  1T3J A;  1RE4 C;  2WT7 B;  3RK3 E;  1P84 E;  1Q86 Q;  1AQ5 A;  2JO6 A;  2KI7 B;  2M5A B;  1ZXG A;  1NTK J;  4GOE A;  3V4Q A;  1NGM B;  4NPD A;  3U59 A;  1L4A C;  4OGQ C;  1GL2 A;  2QJY B;  1J1E C;  5CXM A;  1RQU A;  1JMM A;  2A45 G;  3HE5 B;  3WU2 H;  1NTZ D;  1XTC C;  4JYB A;  2XRX A;  2DE6 D;  4QCK A;  2D2C C;  2ZYL A;  4GIF A;  1FZF A;  4NPF X;  1LTS C;  3AZC A;  5KLV J;  1KB9 I;  1MFZ A;  4QUQ A;  4Z1M H;  4BWN A;  3VMI D;  3CME P;  3FOU A;  3CWB J;  2NZ2 A;  1IFP A;  3MZW B;  4DOJ A;  4BRY A;  1SLQ A;  2HFE D;  3EQQ A;  4JF7 A;  1N8R Q;  5AW2 B;  3VN0 A;  1SQP J;  2QEX P;  1SQP E;  3EFG A;  5L8R J;  2Z5H A;  1OFC X;  1SQV K;  3JCU H;  1L0N G;  1X9V A;  1GL2 B;  1PGJ A;  3AE7 C;  2IBZ E;  3L70 E;  3LW5 J;  3HUS A;  1LWU B;  3OAK A;  4H13 C;  3AE8 C;  5APS A;  1FZA A;  3KYQ A;  2Q7C A;  1SQB G;  2QM7 A;  4LLH A;  4I1L A;  1ZW0 A;  4NBF D;  2AEJ A;  2JKV A;  2WPS A;  1AVO A;  1KIL B;  2E5Y A;  3GTS A;  1GDT A;  3TYY A;  3AEB C;  1N73 A;  3GB4 A;  3LW5 H;  1PZQ A;  1FBM A;  3PP5 A;  1LWU C;  4AYC A;  5KKZ B;  2NWF A;  2A06 E;  5E79 H;  4GDO A;  3CXH E;  2WWW A;  2RH0 A;  1KC8 Q;  2WPR A;  4ZMD A;  1U57 A;  1OW8 A;  2ZFC A;  3II6 A;  1PPJ G;  2HPC A;  2W6A A;  3B4S A;  2KSE A;  2N9Y B;  1S5L X;  3FWN A;  3GTE A;  2GA1 A;  2WPV B;  2GM4 A;  1IFM A;  1BE3 E;  3TF5 A;  3L71 D;  4JBZ A;  1NU1 K;  1ZV8 A;  3H1L E;  1NTM G;  2C9N Y;  2P58 A;  1BCC J;  1VF5 D;  3L74 E;  1LTB C;  2ZYD A;  2B9B A;  1YQ3 C;  1NO4 A;  3H1J D;  1W5C E;  2QJY C;  3BRV B;  1FC2 C;  5CCG A;  2YNY A;  2H89 C;  1M1J A;  1GK4 A;  1A02 F;  2CPB A;  2BAS A;  3N4X A;  1KB9 H;  2K3R A;  2KXP B;  4DT0 A;  4HJG H;  1WQL A;  3R2P A;  1EXJ A;  4HM0 A;  1PP9 J;  2YIU C;  3S4R A;  1AVY A;  1URQ B;  2BCC E;  1EDK A;  3EWK A;  2J58 A;  1VQ4 P;  2QJK C;  2P1J A;  2OYI C;  2HR3 A;  1S9K D;  2WQY C;  3Q5S A;  3B5N D;  1S5L H;  1YI2 P;  1DEB A;  1Y9B A;  3N7N A;  4Y99 B;  2OTL P;  4GKG A;  2KS1 B;  2M3E A;  3OA7 A;  4D6T D;  3CPW O;  2FXP A;  1PGQ A;  2LKM A;  4GT1 A;  4WBA A;  3RBX A;  1QGK B;  5APW A;  3GHG C;  1JCD A;  2H43 A;  1BE3 J;  2M3B A;  2LXB A;  1VDF A;  3KQG A;  3A5T A;  2OYH A;  3A7O A;  2R3S A;  3CLQ A;  5GTI E;  4I6M C;  4QMA A;  2I7F A;  3L75 D;  1HF9 A;  1KQG B;  2W90 A;  5APT A;  2QJP C;  1FZC A;  1EDL A;  4AAY B;  3MUD C;  2YKO A;  2I1J A;  3O6Q B;  3TGU J;  1H0T A;  3V6I A;  2FKW B;  2A45 H;  2OYI B;  1RQV A;  1DD3 A;  4HM3 A;  1PV3 A;  2LR2 A;  3AE1 C;  1R8E A;  1ZRT E;  3RL0 D;  3AEA C;  4EDF A;  3FX0 A;  1LNQ A;  3AE3 C;  2IX7 C;  1GTW A;  3SFD C;  3CC2 P;  3H1K G;  3AEE C;  1SFC A;  1LTJ C;  1L0L G;  1Q90 D;  3VCA A;  1KZU B;  5KJ7 D;  1IJD B;  1KB9 E;  3GCE A;  3ZDM A;  4NB8 D;  1HVV A;  1SVF A;  3H1K E;  5CMZ A;  2KLV A;  4ASV A;  4PV1 C;  3M91 A;  4U3F E;  3F89 A;  5AW7 B;  3RL0 C;  1NTZ G;  1AJY A;  5KTB A;  1W2B O;  4OH8 B;  3TDK A;  2KOG A;  3V4W A;  1SQB E;  2E75 C;  5HL4 A;  4UB8 H;  2QVA A;  3K5B A;  3KZI H;  1S2E A;  4OVN F;  2WSC J;  1PP9 E;  4RJT A;  3L72 E;  2E76 C;  1RHZ B;  1FZB A;  3I56 P;  3CCR P;  1SQP G;  2NPS A;  2FY8 A;  3AE6 C;  1JO5 A;  5KLV G;  2Z5I A;  2HMK A;  2ZVO B;  4IFF A;  2NVF A;  1LTI C;  2FYN B;  3BAT A;  2ZXX A;  2I1K A;  1N7S C;  1JUN A;  5KAF H;  1BCC E;  3CCU P;  1NU1 D;  1S3J A;  4YPC A;  1VQL P;  2FYU D;  2BMO A;  1FS0 E;  3BAS A;  1M57 D;  1L0N J;  2HMJ A;  3OW2 O;  5GTH H;  2XU6 A;  3WUU A;  2O1K A;  2D2C D;  3L74 G;  3L37 A;  2O3J A;  3GL2 A;  1MZ9 A;  3L73 J;  3WUV A;  3GZY A;  3KHU A;  1YIT P;  3IR9 A;  1KIL D;  4QDF A;  3JCU E;  5CBN A;  1DH3 A;  1X8Y A;  2AXC A;  1CSB A;  2XSO A;  1FOS F;  1VQ6 P;  1RE3 A;  1GW3 A;  2V4H A;  1SQX G;  3G71 P;  1FU1 A;  2B1X A;  1M8O B;  1BE3 G;  5DJT B;  2BMR A;  2E5T A;  2R32 A;  1KYO D;  1NWQ A;  1S72 P;  5AVZ B;  2ZVN B;  1L0N K;  3L35 A;  1VQO P;  3GZX A;  3JSV C;  1AA0 A;  4IL6 X;  1KYO E;  1L0L J;  2UWJ E;  1KIL A;  1PGP A;  2IFN A;  2DE5 D;  3PLN A;  4K35 A;  5BU8 B;  4D6T G;  3SWK A;  2QG4 A;  2C0X A;  1SQQ G;  3H1I D;  1QEX A;  1LT9 C;  1IK7 A;  3I55 P;  2FBW C;  1RF1 A;  2AXT E;  2E43 A;  3TGU E;  1HUC A;  1NTZ J;  3G9R A;  3KPE A;  3IF4 A;  5KLV E;  2XV5 A;  2XR8 A;  1BGY J;  4EMJ B;  3QH9 A;  1Q7Y Q;  1JM1 A;  4I7Z C;  1EZV I;  4BRY B;  2YKP A;  1VQP P;  3D70 A;  1SQX K;  3M0D A;  2W6J H;  4UB8 E;  5TIS E;  1O7G A;  2N9B A;  2NRG A;  2K9Y A;  1FDI A;  2ZT9 C;  3VP9 A;  1URQ C;  2XSH A;  4XA4 A;  3CCV P;  1NTK E;  2FYU K;  3TK1 A;  1EQ7 A;  4K3A A;  1Y47 A;  5TJH A;  4H44 C;  5CBO A;  4Y28 J;  3AED C;  1NJI Q;  1NTK D;  2PGD A;  3D89 A;  4IL6 H;  1G1J A;  2IYP A;  1VQ9 P;  5K5G B;  1SFC D;  1FE6 A;  3GL0 A;  1N86 A;  3V2R A;  2ZXE B;  4W7Y A;  3L72 J;  2ZT9 D;  2KSJ A;  1URQ D;  2Y9Y A;  2Q3I A;  1A02 J;  1M56 D;  3AEF C;  4PD4 H;  5KLV D;  2N1T B;  2B87 B;  1K04 A;  3TNU B;  5KAI H;  1D7M A;  4TT3 H;  3QWO C;  2E4P A;  2OYH B;  1JY2 O;  2OGU A;  2JP3 A;  1EDI A;  3MIW A;  2KP8 A;  1GK6 A;  3VMG D;  2YXR B;  3HD7 A;  1SQB D;  2N1T C;  5CJ0 A;  1JM0 A;  3WUT A;  5AW8 B;  3Q5P A;  1G2C A;  3CI9 A;  1M1K Q;  2KNC B;  1LJ2 A;  3PHL A;  4HM6 A;  3L75 G;  2Z4E A;  4U3F D;  2ZJS E;  5APQ A;  1LGH B;  2DW3 A;  4HKZ H;  2BEQ D;  4RES B;  2NPS D;  2A45 I;  4AQR D;  2JWA A;  3H6P A;  1QX8 A;  4L74 A;  2QRX A;  1HGV A;  5B5E H;  1SQP K;  3S1K A;  4I2L C;  3BCC G;  1RE4 A;  3GF3 A;  1G8K B;  1P84 I;  4O9B A;  1NAF A;  1GU4 A;  1HBW A;  2FYU G;  1WRG A;  4MN4 C;  2HML A;  1L4A A;  3H1I J;  3O8Z A;  3SWY A;  1GL2 C;  4IOI H;  2P67 A;  3D6Z A;  1JY2 N;  1BSH A;  3CL3 D;  5KAF E;  5AEW A;  1HGZ A;  1QVG O;  3SSU A;  5BOK A;  3KDP B;  3UIA A;  1ZLL A;  3EFF K;  3E7K A;  2YKQ A;  3L70 J;  3Q3D A;  1H0T B;  4P1C H;  1HTL C;  4QDF B;  1FOS E;  4NBA D;  1NTK K;  2FYU E;  1GL2 D;  4AUW A;  1EC5 A;  4D6T J;  2WSC H;  1SQQ J;  2E42 A;  2O01 N;  1CI6 A;  3RK2 B;  2FYZ A;  2WPQ A;  2Y0C A;  5APV A;  4QDC A;  5AVQ B;  2MJZ A;  2WSE J;  2HG5 D;  1L4A B;  4OGQ B;  3HUS C;  4PD4 I;  2YO3 A;  1BGY G;  1S4X A;  1SQV J;  3PH0 A;  3L72 D;  3VP8 A;  1IZN B;  3P7K A;  2PAJ A;  3G4S P;  1OMI A;  3TGU D;  1NU1 G;  5AVR B;  1USD A;  1JTH B;  3AE9 C;  3CX5 I;  1N73 C;  4WY4 B;  1N7S D;  1IC2 A;  2KIK A;  2KLU A;  3A0B E;  4NBE D;  3L36 A;  3HRN A;  3H1L J;  2J59 M;  3L74 D;  2KYV A;  1UUV A;  3FWL A;  1OXZ A;  5KLI C;  2XKM A;  1TU3 F;  2P10 A;  3GW6 A;  1L2P A;  1O7M A;  1DX7 A;  1N2D C;  2FYN C;  1HJB A;  1RF0 C;  1LP1 B;  1YYC A;  1ZOY C;  1T6A A;  3L72 G;  2G8Y A;  4L73 A;  2JZA A;  4HJL A;  1UIX A;  4A7P A;  1JB0 J;  2OTJ P;  2POH A;  1LTG C;  1SQX J;  3VYI A;  4ZKP A;  5M1B A;  3HE4 B;  5CCH A;  5AW4 B;  2SPZ A;  2Q3E A;  1HJ0 A;  2GBW A;  2Q9I A;  1FDO A;  1R5S A;  1PIX A;  1NDO A;  1G8J B;  3HE5 A;  1AQT A;  1O7P A;  4HB1 A;  2Q1K A;  4WB4 A;  5CCG C;  5C39 A;  1KIL E;  3A3Y B;  1U7M A;  2E76 B;  1NTM K;  2K1A A;  4PV1 B;  3VMH D;  5APU A;  4EYY Q;  1YJW P;  1HH0 A;  2HYN A;  1NTK G;  4NB9 D;  1PGO A;  4IL6 E;  1FQT A;  4N6J A;  3AE5 C;  4WY4 C;  1N73 B;  2OYI A;  4PJ0 H;  3C0D A;  1JCC A;  1L0L K;  3CC7 P;  3KXD A;  3B5N A;  1SP4 A;  1E79 H;  4L76 A;  4CPG A;  1IFI A;  4D6T E;  3C1L A;  3MTU E;  4N3Y B;  2FYU J;  1SQP D;  4HM7 A;  3IN6 A;  4JQ0 D;  4NBH D;  3CWB G;  1NTZ K;  1J1D B;  1S9K E;  2XNX A;  3R4Y A;  3FXD A;  3T97 A;  5TIS H;  4ASW A;  3W67 A;  1Y8A A;  4YXW H;  3RK2 C;  5KJ7 C;  2K88 A;  2BCC G;  2KZJ A;  2KZI A;  2IBZ I;  3CXH H;  2E74 B;  5APX A;  1CZQ A;  5EFW B;  1KD1 Q;  2J5U A;  3EQ2 A;  3GMA A;  2O01 J;  1FZC C;  1NTZ E;  2Q5U A;  5BVZ A;  3H1I E;  3GF7 A;  1IO4 A;  1BDC A;  2FFD A;  3H1J E;  4I7Z B;  3VMA A;  4YXD C;  2E74 D;  2K37 A;  2BMQ A;  2JWD A;  1Q2N A;  1NU1 J;  1NHL A;  1Z56 A;  2R3C A;  3EN1 A;  1P84 D;  1CW5 A;  3H1K D;  2XND H;  1QL2 A;  3Q2Y A;  1KB9 D;  1SFC C;  3AEG C;  2H8P D;  1T8Z A;  3GLM A;  5KAI E;  1M1J B;  2OTK E;  1LT9 B;  3NXS A;  1SS1 A;  2I8D A;  3GHG B;  3A0B H;  3H1L G;  2V7Q H;  3HD7 D;  1EZV E;  2E74 C;  1Q90 C;  4Y99 C;  3L71 J;  2NVE A;  1PFI A;  1ZRT D;  4KHX A;  1E5W A;  3PTZ A;  1KFN A;  5AVY B;  1BCC G;  2WMM A;  2IZ1 A;  2A06 D;  1LP1 A;  1MKM A;  2N1T D;  3VOP A;  1VQ8 P;  5H2F H;  4PV1 D;  2ZAE B;  1JY3 P;  2WVR A;  3CX5 H;  1NKN A;  1HWT C;  3ITK A;  2Y9Z A;  1S5L E;  3L75 E;  2A06 G;  2C9L Y;  4H0L B;  2WZ7 A;  2HPC B;  3E1I A;  2YMK A;  3RBZ A;  2HOD B;  3F5H A;  3HE4 A;  2NPS C;  3CCS P;  1OIP A;  4KJM A;  3CCE P;  5GTH E;  1ZME C;  4JYC A;  2GUS A;  3A0H H;  1NU1 E;  1BCC D;  4W80 A;  3BRT B;  1X79 B;  3H32 A;  3H1J J;  4HH2 A;  1MFT A;  1OVR A;  1IFD A;  5KKZ C;  3CXH I;  4TLF A;  1NVO A;  5AW6 B;  1XTG B;  4KT0 J;  2BCC D;  3M06 A;  4HYT B;  1VQ5 P;  1Q81 Q;  4P1B H;  4B86 A;  4GOD A;  3M9B A;  1PP9 D;  5AVS B;  3B8E B;  4HM5 A;  3NMD A;  1BGY D;  1R5L A;  2FXM A;  1VQK P;  2ZYA A;  1N7S B;  4UB6 E;  3U1C A;  4H13 B;  2R5B A;  3M0A A;  1SQB K;  1SQQ K;  3VMZ A;  3DQY A;  3H1H D;  2GBX A;  5KLI B;  4AIV A;  1KYO H;  1VL2 A;  1NH4 A;  2WSF H;  1MV8 A;  3H25 A;  1M90 Q;  1YJN P;  1BE3 D;  1L4A D;  4OGQ D;  4U3F J;  4RKU J;  5BU5 A;  3S9O A;  3H1K J;  2OAR A;  2E75 B;  3GKE A;  2AEM A;  2IYO A;  3WU2 E;  2FXO A;  2QPZ A;  3MP7 B;  1YTZ T;  3Q1M A;  1IK9 A;  5E79 E;  3V2Q A;  1M7L A;  3BCC E;  5DJU B;  2WT7 A;  1EZV G;  1VPC A;  2KB7 P;  1KMI Z;  4H44 D;  4NBD D;  1H8A A;  3MGN A;  1OX3 A;  1LWU A;  1YBK A;  5B66 H;  3HUS B;  3HTK B;  2CKF A;  2YMY A;  5AVU B;  3L4F A;  4EOT A;  4PJ0 E;  1G2C B;  1NYK A;  2D2C B;  1IFJ A;  3L73 E;  3V2N A;  5AW0 B;  2E4Q A;  3VMY A;  1VF5 C;  2L5G B;  5H2F E;  2M0B A;  3MHV A;  3I5C A;  1JY3 N;  2IBZ D;  3L70 D;  3M0D C;  2JO1 A;  2IFM A;  1VQ7 P;  1URQ A;  2H7H A;  1JNM A;  2Q3W A;  1PL5 A;  4XE5 B;  1SJG A;  2OQQ A;  2NUM A;  4UB6 H;  3CX5 D;  2JDI H;  4H0L D;  3CCQ P;  4C7R A;  1KV4 A;  3RK3 B;  4HM1 A;  1M1J C;  1H88 A;  2PFX A;  3LID A;  1OW7 A;  2K9J B;  3RK3 C;  3AE4 C;  1T2K D;  4C46 A;  2W8Z A;  1KYO I;  2B87 A;  2Y0E A;  1ZR2 A;  1VQN P;  3V2P A;  1RIE A;  4ZNC A;  2KNC A;  4HKV A;  2YVJ B;  3C9I A;  2W6B A;  3FGA D;  3B71 A;  3VTP C;  3NTN A;  4OWF A;  1G1I A;  4NBC D;  4QUR A;  1K9M Q;  4R4M A;  1FZC B;  3L73 G;  3W68 A;  1SQQ E;  4EIJ A;  2N1T A;  1ZP0 C;  3RK3 D;  3H1L D;  1FZE A;  1T2K C;  3G3Z A;  3L74 J;  3L71 E;  1O7N A;  1OW6 A;  3M9H A;  2FFD B;  3GHG A;  4DCK A;  1ZR4 A;  1SQX E;  3USS A;  1VQM P;  4NBB D;  1J1D C;  2OYH C;  3SFE C;  3U1A A;  2QM8 A;  2C0W A;  2KS1 A;  1RFS A; 
#chains in the Genus database with same CATH homology
 2XRX A;  2NVE A;  2DE6 D;  3D89 A;  2DE7 D;  2B1X A;  2HML A;  4D6T E;  2YFI A;  2ZYL A;  4QCK A;  4NBE D;  2NVG A;  2BMR A;  3GTE A;  1L0N E;  3AZC A;  2Q3W A;  1PP9 E;  4QUQ A;  3L72 E;  1NTM E;  1SJG A;  1ULJ A;  3DQY A;  4NBG D;  2GBX A;  4HM7 A;  4PV1 D;  1UUV A;  2NUM A;  4AIV A;  5KLI C;  4NBH D;  2YFJ A;  3GL0 A;  3VMI D;  4H0L D;  2I7F A;  1BE3 E;  4HM4 A;  3FOU A;  1O7M A;  5AEW A;  4HM1 A;  2ZT9 D;  3GZX A;  2FYN C;  3L75 E;  3H1L E;  2QJP C;  2HMK A;  4HM8 A;  4OGQ D;  4AAY B;  2NVF A;  3N0Q A;  4QUP A;  3VCP A;  2JZA A;  3EQQ A;  1O7W A;  4HJL A;  5BOK A;  3H1H E;  3L74 E;  1VF5 D;  3GOB A;  1SQP E;  1KYO E;  4QDD A;  3GKE A;  4P1C H;  4HM3 A;  2DE5 D;  2QJY C;  2E4P A;  2QPZ A;  1ZRT E;  1BCC E;  4QDF B;  1RIE A;  4NBA D;  1SQV E;  2FYU E;  1O7H A;  1EG9 A;  3VMG D;  1NTZ E;  1VM9 A;  5AEU A;  2GBW A;  4HKV A;  1UUW A;  2YVJ B;  2IBZ E;  3H1I E;  3L70 E;  3BCC E;  2BMO A;  2YFL A;  1NU1 E;  1WQL A;  1NDO A;  1G8J B;  1VCK A;  1O7P A;  2HMM A;  2HMN A;  1PPJ E;  1BGY E;  3H1J E;  3TGU E;  4H44 D;  4HM0 A;  2E75 D;  4NBF D;  4NBC D;  4NBD D;  4QUR A;  2HMJ A;  2E74 D;  3VCA A;  5KLV E;  2BMQ A;  2YIU C;  4QDC A;  4HM2 A;  4HM6 A;  1SQQ E;  2XR8 A;  2D2C D;  4EMJ B;  2CKF A;  1KB9 E;  3EN1 A;  3GCE A;  5KKZ C;  2BCC E;  3GL2 A;  3GTS A;  4NB8 D;  2HMO A;  2QJK C;  3H1K E;  3L71 E;  1JM1 A;  3GZY A;  1O7N A;  2E76 D;  1P84 E;  3CX5 E;  4U3F E;  2JO6 A;  1NYK A;  3GB4 A;  2NUK A;  1L0L E;  3VMH D;  1O7G A;  3CWB E;  4P1B H;  3L73 E;  4QDF A;  2NWF A;  1SQX E;  2XSH A;  2A06 E;  4NB9 D;  4HM5 A;  1FQT A;  4NBB D;  3CXH E;  4PD4 E;  4H13 D;  2E4Q A;  5CXM A;  1NTK E;  2B24 A;  1G8K B;  3C0D A;  1ULI A;  1EZV E;  1SQB E;  5HL4 A;  2XSO A;  1Q90 C;  1RFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...