3H1HE

Cytochrome bc1 complex from chicken
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
total genus 40
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1hE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1hE02
1O7PA 3VCPA 2GBXA 1Q90C 2HMMA 2E75D 5AEWA 4P1BH 4D6TE 2HMKA 2D2CD 2DE7D 2QJKC 3H1JE 3GL2A 5HL4A 1BCCE 2CKFA 2DE6D 2XR8A 1UUVA 4HM2A 2BCCE 2QPZA 4HM1A 4H0LD 1VF5D 3GZXA 4NB8D 2HMJA 4HM3A 2IBZE 3VMHD 1FQTA 1NTKE 4P1CH 4AIVA 1WQLA 2FYNC 4HM0A 2YFLA 4U3FE 3GL0A 1VM9A 3BCCE 4H44D 4QDCA 1UUWA 1JM1A 3H1HE 3GCEA 4NBHD 3H1KE 1ULIA 1SQBE 1KB9E 3VMGD 2E4QA 4QUPA 4HM6A 3VMID 1NYKA 3L75E 5KLIC 3L71E 1RFSA 1SQVE 2JZAA 1ULJA 1VCKA 4QCKA 4QURA 2DE5D 3GTSA 3L74E 2E74D 2XSHA 4HM4A 3EN1A 1NU1E 2HMNA 4PD4E 1EG9A 1G8KB 3C0DA 4H13D 4NB9D 4AAYB 2NUKA 1SJGA 1SQPE 1EZVE 3GB4A 3GZYA 2A06E 2YFJA 1BGYE 1RIEA 2JO6A 3AZCA 4NBAD 3DQYA 2HMLA 2BMQA 4NBED 1O7NA 1SQQE 2NVGA 5BOKA 4HM5A 4QUQA 5AEUA 1G8JB 1PP9E 4HM7A 3CX5E 2NVEA 4HM8A 2QJPC 1BE3E 3CWBE 3EQQA 4HKVA 1SQXE 2NUMA 4NBDD 1L0NE 1NDOA 4QDFB 2NWFA 2GBWA 2ZT9D 1PPJE 2E4PA 1KYOE 4QDDA 5KKZC 2Q3WA 3VCAA 3GOBA 2B24A 4QDFA 3L73E 1NTZE 2QJYC 5CXMA 2YFIA 5KLVE 2ZYLA 2NVFA 1O7HA 2I7FA 3FOUA 1ZRTE 1L0LE 3GTEA 2BMOA 3CXHE 4NBGD 2YVJB 3L72E 3TGUE 1O7WA 2XRXA 3N0QA 2B1XA 4HJLA 1O7GA 4OGQD 2FYUE 2YIUC 2HMOA 1O7MA 1NTME 4PV1D 3H1LE 2BMRA 3GKEA 3L70E 1P84E 4EMJB 2XSOA 3H1IE 3D89A 4NBFD 4NBBD 4NBCD 2E76D
chains in the Genus database with same CATH superfamily
1O7PA 2A45G 1JMBA 3HD7D 1FZCA 1NKZB 5AW3B 2KB7P 5HL4A 1LTBC 1CI6A 4O9BA 3G3ZA 3MTUE 3AE1C 3Q3DA 4P1CH 1NJIQ 2ZT9C 1RF1B 1H8AA 3TNUB 3T97B 2BEQD 3AE6C 4U3FJ 3L71J 4EYYQ 1R5SA 3CCLP 3B5ND 1LTJB 1SQPJ 2KIKA 4EOTA 1KQLA 1M8OB 2IYPA 1M1JB 3AE9C 5CCHD 3KQGA 1RQVA 2YO3A 3BRVB 1S4XA 4Z1MH 2IBZG 3NTNA 1BE3J 1NU1K 3HRNA 4JBZA 1KQGB 5DJUB 1S72P 2KS1B 1URQC 1LT9B 3IAOA 2QE7H 3CWBE 2DW3A 2KLVA 4L76A 3AEGC 1SQVJ 5TJHA 3GOBA 4QDFA 2YXRB 1K04A 2Q1KA 3AE8C 1FOSE 1GL2C 1L0LE 1MZ9A 3LIDA 1FOSF 1G2CA 1USEA 1VL2A 1VQLP 4HKZH 2POHA 2QRXA 1O7MA 3PRJA 1R5LA 3SWFA 1K9MQ 2IZ1A 2E43A 1XTGB 5KKZB 4U3FG 3A0HH 2JEEA 1OIPA 4IOIH 5EFWB 3L73G 3AEBC 3HE4B 1EZVI 3GL0A 4C46A 3D71A 1KB9H 1N73B 4M3LA 2D2CB 1GZLA 2E74D 1N7SB 2WMMA 3H1KD 1HWTC 3C0DA 5C39A 4AAYB 2ZFCA 1LWUB 3VMXA 2GUVA 4PV1C 1H0TA 3CCEP 1J1EB 3CX5H 2WPRA 5AVTB 1JB0J 1NTZK 2WSFJ 1T6AA 3GG2A 1L0LD 4RO0A 2KK7A 3VOPA 1VQ9P 1NYHA 4K3AA 3CXHD 3L37A 2A45H 3V4QA 1PIXA 4C7RA 3PJSK 3OAKA 1LP1B 3VP8A 1KYOI 4C7NB 4LC1A 4PD4I 4IFMA 3TGUE 3CI9A 1O7WA 2FYUE 1KC8Q 4JYBA 3L75G 2N1TA 3CD6P 3TGUD 2OYIA 3ZDMA 2WPVB 1L2PA 2E76D 5TISE 1ZN5A 3VTPC 1BCCE 1RF0C 2CK3H 1L4AD 1NAFA 2O01H 2P7JA 3CX5I 2HMJA 3A0BE 1FU1A 1IFIA 3G71P 4NPDA 5AVRB 1JMMA 3TDKA 3H1KE 1VDFA 3P8MC 2Q3EA 2WSSH 2JZAA 1JTHA 2YO2A 2JP3A 4N78E 2AEJA 4JF7A 5KAIH 1SQPG 1KB9D 1IZNB 4H13D 1Q86Q 3AEEC 2QEXP 1QGKB 1T2KC 4HH2A 2FYNB 4HM5A 3P32A 2JO1A 3GHGC 3M0DA 5AVYB 1BE3E 2ZJSE 1W2BO 1DIPA 3B5NB 1LWUC 2NUMA 1SS1A 3H1JJ 2IBZI 1BE3D 3CXHH 1N7SC 5E79E 1A02J 1XTCC 2WSCJ 5KLVE 1NGMB 3FOUA 1ZRTE 1L4AB 2H8PD 1GK4A 3AEDC 1LNQA 1GDTA 1RHZB 1H88A 1NU1J 2FFDB 1FE6A 3L70J 1ZOYC 3JC22 4D6TD 1KQFB 1EDLA 1RQUA 1Q90D 1OW6A 3M9HA 4R4MA 2QPZA 3HUSB 5APQA 2L91A 1SQVD 1HGZA 1H0TB 1WQLA 1N73A 2KOGA 5GTHE 5AVQB 3R4YA 2BEZF 1URQA 1WMKA 1M1KQ 1PFIA 1X0TA 4A7PA 1NKNA 3O6QB 1JY3O 2KSEA 3B71A 1USDA 2W27A 1KORA 2NPSA 1OXZA 1SQQK 3L35A 4YXWH 2NVGA 1SQQJ 2MKVA 3LW5J 2PAJA 5KLVD 3RL0C 3VMZA 5AVUB 1IJDB 1LJ2A 2WTYA 4HKVA 3K5BA 4R4LA 4QDFB 3CLQA 2Q3WA 1X8YA 1NTZE 4I7ZB 4N3YB 1Q82Q 5CXMA 1EXJA 3CCSP 1FBMA 4LGDE 2RH0A 3CMAP 3AE5C 3HD7C 1DD3A 1QEXA 2XZRA 3L74J 1PPJG 2ZT9B 1IFMA 3NXSA 4KT0J 1O7GA 4OGQD 1JUNA 1ZMEC 1NTKG 2BMRA 3L70E 3C1LA 3M0AA 2O3JA 2XDJA 3CL3D 1PP9J 2OTKE 1SQBG 4BWNA 3VN0A 2KNCA 1Q7YQ 3USSA 3FXDA 5CHXA 4DJGA 3HTKA 4WWIA 2HR3A 2N1TC 3H1HE 2FYUK 4EIJA 3AEFC 2B89A 4H0LB 3H1HD 3FGAD 3H1KJ 3TGUJ 4XA4A 4RJTA 2OARA 2P1JA 1JY2P 2PP6A 2W8ZA 2A06G 3W67A 2YMYA 2HLOA 2P2UA 5CJ4A 2FXOA 3AZCA 1JCCA 1JM0A 1W2EA 2R44A 3V2NA 2YKPA 2NZ2A 4BRYA 1CI6B 1FS0E 2CPBA 4D6TJ 2AXCA 3CWBD 1L0LJ 3P8CD 2ZYLA 3VMAA 2I7FA 2WT7B 3GTEA 3IFMA 1LTTC 1K05A 1YJ9P 3C8VA 3H1LG 2A45I 3H32B 2V4HA 2W6AA 1P84E 4HB1A 4Y99C 3KPEA 3H1JD 4I7ZC 1KYOH 3CMEP 3FXEA 2B9BA 1VQPP 3H1JE 3IF4A 3HUSA 2FYUD 2IPPA 2GUSA 3VMHD 4JPZB 1VQ4P 2WPQA 2IBZD 3BASA 1SQBE 2E4QA 3V4WA 1JTHB 3L75E 3A0HE 4YXDC 4QCKA 1NU1D 5H2FE 1ULJA 1VCKA 5DJTB 1G2CB 1FDIA 1P84H 3C9IA 3L70G 1NU1E 5CMZA 5AVSB 3KZIE 1BDCA 5GTIE 2K9YA 3AE4C 1EZVG 2G8YA 4GIFA 3S9OA 1J1DB 1S1CX 3I56P 3Q1MA 4NBED 1GU5A 3GHGB 1Y9BA 1ZP0C 2XU6A 3EQQA 1KYOD 2P67A 5KAFE 4WY4B 2WWWA 2E5TA 5H2FH 2NWFA 4GT1A 3VCAA 2B24A 1FDMA 2RMZA 5CCHA 1L0NJ 3KHUA 1AA0A 3HD7B 3RL0g 1P84D 1CZQA 1KMIZ 1OWAA 2J59M 3L4FA 3RK2C 2M3BA 2WVRA 1IK7A 2XRXA 1PL5A 3N0QA 1M56D 3WU2E 1MV8A 3H1LE 1VQ5P 1W5CE 1KFMA 2JWAA 1BE3G 1FQTA 4MN4C 3FWNA 4I6MC 2W83C 3N4XA 1FZGA 1G1JA 4HM1A 2HODB 1S5LX 3PP5A 3H1KG 2IDBA 5CBNA 1X79B 3MHVA 1HGVA 2FYNC 1LT1A 2YFLA 2R5DA 3BCCJ 4GODA 3GCEA 1ZR2A 1FJPA 2XKMA 4HM6A 1T2KD 2KP8A 2OQQA 2OYOA 3GTSA 2WZ7A 3L74E 1VQ6P 1DX7A 2WSFH 1S3JA 2M3EA 3N7NA 4PD4E 4GOFA 3PHLA 2YNYA 3A3YB 3H1IJ 1SQBK 5CCGD 1YJNP 3CX5D 4NBAD 1Z56A 2HMLA 4IL6E 3SFEC 2M8RA 4Y28J 1URQB 1FZFA 1G8JB 3NMDA 2QJPC 3RL0B 4RESB 4AUWA 3CCVP 2Q9IA 3OA7A 3Q5SA 1BDDA 2J5UA 5KTBA 1PPJE 1LTJC 2NPSD 1O7HA 2XNXA 5AW2B 1OVVA 1LTIC 2KSJA 2OGUA 2G3AA 3GLMA 4UB8E 1CSBA 4NBCD 1DEBA 4D6TE 3Q2YA 2HMKA 2LXBA 2D2CD 4UB6E 1H89A 1R8EA 1VPCA 1UUVA 2LR2A 1J1DC 1LT9A 1S9KE 1IFJA 2M0BA 1GMJA 3M9QA 2HYNA 2R32A 4PD4D 2JDIH 4QUPA 1PGPA 2D2CC 5KLIC 3V2QA 2FFDC 2FXMA 2A06D 1X9VA 1URQD 2ZYDA 3L75J 1VQMP 2K9JB 2H88C 4YPCA 2AEMA 2LXCB 1KN7A 1VQNP 4ZKUA 1JOCA 1RY3A 1SQQG 3Q5RA 1O7NA 1FZAA 3MUDA 1GD2E 5AEUA 2P10A 2I1KA 3PLNA 4UB6H 1N8RQ 3O8ZA 3HE5B 1M1JC 2N1TD 2GBWA 4UB8H 5M1BA 2ZT9D 2I1JA 4TLFA 4QDDA 5KKZC 5AW9B 2PFXA 2QJYC 1PP9D 2NVFA 2LKMA 5GTHH 1HH0A 1KB9I 4NPFX 3PH0A 1K73Q 4BRYB 5KLVK 3H1JG 1SVFA 3EWKA 2Z5HA 1AQ5A 3CWBG 3D89A 3G9RA 4NBFD 4NBBD 1CW5A 1JEKA 3TF5A 1RE3A 3Q5PA 1NHLA 1MFTA 5AW1B 3TNUA 1YI2P 4AIVA 1HUCA 3CCMP 1UIXA 3B8EB 3BATA 2H89C 3RK2D 1RE3C 3E1IA 1JM1A 2BCCD 3VMGD 1L4AC 5E79H 1S5LE 5KJ7C 4OVNF 4I1LA 1RF1A 3EN1A 3CCQP 3A7OA 1E5WA 2K88A 2N1TB 1HJ0A 3M06A 1BGYE 1HF9A 1SP4A 1RIEA 2Z4EA 1YQ4C 4I2LC 1AQTA 4LLHA 1Y8AA 3D6YA 1OW8A 2W6JH 3HUSC 4DZOA 1LP1A 2P58A 2H7HA 2KS1A 1LGHB 2E4PA 1KFNA 3RK3E 1WT6A 1PV3A 5AVZB 3TSIA 3KDPB 2YKOA 2E75C 3L74G 3LW5H 1YITP 2Q3IA 1KTMA 1UIIA 4W7ZA 1SQBJ 2B88A 1G1IA 1ZV8A 2E5YA 2ZVOB 4XFJA 2B87B 2R3SA 2GM4A 5CCHC 1FZEA 3HE4A 3SWKA 1M7LA 2IX7C 1J2JB 2HODA 4L73A 1VQ8P 5CJ0A 4H0LD 3SWYA 3WMM0 1QL2A 2IBZE 5B5EH 2E42A 3MZWB 1SQBD 2BCCJ 1NTZG 2QIWA 3KZIH 3R2PA 1FAVA 4NBHD 1SQXJ 1HVVA 4Y99B 2IYOA 5APVA 5AVVB 1A02F 5APYA 1NYKA 2J58A 3L71E 1SQXK 1GW4A 2WT7A 4K35A 1KILE 1SFCB 1L4AA 4HM4A 3T97A 1FC2C 2Q7CA 2C9NY 1SLQA 1EZVE 4OH8B 4WY4D 2C9LY 3GZYA 3S4RA 3B5NA 1LTJA 1Y47A 3M9BA 2C0WA 3A5TA 1NH4A 3VYIA 2QJKB 1VQKP 1IFDA 3RK3B 4ASVA 1L0NE 2WSEJ 3LIEA 4HYTB 5AVXB 3MGNA 3AECC 3L73E 3U1CA 1YHQP 2FFDA 3RL0D 2AXTH 3CXHE 1YIJP 1YJWP 2UWJE 3TGUG 2GA1A 2YVJB 3GF3A 1E79H 2B1XA 1QVGO 1GU4A 2K37A 3JCUE 3O6QA 1BCCD 1LTGC 3II6A 2M5AA 5AW5B 1YYCA 2CPSA 3H1LD 4BXLA 3BRTB 4B86A 3U59A 2DE7D 3ABVC 2HFED 4JYCA 2XR8A 4HM2A 4HJGH 1IFNA 5CCGA 3JSVC 2FYUG 1GL2D 2ZVNB 1NTKD 1U7MA 1DH3A 1T8ZA 2V7QJ 2N9BA 2FBWC 3WUUA 4N78D 5CCGC 2R5BA 3V6IA 2KZJA 4L74A 2XSHA 3V2PA 2KZIA 2HMNA 1T3UA 1EG9A 4EDFA 3H25A 4OGQC 1HTLC 4NB9D 1SQXG 2A06E 3CC7P 3TYYA 1EDIA 2QA4P 1N7SA 1KD1Q 1M57D 4EI2A 1EDKA 2HPCA 1WRGA 3B5NC 2NVEA 1JY2N 2Y9YA 3D6ZA 4H13B 3G4SP 4TT3H 2PRRA 3W68A 5CBOA 1HJBA 3B4SA 3TK1A 1K8AQ 2OYHA 1OVRA 5BU5A 2W6BA 1OMIA 2ZAEB 4ZMDA 1N7LA 3WUTA 3RBZA 5K5GB 1QL1A 2SPZA 3JCUH 5KAFH 1ZRTD 1BGYJ 1NTZD 2WQYC 3WUVA 3FWLA 1KZUB 2KXPB 4EMJB 4GDOA 3F5HA 2QG4A 4P1BH 1SFCA 1PP9G 1S9KD 1BCCJ 5APXA 4DT0A 4JQ0D 1JCDA 3MP7B 5AVWB 2C0XA 1VM9A 2O1JA 1D7MA 3H1HJ 1AVYA 1AVOA 1KB9E 3AE3C 2ZYGA 4GKGA 1RFSA 1VF5C 2DE5D 4IFFA 3RK2B 1ZLLA 2FYZA 3AEAC 1RF1C 2NUKA 3H32A 2JO6A 1SQPK 2BMQA 1NTMG 2MJZA 4HM7A 2Y0CA 1IC2A 1AFOA 4N6JA 1RF0A 4NPEA 2OYHC 1SQXE 1NDOA 2W90A 5KLVG 1HBWA 2IZ0A 2RKLA 3CXHI 3NFQA 1VQOP 3AE2C 4PV1B 5GTIH 5APSA 2BMOA 2XNDH 1YBKA 1SQVK 1YQ3C 3P8CE 3U1AA 4PV1D 3GKEA 4WB4A 2M5AB 3CCRP 1PGQA 1Q81Q 4IFDK 3VMID 2H43A 3RK3C 2L5GB 1Q90C 2E75D 1LTAC 2QJKC 1LT9C 1M90Q 1KQSO 1OVUA 3L36A 3GL2A 2ZXEB 2DE6D 2O01J 3EFGA 1JY3N 3GZXA 3GHGA 3M0DC 5B66E 2KI7B 3CCJP 3L73J 1ZXGA 3H1HG 4PD4H 1UUWA 4WBAA 4WY4A 4RKUJ 3V2RA 1N86A 2KNCB 3CPWO 3MUDC 1BSNA 1BSHA 4IL6X 1KV4A 3BCCD 1Q2NA 2QM7A 1GL2B 4CPGA 2KUBA 2FY8A 1SQPE 3GB4A 3SFDC 1FZCC 2YFJA 1S5LH 1NTMJ 1KILD 1PZQA 1SQQE 2ITAA 2E74B 1PP9E 1NTMK 1BGYD 4HM8A 5APTA 2OTLP 1SQQD 4PJ0H 2IFNA 1QLED 1QX8A 4H44C 4D6TG 2ZYAA 5B66H 1KILB 3WU2H 1L0NG 1NTZJ 2YXQB 4OWFA 3A2AA 2YFIA 3I55P 5KJ7A 3RK3D 2IFMA 5APUA 1L0ND 5APWA 1U7JA 3VMYA 3KXDA 3F89A 1KILC 4YTPC 2HMOA 1L0LG 2OTJP 1FZBA 4H0LC 1LWUA 3H1LJ 2BCCG 1RE4A 3IN6A 1QVFO 3VCPA 3VP9A 2GBXA 2NRGA 2HMMA 2OYIC 5AEWA 1MUUA 1FDOA 1L0NK 2CKFA 5KJ7D 1IK9A 2BCCE 1S2EA 3SSUA 1FZCB 3CC4P 5AW6B 3EQ2A 2E76B 1ZR4A 4HM0A 1M1JA 3L75D 3BCCE 3OW2O 3IR9A 1BCCG 4GOEA 3HTKB 1P84I 1RE4C 2Q6QA 4C7NA 1SQPD 3MIWA 3UIAA 1OW7A 2WPSA 3EFFK 3L71D 1VF5B 1L0LK 4QMAA 3AE7C 1GTWA 1NU1G 1G8KB 2Y0DA 1SJGA 2B87A 2O1KA 3RGUA 3DQYA 2V7QH 3L74D 1EZVD 3FX0A 4U7JA 3H6PA 2BASA 2WSEH 4NBDD 4KHXA 5BU8B 1YTZI 3GMAA 1KYOE 3ITKA 4ZKPA 3CC2P 1N2DC 5AW7B 2NPSC 2QM8A 2KLUA 4NBGD 1RH5B 3L73D 2HPCB 2QJYB 2YIUC 1EQ7A 4W7YA 2Z5IA 2OYHB 2K9JA 4DCKA 5L8RJ 2PGDA 1AJYA 4WVZA 3BVHA 1TU3F 3MD0A 1GK6A 1SFCD 1VF5D 1OZHA 5KAIE 4U3FD 4HM3A 2AEFA 1NTKE 2JJLA 3H1ID 1MFZA 3G6EP 1MKMA 2K1AA 2YKQA 4U3FE 3P7KA 3E7KA 2YMKA 3H1IG 3RBXA 2FXPA 5BVZA 1ULIA 2E75B 3D70A 1SQVE 4W80A 2JKVA 1X22A 2HG5D 2JR8A 1SQVG 3CWBJ 2E74C 1PGJA 3CCUP 3CX5E 1JY2O 1T3JA 2K3RA 2Y9ZA 3E1RA 2QSIA 2OYIB 3GF7A 1SFCC 4ZNCA 1PPJD 2QVAA 2WSCH 4KJMA 1IFPA 1NTMD 3L72E 3PTZA 3S1KA 1NO4A 3HD7A 1JY3P 2R3CA 1JNMA 1NTME 2NPSB 3H1IE 4H13C 1VQ7P 1U57A 2QJPB 2AXTE 5AW8B 1NWQA 3A0BH 3L71G 1NTKK 4DOJA 4NB8D 3L70D 2WITA 1NTKJ 2VRSA 5KLVJ 1AV1A 4OGQB 5TISH 2KYVA 4H44D 4QDCA 3V5BA 2Q5UA 3OJAB 2FKWB 2RN0A 4AYCA 5AW4B 1EXIA 2YIUB 4QURA 4ASWA 1OX3A 4L75A 2FYUJ 2JWDA 2Y0EA 2ZXXA 2E76C 4XE5B 1JO5A 1NVOA 3HE5A 5BOKA 4QUQA 3I5CA 1SQXD 3L72G 1PGOA 2O01N 1KILA 5B5EE 3BCCG 1N7SD 1GL2A 3L72D 1YTZT 1DD4A 1J1EC 2N9YB 3GW6A 1DEEG 1LTSC 1OFCX 1EC5A 5AW0B 1FJKA 2I8DA 4IL6H 1IO4A 5KLIB 1ZW0A 3KYQA 1EDJA 4AQRD 3L72J 3QWOC 1BGYG 4PJ0E 1NAYA 4HJLA 1NOHA 4H44B 1GW3A 4WY4C 3M91A 3QH9A 2XV5A 2XSOA 1N73C
chains in the Genus database with same CATH topology
1O7PA 3VCPA 2GBXA 1Q90C 2HMMA 2E75D 5AEWA 4P1BH 4D6TE 2HMKA 2D2CD 2DE7D 2QJKC 3H1JE 3GL2A 5HL4A 1BCCE 2CKFA 2DE6D 2XR8A 1UUVA 4HM2A 2BCCE 2QPZA 4HM1A 4H0LD 1VF5D 3GZXA 4NB8D 2HMJA 4HM3A 2IBZE 3VMHD 1FQTA 1NTKE 4P1CH 4AIVA 1WQLA 2FYNC 4HM0A 2YFLA 4U3FE 3GL0A 1VM9A 3BCCE 4H44D 4QDCA 1UUWA 1JM1A 3H1HE 3GCEA 4NBHD 3H1KE 1ULIA 1SQBE 1KB9E 3VMGD 2E4QA 4QUPA 4HM6A 3VMID 1NYKA 3L75E 5KLIC 3L71E 1RFSA 1SQVE 2JZAA 1ULJA 1VCKA 4QCKA 4QURA 2DE5D 3GTSA 3L74E 2E74D 2XSHA 4HM4A 3EN1A 1NU1E 2HMNA 4PD4E 1EG9A 1G8KB 3C0DA 4H13D 4NB9D 4AAYB 2NUKA 1SJGA 1SQPE 1EZVE 3GB4A 3GZYA 2A06E 2YFJA 1BGYE 1RIEA 2JO6A 3AZCA 4NBAD 3DQYA 2HMLA 2BMQA 4NBED 1O7NA 1SQQE 2NVGA 5BOKA 4HM5A 4QUQA 5AEUA 1G8JB 1PP9E 4HM7A 3CX5E 2NVEA 4HM8A 2QJPC 1BE3E 3CWBE 3EQQA 4HKVA 1SQXE 2NUMA 4NBDD 1L0NE 1NDOA 4QDFB 2NWFA 2GBWA 2ZT9D 1PPJE 2E4PA 1KYOE 4QDDA 5KKZC 2Q3WA 3VCAA 3GOBA 2B24A 4QDFA 3L73E 1NTZE 2QJYC 5CXMA 2YFIA 5KLVE 2ZYLA 2NVFA 1O7HA 2I7FA 3FOUA 1ZRTE 1L0LE 3GTEA 2BMOA 3CXHE 4NBGD 2YVJB 3L72E 3TGUE 1O7WA 2XRXA 3N0QA 2B1XA 4HJLA 1O7GA 4OGQD 2FYUE 2YIUC 2HMOA 1O7MA 1NTME 4PV1D 3H1LE 2BMRA 3GKEA 3L70E 1P84E 4EMJB 2XSOA 3H1IE 3D89A 4NBFD 4NBBD 4NBCD 2E76D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P A;  3VCP A;  2GBX A;  1Q90 C;  2HMM A;  2E75 D;  5AEW A;  4P1B H;  4D6T E;  2HMK A;  2D2C D;  2DE7 D;  2QJK C;  3H1J E;  3GL2 A;  5HL4 A;  1BCC E;  2CKF A;  2DE6 D;  2XR8 A;  1UUV A;  4HM2 A;  2BCC E;  2QPZ A;  4HM1 A;  4H0L D;  1VF5 D;  3GZX A;  4NB8 D;  2HMJ A;  4HM3 A;  2IBZ E;  3VMH D;  1FQT A;  1NTK E;  4P1C H;  4AIV A;  1WQL A;  2FYN C;  4HM0 A;  2YFL A;  4U3F E;  3GL0 A;  1VM9 A;  3BCC E;  4H44 D;  4QDC A;  1UUW A;  1JM1 A;  3H1H E;  3GCE A;  4NBH D;  3H1K E;  1ULI A;  1SQB E;  1KB9 E;  3VMG D;  2E4Q A;  4QUP A;  4HM6 A;  3VMI D;  1NYK A;  3L75 E;  5KLI C;  3L71 E;  1RFS A;  1SQV E;  2JZA A;  1ULJ A;  1VCK A;  4QCK A;  4QUR A;  2DE5 D;  3GTS A;  3L74 E;  2E74 D;  2XSH A;  4HM4 A;  3EN1 A;  1NU1 E;  2HMN A;  4PD4 E;  1EG9 A;  1G8K B;  3C0D A;  4H13 D;  4NB9 D;  4AAY B;  2NUK A;  1SJG A;  1SQP E;  1EZV E;  3GB4 A;  3GZY A;  2A06 E;  2YFJ A;  1BGY E;  1RIE A;  2JO6 A;  3AZC A;  4NBA D;  3DQY A;  2HML A;  2BMQ A;  4NBE D;  1O7N A;  1SQQ E;  2NVG A;  5BOK A;  4HM5 A;  4QUQ A;  5AEU A;  1G8J B;  1PP9 E;  4HM7 A;  3CX5 E;  2NVE A;  4HM8 A;  2QJP C;  1BE3 E;  3CWB E;  3EQQ A;  4HKV A;  1SQX E;  2NUM A;  4NBD D;  1L0N E;  1NDO A;  4QDF B;  2NWF A;  2GBW A;  2ZT9 D;  1PPJ E;  2E4P A;  1KYO E;  4QDD A;  5KKZ C;  2Q3W A;  3VCA A;  3GOB A;  2B24 A;  4QDF A;  3L73 E;  1NTZ E;  2QJY C;  5CXM A;  2YFI A;  5KLV E;  2ZYL A;  2NVF A;  1O7H A;  2I7F A;  3FOU A;  1ZRT E;  1L0L E;  3GTE A;  2BMO A;  3CXH E;  4NBG D;  2YVJ B;  3L72 E;  3TGU E;  1O7W A;  2XRX A;  3N0Q A;  2B1X A;  4HJL A;  1O7G A;  4OGQ D;  2FYU E;  2YIU C;  2HMO A;  1O7M A;  1NTM E;  4PV1 D;  3H1L E;  2BMR A;  3GKE A;  3L70 E;  1P84 E;  4EMJ B;  2XSO A;  3H1I E;  3D89 A;  4NBF D;  4NBB D;  4NBC D;  2E76 D; 
#chains in the Genus database with same CATH topology
 1O7P A;  2A45 G;  1JMB A;  3HD7 D;  1FZC A;  1NKZ B;  5AW3 B;  2KB7 P;  5HL4 A;  1LTB C;  1CI6 A;  4O9B A;  3G3Z A;  3MTU E;  3AE1 C;  3Q3D A;  4P1C H;  1NJI Q;  2ZT9 C;  1RF1 B;  1H8A A;  3TNU B;  3T97 B;  2BEQ D;  3AE6 C;  4U3F J;  3L71 J;  4EYY Q;  1R5S A;  3CCL P;  3B5N D;  1LTJ B;  1SQP J;  2KIK A;  4EOT A;  1KQL A;  1M8O B;  2IYP A;  1M1J B;  3AE9 C;  5CCH D;  3KQG A;  1RQV A;  2YO3 A;  3BRV B;  1S4X A;  4Z1M H;  2IBZ G;  3NTN A;  1BE3 J;  1NU1 K;  3HRN A;  4JBZ A;  1KQG B;  5DJU B;  1S72 P;  2KS1 B;  1URQ C;  1LT9 B;  3IAO A;  2QE7 H;  3CWB E;  2DW3 A;  2KLV A;  4L76 A;  3AEG C;  1SQV J;  5TJH A;  3GOB A;  4QDF A;  2YXR B;  1K04 A;  2Q1K A;  3AE8 C;  1FOS E;  1GL2 C;  1L0L E;  1MZ9 A;  3LID A;  1FOS F;  1G2C A;  1USE A;  1VL2 A;  1VQL P;  4HKZ H;  2POH A;  2QRX A;  1O7M A;  3PRJ A;  1R5L A;  3SWF A;  1K9M Q;  2IZ1 A;  2E43 A;  1XTG B;  5KKZ B;  4U3F G;  3A0H H;  2JEE A;  1OIP A;  4IOI H;  5EFW B;  3L73 G;  3AEB C;  3HE4 B;  1EZV I;  3GL0 A;  4C46 A;  3D71 A;  1KB9 H;  1N73 B;  4M3L A;  2D2C B;  1GZL A;  2E74 D;  1N7S B;  2WMM A;  3H1K D;  1HWT C;  3C0D A;  5C39 A;  4AAY B;  2ZFC A;  1LWU B;  3VMX A;  2GUV A;  4PV1 C;  1H0T A;  3CCE P;  1J1E B;  3CX5 H;  2WPR A;  5AVT B;  1JB0 J;  1NTZ K;  2WSF J;  1T6A A;  3GG2 A;  1L0L D;  4RO0 A;  2KK7 A;  3VOP A;  1VQ9 P;  1NYH A;  4K3A A;  3CXH D;  3L37 A;  2A45 H;  3V4Q A;  1PIX A;  4C7R A;  3PJS K;  3OAK A;  1LP1 B;  3VP8 A;  1KYO I;  4C7N B;  4LC1 A;  4PD4 I;  4IFM A;  3TGU E;  3CI9 A;  1O7W A;  2FYU E;  1KC8 Q;  4JYB A;  3L75 G;  2N1T A;  3CD6 P;  3TGU D;  2OYI A;  3ZDM A;  2WPV B;  1L2P A;  2E76 D;  5TIS E;  1ZN5 A;  3VTP C;  1BCC E;  1RF0 C;  2CK3 H;  1L4A D;  1NAF A;  2O01 H;  2P7J A;  3CX5 I;  2HMJ A;  3A0B E;  1FU1 A;  1IFI A;  3G71 P;  4NPD A;  5AVR B;  1JMM A;  3TDK A;  3H1K E;  1VDF A;  3P8M C;  2Q3E A;  2WSS H;  2JZA A;  1JTH A;  2YO2 A;  2JP3 A;  4N78 E;  2AEJ A;  4JF7 A;  5KAI H;  1SQP G;  1KB9 D;  1IZN B;  4H13 D;  1Q86 Q;  3AEE C;  2QEX P;  1QGK B;  1T2K C;  4HH2 A;  2FYN B;  4HM5 A;  3P32 A;  2JO1 A;  3GHG C;  3M0D A;  5AVY B;  1BE3 E;  2ZJS E;  1W2B O;  1DIP A;  3B5N B;  1LWU C;  2NUM A;  1SS1 A;  3H1J J;  2IBZ I;  1BE3 D;  3CXH H;  1N7S C;  5E79 E;  1A02 J;  1XTC C;  2WSC J;  5KLV E;  1NGM B;  3FOU A;  1ZRT E;  1L4A B;  2H8P D;  1GK4 A;  3AED C;  1LNQ A;  1GDT A;  1RHZ B;  1H88 A;  1NU1 J;  2FFD B;  1FE6 A;  3L70 J;  1ZOY C;  3JC2 2;  4D6T D;  1KQF B;  1EDL A;  1RQU A;  1Q90 D;  1OW6 A;  3M9H A;  4R4M A;  2QPZ A;  3HUS B;  5APQ A;  2L91 A;  1SQV D;  1HGZ A;  1H0T B;  1WQL A;  1N73 A;  2KOG A;  5GTH E;  5AVQ B;  3R4Y A;  2BEZ F;  1URQ A;  1WMK A;  1M1K Q;  1PFI A;  1X0T A;  4A7P A;  1NKN A;  3O6Q B;  1JY3 O;  2KSE A;  3B71 A;  1USD A;  2W27 A;  1KOR A;  2NPS A;  1OXZ A;  1SQQ K;  3L35 A;  4YXW H;  2NVG A;  1SQQ J;  2MKV A;  3LW5 J;  2PAJ A;  5KLV D;  3RL0 C;  3VMZ A;  5AVU B;  1IJD B;  1LJ2 A;  2WTY A;  4HKV A;  3K5B A;  4R4L A;  4QDF B;  3CLQ A;  2Q3W A;  1X8Y A;  1NTZ E;  4I7Z B;  4N3Y B;  1Q82 Q;  5CXM A;  1EXJ A;  3CCS P;  1FBM A;  4LGD E;  2RH0 A;  3CMA P;  3AE5 C;  3HD7 C;  1DD3 A;  1QEX A;  2XZR A;  3L74 J;  1PPJ G;  2ZT9 B;  1IFM A;  3NXS A;  4KT0 J;  1O7G A;  4OGQ D;  1JUN A;  1ZME C;  1NTK G;  2BMR A;  3L70 E;  3C1L A;  3M0A A;  2O3J A;  2XDJ A;  3CL3 D;  1PP9 J;  2OTK E;  1SQB G;  4BWN A;  3VN0 A;  2KNC A;  1Q7Y Q;  3USS A;  3FXD A;  5CHX A;  4DJG A;  3HTK A;  4WWI A;  2HR3 A;  2N1T C;  3H1H E;  2FYU K;  4EIJ A;  3AEF C;  2B89 A;  4H0L B;  3H1H D;  3FGA D;  3H1K J;  3TGU J;  4XA4 A;  4RJT A;  2OAR A;  2P1J A;  1JY2 P;  2PP6 A;  2W8Z A;  2A06 G;  3W67 A;  2YMY A;  2HLO A;  2P2U A;  5CJ4 A;  2FXO A;  3AZC A;  1JCC A;  1JM0 A;  1W2E A;  2R44 A;  3V2N A;  2YKP A;  2NZ2 A;  4BRY A;  1CI6 B;  1FS0 E;  2CPB A;  4D6T J;  2AXC A;  3CWB D;  1L0L J;  3P8C D;  2ZYL A;  3VMA A;  2I7F A;  2WT7 B;  3GTE A;  3IFM A;  1LTT C;  1K05 A;  1YJ9 P;  3C8V A;  3H1L G;  2A45 I;  3H32 B;  2V4H A;  2W6A A;  1P84 E;  4HB1 A;  4Y99 C;  3KPE A;  3H1J D;  4I7Z C;  1KYO H;  3CME P;  3FXE A;  2B9B A;  1VQP P;  3H1J E;  3IF4 A;  3HUS A;  2FYU D;  2IPP A;  2GUS A;  3VMH D;  4JPZ B;  1VQ4 P;  2WPQ A;  2IBZ D;  3BAS A;  1SQB E;  2E4Q A;  3V4W A;  1JTH B;  3L75 E;  3A0H E;  4YXD C;  4QCK A;  1NU1 D;  5H2F E;  1ULJ A;  1VCK A;  5DJT B;  1G2C B;  1FDI A;  1P84 H;  3C9I A;  3L70 G;  1NU1 E;  5CMZ A;  5AVS B;  3KZI E;  1BDC A;  5GTI E;  2K9Y A;  3AE4 C;  1EZV G;  2G8Y A;  4GIF A;  3S9O A;  1J1D B;  1S1C X;  3I56 P;  3Q1M A;  4NBE D;  1GU5 A;  3GHG B;  1Y9B A;  1ZP0 C;  2XU6 A;  3EQQ A;  1KYO D;  2P67 A;  5KAF E;  4WY4 B;  2WWW A;  2E5T A;  5H2F H;  2NWF A;  4GT1 A;  3VCA A;  2B24 A;  1FDM A;  2RMZ A;  5CCH A;  1L0N J;  3KHU A;  1AA0 A;  3HD7 B;  3RL0 g;  1P84 D;  1CZQ A;  1KMI Z;  1OWA A;  2J59 M;  3L4F A;  3RK2 C;  2M3B A;  2WVR A;  1IK7 A;  2XRX A;  1PL5 A;  3N0Q A;  1M56 D;  3WU2 E;  1MV8 A;  3H1L E;  1VQ5 P;  1W5C E;  1KFM A;  2JWA A;  1BE3 G;  1FQT A;  4MN4 C;  3FWN A;  4I6M C;  2W83 C;  3N4X A;  1FZG A;  1G1J A;  4HM1 A;  2HOD B;  1S5L X;  3PP5 A;  3H1K G;  2IDB A;  5CBN A;  1X79 B;  3MHV A;  1HGV A;  2FYN C;  1LT1 A;  2YFL A;  2R5D A;  3BCC J;  4GOD A;  3GCE A;  1ZR2 A;  1FJP A;  2XKM A;  4HM6 A;  1T2K D;  2KP8 A;  2OQQ A;  2OYO A;  3GTS A;  2WZ7 A;  3L74 E;  1VQ6 P;  1DX7 A;  2WSF H;  1S3J A;  2M3E A;  3N7N A;  4PD4 E;  4GOF A;  3PHL A;  2YNY A;  3A3Y B;  3H1I J;  1SQB K;  5CCG D;  1YJN P;  3CX5 D;  4NBA D;  1Z56 A;  2HML A;  4IL6 E;  3SFE C;  2M8R A;  4Y28 J;  1URQ B;  1FZF A;  1G8J B;  3NMD A;  2QJP C;  3RL0 B;  4RES B;  4AUW A;  3CCV P;  2Q9I A;  3OA7 A;  3Q5S A;  1BDD A;  2J5U A;  5KTB A;  1PPJ E;  1LTJ C;  2NPS D;  1O7H A;  2XNX A;  5AW2 B;  1OVV A;  1LTI C;  2KSJ A;  2OGU A;  2G3A A;  3GLM A;  4UB8 E;  1CSB A;  4NBC D;  1DEB A;  4D6T E;  3Q2Y A;  2HMK A;  2LXB A;  2D2C D;  4UB6 E;  1H89 A;  1R8E A;  1VPC A;  1UUV A;  2LR2 A;  1J1D C;  1LT9 A;  1S9K E;  1IFJ A;  2M0B A;  1GMJ A;  3M9Q A;  2HYN A;  2R32 A;  4PD4 D;  2JDI H;  4QUP A;  1PGP A;  2D2C C;  5KLI C;  3V2Q A;  2FFD C;  2FXM A;  2A06 D;  1X9V A;  1URQ D;  2ZYD A;  3L75 J;  1VQM P;  2K9J B;  2H88 C;  4YPC A;  2AEM A;  2LXC B;  1KN7 A;  1VQN P;  4ZKU A;  1JOC A;  1RY3 A;  1SQQ G;  3Q5R A;  1O7N A;  1FZA A;  3MUD A;  1GD2 E;  5AEU A;  2P10 A;  2I1K A;  3PLN A;  4UB6 H;  1N8R Q;  3O8Z A;  3HE5 B;  1M1J C;  2N1T D;  2GBW A;  4UB8 H;  5M1B A;  2ZT9 D;  2I1J A;  4TLF A;  4QDD A;  5KKZ C;  5AW9 B;  2PFX A;  2QJY C;  1PP9 D;  2NVF A;  2LKM A;  5GTH H;  1HH0 A;  1KB9 I;  4NPF X;  3PH0 A;  1K73 Q;  4BRY B;  5KLV K;  3H1J G;  1SVF A;  3EWK A;  2Z5H A;  1AQ5 A;  3CWB G;  3D89 A;  3G9R A;  4NBF D;  4NBB D;  1CW5 A;  1JEK A;  3TF5 A;  1RE3 A;  3Q5P A;  1NHL A;  1MFT A;  5AW1 B;  3TNU A;  1YI2 P;  4AIV A;  1HUC A;  3CCM P;  1UIX A;  3B8E B;  3BAT A;  2H89 C;  3RK2 D;  1RE3 C;  3E1I A;  1JM1 A;  2BCC D;  3VMG D;  1L4A C;  5E79 H;  1S5L E;  5KJ7 C;  4OVN F;  4I1L A;  1RF1 A;  3EN1 A;  3CCQ P;  3A7O A;  1E5W A;  2K88 A;  2N1T B;  1HJ0 A;  3M06 A;  1BGY E;  1HF9 A;  1SP4 A;  1RIE A;  2Z4E A;  1YQ4 C;  4I2L C;  1AQT A;  4LLH A;  1Y8A A;  3D6Y A;  1OW8 A;  2W6J H;  3HUS C;  4DZO A;  1LP1 A;  2P58 A;  2H7H A;  2KS1 A;  1LGH B;  2E4P A;  1KFN A;  3RK3 E;  1WT6 A;  1PV3 A;  5AVZ B;  3TSI A;  3KDP B;  2YKO A;  2E75 C;  3L74 G;  3LW5 H;  1YIT P;  2Q3I A;  1KTM A;  1UII A;  4W7Z A;  1SQB J;  2B88 A;  1G1I A;  1ZV8 A;  2E5Y A;  2ZVO B;  4XFJ A;  2B87 B;  2R3S A;  2GM4 A;  5CCH C;  1FZE A;  3HE4 A;  3SWK A;  1M7L A;  2IX7 C;  1J2J B;  2HOD A;  4L73 A;  1VQ8 P;  5CJ0 A;  4H0L D;  3SWY A;  3WMM 0;  1QL2 A;  2IBZ E;  5B5E H;  2E42 A;  3MZW B;  1SQB D;  2BCC J;  1NTZ G;  2QIW A;  3KZI H;  3R2P A;  1FAV A;  4NBH D;  1SQX J;  1HVV A;  4Y99 B;  2IYO A;  5APV A;  5AVV B;  1A02 F;  5APY A;  1NYK A;  2J58 A;  3L71 E;  1SQX K;  1GW4 A;  2WT7 A;  4K35 A;  1KIL E;  1SFC B;  1L4A A;  4HM4 A;  3T97 A;  1FC2 C;  2Q7C A;  2C9N Y;  1SLQ A;  1EZV E;  4OH8 B;  4WY4 D;  2C9L Y;  3GZY A;  3S4R A;  3B5N A;  1LTJ A;  1Y47 A;  3M9B A;  2C0W A;  3A5T A;  1NH4 A;  3VYI A;  2QJK B;  1VQK P;  1IFD A;  3RK3 B;  4ASV A;  1L0N E;  2WSE J;  3LIE A;  4HYT B;  5AVX B;  3MGN A;  3AEC C;  3L73 E;  3U1C A;  1YHQ P;  2FFD A;  3RL0 D;  2AXT H;  3CXH E;  1YIJ P;  1YJW P;  2UWJ E;  3TGU G;  2GA1 A;  2YVJ B;  3GF3 A;  1E79 H;  2B1X A;  1QVG O;  1GU4 A;  2K37 A;  3JCU E;  3O6Q A;  1BCC D;  1LTG C;  3II6 A;  2M5A A;  5AW5 B;  1YYC A;  2CPS A;  3H1L D;  4BXL A;  3BRT B;  4B86 A;  3U59 A;  2DE7 D;  3ABV C;  2HFE D;  4JYC A;  2XR8 A;  4HM2 A;  4HJG H;  1IFN A;  5CCG A;  3JSV C;  2FYU G;  1GL2 D;  2ZVN B;  1NTK D;  1U7M A;  1DH3 A;  1T8Z A;  2V7Q J;  2N9B A;  2FBW C;  3WUU A;  4N78 D;  5CCG C;  2R5B A;  3V6I A;  2KZJ A;  4L74 A;  2XSH A;  3V2P A;  2KZI A;  2HMN A;  1T3U A;  1EG9 A;  4EDF A;  3H25 A;  4OGQ C;  1HTL C;  4NB9 D;  1SQX G;  2A06 E;  3CC7 P;  3TYY A;  1EDI A;  2QA4 P;  1N7S A;  1KD1 Q;  1M57 D;  4EI2 A;  1EDK A;  2HPC A;  1WRG A;  3B5N C;  2NVE A;  1JY2 N;  2Y9Y A;  3D6Z A;  4H13 B;  3G4S P;  4TT3 H;  2PRR A;  3W68 A;  5CBO A;  1HJB A;  3B4S A;  3TK1 A;  1K8A Q;  2OYH A;  1OVR A;  5BU5 A;  2W6B A;  1OMI A;  2ZAE B;  4ZMD A;  1N7L A;  3WUT A;  3RBZ A;  5K5G B;  1QL1 A;  2SPZ A;  3JCU H;  5KAF H;  1ZRT D;  1BGY J;  1NTZ D;  2WQY C;  3WUV A;  3FWL A;  1KZU B;  2KXP B;  4EMJ B;  4GDO A;  3F5H A;  2QG4 A;  4P1B H;  1SFC A;  1PP9 G;  1S9K D;  1BCC J;  5APX A;  4DT0 A;  4JQ0 D;  1JCD A;  3MP7 B;  5AVW B;  2C0X A;  1VM9 A;  2O1J A;  1D7M A;  3H1H J;  1AVY A;  1AVO A;  1KB9 E;  3AE3 C;  2ZYG A;  4GKG A;  1RFS A;  1VF5 C;  2DE5 D;  4IFF A;  3RK2 B;  1ZLL A;  2FYZ A;  3AEA C;  1RF1 C;  2NUK A;  3H32 A;  2JO6 A;  1SQP K;  2BMQ A;  1NTM G;  2MJZ A;  4HM7 A;  2Y0C A;  1IC2 A;  1AFO A;  4N6J A;  1RF0 A;  4NPE A;  2OYH C;  1SQX E;  1NDO A;  2W90 A;  5KLV G;  1HBW A;  2IZ0 A;  2RKL A;  3CXH I;  3NFQ A;  1VQO P;  3AE2 C;  4PV1 B;  5GTI H;  5APS A;  2BMO A;  2XND H;  1YBK A;  1SQV K;  1YQ3 C;  3P8C E;  3U1A A;  4PV1 D;  3GKE A;  4WB4 A;  2M5A B;  3CCR P;  1PGQ A;  1Q81 Q;  4IFD K;  3VMI D;  2H43 A;  3RK3 C;  2L5G B;  1Q90 C;  2E75 D;  1LTA C;  2QJK C;  1LT9 C;  1M90 Q;  1KQS O;  1OVU A;  3L36 A;  3GL2 A;  2ZXE B;  2DE6 D;  2O01 J;  3EFG A;  1JY3 N;  3GZX A;  3GHG A;  3M0D C;  5B66 E;  2KI7 B;  3CCJ P;  3L73 J;  1ZXG A;  3H1H G;  4PD4 H;  1UUW A;  4WBA A;  4WY4 A;  4RKU J;  3V2R A;  1N86 A;  2KNC B;  3CPW O;  3MUD C;  1BSN A;  1BSH A;  4IL6 X;  1KV4 A;  3BCC D;  1Q2N A;  2QM7 A;  1GL2 B;  4CPG A;  2KUB A;  2FY8 A;  1SQP E;  3GB4 A;  3SFD C;  1FZC C;  2YFJ A;  1S5L H;  1NTM J;  1KIL D;  1PZQ A;  1SQQ E;  2ITA A;  2E74 B;  1PP9 E;  1NTM K;  1BGY D;  4HM8 A;  5APT A;  2OTL P;  1SQQ D;  4PJ0 H;  2IFN A;  1QLE D;  1QX8 A;  4H44 C;  4D6T G;  2ZYA A;  5B66 H;  1KIL B;  3WU2 H;  1L0N G;  1NTZ J;  2YXQ B;  4OWF A;  3A2A A;  2YFI A;  3I55 P;  5KJ7 A;  3RK3 D;  2IFM A;  5APU A;  1L0N D;  5APW A;  1U7J A;  3VMY A;  3KXD A;  3F89 A;  1KIL C;  4YTP C;  2HMO A;  1L0L G;  2OTJ P;  1FZB A;  4H0L C;  1LWU A;  3H1L J;  2BCC G;  1RE4 A;  3IN6 A;  1QVF O;  3VCP A;  3VP9 A;  2GBX A;  2NRG A;  2HMM A;  2OYI C;  5AEW A;  1MUU A;  1FDO A;  1L0N K;  2CKF A;  5KJ7 D;  1IK9 A;  2BCC E;  1S2E A;  3SSU A;  1FZC B;  3CC4 P;  5AW6 B;  3EQ2 A;  2E76 B;  1ZR4 A;  4HM0 A;  1M1J A;  3L75 D;  3BCC E;  3OW2 O;  3IR9 A;  1BCC G;  4GOE A;  3HTK B;  1P84 I;  1RE4 C;  2Q6Q A;  4C7N A;  1SQP D;  3MIW A;  3UIA A;  1OW7 A;  2WPS A;  3EFF K;  3L71 D;  1VF5 B;  1L0L K;  4QMA A;  3AE7 C;  1GTW A;  1NU1 G;  1G8K B;  2Y0D A;  1SJG A;  2B87 A;  2O1K A;  3RGU A;  3DQY A;  2V7Q H;  3L74 D;  1EZV D;  3FX0 A;  4U7J A;  3H6P A;  2BAS A;  2WSE H;  4NBD D;  4KHX A;  5BU8 B;  1YTZ I;  3GMA A;  1KYO E;  3ITK A;  4ZKP A;  3CC2 P;  1N2D C;  5AW7 B;  2NPS C;  2QM8 A;  2KLU A;  4NBG D;  1RH5 B;  3L73 D;  2HPC B;  2QJY B;  2YIU C;  1EQ7 A;  4W7Y A;  2Z5I A;  2OYH B;  2K9J A;  4DCK A;  5L8R J;  2PGD A;  1AJY A;  4WVZ A;  3BVH A;  1TU3 F;  3MD0 A;  1GK6 A;  1SFC D;  1VF5 D;  1OZH A;  5KAI E;  4U3F D;  4HM3 A;  2AEF A;  1NTK E;  2JJL A;  3H1I D;  1MFZ A;  3G6E P;  1MKM A;  2K1A A;  2YKQ A;  4U3F E;  3P7K A;  3E7K A;  2YMK A;  3H1I G;  3RBX A;  2FXP A;  5BVZ A;  1ULI A;  2E75 B;  3D70 A;  1SQV E;  4W80 A;  2JKV A;  1X22 A;  2HG5 D;  2JR8 A;  1SQV G;  3CWB J;  2E74 C;  1PGJ A;  3CCU P;  3CX5 E;  1JY2 O;  1T3J A;  2K3R A;  2Y9Z A;  3E1R A;  2QSI A;  2OYI B;  3GF7 A;  1SFC C;  4ZNC A;  1PPJ D;  2QVA A;  2WSC H;  4KJM A;  1IFP A;  1NTM D;  3L72 E;  3PTZ A;  3S1K A;  1NO4 A;  3HD7 A;  1JY3 P;  2R3C A;  1JNM A;  1NTM E;  2NPS B;  3H1I E;  4H13 C;  1VQ7 P;  1U57 A;  2QJP B;  2AXT E;  5AW8 B;  1NWQ A;  3A0B H;  3L71 G;  1NTK K;  4DOJ A;  4NB8 D;  3L70 D;  2WIT A;  1NTK J;  2VRS A;  5KLV J;  1AV1 A;  4OGQ B;  5TIS H;  2KYV A;  4H44 D;  4QDC A;  3V5B A;  2Q5U A;  3OJA B;  2FKW B;  2RN0 A;  4AYC A;  5AW4 B;  1EXI A;  2YIU B;  4QUR A;  4ASW A;  1OX3 A;  4L75 A;  2FYU J;  2JWD A;  2Y0E A;  2ZXX A;  2E76 C;  4XE5 B;  1JO5 A;  1NVO A;  3HE5 A;  5BOK A;  4QUQ A;  3I5C A;  1SQX D;  3L72 G;  1PGO A;  2O01 N;  1KIL A;  5B5E E;  3BCC G;  1N7S D;  1GL2 A;  3L72 D;  1YTZ T;  1DD4 A;  1J1E C;  2N9Y B;  3GW6 A;  1DEE G;  1LTS C;  1OFC X;  1EC5 A;  5AW0 B;  1FJK A;  2I8D A;  4IL6 H;  1IO4 A;  5KLI B;  1ZW0 A;  3KYQ A;  1EDJ A;  4AQR D;  3L72 J;  3QWO C;  1BGY G;  4PJ0 E;  1NAY A;  4HJL A;  1NOH A;  4H44 B;  1GW3 A;  4WY4 C;  3M91 A;  3QH9 A;  2XV5 A;  2XSO A;  1N73 C; 
#chains in the Genus database with same CATH homology
 1O7P A;  3VCP A;  2GBX A;  1Q90 C;  2HMM A;  2E75 D;  5AEW A;  4P1B H;  4D6T E;  2HMK A;  2D2C D;  2DE7 D;  2QJK C;  3H1J E;  3GL2 A;  5HL4 A;  1BCC E;  2CKF A;  2DE6 D;  2XR8 A;  1UUV A;  4HM2 A;  2BCC E;  2QPZ A;  4HM1 A;  4H0L D;  1VF5 D;  3GZX A;  4NB8 D;  2HMJ A;  4HM3 A;  2IBZ E;  3VMH D;  1FQT A;  1NTK E;  4P1C H;  4AIV A;  1WQL A;  2FYN C;  4HM0 A;  2YFL A;  4U3F E;  3GL0 A;  1VM9 A;  3BCC E;  4H44 D;  4QDC A;  1UUW A;  1JM1 A;  3H1H E;  3GCE A;  4NBH D;  3H1K E;  1ULI A;  1SQB E;  1KB9 E;  3VMG D;  2E4Q A;  4QUP A;  4HM6 A;  3VMI D;  1NYK A;  3L75 E;  5KLI C;  3L71 E;  1RFS A;  1SQV E;  2JZA A;  1ULJ A;  1VCK A;  4QCK A;  4QUR A;  2DE5 D;  3GTS A;  3L74 E;  2E74 D;  2XSH A;  4HM4 A;  3EN1 A;  1NU1 E;  2HMN A;  4PD4 E;  1EG9 A;  1G8K B;  3C0D A;  4H13 D;  4NB9 D;  4AAY B;  2NUK A;  1SJG A;  1SQP E;  1EZV E;  3GB4 A;  3GZY A;  2A06 E;  2YFJ A;  1BGY E;  1RIE A;  2JO6 A;  3AZC A;  4NBA D;  3DQY A;  2HML A;  2BMQ A;  4NBE D;  1O7N A;  1SQQ E;  2NVG A;  5BOK A;  4HM5 A;  4QUQ A;  5AEU A;  1G8J B;  1PP9 E;  4HM7 A;  3CX5 E;  2NVE A;  4HM8 A;  2QJP C;  1BE3 E;  3CWB E;  3EQQ A;  4HKV A;  1SQX E;  2NUM A;  4NBD D;  1L0N E;  1NDO A;  4QDF B;  2NWF A;  2GBW A;  2ZT9 D;  1PPJ E;  2E4P A;  1KYO E;  4QDD A;  5KKZ C;  2Q3W A;  3VCA A;  3GOB A;  2B24 A;  4QDF A;  3L73 E;  1NTZ E;  2QJY C;  5CXM A;  2YFI A;  5KLV E;  2ZYL A;  2NVF A;  1O7H A;  2I7F A;  3FOU A;  1ZRT E;  1L0L E;  3GTE A;  2BMO A;  3CXH E;  4NBG D;  2YVJ B;  3L72 E;  3TGU E;  1O7W A;  2XRX A;  3N0Q A;  2B1X A;  4HJL A;  1O7G A;  4OGQ D;  2FYU E;  2YIU C;  2HMO A;  1O7M A;  1NTM E;  4PV1 D;  3H1L E;  2BMR A;  3GKE A;  3L70 E;  1P84 E;  4EMJ B;  2XSO A;  3H1I E;  3D89 A;  4NBF D;  4NBB D;  4NBC D;  2E76 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...