3H1HE

Cytochrome bc1 complex from chicken
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 40
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1hE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1hE02
1BGYE 2NVFA 2ZYLA 3H1LE 3L71E 2QJYC 3GTEA 4NBHD 1L0NE 1BCCE 4QUPA 3L75E 2E75D 2DE7D 4H13D 3H1IE 3GL2A 1G8JB 1PP9E 1SQBE 4QUQA 5KLIC 4HM7A 3GL0A 1ULJA 3GCEA 2BMRA 4PD4E 1ULIA 1NTKE 1WQLA 2NUMA 5AEUA 4NBED 1JM1A 1Q90C 2YFIA 1SQPE 3EQQA 4NBCD 2BCCE 2HMLA 2YVJB 2ZT9D 3L74E 1EZVE 4NBGD 5KLVE 2BMQA 3N0QA 2DE5D 2QJKC 2D2CD 1SQXE 3D89A 2XRXA 2IBZE 2HMKA 3GTSA 1NTME 4NB8D 1BE3E 1NYKA 5BOKA 3EN1A 3TGUE 4EMJB 2E4PA 5HL4A 2JO6A 3L72E 2E74D 2HMMA 4HM3A 3CXHE 1ZRTE 4NBFD 1RIEA 1SJGA 2HMNA 2CKFA 4AIVA 4NBBD 1O7HA 1O7PA 4D6TE 1EG9A 2QPZA 2YFJA 1NU1E 4U3FE 3CX5E 4QDCA 2B1XA 2XR8A 4AAYB 5CXMA 4HKVA 1SQVE 3C0DA 2Q3WA 3BCCE 3H1JE 2HMOA 1VM9A 1VCKA 4H44D 3L73E 4HJLA 3VCPA 1FQTA 3VCAA 1SQQE 1UUVA 4P1BH 1NDOA 2A06E 3GB4A 3VMHD 2GBWA 4HM1A 2BMOA 4HM8A 3GZYA 2NVEA 5AEWA 4NBAD 5KKZC 4NB9D 2B24A 2NVGA 4QDDA 2I7FA 4HM5A 4QDFA 4HM6A 4HM4A 1NTZE 3FOUA 4OGQD 4HM2A 3H1KE 4QCKA 1VF5D 2XSOA 2QJPC 4H0LD 2XSHA 1O7WA 2YIUC 3VMGD 1P84E 1PPJE 4QURA 1RFSA 1L0LE 2FYNC 3GZXA 3VMID 1O7MA 1O7NA 1KB9E 4QDFB 2HMJA 2JZAA 3GOBA 4P1CH 3CWBE 3H1HE 3DQYA 4PV1D 2GBXA 2NUKA 2E76D 1G8KB 2NWFA 3GKEA 4HM0A 2YFLA 1UUWA 2DE6D 1O7GA 3AZCA 3L70E 2E4QA 2FYUE 1KYOE 4NBDD
chains in the Genus database with same CATH superfamily
2LKMA 3NXSA 3KPEA 2N1TC 1USDA 1GL2D 1ZR2A 4QUPA 1LTAC 3VYIA 1IFDA 2Q6QA 1N7SC 3CCJP 1S4XA 1ZLLA 3G6EP 1KYOD 3CX5H 2W8ZA 1EXJA 3LIEA 3VMZA 1ULIA 3RGUA 1QLED 1L0LD 3C1LA 2OGUA 2ZT9D 2Y0EA 1VQ9P 2DE5D 3E1RA 1KTMA 3D89A 1JNMA 3HD7A 4LC1A 5KLVK 1JB0J 2JO6A 1ZP0C 1FZCA 2P67A 3H1LG 3H1HJ 3H32B 2WSFH 1NAYA 3CPWO 1URQD 4AAYB 2H7HA 1IK9A 4DZOA 4UB8E 1K8AQ 2CK3H 2O01N 3GW6A 5KJ7D 1BE3J 3RK3C 2KS1A 2P58A 4GOEA 1NTZE 1PP9J 1LT1A 1O7WA 2YIUC 4D6TJ 1YI2P 2Y0CA 1OIPA 1PGOA 1KILA 3S9OA 2C9NY 3N7NA 3B8EB 1GU5A 5E79H 1LWUB 2CPBA 5AW2B 2R3CA 2WTYA 4R4MA 2NPSD 2W90A 2KZJA 1DX7A 3CCLP 1OW6A 3CCMP 2XKMA 2KOGA 1L0ND 3HD7C 2Z5HA 4JBZA 1PPJG 4IFMA 2YFIA 2GUSA 1EZVE 2M3BA 2JR8A 3TDKA 1T2KD 1FZCC 1JEKA 1FZEA 1YQ3C 3WUUA 1LJ2A 3H1LD 4H13B 2POHA 2GA1A 1FDOA 1YBKA 2KUBA 1YTZI 1EDLA 3C0DA 3BCCE 3H1JE 5APXA 1EDKA 1M56D 1M1JB 3HUSA 3W68A 3OAKA 5APWA 4EDFA 1NDOA 3VMHD 3IF4A 2BMOA 1EDIA 2NVEA 1NTMJ 4QDDA 4HJGH 3L74G 2A45G 4NPFX 4IL6E 1KILC 1SQXG 2ZVOB 3S4RA 4H0LC 3T97B 3TGUG 2W6AA 2XV5A 1O7NA 1KB9E 3AEAC 1CSBA 2QSIA 2YFLA 1O7GA 1P84D 1FZGA 3CC7P 2FYUE 1D7MA 1KQGB 3EFGA 1M57D 1VF5B 1LTJB 3KZIH 2P10A 1ZOYC 1BGYD 1SQBE 4IOIH 1S2EA 2IYOA 1VL2A 1AFOA 2XNXA 3TK1A 1SQPE 3GHGA 4NBGD 2PP6A 1UIXA 3CXHI 2QJKC 1YYCA 4UB6H 5AW3B 2KI7B 1L0NJ 3BVHA 2HR3A 2WVRA 3HUSC 1UIIA 1JOCA 3HTKA 2MKVA 2HODB 3M9BA 1OVVA 3QWOC 2XR8A 1VQ4P 1VQNP 3V2NA 1OZHA 3D71A 3V6IA 2KB7P 3H25A 1SQQE 1UUVA 5AW1B 3AE2C 2E5TA 1ZMEC 2IZ1A 1IFIA 2FYZA 3L72J 1KQFB 1SQXD 4AQRD 4OGQC 2IBZG 3PH0A 3VMGD 1LT9B 2Y9ZA 3TGUD 2XDJA 4U3FJ 1Y47A 5AW5B 1NWQA 3CWBE 4N78D 5CCHC 1L0LK 2GBXA 1NKZB 3AE3C 3HD7D 1W5CE 1NU1G 3L70E 1Z56A 1NAFA 3AE5C 3MZWB 2JEEA 4TT3H 1DD4A 3SWKA 1DEEG 5B66E 2E75D 2ZXEB 3OW2O 1VDFA 1FDMA 1VQ6P 3JCUE 2LXCB 2OTKE 4QUQA 3GCEA 1NGMB 2NUMA 2WMMA 2WPQA 3RK2B 2BMQA 2HPCA 5CBNA 3GF7A 3HE4B 1BGYJ 3M0AA 4EIJA 2K9JA 2M5AB 3M0DA 1HGZA 3CXHE 3ZDMA 1RE3A 1T3UA 1IFMA 5KAFH 5KLIB 5DJTB 2WPSA 2HYNA 3OJAB 4XE5B 1SQVE 3MTUE 1SFCA 1JTHB 2OYOA 4BRYB 3V2RA 3IR9A 3PHLA 5CJ4A 2D2CB 2AEJA 1HJ0A 3B5NB 2I1JA 3KHUA 1Y8AA 2IBZD 3A0HH 2PAJA 1LTTC 1BE3G 3NMDA 3RL0D 2E5YA 3HE5B 1L0NK 1NTZD 1OW8A 4D6TG 2FFDB 1NU1D 1J1DB 1FJPA 2G8YA 1VQLP 4BXLA 2ZYDA 2KLVA 1Y9BA 4ASVA 3AEBC 2G3AA 3CI9A 4AYCA 2R44A 5EFWB 2C0XA 4HM7A 3RK2D 3CCEP 1GK6A 1NTKE 1VQ5P 3G4SP 3EQQA 3M0DC 2L5GB 1RE3C 1HWTC 1JCDA 3H32A 3FWLA 3GTSA 2M8RA 1GL2B 3EN1A 1NOHA 1H0TB 3AEDC 1SFCC 1U57A 4HM3A 2OYHB 2WSEJ 2O01J 5AW8B 4YXDC 3RK3E 1IFNA 3CX5E 4XFJA 4N6JA 2WSSH 2UWJE 1LTGC 5CHXA 2AEMA 1FDIA 1QVGO 4HKZH 2IZ0A 5CCHD 3CCQP 4A7PA 3VCAA 3TNUB 1H89A 3WU2H 2WITA 2ZYAA 4DCKA 1CZQA 1BDCA 2N9YB 3AEFC 1FAVA 4NBAD 3VTPC 2BASA 3M9HA 3H1JD 5AVUB 1K05A 3I55P 5GTIH 1L2PA 1SQQG 1BE3D 1NTMG 1R5LA 1FZFA 2OTLP 1LWUA 2AXCA 3PRJA 5APUA 2FYNB 3OA7A 3TSIA 4KJMA 4PV1D 4D6TD 3G9RA 3D6YA 3AE7C 2V7QH 2B9BA 1RF1A 4GKGA 3N4XA 3V4WA 1KB9D 2V4HA 1NTZJ 4U7JA 1VPCA 5CCGA 1N7LA 3H1IE 2FYUD 4OWFA 1HUCA 1RQUA 3LW5H 1VQ7P 1YQ4C 3EQ2A 5AEUA 2WSCH 2HMLA 1QL1A 5KLVE 2DW3A 1SQBD 5E79E 1AVYA 4RJTA 2NPSB 1SVFA 1SQPD 1SQXK 5HL4A 3C8VA 1M1JA 4MN4C 3MUDC 5CBOA 2H89C 4C7NB 4AIVA 1L0NG 1FBMA 3CLQA 2KSJA 1X22A 1KILE 4I7ZC 1VCKA 1KQSO 3L73E 3MD0A 4P1BH 2A06E 4PD4D 2GBWA 1JO5A 3ITKA 1LWUC 3VMAA 2YXRB 2R5DA 2I7FA 5KKZB 1SQVG 2OYIC 3H1KE 4QCKA 1SQQD 3AE9C 1NTMD 1YJ9P 1S9KE 3W67A 2H43A 1RF1C 2M0BA 3L72G 1LNQA 2Q1KA 3BCCJ 3H1JJ 1BSHA 5B5EH 2BEQD 4U3FG 3B71A 1T3JA 2R32A 1IK7A 2RN0A 5CCGC 1G2CB 2PRRA 4JYBA 2QJYC 3H6PA 1NHLA 2JWAA 2AXTH 3L70D 1GTWA 2FKWB 3E1IA 4H13C 3G71P 2HG5D 2P2UA 4RO0A 4Y99C 2YKQA 4NBCD 1L4AD 3AECC 3RBZA 1M1JC 3AE8C 3BRTB 3M91A 2FYUJ 1IC2A 1EDJA 2XRXA 3SWFA 5BOKA 2ZAEB 1NTKG 3FXEA 4N3YB 1BGYG 3KZIE 1H88A 1SQBJ 1BCCG 1IZNB 1KFMA 1DIPA 1SQPJ 1VM9A 1NU1K 1NYHA 3L4FA 1KYOI 1M90Q 3U1AA 2QM7A 4EYYQ 1YJWP 3CCRP 2O3JA 3GF3A 3CMEP 1SQVD 4UB6E 4HM2A 2QG4A 2GUVA 1AV1A 2IPPA 3KDPB 3Q1MA 4C7RA 1VF5C 2YIUB 3L72D 3GOBA 3H1HE 2WT7B 2OTJP 1KV4A 1LGHB 1SQQJ 4U3FD 2KZIA 3R2PA 1JY2P 1WMKA 3VP9A 2JJLA 2Q7CA 1JUNA 2N1TD 3VP8A 4WY4A 4W7ZA 1N7SD 3P8CD 1KD1Q 3SWYA 1PP9E 3SFDC 2KK7A 3M06A 2BMRA 3U1CA 1JY3P 3HD7B 2BCCE 1QGKB 4WBAA 3L70J 3AE4C 2ZFCA 4DT0A 1FZCB 5CMZA 1NTKD 2WPRA 1RE4A 3CMAP 2FXOA 2E75B 1GW4A 4BRYA 2E74C 3II6A 3QH9A 1A02F 1O7HA 1O7PA 1BCCD 2Y9YA 2YFJA 1K04A 2IX7C 4YPCA 5CXMA 3B5NA 4W7YA 4H44C 3AE1C 4ZMDA 2RKLA 2SPZA 2ITAA 3RK3D 3D6ZA 3CX5D 3GG2A 2B24A 3HE5A 1RQVA 4ZKUA 4JYCA 3I56P 2AEFA 1HJBA 2FYUK 4TLFA 1RFSA 1L0LE 5KAFE 3RBXA 1SQVJ 3D70A 1VQ8P 1VQKP 5L8RJ 4WY4C 2NWFA 3BRVB 1UUWA 2E76C 3VN0A 5AW6B 5CJ0A 5K5GB 1BDDA 2B87A 1S5LX 3L71E 1R5SA 1MUUA 1SQPK 3L75E 2J58A 4LGDE 1T8ZA 2YKPA 5TISH 3A0HE 3V2QA 1NTZG 3RL0B 5DJUB 5KLIC 1A02J 4JPZB 2W6BA 3CCSP 1PFIA 1JM1A 1GL2A 1RE4C 2QRXA 2H8PD 1H0TA 2OYHA 2Z5IA 2QJKB 5C39A 5AVVB 4NPEA 2D2CC 3GHGC 1P84I 2VRSA 1SQQK 1NTMK 1SS1A 2ZVNB 3HUSB 1EG9A 4JF7A 3EFFK 4HKVA 1NTKJ 2Q3WA 4B86A 1GDTA 1KYOH 1JY2N 1BCCJ 2K1AA 5AEWA 5AVWB 1URQA 1EZVG 4DOJA 1KILD 1MFZA 3PP5A 3L73D 1ZXGA 1G1JA 4H0LD 1DH3A 2KSEA 4HYTB 1OX3A 1N73A 4PD4H 5KJ7A 2NUKA 1X8YA 1JY3N 1YJNP 1U7MA 1X79B 1Q81Q 1X0TA 4WB4A 1S9KD 2NZ2A 3AEGC 3WU2E 3BCCG 3H1JG 3A0BH 1AQTA 1HGVA 3H1LE 3GTEA 1USEA 1Q82Q 2RH0A 2KIKA 1PIXA 4OH8B 1GL2C 3U59A 1KMIZ 1W2EA 5GTIE 2A45I 2XU6A 2OYHC 2J5UA 1YHQP 4ZNCA 2WSFJ 4PV1B 1J1EB 1K9MQ 3V2PA 2ZT9C 1YITP 1W2BO 1HH0A 4RESB 4L75A 1SQVK 3JC22 1NYKA 1FOSE 3AE6C 1KORA 2FYUG 5AVTB 3H1IJ 2K3RA 1JY2O 2QPZA 5AW9B 2GM4A 3G3ZA 3R4YA 1URQC 2HMOA 2FXMA 3PTZA 3BATA 4HJLA 3VCPA 1SQBG 3Q2YA 3BASA 1YIJP 1QVFO 4HH2A 4KT0J 1SQPG 2OQQA 1N73C 1EZVD 3L36A 2K37A 5KJ7C 3CCUP 4OGQD 1WRGA 2YO3A 1JY3O 3TF5A 3P32A 4EI2A 1PPJE 4EOTA 4ASWA 2XNDH 4QDFB 2HMJA 4P1CH 2E43A 3K5BA 3L73J 2KNCB 2LXBA 1GU4A 3FWNA 4XA4A 2IFMA 5APTA 1S5LE 3BCCD 4NBDD 3L37A 1NTKK 2I8DA 2O1KA 2JWDA 2Q5UA 2QJPB 2KLUA 1SLQA 1PV3A 4QMAA 1NVOA 2DE7D 2H88C 2PGDA 3PJSK 4IFDK 2HPCB 4CPGA 3L71G 3A2AA 2IBZI 2K9JB 2YKOA 1CI6B 3L74E 1LP1B 3CD6P 2E42A 3CC4P 5B5EE 2KP8A 2J59M 3CWBG 1SQXE 1T2KC 4I1LA 1Q2NA 3P8MC 3L70G 5APQA 3TGUE 2BCCD 4IFFA 1P84H 4NBFD 5KAIE 1SJGA 1SFCB 2HMNA 2AXTE 2Q3EA 3A5TA 1M7LA 2B1XA 4IL6X 1OXZA 1X9VA 1L4AB 2P1JA 3F5HA 1PGJA 3V4QA 2Z4EA 2W27A 5GTHH 5H2FH 4NB9D 2NVGA 2JO1A 2WPVB 4HM5A 3L35A 2QM8A 3Q3DA 3CCVP 3KYQA 1FZAA 1M1KQ 5TJHA 1JMBA 1HVVA 4JQ0D 1S5LH 2JZAA 1EZVI 3DQYA 3MIWA 3GKEA 4HM0A 3T97A 4Z1MH 1VQPP 1GD2E 5APSA 4NBHD 4K3AA 1N86A 2KYVA 2OARA 3NTNA 1U7JA 3FXDA 1CW5A 2A45H 3S1KA 2O1JA 3L71D 1LTJA 3IFMA 1R8EA 2M3EA 1H8AA 3L75D 1FZBA 4OVNF 1VQOP 3CWBD 3B4SA 2FXPA 2N1TB 1KC8Q 2IBZE 5KAIH 3PLNA 1SFCD 1N8RQ 1N7SB 3IN6A 3E7KA 4YTPC 4O9BA 1KB9I 1GZLA 1NKNA 2WZ7A 3WUVA 1KFNA 1QX8A 1NU1E 1LTIC 4QDCA 2BCCJ 4DJGA 3FGAD 2W83C 2NRGA 4I7ZB 2HODA 2RMZA 1S1CX 1M8OB 5AVXB 1DEBA 1NJIQ 2OYIB 2XSOA 2WSEH 2XSHA 2O01H 1NTZK 3GZXA 1IJDB 2ZXXA 1OVRA 3CXHD 3O6QB 3WMM0 1RF1B 3P7KA 1Q86Q 3F89A 1ZV8A 1LT9A 4GT1A 1FJKA 3RK3B 3Q5SA 2R5BA 4BWNA 2JP3A 5M1BA 2FBWC 1LTJC 3HRNA 4PJ0E 2QJYB 3I5CA 4PD4I 2E75C 1L0LJ 1G8JB 1FS0E 1K73Q 3NFQA 3GL0A 1RH5B 1RF0A 4K35A 3Q5PA 1E5WA 5APYA 5AW4B 4Y99B 4UB8H 3N0QA 3CL3D 1S3JA 3L71J 2K9YA 2B89A 1BE3E 3L75J 3WUTA 4EMJB 3IAOA 4Y28J 3HE4A 1ZRTE 3KXDA 4ZKPA 2CKFA 3CWBJ 4C46A 2M5AA 4D6TE 5TISE 1VQMP 1E79H 2QE7H 3H1IG 1RHZB 2KXPB 1KZUB 2YO2A 2L91A 1JTHA 5KLVG 1HBWA 1LT9C 5CCHA 3RL0g 2C9LY 3VMID 5AVYB 1EQ7A 3SSUA 2KS1B 3TYYA 5BU8B 1MFTA 3RL0C 2W6JH 2DE6D 4GODA 2IDBA 1PPJD 5CCGD 4PJ0H 1ZR4A 4I6MC 1KYOE 2C0WA 1FOSF 1MKMA 2FFDA 3L73G 1EC5A 1KILB 2A06G 1JMMA 1RF0C 5KTBA 4H0LB 2R3SA 4H13D 3GL2A 5AVSB 2YMYA 1XTCC 3H1KG 3MP7B 4PD4E 2B88A 1WQLA 3RK2C 1Q90C 1SQBK 3CC2P 4L76A 1FU1A 1AQ5A 1FE6A 3H1LJ 2HMKA 1S72P 4IL6H 1NTME 3A0BE 1PZQA 2E4PA 3L74D 1IFJA 5AW7B 1KQLA 2YXQB 4NBBD 2E74B 1KB9H 2JKVA 3H1ID 5APVA 5AVQB 1FQTA 2V7QJ 4H44B 2MJZA 2Q3IA 3GZYA 3B5NC 3SFEC 5KLVD 4QDFA 4HM6A 3TNUA 4HM4A 2LR2A 3FOUA 3MGNA 1VF5D 2QEXP 2KNCA 2K88A 3LIDA 3V5BA 4I2LC 2PFXA 1NH4A 3LW5J 1O7MA 2FFDC 3AEEC 1J1DC 5AVZB 4KHXA 2I1KA 2WSCJ 2N9BA 4PV1C 3AZCA 4WY4B 1J1EC 1KN7A 2E76B 2E4QA 2NVFA 2ZYLA 2A06D 1L0NE 4OGQB 1CI6A 2FY8A 3CX5I 1LP1A 3VOPA 1PL5A 5BU5A 3A7OA 3H1KD 4LLHA 1NO4A 3USSA 1GK4A 3EWKA 3GLMA 1GMJA 1IO4A 4W80A 4L73A 1OMIA 3H1HG 4GDOA 1N2DC 1OWAA 1AVOA 4NB8D 2QVAA 1FC2C 2IFNA 3L72E 2E74D 3GHGB 4M3LA 1L4AA 1LTBC 2CPSA 1YTZT 1AA0A 3GMAA 1IFPA 2NPSA 2WWWA 1ZW0A 4U3FE 4C7NA 4H44D 3L74J 1PP9G 1QL2A 3HTKB 1DD3A 3MHVA 1SQXJ 4HM8A 2JDIH 3P8CE 1EXIA 2BCCG 5AVRB 4HB1A 4WWIA 1PGQA 5B66H 3TGUJ 3VMYA 2QJPC 1GW3A 3JCUH 1P84E 1WT6A 2FYNC 2YNYA 2YMKA 5KLVJ 4WY4D 2B87B 2E76D 1G8KB 1OFCX 1Q90D 1BGYE 3JSVC 5GTHE 5H2FE 1BCCE 3CXHH 4GOFA 1ZN5A 1G1IA 1G2CA 2Q9IA 1XTGB 2ZYGA 2HFED 3FX0A 2N1TA 1HF9A 1ULJA 3VMXA 1J2JB 4NBED 2BEZF 1N7SA 1L0LG 2YVJB 2QA4P 4AUWA 1L4AC 3KQGA 1HTLC 3H1HD 3MUDA 4RKUJ 2D2CD 2ZT9B 3H1KJ 1PGPA 2NPSC 2ZJSE 3M9QA 1SP4A 3B5ND 1T6AA 1RY3A 2HMMA 5AW0B 1BSNA 5BVZA 3O8ZA 1RIEA 2P7JA 3L75G 1JM0A 4WVZA 1JCCA 4R4LA 1PP9D 1URQB 1ZRTD 1OW7A 2WQYC 2OYIA 3GB4A 2IYPA 4HM1A 4GIFA 4NPDA 3ABVC 5KKZC 1TU3F 3O6QA 3UIAA 3Q5RA 4L74A 4YXWH 1N73B 1OVUA 1AJYA 4N78E 3A3YB 2XZRA 1MZ9A 4QURA 1NU1J 2Y0DA 1QEXA 2HLOA 3C9IA 1LTSC 1MV8A 2QIWA 2WT7A 1Q7YQ
chains in the Genus database with same CATH topology
1BGYE 2NVFA 2ZYLA 3H1LE 3L71E 2QJYC 3GTEA 4NBHD 1L0NE 1BCCE 4QUPA 3L75E 2E75D 2DE7D 4H13D 3H1IE 3GL2A 1G8JB 1PP9E 1SQBE 4QUQA 5KLIC 4HM7A 3GL0A 1ULJA 3GCEA 2BMRA 4PD4E 1ULIA 1NTKE 1WQLA 2NUMA 5AEUA 4NBED 1JM1A 1Q90C 2YFIA 1SQPE 3EQQA 4NBCD 2BCCE 2HMLA 2YVJB 2ZT9D 3L74E 1EZVE 4NBGD 5KLVE 2BMQA 3N0QA 2DE5D 2QJKC 2D2CD 1SQXE 3D89A 2XRXA 2IBZE 2HMKA 3GTSA 1NTME 4NB8D 1BE3E 1NYKA 5BOKA 3EN1A 3TGUE 4EMJB 2E4PA 5HL4A 2JO6A 3L72E 2E74D 2HMMA 4HM3A 3CXHE 1ZRTE 4NBFD 1RIEA 1SJGA 2HMNA 2CKFA 4AIVA 4NBBD 1O7HA 1O7PA 4D6TE 1EG9A 2QPZA 2YFJA 1NU1E 4U3FE 3CX5E 4QDCA 2B1XA 2XR8A 4AAYB 5CXMA 4HKVA 1SQVE 3C0DA 2Q3WA 3BCCE 3H1JE 2HMOA 1VM9A 1VCKA 4H44D 3L73E 4HJLA 3VCPA 1FQTA 3VCAA 1SQQE 1UUVA 4P1BH 1NDOA 2A06E 3GB4A 3VMHD 2GBWA 4HM1A 2BMOA 4HM8A 3GZYA 2NVEA 5AEWA 4NBAD 5KKZC 4NB9D 2B24A 2NVGA 4QDDA 2I7FA 4HM5A 4QDFA 4HM6A 4HM4A 1NTZE 3FOUA 4OGQD 4HM2A 3H1KE 4QCKA 1VF5D 2XSOA 2QJPC 4H0LD 2XSHA 1O7WA 2YIUC 3VMGD 1P84E 1PPJE 4QURA 1RFSA 1L0LE 2FYNC 3GZXA 3VMID 1O7MA 1O7NA 1KB9E 4QDFB 2HMJA 2JZAA 3GOBA 4P1CH 3CWBE 3H1HE 3DQYA 4PV1D 2GBXA 2NUKA 2E76D 1G8KB 2NWFA 3GKEA 4HM0A 2YFLA 1UUWA 2DE6D 1O7GA 3AZCA 3L70E 2E4QA 2FYUE 1KYOE 4NBDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY E;  2NVF A;  2ZYL A;  3H1L E;  3L71 E;  2QJY C;  3GTE A;  4NBH D;  1L0N E;  1BCC E;  4QUP A;  3L75 E;  2E75 D;  2DE7 D;  4H13 D;  3H1I E;  3GL2 A;  1G8J B;  1PP9 E;  1SQB E;  4QUQ A;  5KLI C;  4HM7 A;  3GL0 A;  1ULJ A;  3GCE A;  2BMR A;  4PD4 E;  1ULI A;  1NTK E;  1WQL A;  2NUM A;  5AEU A;  4NBE D;  1JM1 A;  1Q90 C;  2YFI A;  1SQP E;  3EQQ A;  4NBC D;  2BCC E;  2HML A;  2YVJ B;  2ZT9 D;  3L74 E;  1EZV E;  4NBG D;  5KLV E;  2BMQ A;  3N0Q A;  2DE5 D;  2QJK C;  2D2C D;  1SQX E;  3D89 A;  2XRX A;  2IBZ E;  2HMK A;  3GTS A;  1NTM E;  4NB8 D;  1BE3 E;  1NYK A;  5BOK A;  3EN1 A;  3TGU E;  4EMJ B;  2E4P A;  5HL4 A;  2JO6 A;  3L72 E;  2E74 D;  2HMM A;  4HM3 A;  3CXH E;  1ZRT E;  4NBF D;  1RIE A;  1SJG A;  2HMN A;  2CKF A;  4AIV A;  4NBB D;  1O7H A;  1O7P A;  4D6T E;  1EG9 A;  2QPZ A;  2YFJ A;  1NU1 E;  4U3F E;  3CX5 E;  4QDC A;  2B1X A;  2XR8 A;  4AAY B;  5CXM A;  4HKV A;  1SQV E;  3C0D A;  2Q3W A;  3BCC E;  3H1J E;  2HMO A;  1VM9 A;  1VCK A;  4H44 D;  3L73 E;  4HJL A;  3VCP A;  1FQT A;  3VCA A;  1SQQ E;  1UUV A;  4P1B H;  1NDO A;  2A06 E;  3GB4 A;  3VMH D;  2GBW A;  4HM1 A;  2BMO A;  4HM8 A;  3GZY A;  2NVE A;  5AEW A;  4NBA D;  5KKZ C;  4NB9 D;  2B24 A;  2NVG A;  4QDD A;  2I7F A;  4HM5 A;  4QDF A;  4HM6 A;  4HM4 A;  1NTZ E;  3FOU A;  4OGQ D;  4HM2 A;  3H1K E;  4QCK A;  1VF5 D;  2XSO A;  2QJP C;  4H0L D;  2XSH A;  1O7W A;  2YIU C;  3VMG D;  1P84 E;  1PPJ E;  4QUR A;  1RFS A;  1L0L E;  2FYN C;  3GZX A;  3VMI D;  1O7M A;  1O7N A;  1KB9 E;  4QDF B;  2HMJ A;  2JZA A;  3GOB A;  4P1C H;  3CWB E;  3H1H E;  3DQY A;  4PV1 D;  2GBX A;  2NUK A;  2E76 D;  1G8K B;  2NWF A;  3GKE A;  4HM0 A;  2YFL A;  1UUW A;  2DE6 D;  1O7G A;  3AZC A;  3L70 E;  2E4Q A;  2FYU E;  1KYO E;  4NBD D; 
#chains in the Genus database with same CATH topology
 2LKM A;  3NXS A;  3KPE A;  2N1T C;  1USD A;  1GL2 D;  1ZR2 A;  4QUP A;  1LTA C;  3VYI A;  1IFD A;  2Q6Q A;  1N7S C;  3CCJ P;  1S4X A;  1ZLL A;  3G6E P;  1KYO D;  3CX5 H;  2W8Z A;  1EXJ A;  3LIE A;  3VMZ A;  1ULI A;  3RGU A;  1QLE D;  1L0L D;  3C1L A;  2OGU A;  2ZT9 D;  2Y0E A;  1VQ9 P;  2DE5 D;  3E1R A;  1KTM A;  3D89 A;  1JNM A;  3HD7 A;  4LC1 A;  5KLV K;  1JB0 J;  2JO6 A;  1ZP0 C;  1FZC A;  2P67 A;  3H1L G;  3H1H J;  3H32 B;  2WSF H;  1NAY A;  3CPW O;  1URQ D;  4AAY B;  2H7H A;  1IK9 A;  4DZO A;  4UB8 E;  1K8A Q;  2CK3 H;  2O01 N;  3GW6 A;  5KJ7 D;  1BE3 J;  3RK3 C;  2KS1 A;  2P58 A;  4GOE A;  1NTZ E;  1PP9 J;  1LT1 A;  1O7W A;  2YIU C;  4D6T J;  1YI2 P;  2Y0C A;  1OIP A;  1PGO A;  1KIL A;  3S9O A;  2C9N Y;  3N7N A;  3B8E B;  1GU5 A;  5E79 H;  1LWU B;  2CPB A;  5AW2 B;  2R3C A;  2WTY A;  4R4M A;  2NPS D;  2W90 A;  2KZJ A;  1DX7 A;  3CCL P;  1OW6 A;  3CCM P;  2XKM A;  2KOG A;  1L0N D;  3HD7 C;  2Z5H A;  4JBZ A;  1PPJ G;  4IFM A;  2YFI A;  2GUS A;  1EZV E;  2M3B A;  2JR8 A;  3TDK A;  1T2K D;  1FZC C;  1JEK A;  1FZE A;  1YQ3 C;  3WUU A;  1LJ2 A;  3H1L D;  4H13 B;  2POH A;  2GA1 A;  1FDO A;  1YBK A;  2KUB A;  1YTZ I;  1EDL A;  3C0D A;  3BCC E;  3H1J E;  5APX A;  1EDK A;  1M56 D;  1M1J B;  3HUS A;  3W68 A;  3OAK A;  5APW A;  4EDF A;  1NDO A;  3VMH D;  3IF4 A;  2BMO A;  1EDI A;  2NVE A;  1NTM J;  4QDD A;  4HJG H;  3L74 G;  2A45 G;  4NPF X;  4IL6 E;  1KIL C;  1SQX G;  2ZVO B;  3S4R A;  4H0L C;  3T97 B;  3TGU G;  2W6A A;  2XV5 A;  1O7N A;  1KB9 E;  3AEA C;  1CSB A;  2QSI A;  2YFL A;  1O7G A;  1P84 D;  1FZG A;  3CC7 P;  2FYU E;  1D7M A;  1KQG B;  3EFG A;  1M57 D;  1VF5 B;  1LTJ B;  3KZI H;  2P10 A;  1ZOY C;  1BGY D;  1SQB E;  4IOI H;  1S2E A;  2IYO A;  1VL2 A;  1AFO A;  2XNX A;  3TK1 A;  1SQP E;  3GHG A;  4NBG D;  2PP6 A;  1UIX A;  3CXH I;  2QJK C;  1YYC A;  4UB6 H;  5AW3 B;  2KI7 B;  1L0N J;  3BVH A;  2HR3 A;  2WVR A;  3HUS C;  1UII A;  1JOC A;  3HTK A;  2MKV A;  2HOD B;  3M9B A;  1OVV A;  3QWO C;  2XR8 A;  1VQ4 P;  1VQN P;  3V2N A;  1OZH A;  3D71 A;  3V6I A;  2KB7 P;  3H25 A;  1SQQ E;  1UUV A;  5AW1 B;  3AE2 C;  2E5T A;  1ZME C;  2IZ1 A;  1IFI A;  2FYZ A;  3L72 J;  1KQF B;  1SQX D;  4AQR D;  4OGQ C;  2IBZ G;  3PH0 A;  3VMG D;  1LT9 B;  2Y9Z A;  3TGU D;  2XDJ A;  4U3F J;  1Y47 A;  5AW5 B;  1NWQ A;  3CWB E;  4N78 D;  5CCH C;  1L0L K;  2GBX A;  1NKZ B;  3AE3 C;  3HD7 D;  1W5C E;  1NU1 G;  3L70 E;  1Z56 A;  1NAF A;  3AE5 C;  3MZW B;  2JEE A;  4TT3 H;  1DD4 A;  3SWK A;  1DEE G;  5B66 E;  2E75 D;  2ZXE B;  3OW2 O;  1VDF A;  1FDM A;  1VQ6 P;  3JCU E;  2LXC B;  2OTK E;  4QUQ A;  3GCE A;  1NGM B;  2NUM A;  2WMM A;  2WPQ A;  3RK2 B;  2BMQ A;  2HPC A;  5CBN A;  3GF7 A;  3HE4 B;  1BGY J;  3M0A A;  4EIJ A;  2K9J A;  2M5A B;  3M0D A;  1HGZ A;  3CXH E;  3ZDM A;  1RE3 A;  1T3U A;  1IFM A;  5KAF H;  5KLI B;  5DJT B;  2WPS A;  2HYN A;  3OJA B;  4XE5 B;  1SQV E;  3MTU E;  1SFC A;  1JTH B;  2OYO A;  4BRY B;  3V2R A;  3IR9 A;  3PHL A;  5CJ4 A;  2D2C B;  2AEJ A;  1HJ0 A;  3B5N B;  2I1J A;  3KHU A;  1Y8A A;  2IBZ D;  3A0H H;  2PAJ A;  1LTT C;  1BE3 G;  3NMD A;  3RL0 D;  2E5Y A;  3HE5 B;  1L0N K;  1NTZ D;  1OW8 A;  4D6T G;  2FFD B;  1NU1 D;  1J1D B;  1FJP A;  2G8Y A;  1VQL P;  4BXL A;  2ZYD A;  2KLV A;  1Y9B A;  4ASV A;  3AEB C;  2G3A A;  3CI9 A;  4AYC A;  2R44 A;  5EFW B;  2C0X A;  4HM7 A;  3RK2 D;  3CCE P;  1GK6 A;  1NTK E;  1VQ5 P;  3G4S P;  3EQQ A;  3M0D C;  2L5G B;  1RE3 C;  1HWT C;  1JCD A;  3H32 A;  3FWL A;  3GTS A;  2M8R A;  1GL2 B;  3EN1 A;  1NOH A;  1H0T B;  3AED C;  1SFC C;  1U57 A;  4HM3 A;  2OYH B;  2WSE J;  2O01 J;  5AW8 B;  4YXD C;  3RK3 E;  1IFN A;  3CX5 E;  4XFJ A;  4N6J A;  2WSS H;  2UWJ E;  1LTG C;  5CHX A;  2AEM A;  1FDI A;  1QVG O;  4HKZ H;  2IZ0 A;  5CCH D;  3CCQ P;  4A7P A;  3VCA A;  3TNU B;  1H89 A;  3WU2 H;  2WIT A;  2ZYA A;  4DCK A;  1CZQ A;  1BDC A;  2N9Y B;  3AEF C;  1FAV A;  4NBA D;  3VTP C;  2BAS A;  3M9H A;  3H1J D;  5AVU B;  1K05 A;  3I55 P;  5GTI H;  1L2P A;  1SQQ G;  1BE3 D;  1NTM G;  1R5L A;  1FZF A;  2OTL P;  1LWU A;  2AXC A;  3PRJ A;  5APU A;  2FYN B;  3OA7 A;  3TSI A;  4KJM A;  4PV1 D;  4D6T D;  3G9R A;  3D6Y A;  3AE7 C;  2V7Q H;  2B9B A;  1RF1 A;  4GKG A;  3N4X A;  3V4W A;  1KB9 D;  2V4H A;  1NTZ J;  4U7J A;  1VPC A;  5CCG A;  1N7L A;  3H1I E;  2FYU D;  4OWF A;  1HUC A;  1RQU A;  3LW5 H;  1VQ7 P;  1YQ4 C;  3EQ2 A;  5AEU A;  2WSC H;  2HML A;  1QL1 A;  5KLV E;  2DW3 A;  1SQB D;  5E79 E;  1AVY A;  4RJT A;  2NPS B;  1SVF A;  1SQP D;  1SQX K;  5HL4 A;  3C8V A;  1M1J A;  4MN4 C;  3MUD C;  5CBO A;  2H89 C;  4C7N B;  4AIV A;  1L0N G;  1FBM A;  3CLQ A;  2KSJ A;  1X22 A;  1KIL E;  4I7Z C;  1VCK A;  1KQS O;  3L73 E;  3MD0 A;  4P1B H;  2A06 E;  4PD4 D;  2GBW A;  1JO5 A;  3ITK A;  1LWU C;  3VMA A;  2YXR B;  2R5D A;  2I7F A;  5KKZ B;  1SQV G;  2OYI C;  3H1K E;  4QCK A;  1SQQ D;  3AE9 C;  1NTM D;  1YJ9 P;  1S9K E;  3W67 A;  2H43 A;  1RF1 C;  2M0B A;  3L72 G;  1LNQ A;  2Q1K A;  3BCC J;  3H1J J;  1BSH A;  5B5E H;  2BEQ D;  4U3F G;  3B71 A;  1T3J A;  2R32 A;  1IK7 A;  2RN0 A;  5CCG C;  1G2C B;  2PRR A;  4JYB A;  2QJY C;  3H6P A;  1NHL A;  2JWA A;  2AXT H;  3L70 D;  1GTW A;  2FKW B;  3E1I A;  4H13 C;  3G71 P;  2HG5 D;  2P2U A;  4RO0 A;  4Y99 C;  2YKQ A;  4NBC D;  1L4A D;  3AEC C;  3RBZ A;  1M1J C;  3AE8 C;  3BRT B;  3M91 A;  2FYU J;  1IC2 A;  1EDJ A;  2XRX A;  3SWF A;  5BOK A;  2ZAE B;  1NTK G;  3FXE A;  4N3Y B;  1BGY G;  3KZI E;  1H88 A;  1SQB J;  1BCC G;  1IZN B;  1KFM A;  1DIP A;  1SQP J;  1VM9 A;  1NU1 K;  1NYH A;  3L4F A;  1KYO I;  1M90 Q;  3U1A A;  2QM7 A;  4EYY Q;  1YJW P;  3CCR P;  2O3J A;  3GF3 A;  3CME P;  1SQV D;  4UB6 E;  4HM2 A;  2QG4 A;  2GUV A;  1AV1 A;  2IPP A;  3KDP B;  3Q1M A;  4C7R A;  1VF5 C;  2YIU B;  3L72 D;  3GOB A;  3H1H E;  2WT7 B;  2OTJ P;  1KV4 A;  1LGH B;  1SQQ J;  4U3F D;  2KZI A;  3R2P A;  1JY2 P;  1WMK A;  3VP9 A;  2JJL A;  2Q7C A;  1JUN A;  2N1T D;  3VP8 A;  4WY4 A;  4W7Z A;  1N7S D;  3P8C D;  1KD1 Q;  3SWY A;  1PP9 E;  3SFD C;  2KK7 A;  3M06 A;  2BMR A;  3U1C A;  1JY3 P;  3HD7 B;  2BCC E;  1QGK B;  4WBA A;  3L70 J;  3AE4 C;  2ZFC A;  4DT0 A;  1FZC B;  5CMZ A;  1NTK D;  2WPR A;  1RE4 A;  3CMA P;  2FXO A;  2E75 B;  1GW4 A;  4BRY A;  2E74 C;  3II6 A;  3QH9 A;  1A02 F;  1O7H A;  1O7P A;  1BCC D;  2Y9Y A;  2YFJ A;  1K04 A;  2IX7 C;  4YPC A;  5CXM A;  3B5N A;  4W7Y A;  4H44 C;  3AE1 C;  4ZMD A;  2RKL A;  2SPZ A;  2ITA A;  3RK3 D;  3D6Z A;  3CX5 D;  3GG2 A;  2B24 A;  3HE5 A;  1RQV A;  4ZKU A;  4JYC A;  3I56 P;  2AEF A;  1HJB A;  2FYU K;  4TLF A;  1RFS A;  1L0L E;  5KAF E;  3RBX A;  1SQV J;  3D70 A;  1VQ8 P;  1VQK P;  5L8R J;  4WY4 C;  2NWF A;  3BRV B;  1UUW A;  2E76 C;  3VN0 A;  5AW6 B;  5CJ0 A;  5K5G B;  1BDD A;  2B87 A;  1S5L X;  3L71 E;  1R5S A;  1MUU A;  1SQP K;  3L75 E;  2J58 A;  4LGD E;  1T8Z A;  2YKP A;  5TIS H;  3A0H E;  3V2Q A;  1NTZ G;  3RL0 B;  5DJU B;  5KLI C;  1A02 J;  4JPZ B;  2W6B A;  3CCS P;  1PFI A;  1JM1 A;  1GL2 A;  1RE4 C;  2QRX A;  2H8P D;  1H0T A;  2OYH A;  2Z5I A;  2QJK B;  5C39 A;  5AVV B;  4NPE A;  2D2C C;  3GHG C;  1P84 I;  2VRS A;  1SQQ K;  1NTM K;  1SS1 A;  2ZVN B;  3HUS B;  1EG9 A;  4JF7 A;  3EFF K;  4HKV A;  1NTK J;  2Q3W A;  4B86 A;  1GDT A;  1KYO H;  1JY2 N;  1BCC J;  2K1A A;  5AEW A;  5AVW B;  1URQ A;  1EZV G;  4DOJ A;  1KIL D;  1MFZ A;  3PP5 A;  3L73 D;  1ZXG A;  1G1J A;  4H0L D;  1DH3 A;  2KSE A;  4HYT B;  1OX3 A;  1N73 A;  4PD4 H;  5KJ7 A;  2NUK A;  1X8Y A;  1JY3 N;  1YJN P;  1U7M A;  1X79 B;  1Q81 Q;  1X0T A;  4WB4 A;  1S9K D;  2NZ2 A;  3AEG C;  3WU2 E;  3BCC G;  3H1J G;  3A0B H;  1AQT A;  1HGV A;  3H1L E;  3GTE A;  1USE A;  1Q82 Q;  2RH0 A;  2KIK A;  1PIX A;  4OH8 B;  1GL2 C;  3U59 A;  1KMI Z;  1W2E A;  5GTI E;  2A45 I;  2XU6 A;  2OYH C;  2J5U A;  1YHQ P;  4ZNC A;  2WSF J;  4PV1 B;  1J1E B;  1K9M Q;  3V2P A;  2ZT9 C;  1YIT P;  1W2B O;  1HH0 A;  4RES B;  4L75 A;  1SQV K;  3JC2 2;  1NYK A;  1FOS E;  3AE6 C;  1KOR A;  2FYU G;  5AVT B;  3H1I J;  2K3R A;  1JY2 O;  2QPZ A;  5AW9 B;  2GM4 A;  3G3Z A;  3R4Y A;  1URQ C;  2HMO A;  2FXM A;  3PTZ A;  3BAT A;  4HJL A;  3VCP A;  1SQB G;  3Q2Y A;  3BAS A;  1YIJ P;  1QVF O;  4HH2 A;  4KT0 J;  1SQP G;  2OQQ A;  1N73 C;  1EZV D;  3L36 A;  2K37 A;  5KJ7 C;  3CCU P;  4OGQ D;  1WRG A;  2YO3 A;  1JY3 O;  3TF5 A;  3P32 A;  4EI2 A;  1PPJ E;  4EOT A;  4ASW A;  2XND H;  4QDF B;  2HMJ A;  4P1C H;  2E43 A;  3K5B A;  3L73 J;  2KNC B;  2LXB A;  1GU4 A;  3FWN A;  4XA4 A;  2IFM A;  5APT A;  1S5L E;  3BCC D;  4NBD D;  3L37 A;  1NTK K;  2I8D A;  2O1K A;  2JWD A;  2Q5U A;  2QJP B;  2KLU A;  1SLQ A;  1PV3 A;  4QMA A;  1NVO A;  2DE7 D;  2H88 C;  2PGD A;  3PJS K;  4IFD K;  2HPC B;  4CPG A;  3L71 G;  3A2A A;  2IBZ I;  2K9J B;  2YKO A;  1CI6 B;  3L74 E;  1LP1 B;  3CD6 P;  2E42 A;  3CC4 P;  5B5E E;  2KP8 A;  2J59 M;  3CWB G;  1SQX E;  1T2K C;  4I1L A;  1Q2N A;  3P8M C;  3L70 G;  5APQ A;  3TGU E;  2BCC D;  4IFF A;  1P84 H;  4NBF D;  5KAI E;  1SJG A;  1SFC B;  2HMN A;  2AXT E;  2Q3E A;  3A5T A;  1M7L A;  2B1X A;  4IL6 X;  1OXZ A;  1X9V A;  1L4A B;  2P1J A;  3F5H A;  1PGJ A;  3V4Q A;  2Z4E A;  2W27 A;  5GTH H;  5H2F H;  4NB9 D;  2NVG A;  2JO1 A;  2WPV B;  4HM5 A;  3L35 A;  2QM8 A;  3Q3D A;  3CCV P;  3KYQ A;  1FZA A;  1M1K Q;  5TJH A;  1JMB A;  1HVV A;  4JQ0 D;  1S5L H;  2JZA A;  1EZV I;  3DQY A;  3MIW A;  3GKE A;  4HM0 A;  3T97 A;  4Z1M H;  1VQP P;  1GD2 E;  5APS A;  4NBH D;  4K3A A;  1N86 A;  2KYV A;  2OAR A;  3NTN A;  1U7J A;  3FXD A;  1CW5 A;  2A45 H;  3S1K A;  2O1J A;  3L71 D;  1LTJ A;  3IFM A;  1R8E A;  2M3E A;  1H8A A;  3L75 D;  1FZB A;  4OVN F;  1VQO P;  3CWB D;  3B4S A;  2FXP A;  2N1T B;  1KC8 Q;  2IBZ E;  5KAI H;  3PLN A;  1SFC D;  1N8R Q;  1N7S B;  3IN6 A;  3E7K A;  4YTP C;  4O9B A;  1KB9 I;  1GZL A;  1NKN A;  2WZ7 A;  3WUV A;  1KFN A;  1QX8 A;  1NU1 E;  1LTI C;  4QDC A;  2BCC J;  4DJG A;  3FGA D;  2W83 C;  2NRG A;  4I7Z B;  2HOD A;  2RMZ A;  1S1C X;  1M8O B;  5AVX B;  1DEB A;  1NJI Q;  2OYI B;  2XSO A;  2WSE H;  2XSH A;  2O01 H;  1NTZ K;  3GZX A;  1IJD B;  2ZXX A;  1OVR A;  3CXH D;  3O6Q B;  3WMM 0;  1RF1 B;  3P7K A;  1Q86 Q;  3F89 A;  1ZV8 A;  1LT9 A;  4GT1 A;  1FJK A;  3RK3 B;  3Q5S A;  2R5B A;  4BWN A;  2JP3 A;  5M1B A;  2FBW C;  1LTJ C;  3HRN A;  4PJ0 E;  2QJY B;  3I5C A;  4PD4 I;  2E75 C;  1L0L J;  1G8J B;  1FS0 E;  1K73 Q;  3NFQ A;  3GL0 A;  1RH5 B;  1RF0 A;  4K35 A;  3Q5P A;  1E5W A;  5APY A;  5AW4 B;  4Y99 B;  4UB8 H;  3N0Q A;  3CL3 D;  1S3J A;  3L71 J;  2K9Y A;  2B89 A;  1BE3 E;  3L75 J;  3WUT A;  4EMJ B;  3IAO A;  4Y28 J;  3HE4 A;  1ZRT E;  3KXD A;  4ZKP A;  2CKF A;  3CWB J;  4C46 A;  2M5A A;  4D6T E;  5TIS E;  1VQM P;  1E79 H;  2QE7 H;  3H1I G;  1RHZ B;  2KXP B;  1KZU B;  2YO2 A;  2L91 A;  1JTH A;  5KLV G;  1HBW A;  1LT9 C;  5CCH A;  3RL0 g;  2C9L Y;  3VMI D;  5AVY B;  1EQ7 A;  3SSU A;  2KS1 B;  3TYY A;  5BU8 B;  1MFT A;  3RL0 C;  2W6J H;  2DE6 D;  4GOD A;  2IDB A;  1PPJ D;  5CCG D;  4PJ0 H;  1ZR4 A;  4I6M C;  1KYO E;  2C0W A;  1FOS F;  1MKM A;  2FFD A;  3L73 G;  1EC5 A;  1KIL B;  2A06 G;  1JMM A;  1RF0 C;  5KTB A;  4H0L B;  2R3S A;  4H13 D;  3GL2 A;  5AVS B;  2YMY A;  1XTC C;  3H1K G;  3MP7 B;  4PD4 E;  2B88 A;  1WQL A;  3RK2 C;  1Q90 C;  1SQB K;  3CC2 P;  4L76 A;  1FU1 A;  1AQ5 A;  1FE6 A;  3H1L J;  2HMK A;  1S72 P;  4IL6 H;  1NTM E;  3A0B E;  1PZQ A;  2E4P A;  3L74 D;  1IFJ A;  5AW7 B;  1KQL A;  2YXQ B;  4NBB D;  2E74 B;  1KB9 H;  2JKV A;  3H1I D;  5APV A;  5AVQ B;  1FQT A;  2V7Q J;  4H44 B;  2MJZ A;  2Q3I A;  3GZY A;  3B5N C;  3SFE C;  5KLV D;  4QDF A;  4HM6 A;  3TNU A;  4HM4 A;  2LR2 A;  3FOU A;  3MGN A;  1VF5 D;  2QEX P;  2KNC A;  2K88 A;  3LID A;  3V5B A;  4I2L C;  2PFX A;  1NH4 A;  3LW5 J;  1O7M A;  2FFD C;  3AEE C;  1J1D C;  5AVZ B;  4KHX A;  2I1K A;  2WSC J;  2N9B A;  4PV1 C;  3AZC A;  4WY4 B;  1J1E C;  1KN7 A;  2E76 B;  2E4Q A;  2NVF A;  2ZYL A;  2A06 D;  1L0N E;  4OGQ B;  1CI6 A;  2FY8 A;  3CX5 I;  1LP1 A;  3VOP A;  1PL5 A;  5BU5 A;  3A7O A;  3H1K D;  4LLH A;  1NO4 A;  3USS A;  1GK4 A;  3EWK A;  3GLM A;  1GMJ A;  1IO4 A;  4W80 A;  4L73 A;  1OMI A;  3H1H G;  4GDO A;  1N2D C;  1OWA A;  1AVO A;  4NB8 D;  2QVA A;  1FC2 C;  2IFN A;  3L72 E;  2E74 D;  3GHG B;  4M3L A;  1L4A A;  1LTB C;  2CPS A;  1YTZ T;  1AA0 A;  3GMA A;  1IFP A;  2NPS A;  2WWW A;  1ZW0 A;  4U3F E;  4C7N A;  4H44 D;  3L74 J;  1PP9 G;  1QL2 A;  3HTK B;  1DD3 A;  3MHV A;  1SQX J;  4HM8 A;  2JDI H;  3P8C E;  1EXI A;  2BCC G;  5AVR B;  4HB1 A;  4WWI A;  1PGQ A;  5B66 H;  3TGU J;  3VMY A;  2QJP C;  1GW3 A;  3JCU H;  1P84 E;  1WT6 A;  2FYN C;  2YNY A;  2YMK A;  5KLV J;  4WY4 D;  2B87 B;  2E76 D;  1G8K B;  1OFC X;  1Q90 D;  1BGY E;  3JSV C;  5GTH E;  5H2F E;  1BCC E;  3CXH H;  4GOF A;  1ZN5 A;  1G1I A;  1G2C A;  2Q9I A;  1XTG B;  2ZYG A;  2HFE D;  3FX0 A;  2N1T A;  1HF9 A;  1ULJ A;  3VMX A;  1J2J B;  4NBE D;  2BEZ F;  1N7S A;  1L0L G;  2YVJ B;  2QA4 P;  4AUW A;  1L4A C;  3KQG A;  1HTL C;  3H1H D;  3MUD A;  4RKU J;  2D2C D;  2ZT9 B;  3H1K J;  1PGP A;  2NPS C;  2ZJS E;  3M9Q A;  1SP4 A;  3B5N D;  1T6A A;  1RY3 A;  2HMM A;  5AW0 B;  1BSN A;  5BVZ A;  3O8Z A;  1RIE A;  2P7J A;  3L75 G;  1JM0 A;  4WVZ A;  1JCC A;  4R4L A;  1PP9 D;  1URQ B;  1ZRT D;  1OW7 A;  2WQY C;  2OYI A;  3GB4 A;  2IYP A;  4HM1 A;  4GIF A;  4NPD A;  3ABV C;  5KKZ C;  1TU3 F;  3O6Q A;  3UIA A;  3Q5R A;  4L74 A;  4YXW H;  1N73 B;  1OVU A;  1AJY A;  4N78 E;  3A3Y B;  2XZR A;  1MZ9 A;  4QUR A;  1NU1 J;  2Y0D A;  1QEX A;  2HLO A;  3C9I A;  1LTS C;  1MV8 A;  2QIW A;  2WT7 A;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 1BGY E;  2NVF A;  2ZYL A;  3H1L E;  3L71 E;  2QJY C;  3GTE A;  4NBH D;  1L0N E;  1BCC E;  4QUP A;  3L75 E;  2E75 D;  2DE7 D;  4H13 D;  3H1I E;  3GL2 A;  1G8J B;  1PP9 E;  1SQB E;  4QUQ A;  5KLI C;  4HM7 A;  3GL0 A;  1ULJ A;  3GCE A;  2BMR A;  4PD4 E;  1ULI A;  1NTK E;  1WQL A;  2NUM A;  5AEU A;  4NBE D;  1JM1 A;  1Q90 C;  2YFI A;  1SQP E;  3EQQ A;  4NBC D;  2BCC E;  2HML A;  2YVJ B;  2ZT9 D;  3L74 E;  1EZV E;  4NBG D;  5KLV E;  2BMQ A;  3N0Q A;  2DE5 D;  2QJK C;  2D2C D;  1SQX E;  3D89 A;  2XRX A;  2IBZ E;  2HMK A;  3GTS A;  1NTM E;  4NB8 D;  1BE3 E;  1NYK A;  5BOK A;  3EN1 A;  3TGU E;  4EMJ B;  2E4P A;  5HL4 A;  2JO6 A;  3L72 E;  2E74 D;  2HMM A;  4HM3 A;  3CXH E;  1ZRT E;  4NBF D;  1RIE A;  1SJG A;  2HMN A;  2CKF A;  4AIV A;  4NBB D;  1O7H A;  1O7P A;  4D6T E;  1EG9 A;  2QPZ A;  2YFJ A;  1NU1 E;  4U3F E;  3CX5 E;  4QDC A;  2B1X A;  2XR8 A;  4AAY B;  5CXM A;  4HKV A;  1SQV E;  3C0D A;  2Q3W A;  3BCC E;  3H1J E;  2HMO A;  1VM9 A;  1VCK A;  4H44 D;  3L73 E;  4HJL A;  3VCP A;  1FQT A;  3VCA A;  1SQQ E;  1UUV A;  4P1B H;  1NDO A;  2A06 E;  3GB4 A;  3VMH D;  2GBW A;  4HM1 A;  2BMO A;  4HM8 A;  3GZY A;  2NVE A;  5AEW A;  4NBA D;  5KKZ C;  4NB9 D;  2B24 A;  2NVG A;  4QDD A;  2I7F A;  4HM5 A;  4QDF A;  4HM6 A;  4HM4 A;  1NTZ E;  3FOU A;  4OGQ D;  4HM2 A;  3H1K E;  4QCK A;  1VF5 D;  2XSO A;  2QJP C;  4H0L D;  2XSH A;  1O7W A;  2YIU C;  3VMG D;  1P84 E;  1PPJ E;  4QUR A;  1RFS A;  1L0L E;  2FYN C;  3GZX A;  3VMI D;  1O7M A;  1O7N A;  1KB9 E;  4QDF B;  2HMJ A;  2JZA A;  3GOB A;  4P1C H;  3CWB E;  3H1H E;  3DQY A;  4PV1 D;  2GBX A;  2NUK A;  2E76 D;  1G8K B;  2NWF A;  3GKE A;  4HM0 A;  2YFL A;  1UUW A;  2DE6 D;  1O7G A;  3AZC A;  3L70 E;  2E4Q A;  2FYU E;  1KYO E;  4NBD D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...