3H1HE

Cytochrome bc1 complex from chicken
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
total genus 40
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1hE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1hE02
4HM4A 2E4PA 3DQYA 2B1XA 1SQVE 5KKZC 4OGQD 3GB4A 4NB8D 3EQQA 4NBFD 1NDOA 2QJKC 4HM7A 2XSHA 4H0LD 5AEWA 5KLIC 4NBAD 3VCAA 1WQLA 1O7NA 4EMJB 2NVFA 2JO6A 2XSOA 3GOBA 4HM5A 1BCCE 1P84E 4P1CH 2YFIA 5AEUA 2XR8A 3GKEA 3GTEA 4U3FE 2HMMA 3H1KE 4NBGD 3VMHD 3GCEA 3C0DA 2E75D 1FQTA 2IBZE 4NBDD 2GBXA 2HMKA 1O7WA 3AZCA 1NTKE 1EZVE 2E76D 4QURA 2QJPC 3H1IE 4HM1A 3TGUE 4NBHD 4NBCD 2DE5D 2D2CD 3L74E 4HM3A 3BCCE 2NUMA 2FYNC 2BCCE 2NWFA 1RFSA 3GZYA 1G8JB 1NU1E 1Q90C 1ZRTE 2Q3WA 3VMID 4HM8A 1NYKA 1RIEA 5BOKA 3EN1A 5KLVE 5CXMA 1O7HA 2CKFA 1BGYE 3H1HE 1SJGA 3CWBE 2E74D 1JM1A 4HM0A 1VM9A 2YIUC 1NTZE 1L0LE 2NVGA 2NVEA 1KYOE 1UUVA 4H13D 2BMOA 3GL0A 1BE3E 2XRXA 4QUQA 1O7PA 3L73E 1L0NE 1SQQE 1SQBE 3L72E 1O7MA 3GTSA 2ZT9D 3N0QA 4QDFB 1O7GA 3VCPA 2B24A 2E4QA 1PP9E 4PV1D 3CX5E 4QDDA 1KB9E 2HMJA 2FYUE 2YVJB 4NBBD 3L71E 1UUWA 1PPJE 4QUPA 1EG9A 4HM2A 2GBWA 2DE6D 2HMOA 2ZYLA 3L75E 4H44D 4P1BH 1G8KB 4HM6A 4NB9D 4AAYB 3H1LE 2YFLA 3GZXA 4QDCA 2YFJA 2I7FA 4QDFA 3D89A 5HL4A 3H1JE 1SQPE 1ULJA 4D6TE 1VF5D 1VCKA 2QPZA 1SQXE 4NBED 1ULIA 2BMRA 1NTME 2DE7D 3GL2A 4HJLA 3FOUA 4QCKA 2QJYC 3VMGD 2JZAA 2NUKA 4AIVA 2HMNA 2A06E 3CXHE 3L70E 2BMQA 4PD4E 4HKVA 2HMLA
chains in the Genus database with same CATH superfamily
3H1JG 3P8MC 5CMZA 4KHXA 5APWA 1FZCB 5AVYB 5KLIB 2OTLP 3L71G 3R4YA 2XSOA 4HM5A 2Y0DA 1L0LK 1RE4C 3MHVA 2H43A 1SQBK 3VMAA 3AZCA 1NTKE 1AV1A 1N7SD 2E76D 1SQPG 4D6TG 3H1KD 1P84H 3WMM0 4IOIH 1JB0J 1RE4A 3M9BA 3TGUD 2B87B 4CPGA 3AEGC 4W7YA 3M9QA 3SWFA 1KQGB 4BRYB 1OX3A 1KILD 1L0LE 1M7LA 1N7LA 2WPRA 3EFGA 5APUA 1Q90D 2XDJA 4OH8B 4DZOA 1SQBE 5APXA 2ZT9D 5B66E 1FDOA 1NTKG 1TU3F 5KLVJ 2J58A 1KZUB 1JTHB 2AEMA 1KYOH 3HRNA 1Q7YQ 1AQ5A 2O1KA 5GTIH 2DE6D 2KP8A 1S4XA 2FYZA 3B5NB 3L71D 1AA0A 1FOSE 3L73J 4LGDE 3CMAP 1PP9J 2HFED 1OXZA 2YMKA 3OAKA 3R2PA 2DE7D 1YJWP 1L0LG 3MIWA 1RHZB 1SQPD 3CXHE 4L73A 1VDFA 3GHGB 1PP9D 4UB6H 1SQBG 2KUBA 5KKZC 2KLVA 2RKLA 2W8ZA 4PJ0H 4I1LA 3RK2C 4HM7A 1ZLLA 2YMYA 1SQXJ 2NVFA 3I56P 3KPEA 3AE6C 1CW5A 3HE5A 4IL6H 1E5WA 2P2UA 4YPCA 2YIUB 1SQXD 2QJPB 1KTMA 1DX7A 4H44C 1IFNA 2KNCB 2FYNC 4EDFA 1G8JB 2KS1A 2FFDC 1FAVA 1ZN5A 1NKNA 2QIWA 2XNDH 3AEEC 3V2NA 2Q1KA 2XV5A 1YJNP 3MP7B 2W27A 2K1AA 4WY4C 2FFDA 2A45H 1JY3N 1USEA 1L0LD 1VF5B 1SQVK 4XFJA 1VQMP 2WSEJ 1SQBD 1X8YA 1S5LE 1SVFA 1ZV8A 4WY4A 4W7ZA 3V4QA 3NFQA 2ZYLA 3L35A 3O8ZA 2C0WA 1RF1C 4YTPC 2Z5HA 1UIIA 1T2KD 3CCEP 2OYHB 3BVHA 2ZVNB 3UIAA 2ZYGA 1ULJA 2IYPA 1GU5A 2QPZA 2WZ7A 3P8CD 1GZLA 2FYUJ 1NU1K 1LT9B 3H6PA 2WWWA 3S1KA 4I2LC 1JY3P 2M5AB 4JBZA 4EYYQ 3AEAC 2AXTH 1RF1A 1SQVE 3Q2YA 3JCUE 5CJ4A 2FYUD 3HE4A 4N6JA 3CXHD 2QJKB 3VYIA 1NKZB 1OWAA 2HYNA 4IL6X 3VCAA 4O9BA 4GIFA 1KD1Q 2Z4EA 2WTYA 4EOTA 4PV1C 3ABVC 3FWLA 1M1JC 1LNQA 2C9LY 1KMIZ 1NHLA 5AW8B 3VMID 1NU1E 3M0DC 3V2RA 1HWTC 1M1JA 1LTJC 5B66H 4OGQB 3M0DA 3G4SP 2XU6A 2NPSB 1LTJA 2HPCA 2WSEH 1AFOA 1X22A 3T97B 2IFNA 5L8RJ 2E75B 2OTJP 1BE3G 1EG9A 1NU1G 1EDIA 3SFEC 5APQA 3CCSP 1KORA 3TF5A 1VQOP 3FWNA 3H25A 2FXMA 4KT0J 1URQC 2DW3A 3RL0C 1AQTA 2E74C 2C9NY 4ASWA 3C1LA 1WMKA 4K3AA 2B1XA 2PRRA 1L2PA 2YO3A 2H8PD 1QVGO 1NWQA 5CBNA 1FZCC 2PP6A 2R32A 5KLIC 1SQVD 1URQA 1JCDA 2B89A 1K04A 2XR8A 3WUUA 4NBGD 1CZQA 3D70A 3SWYA 3L36A 1PGQA 1FZCA 1M1KQ 1QL1A 4YXWH 4H13C 4QMAA 1LP1B 1NU1D 2WPSA 4IFFA 3D71A 2XZRA 3M91A 3BCCJ 2N1TD 1JY2O 2BASA 3GL0A 2B87A 1FZGA 2Y9ZA 4QUQA 1K8AQ 4Y99B 1N8RQ 4TLFA 3BCCD 2R3SA 2YVJB 4BRYA 4DT0A 2MKVA 4YXDC 2W6JH 4QUPA 1N7SB 3L75E 2CPSA 3B5NC 3PRJA 1SQQJ 2I7FA 3PH0A 3A0BH 1JTHA 5CCHD 1HH0A 3CCUP 2IX7C 4Y28J 5KTBA 4QCKA 4AIVA 1SQQD 3B5NA 1KILB 3GHGC 4EI2A 3DQYA 3CL3D 2ZT9B 1X0TA 4ZNCA 1BCCE 3AE3C 3L75G 1IK7A 2HMMA 3GHGA 2QEXP 3H32B 1O7WA 5KJ7D 2OYIC 2QJPC 4HH2A 4PD4D 2FBWC 5H2FE 1L4AD 1OW8A 3H1IG 2E5YA 3EN1A 2OYIA 5CCGC 1BGYE 3WUVA 3ZDMA 3CD6P 2KNCA 1S5LX 1VQNP 1BCCG 2Q7CA 4HKZH 3BATA 3RBXA 1IJDB 2AEFA 3N0QA 4QDFB 2AXCA 1VF5C 2OQQA 5CCGA 4WBAA 1ZRTD 4I6MC 4NBBD 3MTUE 4AYCA 2H89C 4DJGA 1HJBA 1H89A 2PAJA 3L72J 3VMZA 3H1JE 1JOCA 1BGYG 2OYHC 5TISH 3N4XA 1NOHA 2PGDA 3B71A 2BMRA 2QJYB 3IFMA 3VMGD 3KZIH 4JQ0D 2HLOA 1LT9C 3HTKB 3GB4A 3W68A 1Y47A 3USSA 2OYHA 3EQQA 2QJKC 4H0LD 5AEWA 4NBAD 2GUSA 4UB8H 4PD4H 1S2EA 3RK3D 3EWKA 1LT9A 5AEUA 3GTEA 3WU2H 2M5AA 2KIKA 1BCCD 1W5CE 4GOEA 3JSVC 1KB9I 1ZOYC 1MUUA 5DJTB 3RK2D 1JMBA 1KQFB 2WQYC 3H1KJ 3Q3DA 3TGUJ 2M0BA 1ZP0C 1M8OB 5AW7B 1SFCC 2KXPB 5AVXB 5DJUB 5CJ0A 3G3ZA 2NPSC 3F89A 5BVZA 2K88A 2OGUA 3QWOC 2ZYAA 1SFCA 5CBOA 4WY4D 3TYYA 4C7RA 2N9YB 1JCCA 2NPSA 1LTSC 3T97A 1IFDA 1R8EA 2E5TA 3L71J 3H1JD 5E79H 1IC2A 1UIXA 4BXLA 1LJ2A 2FXPA 2HODB 2V7QJ 1LGHB 1SQPJ 4D6TJ 3VP9A 1FC2C 5AVRB 2P1JA 2GM4A 5GTHE 3JC22 1K73Q 4D6TD 2J59M 3CX5I 3KHUA 2OYOA 2D2CD 3L74E 2XKMA 1MZ9A 1W2BO 2Q3EA 5EFWB 3AE5C 2QG4A 1T3UA 2CKFA 1NTKJ 3E1RA 3Q5SA 2IYOA 1EXJA 1OVUA 4WWIA 2KB7P 3E7KA 4NPEA 4ASVA 1NTKD 2NZ2A 2ZVOB 1LP1A 5APYA 4Y99C 1X79B 1OVRA 2JKVA 2E4QA 1EDLA 1G1JA 3L74G 1NJIQ 4HM2A 1P84I 4I7ZB 1L0LJ 1N7SC 2HMOA 5KAFH 1VQLP 2IBZI 1BSNA 3H1LE 3M9HA 4C7NB 1SQBJ 5AVZB 1U7MA 2I1JA 2W6AA 1VCKA 1K9MQ 3TDKA 4JPZB 1LWUB 1N7SA 2V7QH 5AW0B 5APTA 2JWAA 2N1TB 1KILC 4NB8D 1U7JA 3A0HH 3VOPA 1N73B 4C46A 1RY3A 2ZT9C 1VQ4P 2JO6A 1KYOI 1WT6A 5APSA 1NTZK 1URQD 1HTLC 3FXDA 3TK1A 1MFTA 3H1LG 1H88A 1KILA 4N78E 4QURA 2R44A 2DE5D 1G1IA 2KSEA 1N2DC 2BCCE 4GODA 2JJLA 2PFXA 4HM8A 2Y0CA 4XA4A 3H32A 1FOSF 5CXMA 1S3JA 4DCKA 2GUVA 5AVQB 1FZBA 1NTZE 1OW7A 4OWFA 4H13D 1JNMA 1UUVA 1BE3E 2ZAEB 3N7NA 2M3EA 1SS1A 2K9YA 4QDDA 1KB9E 4BWNA 3A2AA 2W90A 1PGOA 3SFDC 2V4HA 2BCCG 4HB1A 1PPJE 1UUWA 1VQKP 3KQGA 2HG5D 3TSIA 1H0TB 2J5UA 1RE3C 1S1CX 4QDCA 4QDFA 1L4AB 2N9BA 2YO2A 1NGMB 3U1AA 3HUSB 1VQ6P 4A7PA 1NTZG 1Q82Q 3AE9C 2QJYC 1VQ7P 3BRVB 2HMNA 1GK6A 1RE3A 4HKVA 4HYTB 3VTPC 2JEEA 2A45I 1YTZT 5KAIE 5GTHH 1RQUA 1NDOA 2XSHA 1OIPA 1PPJG 3CXHH 1DEEG 1EQ7A 1GDTA 3PLNA 3D6ZA 2FY8A 4U3FE 3HTKA 1T8ZA 3VMYA 1Q2NA 1SQVJ 3LIDA 2KSJA 1R5LA 2IZ0A 1RFSA 1VPCA 1NYKA 3GMAA 4U7JA 3HD7D 1O7HA 2R5DA 1U57A 1SJGA 1M90Q 2YKPA 1A02J 1BSHA 3KDPB 1J1EB 2H88C 1GW3A 1NTMK 2NVEA 1NU1J 2BMOA 4H0LB 4U3FG 3B4SA 1VQPP 1NTZD 1YIJP 3RK3B 1LTAC 2B24A 3CX5E 4AUWA 1BE3D 5AVUB 1GK4A 3EQ2A 5CCGD 2QM7A 2IZ1A 2YKQA 1KB9D 2QA4P 1KFMA 3L4FA 4K35A 3RK2B 3GZXA 3D89A 1VF5D 1NH4A 1S5LH 2E43A 1A02F 1HGVA 1NTME 3U59A 1T3JA 1GL2D 2P7JA 1DEBA 2NUKA 2Q5UA 3L70E 1JM0A 4HM4A 1KN7A 2E76B 2FYNB 1RF0C 1XTGB 1NAFA 1KV4A 2A06G 1WQLA 3QH9A 1OZHA 1P84E 2LR2A 3CCJP 2O01N 3JCUH 1FQTA 2IBZE 3CCRP 1L0NK 1USDA 1RF0A 2HODA 3MZWB 3A5TA 3H1IE 4WVZA 4WY4B 1FE6A 2WSFH 1IFJA 3G6EP 2POHA 1NTMG 2RMZA 3SWKA 3NMDA 3P7KA 3GZYA 2RH0A 1QVFO 3L70G 1EZVG 1YTZI 3LIEA 3H1HE 3CWBE 2ZJSE 1JM1A 2YIUC 1RF1B 1KYOE 4LC1A 1PL5A 1S9KE 1KB9H 3HE4B 3BASA 1L0NE 2IBZG 2W6BA 1O7GA 1PV3A 1IK9A 2K9JB 2KZIA 2YKOA 2O3JA 3AE8C 1PIXA 2GBWA 1G2CB 1IO4A 2ITAA 1SFCD 4I7ZC 2D2CB 1YQ3C 1JO5A 2RN0A 3H1HG 3CWBG 1ZR4A 1M57D 3SSUA 2O01H 1GW4A 3II6A 5K5GB 1LWUC 2HMLA 3L75J 1L0NG 1KQSO 1NTMD 4IL6E 2QE7H 2N1TC 3L70D 5KLVK 4R4LA 3U1CA 2R5BA 1MFZA 3GG2A 2O1JA 1O7NA 1NVOA 3L75D 2ZFCA 1N73C 1LTJB 1LWUA 3GW6A 1KILE 2C0XA 1JY3O 3W67A 2WPVB 2N1TA 3B8EB 3CCMP 1AVOA 4RJTA 4NBCD 3H1KG 1N73A 2W83C 1EXIA 3VN0A 3H1ID 1BCCJ 1RIEA 5BOKA 2P67A 3MGNA 5KLVE 1DH3A 1CI6B 3Q5PA 4Z1MH 5AW3B 1SQXK 3RBZA 4KJMA 1CSBA 1JEKA 3L73E 1O7MA 3AEBC 3TNUB 3VCPA 1PP9E 3CI9A 3VMXA 1BGYJ 1QGKB 2IDBA 4ZKPA 4M3LA 2B9BA 4GDOA 2L91A 5KJ7C 1Y8AA 4H44D 3L37A 4HM6A 3D6YA 3CMEP 3S9OA 4OGQC 1BGYD 2MJZA 5KLVG 2A45G 2AXTE 2I1KA 1L4AC 2R3CA 1LTGC 5CHXA 1SQXE 1NO4A 3HUSC 5KJ7A 3KYQA 1T6AA 2CK3H 1JY2N 2SPZA 2E75C 1H0TA 3L73G 3C8VA 3IAOA 2LXBA 4H13B 1PP9G 2WSSH 1L4AA 3H1JJ 1QL2A 3HUSA 1HUCA 3KXDA 3LW5J 3GOBA 1VQ9P 2M8RA 1FDMA 1FJPA 1YQ4C 2QRXA 3AECC 1Q81Q 3GF3A 2K3RA 4OVNF 1SQXG 2FYUK 2NUMA 2YXQB 4JF7A 3G9RA 2HR3A 1XTCC 1J1DB 1JY2P 1YHQP 2L5GB 3AE2C 2Q9IA 3GLMA 4IFMA 3C9IA 2WMMA 4L75A 1HVVA 1OW6A 4IFDK 1ZMEC 2P58A 2WSCH 3I5CA 4LLHA 3PJSK 5AW6B 5H2FH 5KLVD 1HBWA 1J1EC 3P8CE 3Q5RA 4PD4I 4H0LC 1QX8A 5TJHA 3GTSA 5AW4B 3O6QB 3RK3C 4PV1D 3L73D 2FYUE 2IFMA 5AW9B 1K05A 3CLQA 1YBKA 1EZVI 1PGJA 2I8DA 1Z56A 1QLED 3HD7B 2E42A 1QEXA 3FOUA 2OYIB 1PGPA 1WRGA 2E76C 3RGUA 1FZFA 3FXEA 4NBFD 3LW5H 4NPFX 5BU8B 2FYUG 4TT3H 2FKWB 2G3AA 3A7OA 2QM8A 2WT7B 2KLUA 3C0DA 4NBDD 1RH5B 1GD2E 3P32A 1KC8Q 1KFNA 5B5EE 1OFCX 4NBHD 4GKGA 3CCVP 2YNYA 1R5SA 4RKUJ 3PTZA 3PP5A 4GOFA 1Q90C 5AVWB 1ZR2A 3AEDC 1FS0E 3EFFK 1GL2B 4RESB 3FGAD 3RL0D 2E74D 1LT1A 1VM9A 3L74J 1S72P 2AEJA 1YYCA 3M06A 2UWJE 1KQLA 3L74D 3I55P 2JP3A 1GMJA 4HJGH 1IFMA 2VRSA 3A0BE 2G8YA 1PZQA 1G8KB 2D2CC 4NB9D 4AAYB 3G71P 2IPPA 1MKMA 2K9JA 1W2EA 5AVTB 2LKMA 3GL2A 2WITA 3PHLA 1IFIA 1G2CA 5M1BA 2QSIA 1J2JB 3H1LJ 4JYCA 3CCQP 4GT1A 2CPBA 5BU5A 4DOJA 1HF9A 2WVRA 2M3BA 3H1LD 1SQVG 2JR8A 5AW5B 2YFIA 4P1CH 1YI2P 3OW2O 3IF4A 1LTBC 4N3YB 3GCEA 3VMHD 1AVYA 1VL2A 1SQQK 1OVVA 2HMKA 2NRGA 1SFCB 1SP4A 3AE4C 4HM1A 1BDDA 3VP8A 5APVA 1E79H 3B5ND 3BCCE 1X9VA 1GTWA 1FZEA 1VQ8P 2KOGA 4HM0A 1ZXGA 1N86A 2BCCJ 1PFIA 4N78D 2LXCB 1T2KC 1HJ0A 1Q86Q 1O7PA 1YITP 1SQQE 1SLQA 3IR9A 2WSFJ 1DIPA 1D7MA 4XE5B 2BCCD 2HMJA 1CI6A 3BCCG 2WPQA 5TISE 2GA1A 1H8AA 1NTZJ 1AJYA 1BE3J 3KZIE 3TNUA 1EC5A 3M0AA 1ULIA 4NPDA 3NXSA 2Y9YA 3HE5B 1IZNB 2A06E 1ZW0A 3IN6A 4UB8E 2BMQA 4PD4E 5KKZB 1SQQG 2JWDA 3WU2E 1PPJD 3V2QA 1LTIC 2XNXA 4EMJB 3FX0A 3GF7A 2KS1B 1BDCA 2Y0EA 5B5EH 2ZXXA 2KI7B 2YXRB 5AVSB 3OA7A 1YJ9P 2GBXA 2O01J 1EZVE 4H44B 1DD3A 1FU1A 1EDJA 2NWFA 5AW1B 1ZRTE 4L76A 2FFDB 1J1DC 1LTTC 4U3FJ 3V2PA 3F5HA 2FXOA 1OMIA 3E1IA 4U3FD 4AQRD 1M56D 3CXHI 3NTNA 3L72E 4ZMDA 2BEZF 5AW2B 2Q6QA 1DD4A 3ITKA 1GU4A 2ZXEB 1HGZA 4P1BH 2OARA 3RK3E 5E79E 2YFLA 3O6QA 5HL4A 5GTIE 1NYHA 4NBED 2KYVA 1VQ5P 3AE7C 3CCLP 4HJLA 3CC2P 3HD7C 2JZAA 1NAYA 2Z5IA 2E4PA 3L72G 3MD0A 3CX5D 3BRTB 2JDIH 3CPWO 3AEFC 4OGQD 2A06D 3S4RA 5C39A 4UB6E 4ZKUA 4MN4C 2BEQD 3CC7P 2NPSD 1FBMA 3HD7A 1MV8A 1IFPA 1NTMJ 4PV1B 3Q1MA 4PJ0E 1M1JB 3GKEA 3L70J 2OTKE 2KK7A 3H1KE 4R4MA 2E75D 5KAIH 4L74A 3RL0g 3TGUE 4C7NA 4HM3A 1EDKA 2P10A 1Y9BA 2Q3WA 1EZVD 4JYBA 2WT7A 2HPCB 3K5BA 1GL2C 4W80A 2B88A 1SQPK 3H1IJ 4B86A 4RO0A 3A3YB 3MUDC 1P84D 2NVGA 2IBZD 3OJAB 2H7HA 2XRXA 2JO1A 2Q3IA 5KAFE 1JUNA 1GL2A 3CC4P 5CCHC 3TGUG 1FZAA 1JMMA 3H1HJ 3CWBJ 3L72D 3MUDA 3V6IA 4WB4A 5AVVB 3L71E 3AE1C 1RQVA 2KZJA 3V5BA 1FDIA 3WUTA 4EIJA 2WSCJ 2ZYDA 3CX5H 3H1HD 3CWBD 1L0NJ 2YFJA 2K37A 5CCHA 1SQPE 1NTKK 4D6TE 1KYOD 1S9KD 1URQB 3A0HE 2QVAA 3RL0B 1FJKA 1L0ND 2E74B 3V4WA
chains in the Genus database with same CATH topology
4HM4A 2E4PA 3DQYA 2B1XA 1SQVE 5KKZC 4OGQD 3GB4A 4NB8D 3EQQA 4NBFD 1NDOA 2QJKC 4HM7A 2XSHA 4H0LD 5AEWA 5KLIC 4NBAD 3VCAA 1WQLA 1O7NA 4EMJB 2NVFA 2JO6A 2XSOA 3GOBA 4HM5A 1BCCE 1P84E 4P1CH 2YFIA 5AEUA 2XR8A 3GKEA 3GTEA 4U3FE 2HMMA 3H1KE 4NBGD 3VMHD 3GCEA 3C0DA 2E75D 1FQTA 2IBZE 4NBDD 2GBXA 2HMKA 1O7WA 3AZCA 1NTKE 1EZVE 2E76D 4QURA 2QJPC 3H1IE 4HM1A 3TGUE 4NBHD 4NBCD 2DE5D 2D2CD 3L74E 4HM3A 3BCCE 2NUMA 2FYNC 2BCCE 2NWFA 1RFSA 3GZYA 1G8JB 1NU1E 1Q90C 1ZRTE 2Q3WA 3VMID 4HM8A 1NYKA 1RIEA 5BOKA 3EN1A 5KLVE 5CXMA 1O7HA 2CKFA 1BGYE 3H1HE 1SJGA 3CWBE 2E74D 1JM1A 4HM0A 1VM9A 2YIUC 1NTZE 1L0LE 2NVGA 2NVEA 1KYOE 1UUVA 4H13D 2BMOA 3GL0A 1BE3E 2XRXA 4QUQA 1O7PA 3L73E 1L0NE 1SQQE 1SQBE 3L72E 1O7MA 3GTSA 2ZT9D 3N0QA 4QDFB 1O7GA 3VCPA 2B24A 2E4QA 1PP9E 4PV1D 3CX5E 4QDDA 1KB9E 2HMJA 2FYUE 2YVJB 4NBBD 3L71E 1UUWA 1PPJE 4QUPA 1EG9A 4HM2A 2GBWA 2DE6D 2HMOA 2ZYLA 3L75E 4H44D 4P1BH 1G8KB 4HM6A 4NB9D 4AAYB 3H1LE 2YFLA 3GZXA 4QDCA 2YFJA 2I7FA 4QDFA 3D89A 5HL4A 3H1JE 1SQPE 1ULJA 4D6TE 1VF5D 1VCKA 2QPZA 1SQXE 4NBED 1ULIA 2BMRA 1NTME 2DE7D 3GL2A 4HJLA 3FOUA 4QCKA 2QJYC 3VMGD 2JZAA 2NUKA 4AIVA 2HMNA 2A06E 3CXHE 3L70E 2BMQA 4PD4E 4HKVA 2HMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM4 A;  2E4P A;  3DQY A;  2B1X A;  1SQV E;  5KKZ C;  4OGQ D;  3GB4 A;  4NB8 D;  3EQQ A;  4NBF D;  1NDO A;  2QJK C;  4HM7 A;  2XSH A;  4H0L D;  5AEW A;  5KLI C;  4NBA D;  3VCA A;  1WQL A;  1O7N A;  4EMJ B;  2NVF A;  2JO6 A;  2XSO A;  3GOB A;  4HM5 A;  1BCC E;  1P84 E;  4P1C H;  2YFI A;  5AEU A;  2XR8 A;  3GKE A;  3GTE A;  4U3F E;  2HMM A;  3H1K E;  4NBG D;  3VMH D;  3GCE A;  3C0D A;  2E75 D;  1FQT A;  2IBZ E;  4NBD D;  2GBX A;  2HMK A;  1O7W A;  3AZC A;  1NTK E;  1EZV E;  2E76 D;  4QUR A;  2QJP C;  3H1I E;  4HM1 A;  3TGU E;  4NBH D;  4NBC D;  2DE5 D;  2D2C D;  3L74 E;  4HM3 A;  3BCC E;  2NUM A;  2FYN C;  2BCC E;  2NWF A;  1RFS A;  3GZY A;  1G8J B;  1NU1 E;  1Q90 C;  1ZRT E;  2Q3W A;  3VMI D;  4HM8 A;  1NYK A;  1RIE A;  5BOK A;  3EN1 A;  5KLV E;  5CXM A;  1O7H A;  2CKF A;  1BGY E;  3H1H E;  1SJG A;  3CWB E;  2E74 D;  1JM1 A;  4HM0 A;  1VM9 A;  2YIU C;  1NTZ E;  1L0L E;  2NVG A;  2NVE A;  1KYO E;  1UUV A;  4H13 D;  2BMO A;  3GL0 A;  1BE3 E;  2XRX A;  4QUQ A;  1O7P A;  3L73 E;  1L0N E;  1SQQ E;  1SQB E;  3L72 E;  1O7M A;  3GTS A;  2ZT9 D;  3N0Q A;  4QDF B;  1O7G A;  3VCP A;  2B24 A;  2E4Q A;  1PP9 E;  4PV1 D;  3CX5 E;  4QDD A;  1KB9 E;  2HMJ A;  2FYU E;  2YVJ B;  4NBB D;  3L71 E;  1UUW A;  1PPJ E;  4QUP A;  1EG9 A;  4HM2 A;  2GBW A;  2DE6 D;  2HMO A;  2ZYL A;  3L75 E;  4H44 D;  4P1B H;  1G8K B;  4HM6 A;  4NB9 D;  4AAY B;  3H1L E;  2YFL A;  3GZX A;  4QDC A;  2YFJ A;  2I7F A;  4QDF A;  3D89 A;  5HL4 A;  3H1J E;  1SQP E;  1ULJ A;  4D6T E;  1VF5 D;  1VCK A;  2QPZ A;  1SQX E;  4NBE D;  1ULI A;  2BMR A;  1NTM E;  2DE7 D;  3GL2 A;  4HJL A;  3FOU A;  4QCK A;  2QJY C;  3VMG D;  2JZA A;  2NUK A;  4AIV A;  2HMN A;  2A06 E;  3CXH E;  3L70 E;  2BMQ A;  4PD4 E;  4HKV A;  2HML A; 
#chains in the Genus database with same CATH topology
 3H1J G;  3P8M C;  5CMZ A;  4KHX A;  5APW A;  1FZC B;  5AVY B;  5KLI B;  2OTL P;  3L71 G;  3R4Y A;  2XSO A;  4HM5 A;  2Y0D A;  1L0L K;  1RE4 C;  3MHV A;  2H43 A;  1SQB K;  3VMA A;  3AZC A;  1NTK E;  1AV1 A;  1N7S D;  2E76 D;  1SQP G;  4D6T G;  3H1K D;  1P84 H;  3WMM 0;  4IOI H;  1JB0 J;  1RE4 A;  3M9B A;  3TGU D;  2B87 B;  4CPG A;  3AEG C;  4W7Y A;  3M9Q A;  3SWF A;  1KQG B;  4BRY B;  1OX3 A;  1KIL D;  1L0L E;  1M7L A;  1N7L A;  2WPR A;  3EFG A;  5APU A;  1Q90 D;  2XDJ A;  4OH8 B;  4DZO A;  1SQB E;  5APX A;  2ZT9 D;  5B66 E;  1FDO A;  1NTK G;  1TU3 F;  5KLV J;  2J58 A;  1KZU B;  1JTH B;  2AEM A;  1KYO H;  3HRN A;  1Q7Y Q;  1AQ5 A;  2O1K A;  5GTI H;  2DE6 D;  2KP8 A;  1S4X A;  2FYZ A;  3B5N B;  3L71 D;  1AA0 A;  1FOS E;  3L73 J;  4LGD E;  3CMA P;  1PP9 J;  2HFE D;  1OXZ A;  2YMK A;  3OAK A;  3R2P A;  2DE7 D;  1YJW P;  1L0L G;  3MIW A;  1RHZ B;  1SQP D;  3CXH E;  4L73 A;  1VDF A;  3GHG B;  1PP9 D;  4UB6 H;  1SQB G;  2KUB A;  5KKZ C;  2KLV A;  2RKL A;  2W8Z A;  4PJ0 H;  4I1L A;  3RK2 C;  4HM7 A;  1ZLL A;  2YMY A;  1SQX J;  2NVF A;  3I56 P;  3KPE A;  3AE6 C;  1CW5 A;  3HE5 A;  4IL6 H;  1E5W A;  2P2U A;  4YPC A;  2YIU B;  1SQX D;  2QJP B;  1KTM A;  1DX7 A;  4H44 C;  1IFN A;  2KNC B;  2FYN C;  4EDF A;  1G8J B;  2KS1 A;  2FFD C;  1FAV A;  1ZN5 A;  1NKN A;  2QIW A;  2XND H;  3AEE C;  3V2N A;  2Q1K A;  2XV5 A;  1YJN P;  3MP7 B;  2W27 A;  2K1A A;  4WY4 C;  2FFD A;  2A45 H;  1JY3 N;  1USE A;  1L0L D;  1VF5 B;  1SQV K;  4XFJ A;  1VQM P;  2WSE J;  1SQB D;  1X8Y A;  1S5L E;  1SVF A;  1ZV8 A;  4WY4 A;  4W7Z A;  3V4Q A;  3NFQ A;  2ZYL A;  3L35 A;  3O8Z A;  2C0W A;  1RF1 C;  4YTP C;  2Z5H A;  1UII A;  1T2K D;  3CCE P;  2OYH B;  3BVH A;  2ZVN B;  3UIA A;  2ZYG A;  1ULJ A;  2IYP A;  1GU5 A;  2QPZ A;  2WZ7 A;  3P8C D;  1GZL A;  2FYU J;  1NU1 K;  1LT9 B;  3H6P A;  2WWW A;  3S1K A;  4I2L C;  1JY3 P;  2M5A B;  4JBZ A;  4EYY Q;  3AEA C;  2AXT H;  1RF1 A;  1SQV E;  3Q2Y A;  3JCU E;  5CJ4 A;  2FYU D;  3HE4 A;  4N6J A;  3CXH D;  2QJK B;  3VYI A;  1NKZ B;  1OWA A;  2HYN A;  4IL6 X;  3VCA A;  4O9B A;  4GIF A;  1KD1 Q;  2Z4E A;  2WTY A;  4EOT A;  4PV1 C;  3ABV C;  3FWL A;  1M1J C;  1LNQ A;  2C9L Y;  1KMI Z;  1NHL A;  5AW8 B;  3VMI D;  1NU1 E;  3M0D C;  3V2R A;  1HWT C;  1M1J A;  1LTJ C;  5B66 H;  4OGQ B;  3M0D A;  3G4S P;  2XU6 A;  2NPS B;  1LTJ A;  2HPC A;  2WSE H;  1AFO A;  1X22 A;  3T97 B;  2IFN A;  5L8R J;  2E75 B;  2OTJ P;  1BE3 G;  1EG9 A;  1NU1 G;  1EDI A;  3SFE C;  5APQ A;  3CCS P;  1KOR A;  3TF5 A;  1VQO P;  3FWN A;  3H25 A;  2FXM A;  4KT0 J;  1URQ C;  2DW3 A;  3RL0 C;  1AQT A;  2E74 C;  2C9N Y;  4ASW A;  3C1L A;  1WMK A;  4K3A A;  2B1X A;  2PRR A;  1L2P A;  2YO3 A;  2H8P D;  1QVG O;  1NWQ A;  5CBN A;  1FZC C;  2PP6 A;  2R32 A;  5KLI C;  1SQV D;  1URQ A;  1JCD A;  2B89 A;  1K04 A;  2XR8 A;  3WUU A;  4NBG D;  1CZQ A;  3D70 A;  3SWY A;  3L36 A;  1PGQ A;  1FZC A;  1M1K Q;  1QL1 A;  4YXW H;  4H13 C;  4QMA A;  1LP1 B;  1NU1 D;  2WPS A;  4IFF A;  3D71 A;  2XZR A;  3M91 A;  3BCC J;  2N1T D;  1JY2 O;  2BAS A;  3GL0 A;  2B87 A;  1FZG A;  2Y9Z A;  4QUQ A;  1K8A Q;  4Y99 B;  1N8R Q;  4TLF A;  3BCC D;  2R3S A;  2YVJ B;  4BRY A;  4DT0 A;  2MKV A;  4YXD C;  2W6J H;  4QUP A;  1N7S B;  3L75 E;  2CPS A;  3B5N C;  3PRJ A;  1SQQ J;  2I7F A;  3PH0 A;  3A0B H;  1JTH A;  5CCH D;  1HH0 A;  3CCU P;  2IX7 C;  4Y28 J;  5KTB A;  4QCK A;  4AIV A;  1SQQ D;  3B5N A;  1KIL B;  3GHG C;  4EI2 A;  3DQY A;  3CL3 D;  2ZT9 B;  1X0T A;  4ZNC A;  1BCC E;  3AE3 C;  3L75 G;  1IK7 A;  2HMM A;  3GHG A;  2QEX P;  3H32 B;  1O7W A;  5KJ7 D;  2OYI C;  2QJP C;  4HH2 A;  4PD4 D;  2FBW C;  5H2F E;  1L4A D;  1OW8 A;  3H1I G;  2E5Y A;  3EN1 A;  2OYI A;  5CCG C;  1BGY E;  3WUV A;  3ZDM A;  3CD6 P;  2KNC A;  1S5L X;  1VQN P;  1BCC G;  2Q7C A;  4HKZ H;  3BAT A;  3RBX A;  1IJD B;  2AEF A;  3N0Q A;  4QDF B;  2AXC A;  1VF5 C;  2OQQ A;  5CCG A;  4WBA A;  1ZRT D;  4I6M C;  4NBB D;  3MTU E;  4AYC A;  2H89 C;  4DJG A;  1HJB A;  1H89 A;  2PAJ A;  3L72 J;  3VMZ A;  3H1J E;  1JOC A;  1BGY G;  2OYH C;  5TIS H;  3N4X A;  1NOH A;  2PGD A;  3B71 A;  2BMR A;  2QJY B;  3IFM A;  3VMG D;  3KZI H;  4JQ0 D;  2HLO A;  1LT9 C;  3HTK B;  3GB4 A;  3W68 A;  1Y47 A;  3USS A;  2OYH A;  3EQQ A;  2QJK C;  4H0L D;  5AEW A;  4NBA D;  2GUS A;  4UB8 H;  4PD4 H;  1S2E A;  3RK3 D;  3EWK A;  1LT9 A;  5AEU A;  3GTE A;  3WU2 H;  2M5A A;  2KIK A;  1BCC D;  1W5C E;  4GOE A;  3JSV C;  1KB9 I;  1ZOY C;  1MUU A;  5DJT B;  3RK2 D;  1JMB A;  1KQF B;  2WQY C;  3H1K J;  3Q3D A;  3TGU J;  2M0B A;  1ZP0 C;  1M8O B;  5AW7 B;  1SFC C;  2KXP B;  5AVX B;  5DJU B;  5CJ0 A;  3G3Z A;  2NPS C;  3F89 A;  5BVZ A;  2K88 A;  2OGU A;  3QWO C;  2ZYA A;  1SFC A;  5CBO A;  4WY4 D;  3TYY A;  4C7R A;  2N9Y B;  1JCC A;  2NPS A;  1LTS C;  3T97 A;  1IFD A;  1R8E A;  2E5T A;  3L71 J;  3H1J D;  5E79 H;  1IC2 A;  1UIX A;  4BXL A;  1LJ2 A;  2FXP A;  2HOD B;  2V7Q J;  1LGH B;  1SQP J;  4D6T J;  3VP9 A;  1FC2 C;  5AVR B;  2P1J A;  2GM4 A;  5GTH E;  3JC2 2;  1K73 Q;  4D6T D;  2J59 M;  3CX5 I;  3KHU A;  2OYO A;  2D2C D;  3L74 E;  2XKM A;  1MZ9 A;  1W2B O;  2Q3E A;  5EFW B;  3AE5 C;  2QG4 A;  1T3U A;  2CKF A;  1NTK J;  3E1R A;  3Q5S A;  2IYO A;  1EXJ A;  1OVU A;  4WWI A;  2KB7 P;  3E7K A;  4NPE A;  4ASV A;  1NTK D;  2NZ2 A;  2ZVO B;  1LP1 A;  5APY A;  4Y99 C;  1X79 B;  1OVR A;  2JKV A;  2E4Q A;  1EDL A;  1G1J A;  3L74 G;  1NJI Q;  4HM2 A;  1P84 I;  4I7Z B;  1L0L J;  1N7S C;  2HMO A;  5KAF H;  1VQL P;  2IBZ I;  1BSN A;  3H1L E;  3M9H A;  4C7N B;  1SQB J;  5AVZ B;  1U7M A;  2I1J A;  2W6A A;  1VCK A;  1K9M Q;  3TDK A;  4JPZ B;  1LWU B;  1N7S A;  2V7Q H;  5AW0 B;  5APT A;  2JWA A;  2N1T B;  1KIL C;  4NB8 D;  1U7J A;  3A0H H;  3VOP A;  1N73 B;  4C46 A;  1RY3 A;  2ZT9 C;  1VQ4 P;  2JO6 A;  1KYO I;  1WT6 A;  5APS A;  1NTZ K;  1URQ D;  1HTL C;  3FXD A;  3TK1 A;  1MFT A;  3H1L G;  1H88 A;  1KIL A;  4N78 E;  4QUR A;  2R44 A;  2DE5 D;  1G1I A;  2KSE A;  1N2D C;  2BCC E;  4GOD A;  2JJL A;  2PFX A;  4HM8 A;  2Y0C A;  4XA4 A;  3H32 A;  1FOS F;  5CXM A;  1S3J A;  4DCK A;  2GUV A;  5AVQ B;  1FZB A;  1NTZ E;  1OW7 A;  4OWF A;  4H13 D;  1JNM A;  1UUV A;  1BE3 E;  2ZAE B;  3N7N A;  2M3E A;  1SS1 A;  2K9Y A;  4QDD A;  1KB9 E;  4BWN A;  3A2A A;  2W90 A;  1PGO A;  3SFD C;  2V4H A;  2BCC G;  4HB1 A;  1PPJ E;  1UUW A;  1VQK P;  3KQG A;  2HG5 D;  3TSI A;  1H0T B;  2J5U A;  1RE3 C;  1S1C X;  4QDC A;  4QDF A;  1L4A B;  2N9B A;  2YO2 A;  1NGM B;  3U1A A;  3HUS B;  1VQ6 P;  4A7P A;  1NTZ G;  1Q82 Q;  3AE9 C;  2QJY C;  1VQ7 P;  3BRV B;  2HMN A;  1GK6 A;  1RE3 A;  4HKV A;  4HYT B;  3VTP C;  2JEE A;  2A45 I;  1YTZ T;  5KAI E;  5GTH H;  1RQU A;  1NDO A;  2XSH A;  1OIP A;  1PPJ G;  3CXH H;  1DEE G;  1EQ7 A;  1GDT A;  3PLN A;  3D6Z A;  2FY8 A;  4U3F E;  3HTK A;  1T8Z A;  3VMY A;  1Q2N A;  1SQV J;  3LID A;  2KSJ A;  1R5L A;  2IZ0 A;  1RFS A;  1VPC A;  1NYK A;  3GMA A;  4U7J A;  3HD7 D;  1O7H A;  2R5D A;  1U57 A;  1SJG A;  1M90 Q;  2YKP A;  1A02 J;  1BSH A;  3KDP B;  1J1E B;  2H88 C;  1GW3 A;  1NTM K;  2NVE A;  1NU1 J;  2BMO A;  4H0L B;  4U3F G;  3B4S A;  1VQP P;  1NTZ D;  1YIJ P;  3RK3 B;  1LTA C;  2B24 A;  3CX5 E;  4AUW A;  1BE3 D;  5AVU B;  1GK4 A;  3EQ2 A;  5CCG D;  2QM7 A;  2IZ1 A;  2YKQ A;  1KB9 D;  2QA4 P;  1KFM A;  3L4F A;  4K35 A;  3RK2 B;  3GZX A;  3D89 A;  1VF5 D;  1NH4 A;  1S5L H;  2E43 A;  1A02 F;  1HGV A;  1NTM E;  3U59 A;  1T3J A;  1GL2 D;  2P7J A;  1DEB A;  2NUK A;  2Q5U A;  3L70 E;  1JM0 A;  4HM4 A;  1KN7 A;  2E76 B;  2FYN B;  1RF0 C;  1XTG B;  1NAF A;  1KV4 A;  2A06 G;  1WQL A;  3QH9 A;  1OZH A;  1P84 E;  2LR2 A;  3CCJ P;  2O01 N;  3JCU H;  1FQT A;  2IBZ E;  3CCR P;  1L0N K;  1USD A;  1RF0 A;  2HOD A;  3MZW B;  3A5T A;  3H1I E;  4WVZ A;  4WY4 B;  1FE6 A;  2WSF H;  1IFJ A;  3G6E P;  2POH A;  1NTM G;  2RMZ A;  3SWK A;  3NMD A;  3P7K A;  3GZY A;  2RH0 A;  1QVF O;  3L70 G;  1EZV G;  1YTZ I;  3LIE A;  3H1H E;  3CWB E;  2ZJS E;  1JM1 A;  2YIU C;  1RF1 B;  1KYO E;  4LC1 A;  1PL5 A;  1S9K E;  1KB9 H;  3HE4 B;  3BAS A;  1L0N E;  2IBZ G;  2W6B A;  1O7G A;  1PV3 A;  1IK9 A;  2K9J B;  2KZI A;  2YKO A;  2O3J A;  3AE8 C;  1PIX A;  2GBW A;  1G2C B;  1IO4 A;  2ITA A;  1SFC D;  4I7Z C;  2D2C B;  1YQ3 C;  1JO5 A;  2RN0 A;  3H1H G;  3CWB G;  1ZR4 A;  1M57 D;  3SSU A;  2O01 H;  1GW4 A;  3II6 A;  5K5G B;  1LWU C;  2HML A;  3L75 J;  1L0N G;  1KQS O;  1NTM D;  4IL6 E;  2QE7 H;  2N1T C;  3L70 D;  5KLV K;  4R4L A;  3U1C A;  2R5B A;  1MFZ A;  3GG2 A;  2O1J A;  1O7N A;  1NVO A;  3L75 D;  2ZFC A;  1N73 C;  1LTJ B;  1LWU A;  3GW6 A;  1KIL E;  2C0X A;  1JY3 O;  3W67 A;  2WPV B;  2N1T A;  3B8E B;  3CCM P;  1AVO A;  4RJT A;  4NBC D;  3H1K G;  1N73 A;  2W83 C;  1EXI A;  3VN0 A;  3H1I D;  1BCC J;  1RIE A;  5BOK A;  2P67 A;  3MGN A;  5KLV E;  1DH3 A;  1CI6 B;  3Q5P A;  4Z1M H;  5AW3 B;  1SQX K;  3RBZ A;  4KJM A;  1CSB A;  1JEK A;  3L73 E;  1O7M A;  3AEB C;  3TNU B;  3VCP A;  1PP9 E;  3CI9 A;  3VMX A;  1BGY J;  1QGK B;  2IDB A;  4ZKP A;  4M3L A;  2B9B A;  4GDO A;  2L91 A;  5KJ7 C;  1Y8A A;  4H44 D;  3L37 A;  4HM6 A;  3D6Y A;  3CME P;  3S9O A;  4OGQ C;  1BGY D;  2MJZ A;  5KLV G;  2A45 G;  2AXT E;  2I1K A;  1L4A C;  2R3C A;  1LTG C;  5CHX A;  1SQX E;  1NO4 A;  3HUS C;  5KJ7 A;  3KYQ A;  1T6A A;  2CK3 H;  1JY2 N;  2SPZ A;  2E75 C;  1H0T A;  3L73 G;  3C8V A;  3IAO A;  2LXB A;  4H13 B;  1PP9 G;  2WSS H;  1L4A A;  3H1J J;  1QL2 A;  3HUS A;  1HUC A;  3KXD A;  3LW5 J;  3GOB A;  1VQ9 P;  2M8R A;  1FDM A;  1FJP A;  1YQ4 C;  2QRX A;  3AEC C;  1Q81 Q;  3GF3 A;  2K3R A;  4OVN F;  1SQX G;  2FYU K;  2NUM A;  2YXQ B;  4JF7 A;  3G9R A;  2HR3 A;  1XTC C;  1J1D B;  1JY2 P;  1YHQ P;  2L5G B;  3AE2 C;  2Q9I A;  3GLM A;  4IFM A;  3C9I A;  2WMM A;  4L75 A;  1HVV A;  1OW6 A;  4IFD K;  1ZME C;  2P58 A;  2WSC H;  3I5C A;  4LLH A;  3PJS K;  5AW6 B;  5H2F H;  5KLV D;  1HBW A;  1J1E C;  3P8C E;  3Q5R A;  4PD4 I;  4H0L C;  1QX8 A;  5TJH A;  3GTS A;  5AW4 B;  3O6Q B;  3RK3 C;  4PV1 D;  3L73 D;  2FYU E;  2IFM A;  5AW9 B;  1K05 A;  3CLQ A;  1YBK A;  1EZV I;  1PGJ A;  2I8D A;  1Z56 A;  1QLE D;  3HD7 B;  2E42 A;  1QEX A;  3FOU A;  2OYI B;  1PGP A;  1WRG A;  2E76 C;  3RGU A;  1FZF A;  3FXE A;  4NBF D;  3LW5 H;  4NPF X;  5BU8 B;  2FYU G;  4TT3 H;  2FKW B;  2G3A A;  3A7O A;  2QM8 A;  2WT7 B;  2KLU A;  3C0D A;  4NBD D;  1RH5 B;  1GD2 E;  3P32 A;  1KC8 Q;  1KFN A;  5B5E E;  1OFC X;  4NBH D;  4GKG A;  3CCV P;  2YNY A;  1R5S A;  4RKU J;  3PTZ A;  3PP5 A;  4GOF A;  1Q90 C;  5AVW B;  1ZR2 A;  3AED C;  1FS0 E;  3EFF K;  1GL2 B;  4RES B;  3FGA D;  3RL0 D;  2E74 D;  1LT1 A;  1VM9 A;  3L74 J;  1S72 P;  2AEJ A;  1YYC A;  3M06 A;  2UWJ E;  1KQL A;  3L74 D;  3I55 P;  2JP3 A;  1GMJ A;  4HJG H;  1IFM A;  2VRS A;  3A0B E;  2G8Y A;  1PZQ A;  1G8K B;  2D2C C;  4NB9 D;  4AAY B;  3G71 P;  2IPP A;  1MKM A;  2K9J A;  1W2E A;  5AVT B;  2LKM A;  3GL2 A;  2WIT A;  3PHL A;  1IFI A;  1G2C A;  5M1B A;  2QSI A;  1J2J B;  3H1L J;  4JYC A;  3CCQ P;  4GT1 A;  2CPB A;  5BU5 A;  4DOJ A;  1HF9 A;  2WVR A;  2M3B A;  3H1L D;  1SQV G;  2JR8 A;  5AW5 B;  2YFI A;  4P1C H;  1YI2 P;  3OW2 O;  3IF4 A;  1LTB C;  4N3Y B;  3GCE A;  3VMH D;  1AVY A;  1VL2 A;  1SQQ K;  1OVV A;  2HMK A;  2NRG A;  1SFC B;  1SP4 A;  3AE4 C;  4HM1 A;  1BDD A;  3VP8 A;  5APV A;  1E79 H;  3B5N D;  3BCC E;  1X9V A;  1GTW A;  1FZE A;  1VQ8 P;  2KOG A;  4HM0 A;  1ZXG A;  1N86 A;  2BCC J;  1PFI A;  4N78 D;  2LXC B;  1T2K C;  1HJ0 A;  1Q86 Q;  1O7P A;  1YIT P;  1SQQ E;  1SLQ A;  3IR9 A;  2WSF J;  1DIP A;  1D7M A;  4XE5 B;  2BCC D;  2HMJ A;  1CI6 A;  3BCC G;  2WPQ A;  5TIS E;  2GA1 A;  1H8A A;  1NTZ J;  1AJY A;  1BE3 J;  3KZI E;  3TNU A;  1EC5 A;  3M0A A;  1ULI A;  4NPD A;  3NXS A;  2Y9Y A;  3HE5 B;  1IZN B;  2A06 E;  1ZW0 A;  3IN6 A;  4UB8 E;  2BMQ A;  4PD4 E;  5KKZ B;  1SQQ G;  2JWD A;  3WU2 E;  1PPJ D;  3V2Q A;  1LTI C;  2XNX A;  4EMJ B;  3FX0 A;  3GF7 A;  2KS1 B;  1BDC A;  2Y0E A;  5B5E H;  2ZXX A;  2KI7 B;  2YXR B;  5AVS B;  3OA7 A;  1YJ9 P;  2GBX A;  2O01 J;  1EZV E;  4H44 B;  1DD3 A;  1FU1 A;  1EDJ A;  2NWF A;  5AW1 B;  1ZRT E;  4L76 A;  2FFD B;  1J1D C;  1LTT C;  4U3F J;  3V2P A;  3F5H A;  2FXO A;  1OMI A;  3E1I A;  4U3F D;  4AQR D;  1M56 D;  3CXH I;  3NTN A;  3L72 E;  4ZMD A;  2BEZ F;  5AW2 B;  2Q6Q A;  1DD4 A;  3ITK A;  1GU4 A;  2ZXE B;  1HGZ A;  4P1B H;  2OAR A;  3RK3 E;  5E79 E;  2YFL A;  3O6Q A;  5HL4 A;  5GTI E;  1NYH A;  4NBE D;  2KYV A;  1VQ5 P;  3AE7 C;  3CCL P;  4HJL A;  3CC2 P;  3HD7 C;  2JZA A;  1NAY A;  2Z5I A;  2E4P A;  3L72 G;  3MD0 A;  3CX5 D;  3BRT B;  2JDI H;  3CPW O;  3AEF C;  4OGQ D;  2A06 D;  3S4R A;  5C39 A;  4UB6 E;  4ZKU A;  4MN4 C;  2BEQ D;  3CC7 P;  2NPS D;  1FBM A;  3HD7 A;  1MV8 A;  1IFP A;  1NTM J;  4PV1 B;  3Q1M A;  4PJ0 E;  1M1J B;  3GKE A;  3L70 J;  2OTK E;  2KK7 A;  3H1K E;  4R4M A;  2E75 D;  5KAI H;  4L74 A;  3RL0 g;  3TGU E;  4C7N A;  4HM3 A;  1EDK A;  2P10 A;  1Y9B A;  2Q3W A;  1EZV D;  4JYB A;  2WT7 A;  2HPC B;  3K5B A;  1GL2 C;  4W80 A;  2B88 A;  1SQP K;  3H1I J;  4B86 A;  4RO0 A;  3A3Y B;  3MUD C;  1P84 D;  2NVG A;  2IBZ D;  3OJA B;  2H7H A;  2XRX A;  2JO1 A;  2Q3I A;  5KAF E;  1JUN A;  1GL2 A;  3CC4 P;  5CCH C;  3TGU G;  1FZA A;  1JMM A;  3H1H J;  3CWB J;  3L72 D;  3MUD A;  3V6I A;  4WB4 A;  5AVV B;  3L71 E;  3AE1 C;  1RQV A;  2KZJ A;  3V5B A;  1FDI A;  3WUT A;  4EIJ A;  2WSC J;  2ZYD A;  3CX5 H;  3H1H D;  3CWB D;  1L0N J;  2YFJ A;  2K37 A;  5CCH A;  1SQP E;  1NTK K;  4D6T E;  1KYO D;  1S9K D;  1URQ B;  3A0H E;  2QVA A;  3RL0 B;  1FJK A;  1L0N D;  2E74 B;  3V4W A; 
#chains in the Genus database with same CATH homology
 4HM4 A;  2E4P A;  3DQY A;  2B1X A;  1SQV E;  5KKZ C;  4OGQ D;  3GB4 A;  4NB8 D;  3EQQ A;  4NBF D;  1NDO A;  2QJK C;  4HM7 A;  2XSH A;  4H0L D;  5AEW A;  5KLI C;  4NBA D;  3VCA A;  1WQL A;  1O7N A;  4EMJ B;  2NVF A;  2JO6 A;  2XSO A;  3GOB A;  4HM5 A;  1BCC E;  1P84 E;  4P1C H;  2YFI A;  5AEU A;  2XR8 A;  3GKE A;  3GTE A;  4U3F E;  2HMM A;  3H1K E;  4NBG D;  3VMH D;  3GCE A;  3C0D A;  2E75 D;  1FQT A;  2IBZ E;  4NBD D;  2GBX A;  2HMK A;  1O7W A;  3AZC A;  1NTK E;  1EZV E;  2E76 D;  4QUR A;  2QJP C;  3H1I E;  4HM1 A;  3TGU E;  4NBH D;  4NBC D;  2DE5 D;  2D2C D;  3L74 E;  4HM3 A;  3BCC E;  2NUM A;  2FYN C;  2BCC E;  2NWF A;  1RFS A;  3GZY A;  1G8J B;  1NU1 E;  1Q90 C;  1ZRT E;  2Q3W A;  3VMI D;  4HM8 A;  1NYK A;  1RIE A;  5BOK A;  3EN1 A;  5KLV E;  5CXM A;  1O7H A;  2CKF A;  1BGY E;  3H1H E;  1SJG A;  3CWB E;  2E74 D;  1JM1 A;  4HM0 A;  1VM9 A;  2YIU C;  1NTZ E;  1L0L E;  2NVG A;  2NVE A;  1KYO E;  1UUV A;  4H13 D;  2BMO A;  3GL0 A;  1BE3 E;  2XRX A;  4QUQ A;  1O7P A;  3L73 E;  1L0N E;  1SQQ E;  1SQB E;  3L72 E;  1O7M A;  3GTS A;  2ZT9 D;  3N0Q A;  4QDF B;  1O7G A;  3VCP A;  2B24 A;  2E4Q A;  1PP9 E;  4PV1 D;  3CX5 E;  4QDD A;  1KB9 E;  2HMJ A;  2FYU E;  2YVJ B;  4NBB D;  3L71 E;  1UUW A;  1PPJ E;  4QUP A;  1EG9 A;  4HM2 A;  2GBW A;  2DE6 D;  2HMO A;  2ZYL A;  3L75 E;  4H44 D;  4P1B H;  1G8K B;  4HM6 A;  4NB9 D;  4AAY B;  3H1L E;  2YFL A;  3GZX A;  4QDC A;  2YFJ A;  2I7F A;  4QDF A;  3D89 A;  5HL4 A;  3H1J E;  1SQP E;  1ULJ A;  4D6T E;  1VF5 D;  1VCK A;  2QPZ A;  1SQX E;  4NBE D;  1ULI A;  2BMR A;  1NTM E;  2DE7 D;  3GL2 A;  4HJL A;  3FOU A;  4QCK A;  2QJY C;  3VMG D;  2JZA A;  2NUK A;  4AIV A;  2HMN A;  2A06 E;  3CXH E;  3L70 E;  2BMQ A;  4PD4 E;  4HKV A;  2HML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...