3H1HE

Cytochrome bc1 complex from chicken
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE PROTEIN I, MIT
publication title Electron Transfer by Domain Movement in Cytochrome Bc1
pubmed rcsb
molecule tags Oxidoreductase
total genus 40
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1hE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1hE02
1JM1A 1SQBE 1ZRTE 4NBBD 4NBHD 1O7GA 4NBDD 1NYKA 2GBXA 3H1KE 2E4PA 4HM3A 3H1LE 2HMKA 4QURA 1G8JB 4HM7A 1VCKA 3H1JE 4NBFD 4AAYB 4QUQA 2DE7D 3L75E 1SQVE 2BMOA 2YIUC 3EQQA 4HM0A 4QDCA 1L0LE 2FYNC 3GTEA 1VF5D 4NBCD 2QPZA 3L72E 2ZYLA 3CWBE 2HMOA 1KB9E 2NVEA 3GL2A 1RIEA 2FYUE 4HM6A 2B24A 4NBGD 1O7WA 4NBED 1O7MA 4AIVA 2E76D 3VMHD 5AEWA 3H1IE 4EMJB 3L71E 1P84E 2QJYC 2B1XA 2D2CD 1NTKE 5KKZC 3AZCA 4H13D 4PD4E 1O7NA 2NVGA 2YVJB 3VMGD 4H44D 2HMNA 3GB4A 2NUKA 3DQYA 4HJLA 2XRXA 3FOUA 2BCCE 4OGQD 2NWFA 4QDFA 3EN1A 3GOBA 1BGYE 2ZT9D 1BCCE 2JO6A 1NTME 1PPJE 4QDDA 2E75D 2NVFA 2NUMA 3C0DA 2QJPC 1NU1E 3TGUE 2CKFA 1SQPE 2HMJA 2GBWA 4HM5A 1BE3E 4QCKA 4NB8D 2HMMA 2JZAA 5KLIC 2XSHA 2BMRA 1NTZE 1PP9E 2HMLA 3VCAA 1NDOA 4HKVA 1EZVE 3CX5E 4PV1D 1SQQE 3L74E 1O7PA 1EG9A 2Q3WA 2XSOA 5CXMA 3GTSA 3L73E 5BOKA 2I7FA 5HL4A 2DE5D 2DE6D 3L70E 4NB9D 4HM2A 4H0LD 4P1BH 2BMQA 4QUPA 1ULIA 2E74D 1FQTA 2YFJA 1ULJA 4QDFB 3VMID 3D89A 2IBZE 1G8KB 3N0QA 4U3FE 4P1CH 2E4QA 2YFIA 3GCEA 4NBAD 3GL0A 2A06E 4D6TE 1SQXE 2QJKC 3GZXA 3CXHE 1Q90C 4HM1A 3GZYA 3H1HE 1VM9A 5KLVE 2XR8A 1UUVA 5AEUA 1L0NE 2YFLA 4HM4A 1O7HA 1KYOE 3BCCE 3GKEA 1WQLA 1UUWA 4HM8A 1SJGA 3VCPA 1RFSA
chains in the Genus database with same CATH superfamily
3H1HD 1O7GA 4WVZA 1NYKA 1LT9B 5AW5B 4O9BA 1YIJP 3JC22 1HBWA 3WU2E 5AVRB 1J2JB 4MN4C 4N78E 1AQ5A 3P7KA 3H1JD 2L5GB 3AE2C 1KB9I 1N7SB 2YO3A 3L72D 2R44A 2Y0EA 2FYUD 3GHGC 2ZVOB 1VQNP 2YO2A 3AE4C 3FOUA 1BGYE 4HJGH 4C46A 1JCDA 4D6TG 1JOCA 1BE3E 3D6ZA 2JZAA 2KNCA 1MV8A 3HTKB 1NTMD 3GHGA 2V7QH 3GTSA 3HD7C 2LKMA 2I7FA 1LWUB 4NB9D 2OQQA 4HM2A 3CX5D 1A02J 4JF7A 1NJIQ 1G8KB 2YFIA 4U3FJ 1USDA 3KHUA 1S5LH 2H43A 2Y0CA 3CMAP 1BCCG 2QE7H 3PP5A 3CC7P 4W80A 2KS1B 1NKNA 4H0LC 5AW3B 2A06D 3VTPC 2ZYAA 1HWTC 3OAKA 3HRNA 1SJGA 2WSFH 4JQ0D 1K73Q 1JO5A 3AECC 2GBXA 2K3RA 1NAFA 3BCCD 3V2RA 5CMZA 3O6QA 3L75E 2YIUC 1KD1Q 1NU1G 1CZQA 2C0WA 3PTZA 3H1LD 2QEXP 4WWIA 2W6JH 1SQVD 1SVFA 3L71E 3CCQP 4K35A 1N8RQ 4H44D 1KB9D 3SWFA 4I7ZB 1YHQP 5AVSB 1KQFB 1IO4A 2W27A 4ZNCA 1SQPE 1FE6A 3C9IA 5KLIC 1OW6A 4XA4A 1YBKA 3G6EP 1SQBK 3L70J 1ULIA 2ZYDA 3N4XA 2N1TC 1QVGO 1L0LG 3GZYA 1U7MA 2KNCB 1FZCC 2WITA 3AE8C 3SFEC 3EFFK 3GHGB 4N6JA 1L0NJ 2QSIA 5KAFH 3VCPA 2V4HA 3AE5C 2O3JA 2Y0DA 1CSBA 1S72P 3B5ND 3AE1C 4YXDC 2I1JA 2RH0A 3TGUG 1VF5D 2HFED 1PGQA 5GTHE 2E74B 2WPRA 1SQQK 2QJYC 1NTKJ 4H13D 4OGQD 5AW8B 3KZIH 2NWFA 4GOFA 3L35A 3D71A 2ZT9D 2KUBA 5TJHA 1KMIZ 3O6QB 2NVFA 4R4MA 3RK3E 2JWDA 1KILD 2Q7CA 3AE6C 4QCKA 3L75D 1FDMA 1AQTA 1NTZE 3S4RA 1NAYA 3IN6A 3L74J 4GIFA 4EDFA 1YTZT 2HR3A 3EFGA 1HVVA 2Y9ZA 1NOHA 2IFNA 3D89A 1UIIA 2XKMA 1EXJA 4P1CH 2OGUA 2FXPA 4GKGA 2N9BA 3EWKA 1PZQA 2WSEJ 4D6TD 4AYCA 2M3BA 5KLVJ 3N7NA 1FAVA 3VMXA 1RFSA 1JM1A 1JY2N 1U57A 3E1IA 4PV1B 5KLIB 2DE7D 5AVQB 1ZRTD 3SSUA 1Q86Q 1YYCA 2B87A 5B5EE 1JY2P 1ZV8A 3U59A 1PP9G 1MUUA 2NZ2A 1K9MQ 2FY8A 3AEGC 5APSA 3L73G 2NPSD 4L76A 2XRXA 1H0TA 1URQD 2XDJA 1A02F 1X8YA 1EDLA 5APYA 4Y99C 5APVA 3V4WA 4RKUJ 3A0HH 2BMRA 1RF1C 5CJ4A 1NU1D 3TNUA 1S4XA 1GW3A 1NO4A 1SQBG 2IPPA 3LW5J 3NMDA 4PJ0E 3H1KG 1Q81Q 2N9YB 3VMYA 2C9NY 2XNXA 1GU5A 1GK6A 2QJYB 5AW9B 4WY4A 1YJWP 1VQ4P 3H1HE 3CWBG 3RL0D 2JO1A 4LGDE 1N7SC 3VOPA 4NBHD 1ZN5A 1YQ3C 4HM3A 4QURA 1LTAC 3H1JE 1KV4A 3V2PA 1HUCA 2H88C 3TK1A 2E76C 3L72E 3RGUA 5KJ7C 2FYUE 4OVNF 4CPGA 3O8ZA 1QVFO 1SQQG 1HH0A 2C0XA 1L0LD 2WTYA 3H1IJ 2OYOA 1O7NA 1D7MA 1LWUC 3RK2D 1RY3A 3EN1A 1JNMA 1NTME 4UB6H 2NUMA 1G2CA 2B87B 5AW0B 4GOEA 3CX5E 1ZOYC 4M3LA 1X22A 1JY3O 3TGUD 1EG9A 4EIJA 1L0NK 4PD4H 4P1BH 2KZIA 5APWA 1H0TB 3CCSP 2OTKE 3VMID 3ITKA 2C9LY 2IX7C 3GCEA 2A06E 3II6A 2K1AA 1SQXJ 3GF3A 1JY3P 2YKQA 3H1LJ 2YMKA 3MUDC 1KTMA 1Q90C 1T6AA 4UB6E 4W7YA 2QIWA 4EYYQ 3BCCE 1RHZB 2JJLA 3GKEA 3TNUB 2WZ7A 1NTZK 1RE4A 1PGPA 2HYNA 4Y99B 2A45I 2E4PA 3VMAA 3H1LE 3Q5PA 4L73A 1FZGA 1S3JA 3A0BE 1SQVE 4QDCA 2FYNC 1AVYA 1KB9E 4WY4B 1DX7A 1RIEA 4NBED 3FX0A 3P8CD 1OW8A 4BXLA 3VMGD 3MTUE 1QL1A 1FZBA 4QDFA 3HE5A 4PD4I 2HG5D 1BGYJ 3V6IA 3HD7D 2IBZG 4U3FG 2AXTH 1HJ0A 2PAJA 2BCCD 1BE3J 2XSHA 1J1DC 5KLVK 1FC2C 1YI2P 1SFCD 1GL2D 1SS1A 3MGNA 2Z5HA 1PP9D 3E1RA 1IZNB 4H0LD 1LJ2A 1GU4A 2YKOA 1NVOA 5KTBA 2E76B 2W6AA 1G2CB 2OYIA 3F89A 1QX8A 4RESB 1AJYA 4HM1A 1LGHB 2R5DA 2AXTE 2QA4P 2E74C 2KSEA 1X79B 2QG4A 2KSJA 1M1JC 1VQ8P 2RKLA 5C39A 2Q6QA 4NBDD 3P32A 1G8JB 3SFDC 4HM7A 4ASWA 3RK3B 3L75J 3H1KD 4NBCD 4YXWH 2QPZA 2FFDA 2LR2A 1M1JA 3VYIA 1MFZA 4AIVA 3I56P 3VMHD 4R4LA 1ZP0C 2IYPA 3G9RA 3L71J 4I6MC 3CWBD 2NUKA 3A7OA 3L70G 1KILE 1NWQA 3CMEP 1FDIA 1KFMA 2Y9YA 4QDDA 4PD4D 2BEQD 5DJTB 2HMJA 1R8EA 4QMAA 1S5LE 1SQPJ 2SPZA 3CLQA 1GL2A 4HKVA 2N1TD 1NKZB 1JMMA 4IFFA 3WMM0 1L0NG 1OW7A 1GTWA 2L91A 5BOKA 3M0AA 3CCMP 4KHXA 3WUTA 5CBOA 3BRVB 4HH2A 1OXZA 2HODA 3VP9A 4QDFB 3HE5B 3CCEP 2FYNB 1BSHA 3KDPB 4D6TE 5APQA 4PV1C 3MD0A 2H7HA 2IBZI 3SWYA 2O01J 1J1EB 2M5AA 5AVZB 2WPSA 2YFLA 1JUNA 1LTIC 1NTKG 1ZRTE 1E5WA 3AE9C 2G3AA 3W68A 1HJBA 2KLVA 1OZHA 2P10A 2KYVA 2E42A 2BMOA 2OYIB 3CCRP 1J1DB 2ZXEB 2GM4A 1VL2A 3OJAB 3AE7C 2NVEA 2CK3H 2ZAEB 5CHXA 2HLOA 3L74G 4H44C 2D2CD 4EI2A 5EFWB 1K05A 2AXCA 2NVGA 3DQYA 2K9YA 1VQ9P 3GOBA 1XTCC 4L74A 3M9BA 1NU1E 1SQXK 4KJMA 1KC8Q 1M1JB 2P1JA 4ZKUA 4K3AA 1NTZJ 5KLVG 1EC5A 1PFIA 2XSOA 1NGMB 3CCVP 2ZYGA 5KAFE 3C1LA 2YFJA 3KQGA 1M1KQ 3IR9A 4ASVA 2PP6A 1OMIA 2OYHC 3C8VA 2BEZF 5H2FH 2FBWC 5TISH 1T2KD 1H89A 2IBZD 4U3FD 1VQPP 1AA0A 1GMJA 1IJDB 2I1KA 1K8AQ 1N73C 3F5HA 2MKVA 1VQ6P 2VRSA 3B5NC 1K04A 1U7JA 1KQGB 2OYHA 1FOSF 2HODB 5GTIH 1MFTA 1ZLLA 3KZIE 3FWLA 3HE4A 1L4AD 4NBFD 1VF5C 1PPJG 3PHLA 2O1JA 1L0LE 4RO0A 1GZLA 3HUSA 3RBZA 1N73A 2IDBA 1KORA 1KYOH 2B24A 1FBMA 1JY2O 1O7MA 3B5NA 4H13C 3AE3C 2CPSA 3OW2O 5CCGD 2PRRA 1LP1A 2R3CA 5TISE 4OGQC 2YVJB 2P67A 4HJLA 3AEAC 4OH8B 2JO6A 1TU3F 1RQUA 1KILC 2E75D 2QJPC 3TGUE 1QLED 1T8ZA 1BDDA 3Q3DA 5AW2B 4I1LA 1IC2A 1OIPA 3BATA 1BCCD 1N2DC 3TSIA 1QGKB 4HKZH 5KAIH 4IL6H 1KILA 4DJGA 3G4SP 2KB7P 1HTLC 1NHLA 2WSCJ 2E4QA 4KT0J 5CBNA 1N7SD 3L70D 2P2UA 4H44B 4ZMDA 2IZ1A 3M9HA 1VM9A 1UUVA 2YXQB 4WY4C 2RN0A 3H1HJ 3MHVA 3H1IG 2LXCB 1Z56A 2Q5UA 5KJ7D 5AVXB 1L0ND 2OARA 1QEXA 1FDOA 4BRYA 4AAYB 1RE3C 3H1JJ 3PRJA 1JB0J 3P8CE 2BCCJ 3EQQA 1SLQA 1SQPK 3H25A 2HMOA 4WBAA 3PLNA 3GL2A 4NBGD 3L72J 3CI9A 3A0HE 2FYUJ 2O01N 1EZVG 3RBXA 3AZCA 1RE3A 1OVVA 2BCCE 2OYHB 2E5TA 1DD4A 1NTKD 2AEJA 3HE4B 1NTMJ 4AUWA 1SQXG 2CKFA 4HM5A 2KZJA 2XNDH 3H1LG 3GF7A 3CD6P 2NPSA 3HUSB 3VCAA 1PP9E 2ZVNB 2KXPB 1N73B 5CCHD 1G1IA 1URQA 3B5NB 3W67A 3KXDA 3CCJP 4TLFA 1YQ4C 3L73E 4NPEA 4QUPA 1VF5B 3L74D 2QM7A 1ULJA 2H89C 1VQ5P 3U1CA 2B9BA 1N86A 4GDOA 1KQLA 3RK3C 2ZXXA 1EXIA 1VQKP 4H13B 2WQYC 1ZW0A 3RL0C 1GW4A 2OTLP 5AVYB 4OGQB 2PGDA 2XR8A 5AEUA 2W6BA 2ZT9B 3R4YA 1IK7A 1UUWA 3BCCJ 2J5UA 2XV5A 1JCCA 1NYHA 1SQBE 3G3ZA 1KILB 3QWOC 2M0BA 3I5CA 1JM0A 5KLVD 1RE4C 2QJPB 3H1KE 3TF5A 5BVZA 1KYOD 3MZWB 3WUUA 1BGYG 2R3SA 3CXHH 4HM0A 2M3EA 1SQVJ 3USSA 3M0DA 1BE3G 2ZYLA 3CWBE 5AVTB 4HM6A 3LIDA 2E43A 2POHA 3CCLP 1AVOA 2GUSA 1W2BO 4PD4E 3CC4P 1X0TA 4XFJA 3EQ2A 4ZKPA 3GMAA 1DIPA 1YJNP 3GW6A 1E79H 1P84D 3I55P 5L8RJ 4BRYB 3WU2H 1UIXA 1PV3A 4HYTB 1X9VA 2JP3A 3M06A 1J1EC 2HMLA 4N3YB 1PPJD 1OVRA 1SQQE 1O7PA 1EDIA 2ZFCA 5KKZB 1EZVI 2R32A 3NFQA 2BMQA 1FJKA 2E74D 1Q2NA 1DEEG 2XZRA 4JBZA 4NBAD 5B66H 3GL0A 4Y28J 2P7JA 1FJPA 2JKVA 1Y47A 3L75G 2OYIC 2YXRB 2NPSB 2XU6A 3Q5SA 3CXHI 1URQB 1VQLP 3IF4A 3L71G 5AVVB 1S9KD 1M90Q 4IFDK 3L73D 1GK4A 1FOSE 2Q3IA 1SQPG 3WUVA 4DT0A 5B66E 2FFDC 1RH5B 1IFIA 1ZR4A 1HF9A 2MJZA 1W2EA 2OTJP 1WT6A 1M7LA 2WPQA 2M8RA 2YKPA 2V7QJ 1SQBD 3H1ID 1IFMA 2WVRA 4NPDA 3Q1MA 3RL0B 2GBWA 1H8AA 3CPWO 4EOTA 5AVUB 4YTPC 1SFCC 4PV1D 1R5LA 1GL2C 3R2PA 3FXDA 3HD7A 4W7ZA 1CI6A 5HL4A 2I8DA 4JYCA 1S5LX 3RL0g 2E5YA 1EZVD 2WSFJ 3ABVC 4RJTA 2IBZE 4U3FE 2KOGA 2QRXA 3LIEA 3M91A 2QJKC 3GZXA 1SFCA 4D6TJ 2AEFA 1T3JA 4I2LC 5BU8B 3RK2B 4WB4A 2CPBA 3S1KA 3S9OA 1S1CX 1SQXD 2JR8A 5K5GB 2Q1KA 2FYUK 1O7HA 3G71P 2O1KA 3JCUH 1SQQD 3CXHD 3QH9A 2KP8A 3MP7B 2Q9IA 2B89A 1PIXA 3U1AA 1YITP 2W8ZA 2AEMA 4IFMA 1XTGB 2O01H 4L75A 1NTMK 3CL3D 2YMYA 1BCCJ 5BU5A 1W5CE 1NTZG 4EMJB 3V2QA 4N78D 2HMNA 3GB4A 1LTGC 2K37A 3JCUE 1BCCE 3ZDMA 5GTHH 1NU1J 1WMKA 1BGYD 1IFJA 2BASA 4XE5B 3L4FA 2DW3A 1JEKA 4GODA 2WSSH 2B88A 5DJUB 4DOJA 5CXMA 3TYYA 1BE3D 3KYQA 3L36A 1RQVA 3L70E 1OVUA 4AQRD 3P8MC 1LTTC 1FQTA 2IZ0A 2N1TA 3N0QA 1BDCA 2R5BA 2Q3EA 2FFDB 1PL5A 1M8OB 1SQVK 2W83C 3V4QA 1FZCA 3L37A 3B4SA 1L0NE 2JEEA 4JPZB 3HD7B 2ITAA 1CW5A 3K5BA 1CI6B 4HM8A 5APXA 1LTBC 2GA1A 1LTJC 1JTHA 3AEEC 3FGAD 2FXMA 1DH3A 2IFMA 4C7NA 2Z5IA 3KPEA 1YJ9P 4QUQA 3PH0A 1SFCB 1GL2B 3GTEA 3A5TA 2UWJE 1L0LJ 5M1BA 4H0LB 3HUSC 2D2CC 1LTJA 1O7WA 1VDFA 4YPCA 4TT3H 1NTKE 4U7JA 3M9QA 3UIAA 2P58A 2QJKB 1N7LA 4HB1A 1EDKA 2WSEH 3L71D 3SWKA 2G8YA 3JSVC 2YIUB 3A3YB 5B5EH 2HPCA 1FU1A 1KFNA 2M5AB 3TGUJ 1AV1A 2KLUA 4NPFX 3V2NA 5H2FE 2YNYA 2H8PD 1NDOA 1MZ9A 1VQMP 3H1HG 3L74E 2K9JA 2ZT9C 1SQPD 2LXBA 2J59M 1USEA 1HGZA 2KK7A 4LC1A 1DD3A 5CJ0A 4WY4D 3VP8A 2WWWA 3H32A 5GTIE 3PJSK 2J58A 3H1JG 5AW6B 1T2KC 2BCCG 2WT7A 3B8EB 1P84H 3Q2YA 2RMZA 3T97A 2KI7B 3L72G 1PGOA 1IFNA 5KLVE 2FYUG 1KYOE 1M56D 4A7PA 1BSNA 2JWAA 1OX3A 4DZOA 3MIWA 2WSCH 3VN0A 4PJ0H 1L4AC 2PFXA 1FZFA 2HMKA 1ZMEC 1H88A 2N1TB 1LNQA 1NTMG 3A2AA 5E79H 1IK9A 1HGVA 4JYBA 4B86A 1FZCB 1LT1A 3LW5H 5CCGC 2E76D 1KYOI 4IL6X 1SP4A 1L4AA 1P84E 5KKZC 4DCKA 1JTHB 5KAIE 4IL6E 2E75C 2WPVB 4C7NB 3H6PA 3NTNA 2A45G 1NH4A 3V5BA 5APUA 1PPJE 3GLMA 5AW7B 1Y8AA 3C0DA 2A06G 5CCGA 1T3UA 1FZEA 1LT9C 3AEFC 2HMMA 1RF1A 5AVWB 2NPSC 2FXOA 3CC2P 1LTJB 5E79E 1PP9J 3RK3D 1P84I 5APTA 1URQC 3BCCG 2DE5D 3L73J 3Q5RA 1Q82Q 1VQOP 1NTZD 4UB8H 3NXSA 1FZAA 1LT9A 1PGJA 3BRTB 1IFDA 1GDTA 1QL2A 2QM8A 2NRGA 1OFCX 1KN7A 2D2CB 2HPCB 1SQVG 5AW1B 5AW4B 1EDJA 1YTZI 4GT1A 3CX5H 1S9KE 2Z4EA 2WMMA 1M57D 1VPCA 1Q90D 1LP1B 4HM4A 1WRGA 1OWAA 3OA7A 2K9JB 1N7SA 3CCUP 1GD2E 4NBBD 3IFMA 2A45H 1SQBJ 1L2PA 1JMBA 1RF0C 4IOIH 2K88A 3FXEA 3VMZA 3H1KJ 1VCKA 3FWNA 3H32B 1VQ7P 4UB8E 4Z1MH 1MKMA 1NU1K 2WT7B 5KJ7A 1ZXGA 3HTKA 3M0DC 3T97B 1KZUB 1G1JA 3CWBJ 3TDKA 2FKWB 2GUVA 2W90A 1DEBA 5AEWA 1EQ7A 1RF0A 3E7KA 3H1IE 1FS0E 2B1XA 1LWUA 3D6YA 1JY3N 1IFPA 3A0BH 2FYZA 1AFOA 2QVAA 3GG2A 3AEDC 2ZJSE 4C7RA 1KQSO 3BVHA 4NB8D 1KB9H 5CCHC 2KS1A 3RK2C 4OWFA 1ZR2A 1EZVE 3B71A 1SQQJ 2Q3WA 1L4AB 1Y9BA 3CX5I 2DE6D 1S2EA 1R5SA 2JDIH 3D70A 1NTKK 5CCHA 3AEBC 1SQXE 3IAOA 4I7ZC 3MUDA 1Q7YQ 3BASA 3CXHE 4LLHA 1L0LK 1LTSC 2KIKA 1RF1B 2IYOA 4BWNA 1WQLA 2E75B
chains in the Genus database with same CATH topology
1JM1A 1SQBE 1ZRTE 4NBBD 4NBHD 1O7GA 4NBDD 1NYKA 2GBXA 3H1KE 2E4PA 4HM3A 3H1LE 2HMKA 4QURA 1G8JB 4HM7A 1VCKA 3H1JE 4NBFD 4AAYB 4QUQA 2DE7D 3L75E 1SQVE 2BMOA 2YIUC 3EQQA 4HM0A 4QDCA 1L0LE 2FYNC 3GTEA 1VF5D 4NBCD 2QPZA 3L72E 2ZYLA 3CWBE 2HMOA 1KB9E 2NVEA 3GL2A 1RIEA 2FYUE 4HM6A 2B24A 4NBGD 1O7WA 4NBED 1O7MA 4AIVA 2E76D 3VMHD 5AEWA 3H1IE 4EMJB 3L71E 1P84E 2QJYC 2B1XA 2D2CD 1NTKE 5KKZC 3AZCA 4H13D 4PD4E 1O7NA 2NVGA 2YVJB 3VMGD 4H44D 2HMNA 3GB4A 2NUKA 3DQYA 4HJLA 2XRXA 3FOUA 2BCCE 4OGQD 2NWFA 4QDFA 3EN1A 3GOBA 1BGYE 2ZT9D 1BCCE 2JO6A 1NTME 1PPJE 4QDDA 2E75D 2NVFA 2NUMA 3C0DA 2QJPC 1NU1E 3TGUE 2CKFA 1SQPE 2HMJA 2GBWA 4HM5A 1BE3E 4QCKA 4NB8D 2HMMA 2JZAA 5KLIC 2XSHA 2BMRA 1NTZE 1PP9E 2HMLA 3VCAA 1NDOA 4HKVA 1EZVE 3CX5E 4PV1D 1SQQE 3L74E 1O7PA 1EG9A 2Q3WA 2XSOA 5CXMA 3GTSA 3L73E 5BOKA 2I7FA 5HL4A 2DE5D 2DE6D 3L70E 4NB9D 4HM2A 4H0LD 4P1BH 2BMQA 4QUPA 1ULIA 2E74D 1FQTA 2YFJA 1ULJA 4QDFB 3VMID 3D89A 2IBZE 1G8KB 3N0QA 4U3FE 4P1CH 2E4QA 2YFIA 3GCEA 4NBAD 3GL0A 2A06E 4D6TE 1SQXE 2QJKC 3GZXA 3CXHE 1Q90C 4HM1A 3GZYA 3H1HE 1VM9A 5KLVE 2XR8A 1UUVA 5AEUA 1L0NE 2YFLA 4HM4A 1O7HA 1KYOE 3BCCE 3GKEA 1WQLA 1UUWA 4HM8A 1SJGA 3VCPA 1RFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM1 A;  1SQB E;  1ZRT E;  4NBB D;  4NBH D;  1O7G A;  4NBD D;  1NYK A;  2GBX A;  3H1K E;  2E4P A;  4HM3 A;  3H1L E;  2HMK A;  4QUR A;  1G8J B;  4HM7 A;  1VCK A;  3H1J E;  4NBF D;  4AAY B;  4QUQ A;  2DE7 D;  3L75 E;  1SQV E;  2BMO A;  2YIU C;  3EQQ A;  4HM0 A;  4QDC A;  1L0L E;  2FYN C;  3GTE A;  1VF5 D;  4NBC D;  2QPZ A;  3L72 E;  2ZYL A;  3CWB E;  2HMO A;  1KB9 E;  2NVE A;  3GL2 A;  1RIE A;  2FYU E;  4HM6 A;  2B24 A;  4NBG D;  1O7W A;  4NBE D;  1O7M A;  4AIV A;  2E76 D;  3VMH D;  5AEW A;  3H1I E;  4EMJ B;  3L71 E;  1P84 E;  2QJY C;  2B1X A;  2D2C D;  1NTK E;  5KKZ C;  3AZC A;  4H13 D;  4PD4 E;  1O7N A;  2NVG A;  2YVJ B;  3VMG D;  4H44 D;  2HMN A;  3GB4 A;  2NUK A;  3DQY A;  4HJL A;  2XRX A;  3FOU A;  2BCC E;  4OGQ D;  2NWF A;  4QDF A;  3EN1 A;  3GOB A;  1BGY E;  2ZT9 D;  1BCC E;  2JO6 A;  1NTM E;  1PPJ E;  4QDD A;  2E75 D;  2NVF A;  2NUM A;  3C0D A;  2QJP C;  1NU1 E;  3TGU E;  2CKF A;  1SQP E;  2HMJ A;  2GBW A;  4HM5 A;  1BE3 E;  4QCK A;  4NB8 D;  2HMM A;  2JZA A;  5KLI C;  2XSH A;  2BMR A;  1NTZ E;  1PP9 E;  2HML A;  3VCA A;  1NDO A;  4HKV A;  1EZV E;  3CX5 E;  4PV1 D;  1SQQ E;  3L74 E;  1O7P A;  1EG9 A;  2Q3W A;  2XSO A;  5CXM A;  3GTS A;  3L73 E;  5BOK A;  2I7F A;  5HL4 A;  2DE5 D;  2DE6 D;  3L70 E;  4NB9 D;  4HM2 A;  4H0L D;  4P1B H;  2BMQ A;  4QUP A;  1ULI A;  2E74 D;  1FQT A;  2YFJ A;  1ULJ A;  4QDF B;  3VMI D;  3D89 A;  2IBZ E;  1G8K B;  3N0Q A;  4U3F E;  4P1C H;  2E4Q A;  2YFI A;  3GCE A;  4NBA D;  3GL0 A;  2A06 E;  4D6T E;  1SQX E;  2QJK C;  3GZX A;  3CXH E;  1Q90 C;  4HM1 A;  3GZY A;  3H1H E;  1VM9 A;  5KLV E;  2XR8 A;  1UUV A;  5AEU A;  1L0N E;  2YFL A;  4HM4 A;  1O7H A;  1KYO E;  3BCC E;  3GKE A;  1WQL A;  1UUW A;  4HM8 A;  1SJG A;  3VCP A;  1RFS A; 
#chains in the Genus database with same CATH topology
 3H1H D;  1O7G A;  4WVZ A;  1NYK A;  1LT9 B;  5AW5 B;  4O9B A;  1YIJ P;  3JC2 2;  1HBW A;  3WU2 E;  5AVR B;  1J2J B;  4MN4 C;  4N78 E;  1AQ5 A;  3P7K A;  3H1J D;  2L5G B;  3AE2 C;  1KB9 I;  1N7S B;  2YO3 A;  3L72 D;  2R44 A;  2Y0E A;  2FYU D;  3GHG C;  2ZVO B;  1VQN P;  2YO2 A;  3AE4 C;  3FOU A;  1BGY E;  4HJG H;  4C46 A;  1JCD A;  4D6T G;  1JOC A;  1BE3 E;  3D6Z A;  2JZA A;  2KNC A;  1MV8 A;  3HTK B;  1NTM D;  3GHG A;  2V7Q H;  3GTS A;  3HD7 C;  2LKM A;  2I7F A;  1LWU B;  4NB9 D;  2OQQ A;  4HM2 A;  3CX5 D;  1A02 J;  4JF7 A;  1NJI Q;  1G8K B;  2YFI A;  4U3F J;  1USD A;  3KHU A;  1S5L H;  2H43 A;  2Y0C A;  3CMA P;  1BCC G;  2QE7 H;  3PP5 A;  3CC7 P;  4W80 A;  2KS1 B;  1NKN A;  4H0L C;  5AW3 B;  2A06 D;  3VTP C;  2ZYA A;  1HWT C;  3OAK A;  3HRN A;  1SJG A;  2WSF H;  4JQ0 D;  1K73 Q;  1JO5 A;  3AEC C;  2GBX A;  2K3R A;  1NAF A;  3BCC D;  3V2R A;  5CMZ A;  3O6Q A;  3L75 E;  2YIU C;  1KD1 Q;  1NU1 G;  1CZQ A;  2C0W A;  3PTZ A;  3H1L D;  2QEX P;  4WWI A;  2W6J H;  1SQV D;  1SVF A;  3L71 E;  3CCQ P;  4K35 A;  1N8R Q;  4H44 D;  1KB9 D;  3SWF A;  4I7Z B;  1YHQ P;  5AVS B;  1KQF B;  1IO4 A;  2W27 A;  4ZNC A;  1SQP E;  1FE6 A;  3C9I A;  5KLI C;  1OW6 A;  4XA4 A;  1YBK A;  3G6E P;  1SQB K;  3L70 J;  1ULI A;  2ZYD A;  3N4X A;  2N1T C;  1QVG O;  1L0L G;  3GZY A;  1U7M A;  2KNC B;  1FZC C;  2WIT A;  3AE8 C;  3SFE C;  3EFF K;  3GHG B;  4N6J A;  1L0N J;  2QSI A;  5KAF H;  3VCP A;  2V4H A;  3AE5 C;  2O3J A;  2Y0D A;  1CSB A;  1S72 P;  3B5N D;  3AE1 C;  4YXD C;  2I1J A;  2RH0 A;  3TGU G;  1VF5 D;  2HFE D;  1PGQ A;  5GTH E;  2E74 B;  2WPR A;  1SQQ K;  2QJY C;  1NTK J;  4H13 D;  4OGQ D;  5AW8 B;  3KZI H;  2NWF A;  4GOF A;  3L35 A;  3D71 A;  2ZT9 D;  2KUB A;  5TJH A;  1KMI Z;  3O6Q B;  2NVF A;  4R4M A;  3RK3 E;  2JWD A;  1KIL D;  2Q7C A;  3AE6 C;  4QCK A;  3L75 D;  1FDM A;  1AQT A;  1NTZ E;  3S4R A;  1NAY A;  3IN6 A;  3L74 J;  4GIF A;  4EDF A;  1YTZ T;  2HR3 A;  3EFG A;  1HVV A;  2Y9Z A;  1NOH A;  2IFN A;  3D89 A;  1UII A;  2XKM A;  1EXJ A;  4P1C H;  2OGU A;  2FXP A;  4GKG A;  2N9B A;  3EWK A;  1PZQ A;  2WSE J;  4D6T D;  4AYC A;  2M3B A;  5KLV J;  3N7N A;  1FAV A;  3VMX A;  1RFS A;  1JM1 A;  1JY2 N;  1U57 A;  3E1I A;  4PV1 B;  5KLI B;  2DE7 D;  5AVQ B;  1ZRT D;  3SSU A;  1Q86 Q;  1YYC A;  2B87 A;  5B5E E;  1JY2 P;  1ZV8 A;  3U59 A;  1PP9 G;  1MUU A;  2NZ2 A;  1K9M Q;  2FY8 A;  3AEG C;  5APS A;  3L73 G;  2NPS D;  4L76 A;  2XRX A;  1H0T A;  1URQ D;  2XDJ A;  1A02 F;  1X8Y A;  1EDL A;  5APY A;  4Y99 C;  5APV A;  3V4W A;  4RKU J;  3A0H H;  2BMR A;  1RF1 C;  5CJ4 A;  1NU1 D;  3TNU A;  1S4X A;  1GW3 A;  1NO4 A;  1SQB G;  2IPP A;  3LW5 J;  3NMD A;  4PJ0 E;  3H1K G;  1Q81 Q;  2N9Y B;  3VMY A;  2C9N Y;  2XNX A;  1GU5 A;  1GK6 A;  2QJY B;  5AW9 B;  4WY4 A;  1YJW P;  1VQ4 P;  3H1H E;  3CWB G;  3RL0 D;  2JO1 A;  4LGD E;  1N7S C;  3VOP A;  4NBH D;  1ZN5 A;  1YQ3 C;  4HM3 A;  4QUR A;  1LTA C;  3H1J E;  1KV4 A;  3V2P A;  1HUC A;  2H88 C;  3TK1 A;  2E76 C;  3L72 E;  3RGU A;  5KJ7 C;  2FYU E;  4OVN F;  4CPG A;  3O8Z A;  1QVF O;  1SQQ G;  1HH0 A;  2C0X A;  1L0L D;  2WTY A;  3H1I J;  2OYO A;  1O7N A;  1D7M A;  1LWU C;  3RK2 D;  1RY3 A;  3EN1 A;  1JNM A;  1NTM E;  4UB6 H;  2NUM A;  1G2C A;  2B87 B;  5AW0 B;  4GOE A;  3CX5 E;  1ZOY C;  4M3L A;  1X22 A;  1JY3 O;  3TGU D;  1EG9 A;  4EIJ A;  1L0N K;  4PD4 H;  4P1B H;  2KZI A;  5APW A;  1H0T B;  3CCS P;  2OTK E;  3VMI D;  3ITK A;  2C9L Y;  2IX7 C;  3GCE A;  2A06 E;  3II6 A;  2K1A A;  1SQX J;  3GF3 A;  1JY3 P;  2YKQ A;  3H1L J;  2YMK A;  3MUD C;  1KTM A;  1Q90 C;  1T6A A;  4UB6 E;  4W7Y A;  2QIW A;  4EYY Q;  3BCC E;  1RHZ B;  2JJL A;  3GKE A;  3TNU B;  2WZ7 A;  1NTZ K;  1RE4 A;  1PGP A;  2HYN A;  4Y99 B;  2A45 I;  2E4P A;  3VMA A;  3H1L E;  3Q5P A;  4L73 A;  1FZG A;  1S3J A;  3A0B E;  1SQV E;  4QDC A;  2FYN C;  1AVY A;  1KB9 E;  4WY4 B;  1DX7 A;  1RIE A;  4NBE D;  3FX0 A;  3P8C D;  1OW8 A;  4BXL A;  3VMG D;  3MTU E;  1QL1 A;  1FZB A;  4QDF A;  3HE5 A;  4PD4 I;  2HG5 D;  1BGY J;  3V6I A;  3HD7 D;  2IBZ G;  4U3F G;  2AXT H;  1HJ0 A;  2PAJ A;  2BCC D;  1BE3 J;  2XSH A;  1J1D C;  5KLV K;  1FC2 C;  1YI2 P;  1SFC D;  1GL2 D;  1SS1 A;  3MGN A;  2Z5H A;  1PP9 D;  3E1R A;  1IZN B;  4H0L D;  1LJ2 A;  1GU4 A;  2YKO A;  1NVO A;  5KTB A;  2E76 B;  2W6A A;  1G2C B;  2OYI A;  3F89 A;  1QX8 A;  4RES B;  1AJY A;  4HM1 A;  1LGH B;  2R5D A;  2AXT E;  2QA4 P;  2E74 C;  2KSE A;  1X79 B;  2QG4 A;  2KSJ A;  1M1J C;  1VQ8 P;  2RKL A;  5C39 A;  2Q6Q A;  4NBD D;  3P32 A;  1G8J B;  3SFD C;  4HM7 A;  4ASW A;  3RK3 B;  3L75 J;  3H1K D;  4NBC D;  4YXW H;  2QPZ A;  2FFD A;  2LR2 A;  1M1J A;  3VYI A;  1MFZ A;  4AIV A;  3I56 P;  3VMH D;  4R4L A;  1ZP0 C;  2IYP A;  3G9R A;  3L71 J;  4I6M C;  3CWB D;  2NUK A;  3A7O A;  3L70 G;  1KIL E;  1NWQ A;  3CME P;  1FDI A;  1KFM A;  2Y9Y A;  4QDD A;  4PD4 D;  2BEQ D;  5DJT B;  2HMJ A;  1R8E A;  4QMA A;  1S5L E;  1SQP J;  2SPZ A;  3CLQ A;  1GL2 A;  4HKV A;  2N1T D;  1NKZ B;  1JMM A;  4IFF A;  3WMM 0;  1L0N G;  1OW7 A;  1GTW A;  2L91 A;  5BOK A;  3M0A A;  3CCM P;  4KHX A;  3WUT A;  5CBO A;  3BRV B;  4HH2 A;  1OXZ A;  2HOD A;  3VP9 A;  4QDF B;  3HE5 B;  3CCE P;  2FYN B;  1BSH A;  3KDP B;  4D6T E;  5APQ A;  4PV1 C;  3MD0 A;  2H7H A;  2IBZ I;  3SWY A;  2O01 J;  1J1E B;  2M5A A;  5AVZ B;  2WPS A;  2YFL A;  1JUN A;  1LTI C;  1NTK G;  1ZRT E;  1E5W A;  3AE9 C;  2G3A A;  3W68 A;  1HJB A;  2KLV A;  1OZH A;  2P10 A;  2KYV A;  2E42 A;  2BMO A;  2OYI B;  3CCR P;  1J1D B;  2ZXE B;  2GM4 A;  1VL2 A;  3OJA B;  3AE7 C;  2NVE A;  2CK3 H;  2ZAE B;  5CHX A;  2HLO A;  3L74 G;  4H44 C;  2D2C D;  4EI2 A;  5EFW B;  1K05 A;  2AXC A;  2NVG A;  3DQY A;  2K9Y A;  1VQ9 P;  3GOB A;  1XTC C;  4L74 A;  3M9B A;  1NU1 E;  1SQX K;  4KJM A;  1KC8 Q;  1M1J B;  2P1J A;  4ZKU A;  4K3A A;  1NTZ J;  5KLV G;  1EC5 A;  1PFI A;  2XSO A;  1NGM B;  3CCV P;  2ZYG A;  5KAF E;  3C1L A;  2YFJ A;  3KQG A;  1M1K Q;  3IR9 A;  4ASV A;  2PP6 A;  1OMI A;  2OYH C;  3C8V A;  2BEZ F;  5H2F H;  2FBW C;  5TIS H;  1T2K D;  1H89 A;  2IBZ D;  4U3F D;  1VQP P;  1AA0 A;  1GMJ A;  1IJD B;  2I1K A;  1K8A Q;  1N73 C;  3F5H A;  2MKV A;  1VQ6 P;  2VRS A;  3B5N C;  1K04 A;  1U7J A;  1KQG B;  2OYH A;  1FOS F;  2HOD B;  5GTI H;  1MFT A;  1ZLL A;  3KZI E;  3FWL A;  3HE4 A;  1L4A D;  4NBF D;  1VF5 C;  1PPJ G;  3PHL A;  2O1J A;  1L0L E;  4RO0 A;  1GZL A;  3HUS A;  3RBZ A;  1N73 A;  2IDB A;  1KOR A;  1KYO H;  2B24 A;  1FBM A;  1JY2 O;  1O7M A;  3B5N A;  4H13 C;  3AE3 C;  2CPS A;  3OW2 O;  5CCG D;  2PRR A;  1LP1 A;  2R3C A;  5TIS E;  4OGQ C;  2YVJ B;  2P67 A;  4HJL A;  3AEA C;  4OH8 B;  2JO6 A;  1TU3 F;  1RQU A;  1KIL C;  2E75 D;  2QJP C;  3TGU E;  1QLE D;  1T8Z A;  1BDD A;  3Q3D A;  5AW2 B;  4I1L A;  1IC2 A;  1OIP A;  3BAT A;  1BCC D;  1N2D C;  3TSI A;  1QGK B;  4HKZ H;  5KAI H;  4IL6 H;  1KIL A;  4DJG A;  3G4S P;  2KB7 P;  1HTL C;  1NHL A;  2WSC J;  2E4Q A;  4KT0 J;  5CBN A;  1N7S D;  3L70 D;  2P2U A;  4H44 B;  4ZMD A;  2IZ1 A;  3M9H A;  1VM9 A;  1UUV A;  2YXQ B;  4WY4 C;  2RN0 A;  3H1H J;  3MHV A;  3H1I G;  2LXC B;  1Z56 A;  2Q5U A;  5KJ7 D;  5AVX B;  1L0N D;  2OAR A;  1QEX A;  1FDO A;  4BRY A;  4AAY B;  1RE3 C;  3H1J J;  3PRJ A;  1JB0 J;  3P8C E;  2BCC J;  3EQQ A;  1SLQ A;  1SQP K;  3H25 A;  2HMO A;  4WBA A;  3PLN A;  3GL2 A;  4NBG D;  3L72 J;  3CI9 A;  3A0H E;  2FYU J;  2O01 N;  1EZV G;  3RBX A;  3AZC A;  1RE3 A;  1OVV A;  2BCC E;  2OYH B;  2E5T A;  1DD4 A;  1NTK D;  2AEJ A;  3HE4 B;  1NTM J;  4AUW A;  1SQX G;  2CKF A;  4HM5 A;  2KZJ A;  2XND H;  3H1L G;  3GF7 A;  3CD6 P;  2NPS A;  3HUS B;  3VCA A;  1PP9 E;  2ZVN B;  2KXP B;  1N73 B;  5CCH D;  1G1I A;  1URQ A;  3B5N B;  3W67 A;  3KXD A;  3CCJ P;  4TLF A;  1YQ4 C;  3L73 E;  4NPE A;  4QUP A;  1VF5 B;  3L74 D;  2QM7 A;  1ULJ A;  2H89 C;  1VQ5 P;  3U1C A;  2B9B A;  1N86 A;  4GDO A;  1KQL A;  3RK3 C;  2ZXX A;  1EXI A;  1VQK P;  4H13 B;  2WQY C;  1ZW0 A;  3RL0 C;  1GW4 A;  2OTL P;  5AVY B;  4OGQ B;  2PGD A;  2XR8 A;  5AEU A;  2W6B A;  2ZT9 B;  3R4Y A;  1IK7 A;  1UUW A;  3BCC J;  2J5U A;  2XV5 A;  1JCC A;  1NYH A;  1SQB E;  3G3Z A;  1KIL B;  3QWO C;  2M0B A;  3I5C A;  1JM0 A;  5KLV D;  1RE4 C;  2QJP B;  3H1K E;  3TF5 A;  5BVZ A;  1KYO D;  3MZW B;  3WUU A;  1BGY G;  2R3S A;  3CXH H;  4HM0 A;  2M3E A;  1SQV J;  3USS A;  3M0D A;  1BE3 G;  2ZYL A;  3CWB E;  5AVT B;  4HM6 A;  3LID A;  2E43 A;  2POH A;  3CCL P;  1AVO A;  2GUS A;  1W2B O;  4PD4 E;  3CC4 P;  1X0T A;  4XFJ A;  3EQ2 A;  4ZKP A;  3GMA A;  1DIP A;  1YJN P;  3GW6 A;  1E79 H;  1P84 D;  3I55 P;  5L8R J;  4BRY B;  3WU2 H;  1UIX A;  1PV3 A;  4HYT B;  1X9V A;  2JP3 A;  3M06 A;  1J1E C;  2HML A;  4N3Y B;  1PPJ D;  1OVR A;  1SQQ E;  1O7P A;  1EDI A;  2ZFC A;  5KKZ B;  1EZV I;  2R32 A;  3NFQ A;  2BMQ A;  1FJK A;  2E74 D;  1Q2N A;  1DEE G;  2XZR A;  4JBZ A;  4NBA D;  5B66 H;  3GL0 A;  4Y28 J;  2P7J A;  1FJP A;  2JKV A;  1Y47 A;  3L75 G;  2OYI C;  2YXR B;  2NPS B;  2XU6 A;  3Q5S A;  3CXH I;  1URQ B;  1VQL P;  3IF4 A;  3L71 G;  5AVV B;  1S9K D;  1M90 Q;  4IFD K;  3L73 D;  1GK4 A;  1FOS E;  2Q3I A;  1SQP G;  3WUV A;  4DT0 A;  5B66 E;  2FFD C;  1RH5 B;  1IFI A;  1ZR4 A;  1HF9 A;  2MJZ A;  1W2E A;  2OTJ P;  1WT6 A;  1M7L A;  2WPQ A;  2M8R A;  2YKP A;  2V7Q J;  1SQB D;  3H1I D;  1IFM A;  2WVR A;  4NPD A;  3Q1M A;  3RL0 B;  2GBW A;  1H8A A;  3CPW O;  4EOT A;  5AVU B;  4YTP C;  1SFC C;  4PV1 D;  1R5L A;  1GL2 C;  3R2P A;  3FXD A;  3HD7 A;  4W7Z A;  1CI6 A;  5HL4 A;  2I8D A;  4JYC A;  1S5L X;  3RL0 g;  2E5Y A;  1EZV D;  2WSF J;  3ABV C;  4RJT A;  2IBZ E;  4U3F E;  2KOG A;  2QRX A;  3LIE A;  3M91 A;  2QJK C;  3GZX A;  1SFC A;  4D6T J;  2AEF A;  1T3J A;  4I2L C;  5BU8 B;  3RK2 B;  4WB4 A;  2CPB A;  3S1K A;  3S9O A;  1S1C X;  1SQX D;  2JR8 A;  5K5G B;  2Q1K A;  2FYU K;  1O7H A;  3G71 P;  2O1K A;  3JCU H;  1SQQ D;  3CXH D;  3QH9 A;  2KP8 A;  3MP7 B;  2Q9I A;  2B89 A;  1PIX A;  3U1A A;  1YIT P;  2W8Z A;  2AEM A;  4IFM A;  1XTG B;  2O01 H;  4L75 A;  1NTM K;  3CL3 D;  2YMY A;  1BCC J;  5BU5 A;  1W5C E;  1NTZ G;  4EMJ B;  3V2Q A;  4N78 D;  2HMN A;  3GB4 A;  1LTG C;  2K37 A;  3JCU E;  1BCC E;  3ZDM A;  5GTH H;  1NU1 J;  1WMK A;  1BGY D;  1IFJ A;  2BAS A;  4XE5 B;  3L4F A;  2DW3 A;  1JEK A;  4GOD A;  2WSS H;  2B88 A;  5DJU B;  4DOJ A;  5CXM A;  3TYY A;  1BE3 D;  3KYQ A;  3L36 A;  1RQV A;  3L70 E;  1OVU A;  4AQR D;  3P8M C;  1LTT C;  1FQT A;  2IZ0 A;  2N1T A;  3N0Q A;  1BDC A;  2R5B A;  2Q3E A;  2FFD B;  1PL5 A;  1M8O B;  1SQV K;  2W83 C;  3V4Q A;  1FZC A;  3L37 A;  3B4S A;  1L0N E;  2JEE A;  4JPZ B;  3HD7 B;  2ITA A;  1CW5 A;  3K5B A;  1CI6 B;  4HM8 A;  5APX A;  1LTB C;  2GA1 A;  1LTJ C;  1JTH A;  3AEE C;  3FGA D;  2FXM A;  1DH3 A;  2IFM A;  4C7N A;  2Z5I A;  3KPE A;  1YJ9 P;  4QUQ A;  3PH0 A;  1SFC B;  1GL2 B;  3GTE A;  3A5T A;  2UWJ E;  1L0L J;  5M1B A;  4H0L B;  3HUS C;  2D2C C;  1LTJ A;  1O7W A;  1VDF A;  4YPC A;  4TT3 H;  1NTK E;  4U7J A;  3M9Q A;  3UIA A;  2P58 A;  2QJK B;  1N7L A;  4HB1 A;  1EDK A;  2WSE H;  3L71 D;  3SWK A;  2G8Y A;  3JSV C;  2YIU B;  3A3Y B;  5B5E H;  2HPC A;  1FU1 A;  1KFN A;  2M5A B;  3TGU J;  1AV1 A;  2KLU A;  4NPF X;  3V2N A;  5H2F E;  2YNY A;  2H8P D;  1NDO A;  1MZ9 A;  1VQM P;  3H1H G;  3L74 E;  2K9J A;  2ZT9 C;  1SQP D;  2LXB A;  2J59 M;  1USE A;  1HGZ A;  2KK7 A;  4LC1 A;  1DD3 A;  5CJ0 A;  4WY4 D;  3VP8 A;  2WWW A;  3H32 A;  5GTI E;  3PJS K;  2J58 A;  3H1J G;  5AW6 B;  1T2K C;  2BCC G;  2WT7 A;  3B8E B;  1P84 H;  3Q2Y A;  2RMZ A;  3T97 A;  2KI7 B;  3L72 G;  1PGO A;  1IFN A;  5KLV E;  2FYU G;  1KYO E;  1M56 D;  4A7P A;  1BSN A;  2JWA A;  1OX3 A;  4DZO A;  3MIW A;  2WSC H;  3VN0 A;  4PJ0 H;  1L4A C;  2PFX A;  1FZF A;  2HMK A;  1ZME C;  1H88 A;  2N1T B;  1LNQ A;  1NTM G;  3A2A A;  5E79 H;  1IK9 A;  1HGV A;  4JYB A;  4B86 A;  1FZC B;  1LT1 A;  3LW5 H;  5CCG C;  2E76 D;  1KYO I;  4IL6 X;  1SP4 A;  1L4A A;  1P84 E;  5KKZ C;  4DCK A;  1JTH B;  5KAI E;  4IL6 E;  2E75 C;  2WPV B;  4C7N B;  3H6P A;  3NTN A;  2A45 G;  1NH4 A;  3V5B A;  5APU A;  1PPJ E;  3GLM A;  5AW7 B;  1Y8A A;  3C0D A;  2A06 G;  5CCG A;  1T3U A;  1FZE A;  1LT9 C;  3AEF C;  2HMM A;  1RF1 A;  5AVW B;  2NPS C;  2FXO A;  3CC2 P;  1LTJ B;  5E79 E;  1PP9 J;  3RK3 D;  1P84 I;  5APT A;  1URQ C;  3BCC G;  2DE5 D;  3L73 J;  3Q5R A;  1Q82 Q;  1VQO P;  1NTZ D;  4UB8 H;  3NXS A;  1FZA A;  1LT9 A;  1PGJ A;  3BRT B;  1IFD A;  1GDT A;  1QL2 A;  2QM8 A;  2NRG A;  1OFC X;  1KN7 A;  2D2C B;  2HPC B;  1SQV G;  5AW1 B;  5AW4 B;  1EDJ A;  1YTZ I;  4GT1 A;  3CX5 H;  1S9K E;  2Z4E A;  2WMM A;  1M57 D;  1VPC A;  1Q90 D;  1LP1 B;  4HM4 A;  1WRG A;  1OWA A;  3OA7 A;  2K9J B;  1N7S A;  3CCU P;  1GD2 E;  4NBB D;  3IFM A;  2A45 H;  1SQB J;  1L2P A;  1JMB A;  1RF0 C;  4IOI H;  2K88 A;  3FXE A;  3VMZ A;  3H1K J;  1VCK A;  3FWN A;  3H32 B;  1VQ7 P;  4UB8 E;  4Z1M H;  1MKM A;  1NU1 K;  2WT7 B;  5KJ7 A;  1ZXG A;  3HTK A;  3M0D C;  3T97 B;  1KZU B;  1G1J A;  3CWB J;  3TDK A;  2FKW B;  2GUV A;  2W90 A;  1DEB A;  5AEW A;  1EQ7 A;  1RF0 A;  3E7K A;  3H1I E;  1FS0 E;  2B1X A;  1LWU A;  3D6Y A;  1JY3 N;  1IFP A;  3A0B H;  2FYZ A;  1AFO A;  2QVA A;  3GG2 A;  3AED C;  2ZJS E;  4C7R A;  1KQS O;  3BVH A;  4NB8 D;  1KB9 H;  5CCH C;  2KS1 A;  3RK2 C;  4OWF A;  1ZR2 A;  1EZV E;  3B71 A;  1SQQ J;  2Q3W A;  1L4A B;  1Y9B A;  3CX5 I;  2DE6 D;  1S2E A;  1R5S A;  2JDI H;  3D70 A;  1NTK K;  5CCH A;  3AEB C;  1SQX E;  3IAO A;  4I7Z C;  3MUD A;  1Q7Y Q;  3BAS A;  3CXH E;  4LLH A;  1L0L K;  1LTS C;  2KIK A;  1RF1 B;  2IYO A;  4BWN A;  1WQL A;  2E75 B; 
#chains in the Genus database with same CATH homology
 1JM1 A;  1SQB E;  1ZRT E;  4NBB D;  4NBH D;  1O7G A;  4NBD D;  1NYK A;  2GBX A;  3H1K E;  2E4P A;  4HM3 A;  3H1L E;  2HMK A;  4QUR A;  1G8J B;  4HM7 A;  1VCK A;  3H1J E;  4NBF D;  4AAY B;  4QUQ A;  2DE7 D;  3L75 E;  1SQV E;  2BMO A;  2YIU C;  3EQQ A;  4HM0 A;  4QDC A;  1L0L E;  2FYN C;  3GTE A;  1VF5 D;  4NBC D;  2QPZ A;  3L72 E;  2ZYL A;  3CWB E;  2HMO A;  1KB9 E;  2NVE A;  3GL2 A;  1RIE A;  2FYU E;  4HM6 A;  2B24 A;  4NBG D;  1O7W A;  4NBE D;  1O7M A;  4AIV A;  2E76 D;  3VMH D;  5AEW A;  3H1I E;  4EMJ B;  3L71 E;  1P84 E;  2QJY C;  2B1X A;  2D2C D;  1NTK E;  5KKZ C;  3AZC A;  4H13 D;  4PD4 E;  1O7N A;  2NVG A;  2YVJ B;  3VMG D;  4H44 D;  2HMN A;  3GB4 A;  2NUK A;  3DQY A;  4HJL A;  2XRX A;  3FOU A;  2BCC E;  4OGQ D;  2NWF A;  4QDF A;  3EN1 A;  3GOB A;  1BGY E;  2ZT9 D;  1BCC E;  2JO6 A;  1NTM E;  1PPJ E;  4QDD A;  2E75 D;  2NVF A;  2NUM A;  3C0D A;  2QJP C;  1NU1 E;  3TGU E;  2CKF A;  1SQP E;  2HMJ A;  2GBW A;  4HM5 A;  1BE3 E;  4QCK A;  4NB8 D;  2HMM A;  2JZA A;  5KLI C;  2XSH A;  2BMR A;  1NTZ E;  1PP9 E;  2HML A;  3VCA A;  1NDO A;  4HKV A;  1EZV E;  3CX5 E;  4PV1 D;  1SQQ E;  3L74 E;  1O7P A;  1EG9 A;  2Q3W A;  2XSO A;  5CXM A;  3GTS A;  3L73 E;  5BOK A;  2I7F A;  5HL4 A;  2DE5 D;  2DE6 D;  3L70 E;  4NB9 D;  4HM2 A;  4H0L D;  4P1B H;  2BMQ A;  4QUP A;  1ULI A;  2E74 D;  1FQT A;  2YFJ A;  1ULJ A;  4QDF B;  3VMI D;  3D89 A;  2IBZ E;  1G8K B;  3N0Q A;  4U3F E;  4P1C H;  2E4Q A;  2YFI A;  3GCE A;  4NBA D;  3GL0 A;  2A06 E;  4D6T E;  1SQX E;  2QJK C;  3GZX A;  3CXH E;  1Q90 C;  4HM1 A;  3GZY A;  3H1H E;  1VM9 A;  5KLV E;  2XR8 A;  1UUV A;  5AEU A;  1L0N E;  2YFL A;  4HM4 A;  1O7H A;  1KYO E;  3BCC E;  3GKE A;  1WQL A;  1UUW A;  4HM8 A;  1SJG A;  3VCP A;  1RFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...