1G8KB

Crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
RTTLAYPATAVSVAKNLAANEPVSFTYPDTSSPCVAVKLGAPVPGGVGPDDDIVAYSVLCTHMGCPTSYDSSSKTFSCPCHFTEFDAEKAGQMICGEATADLPRVLLRYDAASDALTAVGVDGLIYGRQANVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 100 kDa arsenite oxidase from Alcaligenes faecalis in two crystal forms at 1.64 A and 2.03 A.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords ARSENITE OXIDASE
total genus 27
structure length 133
sequence length 133
chains with identical sequence D, F, H
ec nomenclature ec 1.20.9.1: Arsenate reductase (azurin).
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1g8kB00
2BMQA 3H1HE 3VCAA 4HM8A 3VMGD 1L0LE 1NTZE 1BE3E 3H1IE 1SQQE 3DQYA 1P84E 4U3FE 3EN1A 5CXMA 1RIEA 3GCEA 3GTSA 5HL4A 2QJKC 3GZXA 3H1JE 4HM7A 2HMJA 1O7PA 5KLVE 2ZYLA 1UUVA 3L74E 4NBFD 2I7FA 4H0LD 4QURA 4QDCA 1BCCE 4HM4A 5AEWA 1PPJE 4HKVA 3H1LE 2XR8A 1NU1E 1SQPE 2BMOA 2B1XA 4P1CH 2NUKA 1RFSA 2NVEA 4HM2A 3GL0A 1NTME 4NBHD 4PD4E 1KB9E 4H44D 1VM9A 2B24A 2E75D 1O7MA 2FYNC 1ULIA 3H1KE 4HM5A 2DE6D 3BCCE 3VCPA 1L0NE 2QPZA 2DE7D 2BCCE 2Q3WA 2HMMA 2E4QA 5KLIC 3L70E 3GZYA 2E76D 2CKFA 2DE5D 1ZRTE 2JO6A 1WQLA 1O7WA 1SQXE 4HM1A 4QUPA 1VF5D 2E4PA 3L71E 4H13D 2XSOA 2QJPC 2NWFA 1SQVE 3EQQA 5KKZC 4NB9D 3CX5E 2YFJA 3L75E 3GOBA 1ULJA 1O7NA 2NVGA 4NBBD 3AZCA 2BMRA 2D2CD 2IBZE 4QCKA 1O7GA 4AIVA 1SJGA 3VMHD 4QDDA 1EG9A 3N0QA 2NUMA 2ZT9D 2YIUC 2XSHA 1KYOE 3CWBE 4HJLA 2HMNA 4HM3A 4HM6A 4PV1D 4NBED 2NVFA 4OGQD 2JZAA 3D89A 2YFLA 1G8JB 4HM0A 4P1BH 2HMLA 1SQBE 5BOKA 2GBXA 4QDFA 2YFIA 5AEUA 4QUQA 3VMID 1NTKE 3GKEA 2A06E 1G8KB 1FQTA 2HMKA 3L73E 3GL2A 3C0DA 4NB8D 1PP9E 1Q90C 2FYUE 1NDOA 4QDFB 3CXHE 2YVJB 4NBGD 2HMOA 4NBAD 1EZVE 3GTEA 4AAYB 1JM1A 1UUWA 2QJYC 4EMJB 3L72E 2GBWA 1VCKA 2E74D 3FOUA 4NBCD 3TGUE 2XRXA 4NBDD 1O7HA 3GB4A 1NYKA
chains in the Genus database with same CATH superfamily
2BMQA 3H1HE 3VCAA 4HM8A 3VMGD 1L0LE 1NTZE 1BE3E 3H1IE 1SQQE 3DQYA 1P84E 4U3FE 3EN1A 5CXMA 1RIEA 3GCEA 3GTSA 5HL4A 2QJKC 3GZXA 3H1JE 4HM7A 2HMJA 1O7PA 5KLVE 2ZYLA 1UUVA 3L74E 4NBFD 2I7FA 4H0LD 4QURA 4QDCA 1BCCE 4HM4A 5AEWA 1PPJE 4HKVA 3H1LE 2XR8A 1NU1E 1SQPE 2BMOA 2B1XA 4P1CH 2NUKA 1RFSA 2NVEA 4HM2A 3GL0A 1NTME 4NBHD 4PD4E 1KB9E 4H44D 1VM9A 2B24A 2E75D 1O7MA 2FYNC 1ULIA 3H1KE 4HM5A 2DE6D 3BCCE 3VCPA 1L0NE 2QPZA 2DE7D 2BCCE 2Q3WA 2HMMA 2E4QA 5KLIC 3L70E 3GZYA 2E76D 2CKFA 2DE5D 1ZRTE 2JO6A 1WQLA 1O7WA 1SQXE 4HM1A 4QUPA 1VF5D 2E4PA 3L71E 4H13D 2XSOA 2QJPC 2NWFA 1SQVE 3EQQA 5KKZC 4NB9D 3CX5E 2YFJA 3L75E 3GOBA 1ULJA 1O7NA 2NVGA 4NBBD 3AZCA 2BMRA 2D2CD 2IBZE 4QCKA 1O7GA 4AIVA 1SJGA 3VMHD 4QDDA 1EG9A 3N0QA 2NUMA 2ZT9D 2YIUC 2XSHA 1KYOE 3CWBE 4HJLA 2HMNA 4HM3A 4HM6A 4PV1D 4NBED 2NVFA 4OGQD 2JZAA 3D89A 2YFLA 1G8JB 4HM0A 4P1BH 2HMLA 1SQBE 5BOKA 2GBXA 4QDFA 2YFIA 5AEUA 4QUQA 3VMID 1NTKE 3GKEA 2A06E 1G8KB 1FQTA 2HMKA 3L73E 3GL2A 3C0DA 4NB8D 1PP9E 1Q90C 2FYUE 1NDOA 4QDFB 3CXHE 2YVJB 4NBGD 2HMOA 4NBAD 1EZVE 3GTEA 4AAYB 1JM1A 1UUWA 2QJYC 4EMJB 3L72E 2GBWA 1VCKA 2E74D 3FOUA 4NBCD 3TGUE 2XRXA 4NBDD 1O7HA 3GB4A 1NYKA
chains in the Genus database with same CATH topology
2BMQA 3H1HE 3VCAA 4HM8A 3VMGD 1L0LE 1NTZE 1BE3E 3H1IE 1SQQE 3DQYA 1P84E 4U3FE 3EN1A 5CXMA 1RIEA 3GCEA 3GTSA 5HL4A 2QJKC 3GZXA 3H1JE 4HM7A 2HMJA 1O7PA 5KLVE 2ZYLA 1UUVA 3L74E 4NBFD 2I7FA 4H0LD 4QURA 4QDCA 1BCCE 4HM4A 5AEWA 1PPJE 4HKVA 3H1LE 2XR8A 1NU1E 1SQPE 2BMOA 2B1XA 4P1CH 2NUKA 1RFSA 2NVEA 4HM2A 3GL0A 1NTME 4NBHD 4PD4E 1KB9E 4H44D 1VM9A 2B24A 2E75D 1O7MA 2FYNC 1ULIA 3H1KE 4HM5A 2DE6D 3BCCE 3VCPA 1L0NE 2QPZA 2DE7D 2BCCE 2Q3WA 2HMMA 2E4QA 5KLIC 3L70E 3GZYA 2E76D 2CKFA 2DE5D 1ZRTE 2JO6A 1WQLA 1O7WA 1SQXE 4HM1A 4QUPA 1VF5D 2E4PA 3L71E 4H13D 2XSOA 2QJPC 2NWFA 1SQVE 3EQQA 5KKZC 4NB9D 3CX5E 2YFJA 3L75E 3GOBA 1ULJA 1O7NA 2NVGA 4NBBD 3AZCA 2BMRA 2D2CD 2IBZE 4QCKA 1O7GA 4AIVA 1SJGA 3VMHD 4QDDA 1EG9A 3N0QA 2NUMA 2ZT9D 2YIUC 2XSHA 1KYOE 3CWBE 4HJLA 2HMNA 4HM3A 4HM6A 4PV1D 4NBED 2NVFA 4OGQD 2JZAA 3D89A 2YFLA 1G8JB 4HM0A 4P1BH 2HMLA 1SQBE 5BOKA 2GBXA 4QDFA 2YFIA 5AEUA 4QUQA 3VMID 1NTKE 3GKEA 2A06E 1G8KB 1FQTA 2HMKA 3L73E 3GL2A 3C0DA 4NB8D 1PP9E 1Q90C 2FYUE 1NDOA 4QDFB 3CXHE 2YVJB 4NBGD 2HMOA 4NBAD 1EZVE 3GTEA 4AAYB 1JM1A 1UUWA 2QJYC 4EMJB 3L72E 2GBWA 1VCKA 2E74D 3FOUA 4NBCD 3TGUE 2XRXA 4NBDD 1O7HA 3GB4A 1NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ A;  3H1H E;  3VCA A;  4HM8 A;  3VMG D;  1L0L E;  1NTZ E;  1BE3 E;  3H1I E;  1SQQ E;  3DQY A;  1P84 E;  4U3F E;  3EN1 A;  5CXM A;  1RIE A;  3GCE A;  3GTS A;  5HL4 A;  2QJK C;  3GZX A;  3H1J E;  4HM7 A;  2HMJ A;  1O7P A;  5KLV E;  2ZYL A;  1UUV A;  3L74 E;  4NBF D;  2I7F A;  4H0L D;  4QUR A;  4QDC A;  1BCC E;  4HM4 A;  5AEW A;  1PPJ E;  4HKV A;  3H1L E;  2XR8 A;  1NU1 E;  1SQP E;  2BMO A;  2B1X A;  4P1C H;  2NUK A;  1RFS A;  2NVE A;  4HM2 A;  3GL0 A;  1NTM E;  4NBH D;  4PD4 E;  1KB9 E;  4H44 D;  1VM9 A;  2B24 A;  2E75 D;  1O7M A;  2FYN C;  1ULI A;  3H1K E;  4HM5 A;  2DE6 D;  3BCC E;  3VCP A;  1L0N E;  2QPZ A;  2DE7 D;  2BCC E;  2Q3W A;  2HMM A;  2E4Q A;  5KLI C;  3L70 E;  3GZY A;  2E76 D;  2CKF A;  2DE5 D;  1ZRT E;  2JO6 A;  1WQL A;  1O7W A;  1SQX E;  4HM1 A;  4QUP A;  1VF5 D;  2E4P A;  3L71 E;  4H13 D;  2XSO A;  2QJP C;  2NWF A;  1SQV E;  3EQQ A;  5KKZ C;  4NB9 D;  3CX5 E;  2YFJ A;  3L75 E;  3GOB A;  1ULJ A;  1O7N A;  2NVG A;  4NBB D;  3AZC A;  2BMR A;  2D2C D;  2IBZ E;  4QCK A;  1O7G A;  4AIV A;  1SJG A;  3VMH D;  4QDD A;  1EG9 A;  3N0Q A;  2NUM A;  2ZT9 D;  2YIU C;  2XSH A;  1KYO E;  3CWB E;  4HJL A;  2HMN A;  4HM3 A;  4HM6 A;  4PV1 D;  4NBE D;  2NVF A;  4OGQ D;  2JZA A;  3D89 A;  2YFL A;  1G8J B;  4HM0 A;  4P1B H;  2HML A;  1SQB E;  5BOK A;  2GBX A;  4QDF A;  2YFI A;  5AEU A;  4QUQ A;  3VMI D;  1NTK E;  3GKE A;  2A06 E;  1G8K B;  1FQT A;  2HMK A;  3L73 E;  3GL2 A;  3C0D A;  4NB8 D;  1PP9 E;  1Q90 C;  2FYU E;  1NDO A;  4QDF B;  3CXH E;  2YVJ B;  4NBG D;  2HMO A;  4NBA D;  1EZV E;  3GTE A;  4AAY B;  1JM1 A;  1UUW A;  2QJY C;  4EMJ B;  3L72 E;  2GBW A;  1VCK A;  2E74 D;  3FOU A;  4NBC D;  3TGU E;  2XRX A;  4NBD D;  1O7H A;  3GB4 A;  1NYK A; 
#chains in the Genus database with same CATH topology
 2BMQ A;  3H1H E;  3VCA A;  4HM8 A;  3VMG D;  1L0L E;  1NTZ E;  1BE3 E;  3H1I E;  1SQQ E;  3DQY A;  1P84 E;  4U3F E;  3EN1 A;  5CXM A;  1RIE A;  3GCE A;  3GTS A;  5HL4 A;  2QJK C;  3GZX A;  3H1J E;  4HM7 A;  2HMJ A;  1O7P A;  5KLV E;  2ZYL A;  1UUV A;  3L74 E;  4NBF D;  2I7F A;  4H0L D;  4QUR A;  4QDC A;  1BCC E;  4HM4 A;  5AEW A;  1PPJ E;  4HKV A;  3H1L E;  2XR8 A;  1NU1 E;  1SQP E;  2BMO A;  2B1X A;  4P1C H;  2NUK A;  1RFS A;  2NVE A;  4HM2 A;  3GL0 A;  1NTM E;  4NBH D;  4PD4 E;  1KB9 E;  4H44 D;  1VM9 A;  2B24 A;  2E75 D;  1O7M A;  2FYN C;  1ULI A;  3H1K E;  4HM5 A;  2DE6 D;  3BCC E;  3VCP A;  1L0N E;  2QPZ A;  2DE7 D;  2BCC E;  2Q3W A;  2HMM A;  2E4Q A;  5KLI C;  3L70 E;  3GZY A;  2E76 D;  2CKF A;  2DE5 D;  1ZRT E;  2JO6 A;  1WQL A;  1O7W A;  1SQX E;  4HM1 A;  4QUP A;  1VF5 D;  2E4P A;  3L71 E;  4H13 D;  2XSO A;  2QJP C;  2NWF A;  1SQV E;  3EQQ A;  5KKZ C;  4NB9 D;  3CX5 E;  2YFJ A;  3L75 E;  3GOB A;  1ULJ A;  1O7N A;  2NVG A;  4NBB D;  3AZC A;  2BMR A;  2D2C D;  2IBZ E;  4QCK A;  1O7G A;  4AIV A;  1SJG A;  3VMH D;  4QDD A;  1EG9 A;  3N0Q A;  2NUM A;  2ZT9 D;  2YIU C;  2XSH A;  1KYO E;  3CWB E;  4HJL A;  2HMN A;  4HM3 A;  4HM6 A;  4PV1 D;  4NBE D;  2NVF A;  4OGQ D;  2JZA A;  3D89 A;  2YFL A;  1G8J B;  4HM0 A;  4P1B H;  2HML A;  1SQB E;  5BOK A;  2GBX A;  4QDF A;  2YFI A;  5AEU A;  4QUQ A;  3VMI D;  1NTK E;  3GKE A;  2A06 E;  1G8K B;  1FQT A;  2HMK A;  3L73 E;  3GL2 A;  3C0D A;  4NB8 D;  1PP9 E;  1Q90 C;  2FYU E;  1NDO A;  4QDF B;  3CXH E;  2YVJ B;  4NBG D;  2HMO A;  4NBA D;  1EZV E;  3GTE A;  4AAY B;  1JM1 A;  1UUW A;  2QJY C;  4EMJ B;  3L72 E;  2GBW A;  1VCK A;  2E74 D;  3FOU A;  4NBC D;  3TGU E;  2XRX A;  4NBD D;  1O7H A;  3GB4 A;  1NYK A; 
#chains in the Genus database with same CATH homology
 2BMQ A;  3H1H E;  3VCA A;  4HM8 A;  3VMG D;  1L0L E;  1NTZ E;  1BE3 E;  3H1I E;  1SQQ E;  3DQY A;  1P84 E;  4U3F E;  3EN1 A;  5CXM A;  1RIE A;  3GCE A;  3GTS A;  5HL4 A;  2QJK C;  3GZX A;  3H1J E;  4HM7 A;  2HMJ A;  1O7P A;  5KLV E;  2ZYL A;  1UUV A;  3L74 E;  4NBF D;  2I7F A;  4H0L D;  4QUR A;  4QDC A;  1BCC E;  4HM4 A;  5AEW A;  1PPJ E;  4HKV A;  3H1L E;  2XR8 A;  1NU1 E;  1SQP E;  2BMO A;  2B1X A;  4P1C H;  2NUK A;  1RFS A;  2NVE A;  4HM2 A;  3GL0 A;  1NTM E;  4NBH D;  4PD4 E;  1KB9 E;  4H44 D;  1VM9 A;  2B24 A;  2E75 D;  1O7M A;  2FYN C;  1ULI A;  3H1K E;  4HM5 A;  2DE6 D;  3BCC E;  3VCP A;  1L0N E;  2QPZ A;  2DE7 D;  2BCC E;  2Q3W A;  2HMM A;  2E4Q A;  5KLI C;  3L70 E;  3GZY A;  2E76 D;  2CKF A;  2DE5 D;  1ZRT E;  2JO6 A;  1WQL A;  1O7W A;  1SQX E;  4HM1 A;  4QUP A;  1VF5 D;  2E4P A;  3L71 E;  4H13 D;  2XSO A;  2QJP C;  2NWF A;  1SQV E;  3EQQ A;  5KKZ C;  4NB9 D;  3CX5 E;  2YFJ A;  3L75 E;  3GOB A;  1ULJ A;  1O7N A;  2NVG A;  4NBB D;  3AZC A;  2BMR A;  2D2C D;  2IBZ E;  4QCK A;  1O7G A;  4AIV A;  1SJG A;  3VMH D;  4QDD A;  1EG9 A;  3N0Q A;  2NUM A;  2ZT9 D;  2YIU C;  2XSH A;  1KYO E;  3CWB E;  4HJL A;  2HMN A;  4HM3 A;  4HM6 A;  4PV1 D;  4NBE D;  2NVF A;  4OGQ D;  2JZA A;  3D89 A;  2YFL A;  1G8J B;  4HM0 A;  4P1B H;  2HML A;  1SQB E;  5BOK A;  2GBX A;  4QDF A;  2YFI A;  5AEU A;  4QUQ A;  3VMI D;  1NTK E;  3GKE A;  2A06 E;  1G8K B;  1FQT A;  2HMK A;  3L73 E;  3GL2 A;  3C0D A;  4NB8 D;  1PP9 E;  1Q90 C;  2FYU E;  1NDO A;  4QDF B;  3CXH E;  2YVJ B;  4NBG D;  2HMO A;  4NBA D;  1EZV E;  3GTE A;  4AAY B;  1JM1 A;  1UUW A;  2QJY C;  4EMJ B;  3L72 E;  2GBW A;  1VCK A;  2E74 D;  3FOU A;  4NBC D;  3TGU E;  2XRX A;  4NBD D;  1O7H A;  3GB4 A;  1NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...