1G8KB

Crystal structure analysis of arsenite oxidase from alcaligenes faecalis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
133
structure length
133
Chain Sequence
RTTLAYPATAVSVAKNLAANEPVSFTYPDTSSPCVAVKLGAPVPGGVGPDDDIVAYSVLCTHMGCPTSYDSSSKTFSCPCHFTEFDAEKAGQMICGEATADLPRVLLRYDAASDALTAVGVDGLIYGRQANVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARSENITE OXIDASE
publication title Crystal structure of the 100 kDa arsenite oxidase from Alcaligenes faecalis in two crystal forms at 1.64 A and 2.03 A.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 133
sequence length 133
chains with identical sequence D, F, H
ec nomenclature ec 1.20.9.1: Arsenate reductase (azurin).
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1g8kB00
2Q3WA 1ULJA 2D2CD 2E4PA 2BMQA 2YFIA 3GB4A 1SQBE 4HM3A 1EG9A 1SQQE 3GL0A 4QDFB 2FYNC 3CXHE 4HM2A 2HMOA 3GTEA 1NTKE 4NBDD 2YFLA 4NBCD 1O7WA 3H1HE 2YIUC 3L71E 3CX5E 1PP9E 1BE3E 4H0LD 2DE6D 4NBGD 2HMMA 2IBZE 3CWBE 2E4QA 5HL4A 4PV1D 3BCCE 2DE7D 2I7FA 3L75E 5AEUA 4AAYB 1UUVA 3N0QA 1PPJE 4U3FE 1NDOA 3TGUE 4NB8D 4HKVA 3VCPA 1SQVE 2BMRA 4PD4E 1RFSA 5CXMA 2NVEA 1NTZE 3FOUA 4HM1A 2XSOA 4OGQD 1L0NE 1EZVE 2ZT9D 2YFJA 1RIEA 1SQPE 4HM6A 3L73E 1P84E 1NU1E 4HM7A 4QDFA 5AEWA 1Q90C 1UUWA 2B1XA 2GBXA 1FQTA 3L72E 2HMJA 4EMJB 2GBWA 4P1CH 4QUPA 2E74D 3VMID 3H1IE 3GKEA 3AZCA 2NWFA 1JM1A 2E75D 4NBHD 3C0DA 4QURA 2E76D 1NTME 2HMLA 3H1KE 5KKZC 3VMHD 1O7NA 3GOBA 2CKFA 1VM9A 2B24A 3H1LE 2JZAA 1G8KB 2A06E 1L0LE 1SJGA 1WQLA 1ZRTE 2FYUE 3EQQA 2NUMA 3VMGD 2YVJB 2HMNA 2QJKC 2QPZA 5BOKA 1ULIA 3VCAA 1NYKA 2XSHA 4H44D 1O7GA 2NVGA 2QJPC 1O7MA 3GL2A 4HM0A 2QJYC 1BCCE 3GTSA 4NBFD 2HMKA 1O7PA 3L70E 4NB9D 5KLIC 2DE5D 3EN1A 4HM8A 1O7HA 2BMOA 3GZXA 2ZYLA 3GZYA 4NBBD 2NUKA 3H1JE 4H13D 3GCEA 4HM5A 4QUQA 4QDCA 4NBED 4HJLA 4QDDA 4P1BH 1VF5D 1VCKA 4NBAD 1KB9E 4AIVA 3D89A 5KLVE 2NVFA 4HM4A 4QCKA 2JO6A 2XR8A 1KYOE 1SQXE 3DQYA 1G8JB 2BCCE 3L74E 2XRXA
chains in the Genus database with same CATH superfamily
2Q3WA 1ULJA 2D2CD 2E4PA 2BMQA 2YFIA 3GB4A 1SQBE 4HM3A 1EG9A 1SQQE 3GL0A 4QDFB 2FYNC 3CXHE 4HM2A 2HMOA 3GTEA 1NTKE 4NBDD 2YFLA 4NBCD 1O7WA 3H1HE 2YIUC 3L71E 3CX5E 1PP9E 1BE3E 4H0LD 2DE6D 4NBGD 2HMMA 2IBZE 3CWBE 2E4QA 5HL4A 4PV1D 3BCCE 2DE7D 2I7FA 3L75E 5AEUA 4AAYB 1UUVA 3N0QA 1PPJE 4U3FE 1NDOA 3TGUE 4NB8D 4HKVA 3VCPA 1SQVE 2BMRA 4PD4E 1RFSA 5CXMA 2NVEA 1NTZE 3FOUA 4HM1A 2XSOA 4OGQD 1L0NE 1EZVE 2ZT9D 2YFJA 1RIEA 1SQPE 4HM6A 3L73E 1P84E 1NU1E 4HM7A 4QDFA 5AEWA 1Q90C 1UUWA 2B1XA 2GBXA 1FQTA 3L72E 2HMJA 4EMJB 2GBWA 4P1CH 4QUPA 2E74D 3VMID 3H1IE 3GKEA 3AZCA 2NWFA 1JM1A 2E75D 4NBHD 3C0DA 4QURA 2E76D 1NTME 2HMLA 3H1KE 5KKZC 3VMHD 1O7NA 3GOBA 2CKFA 1VM9A 2B24A 3H1LE 2JZAA 1G8KB 2A06E 1L0LE 1SJGA 1WQLA 1ZRTE 2FYUE 3EQQA 2NUMA 3VMGD 2YVJB 2HMNA 2QJKC 2QPZA 5BOKA 1ULIA 3VCAA 1NYKA 2XSHA 4H44D 1O7GA 2NVGA 2QJPC 1O7MA 3GL2A 4HM0A 2QJYC 1BCCE 3GTSA 4NBFD 2HMKA 1O7PA 3L70E 4NB9D 5KLIC 2DE5D 3EN1A 4HM8A 1O7HA 2BMOA 3GZXA 2ZYLA 3GZYA 4NBBD 2NUKA 3H1JE 4H13D 3GCEA 4HM5A 4QUQA 4QDCA 4NBED 4HJLA 4QDDA 4P1BH 1VF5D 1VCKA 4NBAD 1KB9E 4AIVA 3D89A 5KLVE 2NVFA 4HM4A 4QCKA 2JO6A 2XR8A 1KYOE 1SQXE 3DQYA 1G8JB 2BCCE 3L74E 2XRXA
chains in the Genus database with same CATH topology
2Q3WA 1ULJA 2D2CD 2E4PA 2BMQA 2YFIA 3GB4A 1SQBE 4HM3A 1EG9A 1SQQE 3GL0A 4QDFB 2FYNC 3CXHE 4HM2A 2HMOA 3GTEA 1NTKE 4NBDD 2YFLA 4NBCD 1O7WA 3H1HE 2YIUC 3L71E 3CX5E 1PP9E 1BE3E 4H0LD 2DE6D 4NBGD 2HMMA 2IBZE 3CWBE 2E4QA 5HL4A 4PV1D 3BCCE 2DE7D 2I7FA 3L75E 5AEUA 4AAYB 1UUVA 3N0QA 1PPJE 4U3FE 1NDOA 3TGUE 4NB8D 4HKVA 3VCPA 1SQVE 2BMRA 4PD4E 1RFSA 5CXMA 2NVEA 1NTZE 3FOUA 4HM1A 2XSOA 4OGQD 1L0NE 1EZVE 2ZT9D 2YFJA 1RIEA 1SQPE 4HM6A 3L73E 1P84E 1NU1E 4HM7A 4QDFA 5AEWA 1Q90C 1UUWA 2B1XA 2GBXA 1FQTA 3L72E 2HMJA 4EMJB 2GBWA 4P1CH 4QUPA 2E74D 3VMID 3H1IE 3GKEA 3AZCA 2NWFA 1JM1A 2E75D 4NBHD 3C0DA 4QURA 2E76D 1NTME 2HMLA 3H1KE 5KKZC 3VMHD 1O7NA 3GOBA 2CKFA 1VM9A 2B24A 3H1LE 2JZAA 1G8KB 2A06E 1L0LE 1SJGA 1WQLA 1ZRTE 2FYUE 3EQQA 2NUMA 3VMGD 2YVJB 2HMNA 2QJKC 2QPZA 5BOKA 1ULIA 3VCAA 1NYKA 2XSHA 4H44D 1O7GA 2NVGA 2QJPC 1O7MA 3GL2A 4HM0A 2QJYC 1BCCE 3GTSA 4NBFD 2HMKA 1O7PA 3L70E 4NB9D 5KLIC 2DE5D 3EN1A 4HM8A 1O7HA 2BMOA 3GZXA 2ZYLA 3GZYA 4NBBD 2NUKA 3H1JE 4H13D 3GCEA 4HM5A 4QUQA 4QDCA 4NBED 4HJLA 4QDDA 4P1BH 1VF5D 1VCKA 4NBAD 1KB9E 4AIVA 3D89A 5KLVE 2NVFA 4HM4A 4QCKA 2JO6A 2XR8A 1KYOE 1SQXE 3DQYA 1G8JB 2BCCE 3L74E 2XRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3W A;  1ULJ A;  2D2C D;  2E4P A;  2BMQ A;  2YFI A;  3GB4 A;  1SQB E;  4HM3 A;  1EG9 A;  1SQQ E;  3GL0 A;  4QDF B;  2FYN C;  3CXH E;  4HM2 A;  2HMO A;  3GTE A;  1NTK E;  4NBD D;  2YFL A;  4NBC D;  1O7W A;  3H1H E;  2YIU C;  3L71 E;  3CX5 E;  1PP9 E;  1BE3 E;  4H0L D;  2DE6 D;  4NBG D;  2HMM A;  2IBZ E;  3CWB E;  2E4Q A;  5HL4 A;  4PV1 D;  3BCC E;  2DE7 D;  2I7F A;  3L75 E;  5AEU A;  4AAY B;  1UUV A;  3N0Q A;  1PPJ E;  4U3F E;  1NDO A;  3TGU E;  4NB8 D;  4HKV A;  3VCP A;  1SQV E;  2BMR A;  4PD4 E;  1RFS A;  5CXM A;  2NVE A;  1NTZ E;  3FOU A;  4HM1 A;  2XSO A;  4OGQ D;  1L0N E;  1EZV E;  2ZT9 D;  2YFJ A;  1RIE A;  1SQP E;  4HM6 A;  3L73 E;  1P84 E;  1NU1 E;  4HM7 A;  4QDF A;  5AEW A;  1Q90 C;  1UUW A;  2B1X A;  2GBX A;  1FQT A;  3L72 E;  2HMJ A;  4EMJ B;  2GBW A;  4P1C H;  4QUP A;  2E74 D;  3VMI D;  3H1I E;  3GKE A;  3AZC A;  2NWF A;  1JM1 A;  2E75 D;  4NBH D;  3C0D A;  4QUR A;  2E76 D;  1NTM E;  2HML A;  3H1K E;  5KKZ C;  3VMH D;  1O7N A;  3GOB A;  2CKF A;  1VM9 A;  2B24 A;  3H1L E;  2JZA A;  1G8K B;  2A06 E;  1L0L E;  1SJG A;  1WQL A;  1ZRT E;  2FYU E;  3EQQ A;  2NUM A;  3VMG D;  2YVJ B;  2HMN A;  2QJK C;  2QPZ A;  5BOK A;  1ULI A;  3VCA A;  1NYK A;  2XSH A;  4H44 D;  1O7G A;  2NVG A;  2QJP C;  1O7M A;  3GL2 A;  4HM0 A;  2QJY C;  1BCC E;  3GTS A;  4NBF D;  2HMK A;  1O7P A;  3L70 E;  4NB9 D;  5KLI C;  2DE5 D;  3EN1 A;  4HM8 A;  1O7H A;  2BMO A;  3GZX A;  2ZYL A;  3GZY A;  4NBB D;  2NUK A;  3H1J E;  4H13 D;  3GCE A;  4HM5 A;  4QUQ A;  4QDC A;  4NBE D;  4HJL A;  4QDD A;  4P1B H;  1VF5 D;  1VCK A;  4NBA D;  1KB9 E;  4AIV A;  3D89 A;  5KLV E;  2NVF A;  4HM4 A;  4QCK A;  2JO6 A;  2XR8 A;  1KYO E;  1SQX E;  3DQY A;  1G8J B;  2BCC E;  3L74 E;  2XRX A; 
#chains in the Genus database with same CATH topology
 2Q3W A;  1ULJ A;  2D2C D;  2E4P A;  2BMQ A;  2YFI A;  3GB4 A;  1SQB E;  4HM3 A;  1EG9 A;  1SQQ E;  3GL0 A;  4QDF B;  2FYN C;  3CXH E;  4HM2 A;  2HMO A;  3GTE A;  1NTK E;  4NBD D;  2YFL A;  4NBC D;  1O7W A;  3H1H E;  2YIU C;  3L71 E;  3CX5 E;  1PP9 E;  1BE3 E;  4H0L D;  2DE6 D;  4NBG D;  2HMM A;  2IBZ E;  3CWB E;  2E4Q A;  5HL4 A;  4PV1 D;  3BCC E;  2DE7 D;  2I7F A;  3L75 E;  5AEU A;  4AAY B;  1UUV A;  3N0Q A;  1PPJ E;  4U3F E;  1NDO A;  3TGU E;  4NB8 D;  4HKV A;  3VCP A;  1SQV E;  2BMR A;  4PD4 E;  1RFS A;  5CXM A;  2NVE A;  1NTZ E;  3FOU A;  4HM1 A;  2XSO A;  4OGQ D;  1L0N E;  1EZV E;  2ZT9 D;  2YFJ A;  1RIE A;  1SQP E;  4HM6 A;  3L73 E;  1P84 E;  1NU1 E;  4HM7 A;  4QDF A;  5AEW A;  1Q90 C;  1UUW A;  2B1X A;  2GBX A;  1FQT A;  3L72 E;  2HMJ A;  4EMJ B;  2GBW A;  4P1C H;  4QUP A;  2E74 D;  3VMI D;  3H1I E;  3GKE A;  3AZC A;  2NWF A;  1JM1 A;  2E75 D;  4NBH D;  3C0D A;  4QUR A;  2E76 D;  1NTM E;  2HML A;  3H1K E;  5KKZ C;  3VMH D;  1O7N A;  3GOB A;  2CKF A;  1VM9 A;  2B24 A;  3H1L E;  2JZA A;  1G8K B;  2A06 E;  1L0L E;  1SJG A;  1WQL A;  1ZRT E;  2FYU E;  3EQQ A;  2NUM A;  3VMG D;  2YVJ B;  2HMN A;  2QJK C;  2QPZ A;  5BOK A;  1ULI A;  3VCA A;  1NYK A;  2XSH A;  4H44 D;  1O7G A;  2NVG A;  2QJP C;  1O7M A;  3GL2 A;  4HM0 A;  2QJY C;  1BCC E;  3GTS A;  4NBF D;  2HMK A;  1O7P A;  3L70 E;  4NB9 D;  5KLI C;  2DE5 D;  3EN1 A;  4HM8 A;  1O7H A;  2BMO A;  3GZX A;  2ZYL A;  3GZY A;  4NBB D;  2NUK A;  3H1J E;  4H13 D;  3GCE A;  4HM5 A;  4QUQ A;  4QDC A;  4NBE D;  4HJL A;  4QDD A;  4P1B H;  1VF5 D;  1VCK A;  4NBA D;  1KB9 E;  4AIV A;  3D89 A;  5KLV E;  2NVF A;  4HM4 A;  4QCK A;  2JO6 A;  2XR8 A;  1KYO E;  1SQX E;  3DQY A;  1G8J B;  2BCC E;  3L74 E;  2XRX A; 
#chains in the Genus database with same CATH homology
 2Q3W A;  1ULJ A;  2D2C D;  2E4P A;  2BMQ A;  2YFI A;  3GB4 A;  1SQB E;  4HM3 A;  1EG9 A;  1SQQ E;  3GL0 A;  4QDF B;  2FYN C;  3CXH E;  4HM2 A;  2HMO A;  3GTE A;  1NTK E;  4NBD D;  2YFL A;  4NBC D;  1O7W A;  3H1H E;  2YIU C;  3L71 E;  3CX5 E;  1PP9 E;  1BE3 E;  4H0L D;  2DE6 D;  4NBG D;  2HMM A;  2IBZ E;  3CWB E;  2E4Q A;  5HL4 A;  4PV1 D;  3BCC E;  2DE7 D;  2I7F A;  3L75 E;  5AEU A;  4AAY B;  1UUV A;  3N0Q A;  1PPJ E;  4U3F E;  1NDO A;  3TGU E;  4NB8 D;  4HKV A;  3VCP A;  1SQV E;  2BMR A;  4PD4 E;  1RFS A;  5CXM A;  2NVE A;  1NTZ E;  3FOU A;  4HM1 A;  2XSO A;  4OGQ D;  1L0N E;  1EZV E;  2ZT9 D;  2YFJ A;  1RIE A;  1SQP E;  4HM6 A;  3L73 E;  1P84 E;  1NU1 E;  4HM7 A;  4QDF A;  5AEW A;  1Q90 C;  1UUW A;  2B1X A;  2GBX A;  1FQT A;  3L72 E;  2HMJ A;  4EMJ B;  2GBW A;  4P1C H;  4QUP A;  2E74 D;  3VMI D;  3H1I E;  3GKE A;  3AZC A;  2NWF A;  1JM1 A;  2E75 D;  4NBH D;  3C0D A;  4QUR A;  2E76 D;  1NTM E;  2HML A;  3H1K E;  5KKZ C;  3VMH D;  1O7N A;  3GOB A;  2CKF A;  1VM9 A;  2B24 A;  3H1L E;  2JZA A;  1G8K B;  2A06 E;  1L0L E;  1SJG A;  1WQL A;  1ZRT E;  2FYU E;  3EQQ A;  2NUM A;  3VMG D;  2YVJ B;  2HMN A;  2QJK C;  2QPZ A;  5BOK A;  1ULI A;  3VCA A;  1NYK A;  2XSH A;  4H44 D;  1O7G A;  2NVG A;  2QJP C;  1O7M A;  3GL2 A;  4HM0 A;  2QJY C;  1BCC E;  3GTS A;  4NBF D;  2HMK A;  1O7P A;  3L70 E;  4NB9 D;  5KLI C;  2DE5 D;  3EN1 A;  4HM8 A;  1O7H A;  2BMO A;  3GZX A;  2ZYL A;  3GZY A;  4NBB D;  2NUK A;  3H1J E;  4H13 D;  3GCE A;  4HM5 A;  4QUQ A;  4QDC A;  4NBE D;  4HJL A;  4QDD A;  4P1B H;  1VF5 D;  1VCK A;  4NBA D;  1KB9 E;  4AIV A;  3D89 A;  5KLV E;  2NVF A;  4HM4 A;  4QCK A;  2JO6 A;  2XR8 A;  1KYO E;  1SQX E;  3DQY A;  1G8J B;  2BCC E;  3L74 E;  2XRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...