1P84E

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1p84E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1p84E02
3L75E 1WQLA 1VCKA 3VMGD 2YFIA 2I7FA 4D6TE 4AAYB 1O7WA 4QUQA 4NB9D 4NBAD 5CXMA 3GTSA 3GKEA 3H1HE 1SQXE 2NUMA 1O7PA 4OGQD 2E4PA 1O7GA 3L73E 1KYOE 2HMOA 4NBCD 4QCKA 2B24A 2NUKA 4HM5A 2YVJB 3H1KE 2FYUE 2GBXA 5HL4A 2XRXA 3FOUA 1RFSA 4PD4E 5AEWA 2QJPC 3GOBA 2NVGA 1PPJE 4QDFB 5KLIC 1UUVA 4HKVA 3H1IE 2YFJA 3AZCA 3TGUE 1NTME 1JM1A 3CXHE 4NBHD 3L72E 4QUPA 1Q90C 3EQQA 2E76D 1SQQE 1L0NE 4EMJB 1O7MA 3N0QA 1NTKE 1KB9E 1NYKA 5KKZC 3BCCE 2HMNA 2FYNC 2HMJA 1O7HA 1BCCE 3VCAA 4HM4A 1EG9A 2B1XA 2HMKA 3GB4A 3C0DA 4HM1A 1G8JB 4HM2A 1BGYE 2DE5D 5AEUA 4NBFD 3H1JE 4NBBD 2DE7D 1NU1E 4QURA 2JO6A 1PP9E 3VCPA 1SJGA 2JZAA 4HM7A 3VMHD 1G8KB 2DE6D 2E74D 2YIUC 4H0LD 2NVEA 2CKFA 3GZYA 1SQVE 2BMOA 4NBDD 3CX5E 2QPZA 1SQBE 2A06E 4QDCA 5KLVE 4HJLA 4QDFA 2QJKC 1FQTA 4H13D 1RIEA 3GL2A 1L0LE 1VM9A 2XSHA 4NBGD 1O7NA 3L71E 2Q3WA 3GTEA 1UUWA 2IBZE 2HMLA 3D89A 4QDDA 1VF5D 3GZXA 2NWFA 5BOKA 2D2CD 2E75D 3CWBE 4HM6A 2XR8A 2ZYLA 1BE3E 3L70E 4NBED 2QJYC 4AIVA 3L74E 3GL0A 4U3FE 2GBWA 4HM3A 1NTZE 1ULJA 1EZVE 1ULIA 1ZRTE 2ZT9D 2YFLA 4NB8D 1SQPE 2NVFA 3GCEA 4H44D 3VMID 2E4QA 2XSOA 3H1LE 4P1BH 1P84E 2BCCE 3EN1A 2BMQA 1NDOA 4PV1D 2HMMA 3DQYA 4P1CH 4HM8A 4HM0A 2BMRA
chains in the Genus database with same CATH superfamily
1T2KD 1ZV8A 3B5ND 1VQKP 2BCCD 5BU5A 1ZLLA 1FDIA 3EFFK 1KYOE 4JF7A 1OW8A 5HL4A 1S5LX 3KXDA 1SQBJ 3CWBD 3TGUD 4N3YB 1NTME 3AE2C 2V7QJ 1ZP0C 3A0HE 3L72E 3OJAB 1N2DC 1GL2C 2FFDB 3L75J 4WB4A 1H0TA 1SFCA 2I1JA 2K37A 2JEEA 1ZRTD 1USEA 5AW2B 1QEXA 2WZ7A 5CJ0A 1K8AQ 1NHLA 5APYA 2DE6D 2ZXXA 1MFZA 2V7QH 1FZCB 1EZVG 3CX5E 2OYIA 3PHLA 2IYOA 2P7JA 2ZAEB 1KV4A 4XE5B 1KQSO 3T97A 2LXBA 3BRVB 1OVRA 2LR2A 2Q9IA 2CPSA 1FJKA 3MD0A 1ZRTE 2ZT9D 2P10A 1FE6A 2XDJA 2WWWA 3CCRP 4EIJA 3EN1A 3CWBG 4PV1D 1KYOH 2QIWA 3U1CA 1N73B 5GTHE 1LGHB 3G4SP 4NB9D 1JY2O 2A45G 4WBAA 1MZ9A 1U7MA 1X79B 1NTZD 4EI2A 3CX5I 1OFCX 3PRJA 2A45H 2N9YB 5KAFH 5H2FE 3VP8A 1G2CB 4C7NB 5TISH 3MTUE 1BCCE 4ASWA 2AXCA 1NAYA 3N4XA 3EFGA 2JO6A 2HG5D 3V2QA 4H0LD 1H88A 1LWUA 4NBDD 3VMZA 4IL6E 2A06E 1GW3A 1DIPA 3CC7P 3LW5J 2OARA 3VOPA 1LTGC 3WUTA 1OX3A 1VF5C 4RO0A 3W67A 1VQ8P 3L71G 4ZKUA 2DW3A 3L36A 1PGJA 1SQPE 2Z5HA 5K5GB 3Q5SA 3CC4P 1M57D 2KIKA 3VMID 4GODA 1L0ND 1PGQA 3TSIA 1J1DB 1M1JC 3R4YA 2Q6QA 2OYIB 3KZIE 5B5EE 3M06A 1AJYA 1NTZK 2VRSA 1TU3F 5AW1B 4TT3H 1L0NG 2ZT9B 3A0BE 1URQB 1Q2NA 1EDJA 3N7NA 1N86A 2N1TD 1L0LD 4GKGA 1IFMA 4WY4B 2FY8A 4D6TJ 1NTKE 1PZQA 1KB9E 2HMJA 1GU5A 1VPCA 1BCCD 1CI6B 3M9BA 4WY4A 1GK4A 3Q2YA 3GHGC 1NU1E 1LWUB 1PP9E 2IBZG 3C1LA 1RH5B 3AECC 1A02F 2KP8A 2QM7A 3H1LG 4HJLA 1LTJC 2GM4A 4D6TD 1DX7A 2N9BA 1PV3A 3D6ZA 3CD6P 1VQ4P 3CWBE 1NAFA 3S9OA 3L74E 1IK7A 5KAFE 2YFLA 3V6IA 2E4QA 2D2CB 3B5NB 2H7HA 3H1HJ 4HB1A 4XFJA 1S72P 2PP6A 2P67A 4P1CH 4AQRD 3GHGA 4UB8E 5CCGC 2AXTH 2AEFA 1BDDA 2MKVA 2I7FA 3HE4B 4H13C 1GZLA 4D6TG 3Q5RA 1L4AC 1RY3A 4JQ0D 1W5CE 2FBWC 1QLED 1JO5A 1PPJE 3L74D 4JPZB 1LTAC 4QUPA 3HE4A 1KILB 3FX0A 4L73A 4EMJB 3B5NA 3L72G 3V4WA 1DEBA 2D2CC 3KDPB 1O7HA 5CMZA 3BCCJ 1GD2E 5KLIB 3CCVP 5CCGD 2QE7H 1SLQA 2E5YA 3RK2D 3U1AA 3P8MC 1YYCA 3HD7C 3AEAC 1JMBA 2Q3EA 3GZYA 1SQQJ 3CL3D 4GDOA 1IJDB 3CI9A 1L4AD 2M8RA 1M56D 3U59A 1FZAA 2Q1KA 1O7NA 4HM6A 3MUDA 3VTPC 4NBED 1PGOA 2E75B 3PLNA 2OQQA 1VQMP 3PJSK 4Y99C 2Z4EA 4NB8D 1J1DC 1M1JB 3M0AA 1QVGO 2H43A 1ZR2A 3BCCG 1FOSE 2ZYGA 1VQOP 1BCCJ 3G71P 1BSNA 4GOFA 1KD1Q 2WT7B 1PFIA 3RK2B 2BEQD 1M1KQ 3KHUA 1VF5B 1YQ3C 1O7WA 3P8CE 2M0BA 2H88C 1VQPP 1RE3A 5H2FH 2NPSB 4TLFA 4C46A 3H1KE 3USSA 2FYUE 1EC5A 1SQVD 3SWYA 2O01N 3CX5H 2M5AB 3GOBA 2XU6A 1RF1A 2C0XA 1UIIA 1VQLP 5B5EH 1DD4A 2WITA 3HUSB 1OWAA 1SFCB 4XA4A 1H0TB 3BCCE 2HMNA 3HTKB 3AEFC 1G8JB 3CXHD 4BRYA 1S4XA 1N8RQ 3BVHA 1GK6A 4ZMDA 1LTJB 5KLVD 2HR3A 3C8VA 2BMOA 4PD4I 1HF9A 1L0NK 2QM8A 1S5LH 1U57A 1T3UA 2JKVA 1HGZA 3LIDA 5AVVB 2KXPB 2O01H 3L70G 3AE3C 5CBOA 2UWJE 2YO2A 3GL0A 3QH9A 2YKPA 4YPCA 4HKZH 1EDIA 5AVUB 1RF0C 4C7NA 1JY3N 2RKLA 3AE4C 2W90A 2BCCJ 3AE5C 1KMIZ 1GMJA 2GUSA 1WQLA 4RJTA 5AW9B 2KOGA 4AAYB 4PV1B 5L8RJ 1Q7YQ 4NBAD 1KILC 2HLOA 1O7GA 4KHXA 4QCKA 3VMYA 3VN0A 2KUBA 2XRXA 2ITAA 3VMAA 1LP1A 1VQ5P 2J58A 4PV1C 1K73Q 2Y9YA 2N1TB 2YKQA 3I55P 1GW4A 2JJLA 5BVZA 1NVOA 3MGNA 3GLMA 4H44C 1EG9A 4HM1A 1VQ9P 1MUUA 4HM2A 3RK3E 1NTKJ 3O6QA 5KAIE 2WSEJ 2K3RA 2BEZF 1YQ4C 4OVNF 4NPFX 2K9JB 1SJGA 4HM7A 4HH2A 4UB6H 3H1JG 2FYUJ 4K3AA 2YIUC 2V4HA 1NKZB 5GTIE 3PH0A 1KILE 4I7ZC 3WUVA 4NBGD 1YTZI 3GW6A 2IBZE 1QGKB 3HE5B 3FWLA 3RBZA 5AW7B 4C7RA 2IZ1A 3RK3D 1FBMA 2QJYC 1JMMA 1ZXGA 1KORA 4U3FE 2R5BA 1JTHB 4IOIH 4I2LC 1NTKG 3A2AA 4IL6H 4KJMA 2BMRA 3L75E 1RF0A 1LT1A 5APWA 1X9VA 3CPWO 4OH8B 1YIJP 1KB9H 2NRGA 3B71A 1AQTA 2B24A 1JY2P 1AV1A 3SFDC 1S5LE 1BDCA 3L37A 4EOTA 2XNXA 3TGUE 3SSUA 2FYUG 1KQLA 1OW6A 3SWKA 4NBHD 2W27A 5DJUB 5AW8B 2R5DA 2IBZI 1NH4A 1KTMA 2J5UA 2SPZA 3H1IG 3P32A 3S1KA 1BGYE 1W2BO 3TNUB 1KQGB 2Y0EA 1EQ7A 5DJTB 2QVAA 1HWTC 3L71J 2BCCG 4IFMA 2QPZA 1SQBE 1Q82Q 4Z1MH 1URQA 3L70J 2YKOA 3AEDC 3H1KD 1YJWP 1P84D 1BE3G 1KB9I 4WY4D 1R5LA 4EDFA 2O01J 1AVOA 3RL0B 3H25A 2QG4A 2KI7B 1T6AA 1NWQA 1P84E 5AW0B 4DJGA 1N73C 4HM8A 1Y9BA 1SQBD 3CWBJ 2JR8A 1G1JA 1MV8A 1S3JA 2B89A 2HPCA 2P1JA 1KILA 4JYBA 2N1TA 1O7PA 3P8CD 3K5BA 1NGMB 4WVZA 2NUKA 2GBXA 5KLIC 2O1JA 3V2PA 3LIEA 2K9JA 2KS1B 1KFNA 4R4LA 2G3AA 3H1KJ 3PTZA 1ZMEC 2KSEA 1AQ5A 1LT9A 1L0LG 4Y28J 2WTYA 2B87B 4W80A 3L71D 1IFJA 2NPSC 1FU1A 3AEBC 2FFDA 5GTHH 2H89C 1NU1J 3KQGA 3NTNA 2P2UA 3TNUA 3NMDA 1QX8A 5CHXA 1PP9D 2O3JA 1RQVA 1SS1A 1FS0E 4BXLA 2HFED 1IFNA 2HPCB 1WMKA 4N6JA 1M7LA 2CKFA 1X8YA 2Y0CA 2ZYAA 2YNYA 1SP4A 1KYOD 5APQA 2IBZD 1L0LE 1KFMA 2KS1A 2QJYB 2OGUA 1PPJD 3AE8C 1NJIQ 1XTCC 1SQBK 2FXMA 3TK1A 2L5GB 4RKUJ 1FC2C 3L74G 4I7ZB 4L75A 2E76C 1USDA 2JDIH 5AVYB 4QUQA 3ITKA 2GUVA 3WUUA 4OGQB 3V2NA 3Q5PA 4DOJA 3H1ID 2PFXA 1EDLA 3CXHI 1H8AA 3H1IJ 3L73E 1NTMD 3RBXA 4CPGA 2AXTE 1JCDA 3S4RA 1PP9G 1NU1G 2M5AA 1M8OB 2BASA 1JNMA 1L0NE 3CMEP 3KZIH 3CCJP 1L4AB 1N7SC 1HVVA 4IL6X 3MZWB 2OYHA 3L73D 1NKNA 3F89A 4PJ0H 2HMKA 3GB4A 3R2PA 5APUA 1KQFB 1MFTA 1S2EA 2R32A 4GIFA 2WSSH 1KB9D 5KLVJ 4ZKPA 3II6A 1HH0A 3IFMA 2M3BA 1HGVA 3D71A 4H13D 1QVFO 1BE3J 2K1AA 3ZDMA 1KN7A 2QJKB 5EFWB 2L91A 2XR8A 4H13B 1SQXJ 3RL0C 1XTGB 2A06G 4N78D 1X22A 1YJNP 2PRRA 2CPBA 4P1BH 1H89A 4H44B 1SQPG 1IC2A 1NOHA 2R3CA 5APVA 4HM0A 5KJ7D 1K05A 1VCKA 1NTMK 1AA0A 3G6EP 1BCCG 2E43A 2IZ0A 1GL2B 1LT9B 1R8EA 4AUWA 1X0TA 1LTBC 3E1IA 3FGAD 3HUSA 2E4PA 3L75G 3A0HH 1VQ6P 2KSJA 1IFDA 3B5NC 1IK9A 2A45I 2YXRB 3MIWA 1JB0J 5KAIH 3VP9A 5AEWA 1IZNB 1P84H 1UUVA 1LTTC 1LWUC 4U3FG 1RQUA 4M3LA 3AZCA 1EDKA 1IFPA 2PGDA 2NPSA 5GTIH 1NU1K 2YIUB 1KZUB 3O8ZA 1NYKA 3L72J 3VCAA 2WPQA 2I1KA 2Q7CA 2DE5D 3H1JE 4A7PA 3JCUH 4NBBD 1G2CA 5CCHA 1FZEA 5CCHC 4DCKA 1NTKK 1RHZB 3CC2P 1HTLC 3D6YA 3GMAA 2CK3H 3BATA 2OYHC 2WQYC 1N7LA 1FQTA 1NTMJ 4JYCA 5AVSB 3AE7C 2ZVNB 3GZXA 3W68A 2E75D 2POHA 1Y8AA 2Q3IA 4HM3A 1EZVE 3I5CA 1YJ9P 3CCUP 3C9IA 1L0LK 2BMQA 3NFQA 1CI6A 4QDFB 1SQQG 2FYUK 2R44A 2WMMA 5TJHA 3D89A 3HRNA 1JY3P 4ASVA 2O1KA 1W2EA 3GTSA 1URQC 2E74B 3A3YB 3P7KA 1Q81Q 4NBCD 3MHVA 1JEKA 1ZW0A 1PL5A 3RK3B 1MKMA 2WSCJ 2WSEH 3EQ2A 3RL0g 3FOUA 3IR9A 1ZOYC 3KYQA 5CJ4A 1JM1A 3WU2E 3BASA 1CW5A 4PD4H 2XZRA 3TDKA 3RGUA 2Q5UA 1YI2P 2B1XA 2W6JH 3JC22 1NTMG 1N7SA 1VDFA 4H0LB 5AEUA 1RF1C 1AFOA 2E75C 2J59M 1E5WA 1WT6A 3EWKA 1G8KB 2FXPA 1JM0A 3RL0D 3G3ZA 1SQXD 4MN4C 2QSIA 5KLVE 1YTZT 1OXZA 1GL2D 1SFCD 1T3JA 4YTPC 2Q3WA 2RH0A 1J2JB 5KJ7C 4PJ0E 1U7JA 1BE3E 5M1BA 4AIVA 1DEEG 1ULJA 3SFEC 1Y47A 2FYUD 3JSVC 4H44D 5KKZB 1EXJA 2BCCE 5KTBA 3H1KG 2Y9ZA 3H6PA 3A0BH 5B66E 3H32A 1DD3A 1J1EB 1P84I 2YFIA 5B66H 4KT0J 1BSHA 2HMOA 4HM5A 1EXIA 2WSFH 1JUNA 3H1JD 4YXDC 1RFSA 3V2RA 5E79H 4UB6E 2N1TC 1N7SD 3HE5A 4Y99B 4B86A 3HD7B 3OA7A 1FDOA 1Z56A 2WSCH 3BCCD 1O7MA 4HJGH 3GF3A 5KKZC 1N73A 1K04A 3FXEA 5KLVG 1AVYA 1EZVD 5CBNA 2WPSA 3L74J 2JP3A 4BWNA 3VMHD 1GU4A 2KYVA 3GG2A 4HYTB 3BRTB 1RE3C 3M0DC 3B4SA 3H1HG 2OYIC 1J1EC 3GL2A 5TISE 2OYHB 2OTKE 2ZFCA 5KJ7A 2NWFA 1L0LJ 1KILD 1SQVK 2B88A 4GT1A 2NVFA 1CSBA 2XSOA 2W83C 3CCLP 3H1HD 3HD7A 3SWFA 1HUCA 4LLHA 2IYPA 4LGDE 4EYYQ 2E42A 1GL2A 3GHGB 4D6TE 2QEXP 2QA4P 3T97B 5AVQB 1FJPA 1FAVA 2C9NY 3Q3DA 2YVJB 1N7SB 3KPEA 1JY2N 4U3FJ 2W6AA 4JBZA 2WT7A 1FZCA 4QMAA 2QJPC 1G1IA 4WY4C 4ZNCA 2KZJA 1LJ2A 3TYYA 1NTKD 1BE3D 1LTSC 2E76D 1L4AA 2XNDH 2G8YA 1FZGA 4YXWH 1OIPA 5APXA 1OVVA 2OTLP 1A02J 3C0DA 1R5SA 1VQ7P 2FYZA 1NO4A 3CCSP 1SQPJ 2KZIA 1SQPK 3VCPA 1E79H 1VL2A 2B9BA 3H1LJ 5APTA 4LC1A 4QDFA 3L4FA 2QJKC 1FZCC 2XSHA 4QDDA 1BGYJ 2ZVOB 2WPRA 1FDMA 3L70E 1JTHA 3IF4A 2W6BA 1LTJA 1ULIA 2ZYDA 3H1JJ 3V4QA 4PD4D 2XKMA 2HODB 2IPPA 1T2KC 1NDOA 1NTZG 1ZR4A 3D70A 2KK7A 1URQD 3IAOA 5KLVK 3TGUJ 3VMGD 1Q86Q 2IX7C 3GKEA 5C39A 1M90Q 1RE4A 2HODA 4NPEA 3CMAP 4PD4E 1RF1B 2NVGA 1BGYG 2IFNA 3AEGC 3H1IE 4GOEA 1SQVG 1PP9J 3CCEP 1Q90C 1JOCA 3EQQA 4R4MA 1NU1D 4OGQC 2MJZA 3V5BA 1SQXK 4N78E 4NPDA 3G9RA 3I56P 1BGYD 4IFFA 4HM4A 3M91A 3M0DA 4DZOA 1IFIA 1KYOI 3CX5D 1ZN5A 1L2PA 1YITP 2QJPB 1S9KD 2ZJSE 3M9HA 4QURA 1JCCA 2JWAA 2YMKA 1M1JA 1VQNP 2JO1A 2E74D 2W8ZA 3E7KA 3M9QA 2NVEA 3HUSC 2LXCB 1GDTA 4O9BA 3L75D 3L35A 2E5TA 1NTZJ 2KNCB 1RIEA 1VM9A 2NZ2A 3GTEA 3CXHH 5CCGA 2HMLA 5AVZB 5BOKA 5CCHD 2D2CD 2P58A 3L72D 2AEMA 2GBWA 3A7OA 4W7YA 5APSA 1NTZE 2IDBA 3WU2H 3GF7A 1DH3A 2C9LY 2K88A 3RK2C 5AW6B 2WPVB 3AE6C 3A5TA 3GCEA 5AW4B 3ABVC 4DT0A 1PIXA 3LW5H 3MP7B 1HJ0A 1RE4C 3L73G 4RESB 5CXMA 1SQXE 4OGQD 2Y0DA 3E1RA 3FWNA 2FYNB 2E74C 2NPSD 1LTIC 3CCQP 1SQQD 1S1CX 3HTKA 2KB7P 2YO3A 2XV5A 2ZXEB 1OZHA 4WWIA 2FXOA 2KLVA 4W7ZA 1PPJG 3MUDC 2HYNA 3L70D 1SQQE 5AVXB 1T8ZA 3IN6A 1WRGA 1CZQA 3H1LD 1YBKA 1PGPA 5BU8B 1GTWA 4NBFD 1L0NJ 3TF5A 2DE7D 2WSFJ 1QL1A 4L76A 2PAJA 5AVRB 1UIXA 4U7JA 2JZAA 1NYHA 2LKMA 1KC8Q 1FZFA 2OYOA 4UB8H 5AVWB 3B8EB 3O6QB 4L74A 4H0LC 1LNQA 1UUWA 2KLUA 1HJBA 3F5HA 3L73J 1OVUA 3VMXA 3QWOC 2ZT9C 3OW2O 1SQXG 1FZBA 2YMYA 4U3FD 3RK3C 3UIAA 4IFDK 3H1LE 2R3SA 2HMMA 1LP1B 5AW3B 4I1LA 3H32B 1IO4A 1SQQK 1SFCC 3H1HE 2FFDC 1FOSF 2NUMA 2C0WA 2AEJA 2RN0A 3CCMP 3FXDA 2YXQB 2KNCA 1LT9C 3CLQA 5AVTB 3JCUE 1OMIA 3HD7D 4HKVA 1SQVJ 1EZVI 3AE1C 2YFJA 3CXHE 1SQPD 1S9KE 1QL2A 3OAKA 3VYIA 1Q90D 2GA1A 1D7MA 3PP5A 3N0QA 3AE9C 1SVFA 3AEEC 2FYNC 1SQBG 1K9MQ 2I8DA 2H8PD 5AW5B 4OWFA 2FKWB 1SQVE 3NXSA 4QDCA 1OW7A 5E79E 3Q1MA 4K35A 4BRYB 1JY3O 2A06D 2IFMA 2RMZA 1YHQP 3L71E 2K9YA 4AYCA 1VF5D 2OTJP 1HBWA 2ZYLA 2JWDA 4I6MC 2Z5IA 2B87A 2M3EA 3TGUG 3WMM0 2QRXA 2WVRA 2E76B 3DQYA
chains in the Genus database with same CATH topology
3L75E 1WQLA 1VCKA 3VMGD 2YFIA 2I7FA 4D6TE 4AAYB 1O7WA 4QUQA 4NB9D 4NBAD 5CXMA 3GTSA 3GKEA 3H1HE 1SQXE 2NUMA 1O7PA 4OGQD 2E4PA 1O7GA 3L73E 1KYOE 2HMOA 4NBCD 4QCKA 2B24A 2NUKA 4HM5A 2YVJB 3H1KE 2FYUE 2GBXA 5HL4A 2XRXA 3FOUA 1RFSA 4PD4E 5AEWA 2QJPC 3GOBA 2NVGA 1PPJE 4QDFB 5KLIC 1UUVA 4HKVA 3H1IE 2YFJA 3AZCA 3TGUE 1NTME 1JM1A 3CXHE 4NBHD 3L72E 4QUPA 1Q90C 3EQQA 2E76D 1SQQE 1L0NE 4EMJB 1O7MA 3N0QA 1NTKE 1KB9E 1NYKA 5KKZC 3BCCE 2HMNA 2FYNC 2HMJA 1O7HA 1BCCE 3VCAA 4HM4A 1EG9A 2B1XA 2HMKA 3GB4A 3C0DA 4HM1A 1G8JB 4HM2A 1BGYE 2DE5D 5AEUA 4NBFD 3H1JE 4NBBD 2DE7D 1NU1E 4QURA 2JO6A 1PP9E 3VCPA 1SJGA 2JZAA 4HM7A 3VMHD 1G8KB 2DE6D 2E74D 2YIUC 4H0LD 2NVEA 2CKFA 3GZYA 1SQVE 2BMOA 4NBDD 3CX5E 2QPZA 1SQBE 2A06E 4QDCA 5KLVE 4HJLA 4QDFA 2QJKC 1FQTA 4H13D 1RIEA 3GL2A 1L0LE 1VM9A 2XSHA 4NBGD 1O7NA 3L71E 2Q3WA 3GTEA 1UUWA 2IBZE 2HMLA 3D89A 4QDDA 1VF5D 3GZXA 2NWFA 5BOKA 2D2CD 2E75D 3CWBE 4HM6A 2XR8A 2ZYLA 1BE3E 3L70E 4NBED 2QJYC 4AIVA 3L74E 3GL0A 4U3FE 2GBWA 4HM3A 1NTZE 1ULJA 1EZVE 1ULIA 1ZRTE 2ZT9D 2YFLA 4NB8D 1SQPE 2NVFA 3GCEA 4H44D 3VMID 2E4QA 2XSOA 3H1LE 4P1BH 1P84E 2BCCE 3EN1A 2BMQA 1NDOA 4PV1D 2HMMA 3DQYA 4P1CH 4HM8A 4HM0A 2BMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 E;  1WQL A;  1VCK A;  3VMG D;  2YFI A;  2I7F A;  4D6T E;  4AAY B;  1O7W A;  4QUQ A;  4NB9 D;  4NBA D;  5CXM A;  3GTS A;  3GKE A;  3H1H E;  1SQX E;  2NUM A;  1O7P A;  4OGQ D;  2E4P A;  1O7G A;  3L73 E;  1KYO E;  2HMO A;  4NBC D;  4QCK A;  2B24 A;  2NUK A;  4HM5 A;  2YVJ B;  3H1K E;  2FYU E;  2GBX A;  5HL4 A;  2XRX A;  3FOU A;  1RFS A;  4PD4 E;  5AEW A;  2QJP C;  3GOB A;  2NVG A;  1PPJ E;  4QDF B;  5KLI C;  1UUV A;  4HKV A;  3H1I E;  2YFJ A;  3AZC A;  3TGU E;  1NTM E;  1JM1 A;  3CXH E;  4NBH D;  3L72 E;  4QUP A;  1Q90 C;  3EQQ A;  2E76 D;  1SQQ E;  1L0N E;  4EMJ B;  1O7M A;  3N0Q A;  1NTK E;  1KB9 E;  1NYK A;  5KKZ C;  3BCC E;  2HMN A;  2FYN C;  2HMJ A;  1O7H A;  1BCC E;  3VCA A;  4HM4 A;  1EG9 A;  2B1X A;  2HMK A;  3GB4 A;  3C0D A;  4HM1 A;  1G8J B;  4HM2 A;  1BGY E;  2DE5 D;  5AEU A;  4NBF D;  3H1J E;  4NBB D;  2DE7 D;  1NU1 E;  4QUR A;  2JO6 A;  1PP9 E;  3VCP A;  1SJG A;  2JZA A;  4HM7 A;  3VMH D;  1G8K B;  2DE6 D;  2E74 D;  2YIU C;  4H0L D;  2NVE A;  2CKF A;  3GZY A;  1SQV E;  2BMO A;  4NBD D;  3CX5 E;  2QPZ A;  1SQB E;  2A06 E;  4QDC A;  5KLV E;  4HJL A;  4QDF A;  2QJK C;  1FQT A;  4H13 D;  1RIE A;  3GL2 A;  1L0L E;  1VM9 A;  2XSH A;  4NBG D;  1O7N A;  3L71 E;  2Q3W A;  3GTE A;  1UUW A;  2IBZ E;  2HML A;  3D89 A;  4QDD A;  1VF5 D;  3GZX A;  2NWF A;  5BOK A;  2D2C D;  2E75 D;  3CWB E;  4HM6 A;  2XR8 A;  2ZYL A;  1BE3 E;  3L70 E;  4NBE D;  2QJY C;  4AIV A;  3L74 E;  3GL0 A;  4U3F E;  2GBW A;  4HM3 A;  1NTZ E;  1ULJ A;  1EZV E;  1ULI A;  1ZRT E;  2ZT9 D;  2YFL A;  4NB8 D;  1SQP E;  2NVF A;  3GCE A;  4H44 D;  3VMI D;  2E4Q A;  2XSO A;  3H1L E;  4P1B H;  1P84 E;  2BCC E;  3EN1 A;  2BMQ A;  1NDO A;  4PV1 D;  2HMM A;  3DQY A;  4P1C H;  4HM8 A;  4HM0 A;  2BMR A; 
#chains in the Genus database with same CATH topology
 1T2K D;  1ZV8 A;  3B5N D;  1VQK P;  2BCC D;  5BU5 A;  1ZLL A;  1FDI A;  3EFF K;  1KYO E;  4JF7 A;  1OW8 A;  5HL4 A;  1S5L X;  3KXD A;  1SQB J;  3CWB D;  3TGU D;  4N3Y B;  1NTM E;  3AE2 C;  2V7Q J;  1ZP0 C;  3A0H E;  3L72 E;  3OJA B;  1N2D C;  1GL2 C;  2FFD B;  3L75 J;  4WB4 A;  1H0T A;  1SFC A;  2I1J A;  2K37 A;  2JEE A;  1ZRT D;  1USE A;  5AW2 B;  1QEX A;  2WZ7 A;  5CJ0 A;  1K8A Q;  1NHL A;  5APY A;  2DE6 D;  2ZXX A;  1MFZ A;  2V7Q H;  1FZC B;  1EZV G;  3CX5 E;  2OYI A;  3PHL A;  2IYO A;  2P7J A;  2ZAE B;  1KV4 A;  4XE5 B;  1KQS O;  3T97 A;  2LXB A;  3BRV B;  1OVR A;  2LR2 A;  2Q9I A;  2CPS A;  1FJK A;  3MD0 A;  1ZRT E;  2ZT9 D;  2P10 A;  1FE6 A;  2XDJ A;  2WWW A;  3CCR P;  4EIJ A;  3EN1 A;  3CWB G;  4PV1 D;  1KYO H;  2QIW A;  3U1C A;  1N73 B;  5GTH E;  1LGH B;  3G4S P;  4NB9 D;  1JY2 O;  2A45 G;  4WBA A;  1MZ9 A;  1U7M A;  1X79 B;  1NTZ D;  4EI2 A;  3CX5 I;  1OFC X;  3PRJ A;  2A45 H;  2N9Y B;  5KAF H;  5H2F E;  3VP8 A;  1G2C B;  4C7N B;  5TIS H;  3MTU E;  1BCC E;  4ASW A;  2AXC A;  1NAY A;  3N4X A;  3EFG A;  2JO6 A;  2HG5 D;  3V2Q A;  4H0L D;  1H88 A;  1LWU A;  4NBD D;  3VMZ A;  4IL6 E;  2A06 E;  1GW3 A;  1DIP A;  3CC7 P;  3LW5 J;  2OAR A;  3VOP A;  1LTG C;  3WUT A;  1OX3 A;  1VF5 C;  4RO0 A;  3W67 A;  1VQ8 P;  3L71 G;  4ZKU A;  2DW3 A;  3L36 A;  1PGJ A;  1SQP E;  2Z5H A;  5K5G B;  3Q5S A;  3CC4 P;  1M57 D;  2KIK A;  3VMI D;  4GOD A;  1L0N D;  1PGQ A;  3TSI A;  1J1D B;  1M1J C;  3R4Y A;  2Q6Q A;  2OYI B;  3KZI E;  5B5E E;  3M06 A;  1AJY A;  1NTZ K;  2VRS A;  1TU3 F;  5AW1 B;  4TT3 H;  1L0N G;  2ZT9 B;  3A0B E;  1URQ B;  1Q2N A;  1EDJ A;  3N7N A;  1N86 A;  2N1T D;  1L0L D;  4GKG A;  1IFM A;  4WY4 B;  2FY8 A;  4D6T J;  1NTK E;  1PZQ A;  1KB9 E;  2HMJ A;  1GU5 A;  1VPC A;  1BCC D;  1CI6 B;  3M9B A;  4WY4 A;  1GK4 A;  3Q2Y A;  3GHG C;  1NU1 E;  1LWU B;  1PP9 E;  2IBZ G;  3C1L A;  1RH5 B;  3AEC C;  1A02 F;  2KP8 A;  2QM7 A;  3H1L G;  4HJL A;  1LTJ C;  2GM4 A;  4D6T D;  1DX7 A;  2N9B A;  1PV3 A;  3D6Z A;  3CD6 P;  1VQ4 P;  3CWB E;  1NAF A;  3S9O A;  3L74 E;  1IK7 A;  5KAF E;  2YFL A;  3V6I A;  2E4Q A;  2D2C B;  3B5N B;  2H7H A;  3H1H J;  4HB1 A;  4XFJ A;  1S72 P;  2PP6 A;  2P67 A;  4P1C H;  4AQR D;  3GHG A;  4UB8 E;  5CCG C;  2AXT H;  2AEF A;  1BDD A;  2MKV A;  2I7F A;  3HE4 B;  4H13 C;  1GZL A;  4D6T G;  3Q5R A;  1L4A C;  1RY3 A;  4JQ0 D;  1W5C E;  2FBW C;  1QLE D;  1JO5 A;  1PPJ E;  3L74 D;  4JPZ B;  1LTA C;  4QUP A;  3HE4 A;  1KIL B;  3FX0 A;  4L73 A;  4EMJ B;  3B5N A;  3L72 G;  3V4W A;  1DEB A;  2D2C C;  3KDP B;  1O7H A;  5CMZ A;  3BCC J;  1GD2 E;  5KLI B;  3CCV P;  5CCG D;  2QE7 H;  1SLQ A;  2E5Y A;  3RK2 D;  3U1A A;  3P8M C;  1YYC A;  3HD7 C;  3AEA C;  1JMB A;  2Q3E A;  3GZY A;  1SQQ J;  3CL3 D;  4GDO A;  1IJD B;  3CI9 A;  1L4A D;  2M8R A;  1M56 D;  3U59 A;  1FZA A;  2Q1K A;  1O7N A;  4HM6 A;  3MUD A;  3VTP C;  4NBE D;  1PGO A;  2E75 B;  3PLN A;  2OQQ A;  1VQM P;  3PJS K;  4Y99 C;  2Z4E A;  4NB8 D;  1J1D C;  1M1J B;  3M0A A;  1QVG O;  2H43 A;  1ZR2 A;  3BCC G;  1FOS E;  2ZYG A;  1VQO P;  1BCC J;  3G71 P;  1BSN A;  4GOF A;  1KD1 Q;  2WT7 B;  1PFI A;  3RK2 B;  2BEQ D;  1M1K Q;  3KHU A;  1VF5 B;  1YQ3 C;  1O7W A;  3P8C E;  2M0B A;  2H88 C;  1VQP P;  1RE3 A;  5H2F H;  2NPS B;  4TLF A;  4C46 A;  3H1K E;  3USS A;  2FYU E;  1EC5 A;  1SQV D;  3SWY A;  2O01 N;  3CX5 H;  2M5A B;  3GOB A;  2XU6 A;  1RF1 A;  2C0X A;  1UII A;  1VQL P;  5B5E H;  1DD4 A;  2WIT A;  3HUS B;  1OWA A;  1SFC B;  4XA4 A;  1H0T B;  3BCC E;  2HMN A;  3HTK B;  3AEF C;  1G8J B;  3CXH D;  4BRY A;  1S4X A;  1N8R Q;  3BVH A;  1GK6 A;  4ZMD A;  1LTJ B;  5KLV D;  2HR3 A;  3C8V A;  2BMO A;  4PD4 I;  1HF9 A;  1L0N K;  2QM8 A;  1S5L H;  1U57 A;  1T3U A;  2JKV A;  1HGZ A;  3LID A;  5AVV B;  2KXP B;  2O01 H;  3L70 G;  3AE3 C;  5CBO A;  2UWJ E;  2YO2 A;  3GL0 A;  3QH9 A;  2YKP A;  4YPC A;  4HKZ H;  1EDI A;  5AVU B;  1RF0 C;  4C7N A;  1JY3 N;  2RKL A;  3AE4 C;  2W90 A;  2BCC J;  3AE5 C;  1KMI Z;  1GMJ A;  2GUS A;  1WQL A;  4RJT A;  5AW9 B;  2KOG A;  4AAY B;  4PV1 B;  5L8R J;  1Q7Y Q;  4NBA D;  1KIL C;  2HLO A;  1O7G A;  4KHX A;  4QCK A;  3VMY A;  3VN0 A;  2KUB A;  2XRX A;  2ITA A;  3VMA A;  1LP1 A;  1VQ5 P;  2J58 A;  4PV1 C;  1K73 Q;  2Y9Y A;  2N1T B;  2YKQ A;  3I55 P;  1GW4 A;  2JJL A;  5BVZ A;  1NVO A;  3MGN A;  3GLM A;  4H44 C;  1EG9 A;  4HM1 A;  1VQ9 P;  1MUU A;  4HM2 A;  3RK3 E;  1NTK J;  3O6Q A;  5KAI E;  2WSE J;  2K3R A;  2BEZ F;  1YQ4 C;  4OVN F;  4NPF X;  2K9J B;  1SJG A;  4HM7 A;  4HH2 A;  4UB6 H;  3H1J G;  2FYU J;  4K3A A;  2YIU C;  2V4H A;  1NKZ B;  5GTI E;  3PH0 A;  1KIL E;  4I7Z C;  3WUV A;  4NBG D;  1YTZ I;  3GW6 A;  2IBZ E;  1QGK B;  3HE5 B;  3FWL A;  3RBZ A;  5AW7 B;  4C7R A;  2IZ1 A;  3RK3 D;  1FBM A;  2QJY C;  1JMM A;  1ZXG A;  1KOR A;  4U3F E;  2R5B A;  1JTH B;  4IOI H;  4I2L C;  1NTK G;  3A2A A;  4IL6 H;  4KJM A;  2BMR A;  3L75 E;  1RF0 A;  1LT1 A;  5APW A;  1X9V A;  3CPW O;  4OH8 B;  1YIJ P;  1KB9 H;  2NRG A;  3B71 A;  1AQT A;  2B24 A;  1JY2 P;  1AV1 A;  3SFD C;  1S5L E;  1BDC A;  3L37 A;  4EOT A;  2XNX A;  3TGU E;  3SSU A;  2FYU G;  1KQL A;  1OW6 A;  3SWK A;  4NBH D;  2W27 A;  5DJU B;  5AW8 B;  2R5D A;  2IBZ I;  1NH4 A;  1KTM A;  2J5U A;  2SPZ A;  3H1I G;  3P32 A;  3S1K A;  1BGY E;  1W2B O;  3TNU B;  1KQG B;  2Y0E A;  1EQ7 A;  5DJT B;  2QVA A;  1HWT C;  3L71 J;  2BCC G;  4IFM A;  2QPZ A;  1SQB E;  1Q82 Q;  4Z1M H;  1URQ A;  3L70 J;  2YKO A;  3AED C;  3H1K D;  1YJW P;  1P84 D;  1BE3 G;  1KB9 I;  4WY4 D;  1R5L A;  4EDF A;  2O01 J;  1AVO A;  3RL0 B;  3H25 A;  2QG4 A;  2KI7 B;  1T6A A;  1NWQ A;  1P84 E;  5AW0 B;  4DJG A;  1N73 C;  4HM8 A;  1Y9B A;  1SQB D;  3CWB J;  2JR8 A;  1G1J A;  1MV8 A;  1S3J A;  2B89 A;  2HPC A;  2P1J A;  1KIL A;  4JYB A;  2N1T A;  1O7P A;  3P8C D;  3K5B A;  1NGM B;  4WVZ A;  2NUK A;  2GBX A;  5KLI C;  2O1J A;  3V2P A;  3LIE A;  2K9J A;  2KS1 B;  1KFN A;  4R4L A;  2G3A A;  3H1K J;  3PTZ A;  1ZME C;  2KSE A;  1AQ5 A;  1LT9 A;  1L0L G;  4Y28 J;  2WTY A;  2B87 B;  4W80 A;  3L71 D;  1IFJ A;  2NPS C;  1FU1 A;  3AEB C;  2FFD A;  5GTH H;  2H89 C;  1NU1 J;  3KQG A;  3NTN A;  2P2U A;  3TNU A;  3NMD A;  1QX8 A;  5CHX A;  1PP9 D;  2O3J A;  1RQV A;  1SS1 A;  1FS0 E;  4BXL A;  2HFE D;  1IFN A;  2HPC B;  1WMK A;  4N6J A;  1M7L A;  2CKF A;  1X8Y A;  2Y0C A;  2ZYA A;  2YNY A;  1SP4 A;  1KYO D;  5APQ A;  2IBZ D;  1L0L E;  1KFM A;  2KS1 A;  2QJY B;  2OGU A;  1PPJ D;  3AE8 C;  1NJI Q;  1XTC C;  1SQB K;  2FXM A;  3TK1 A;  2L5G B;  4RKU J;  1FC2 C;  3L74 G;  4I7Z B;  4L75 A;  2E76 C;  1USD A;  2JDI H;  5AVY B;  4QUQ A;  3ITK A;  2GUV A;  3WUU A;  4OGQ B;  3V2N A;  3Q5P A;  4DOJ A;  3H1I D;  2PFX A;  1EDL A;  3CXH I;  1H8A A;  3H1I J;  3L73 E;  1NTM D;  3RBX A;  4CPG A;  2AXT E;  1JCD A;  3S4R A;  1PP9 G;  1NU1 G;  2M5A A;  1M8O B;  2BAS A;  1JNM A;  1L0N E;  3CME P;  3KZI H;  3CCJ P;  1L4A B;  1N7S C;  1HVV A;  4IL6 X;  3MZW B;  2OYH A;  3L73 D;  1NKN A;  3F89 A;  4PJ0 H;  2HMK A;  3GB4 A;  3R2P A;  5APU A;  1KQF B;  1MFT A;  1S2E A;  2R32 A;  4GIF A;  2WSS H;  1KB9 D;  5KLV J;  4ZKP A;  3II6 A;  1HH0 A;  3IFM A;  2M3B A;  1HGV A;  3D71 A;  4H13 D;  1QVF O;  1BE3 J;  2K1A A;  3ZDM A;  1KN7 A;  2QJK B;  5EFW B;  2L91 A;  2XR8 A;  4H13 B;  1SQX J;  3RL0 C;  1XTG B;  2A06 G;  4N78 D;  1X22 A;  1YJN P;  2PRR A;  2CPB A;  4P1B H;  1H89 A;  4H44 B;  1SQP G;  1IC2 A;  1NOH A;  2R3C A;  5APV A;  4HM0 A;  5KJ7 D;  1K05 A;  1VCK A;  1NTM K;  1AA0 A;  3G6E P;  1BCC G;  2E43 A;  2IZ0 A;  1GL2 B;  1LT9 B;  1R8E A;  4AUW A;  1X0T A;  1LTB C;  3E1I A;  3FGA D;  3HUS A;  2E4P A;  3L75 G;  3A0H H;  1VQ6 P;  2KSJ A;  1IFD A;  3B5N C;  1IK9 A;  2A45 I;  2YXR B;  3MIW A;  1JB0 J;  5KAI H;  3VP9 A;  5AEW A;  1IZN B;  1P84 H;  1UUV A;  1LTT C;  1LWU C;  4U3F G;  1RQU A;  4M3L A;  3AZC A;  1EDK A;  1IFP A;  2PGD A;  2NPS A;  5GTI H;  1NU1 K;  2YIU B;  1KZU B;  3O8Z A;  1NYK A;  3L72 J;  3VCA A;  2WPQ A;  2I1K A;  2Q7C A;  2DE5 D;  3H1J E;  4A7P A;  3JCU H;  4NBB D;  1G2C A;  5CCH A;  1FZE A;  5CCH C;  4DCK A;  1NTK K;  1RHZ B;  3CC2 P;  1HTL C;  3D6Y A;  3GMA A;  2CK3 H;  3BAT A;  2OYH C;  2WQY C;  1N7L A;  1FQT A;  1NTM J;  4JYC A;  5AVS B;  3AE7 C;  2ZVN B;  3GZX A;  3W68 A;  2E75 D;  2POH A;  1Y8A A;  2Q3I A;  4HM3 A;  1EZV E;  3I5C A;  1YJ9 P;  3CCU P;  3C9I A;  1L0L K;  2BMQ A;  3NFQ A;  1CI6 A;  4QDF B;  1SQQ G;  2FYU K;  2R44 A;  2WMM A;  5TJH A;  3D89 A;  3HRN A;  1JY3 P;  4ASV A;  2O1K A;  1W2E A;  3GTS A;  1URQ C;  2E74 B;  3A3Y B;  3P7K A;  1Q81 Q;  4NBC D;  3MHV A;  1JEK A;  1ZW0 A;  1PL5 A;  3RK3 B;  1MKM A;  2WSC J;  2WSE H;  3EQ2 A;  3RL0 g;  3FOU A;  3IR9 A;  1ZOY C;  3KYQ A;  5CJ4 A;  1JM1 A;  3WU2 E;  3BAS A;  1CW5 A;  4PD4 H;  2XZR A;  3TDK A;  3RGU A;  2Q5U A;  1YI2 P;  2B1X A;  2W6J H;  3JC2 2;  1NTM G;  1N7S A;  1VDF A;  4H0L B;  5AEU A;  1RF1 C;  1AFO A;  2E75 C;  2J59 M;  1E5W A;  1WT6 A;  3EWK A;  1G8K B;  2FXP A;  1JM0 A;  3RL0 D;  3G3Z A;  1SQX D;  4MN4 C;  2QSI A;  5KLV E;  1YTZ T;  1OXZ A;  1GL2 D;  1SFC D;  1T3J A;  4YTP C;  2Q3W A;  2RH0 A;  1J2J B;  5KJ7 C;  4PJ0 E;  1U7J A;  1BE3 E;  5M1B A;  4AIV A;  1DEE G;  1ULJ A;  3SFE C;  1Y47 A;  2FYU D;  3JSV C;  4H44 D;  5KKZ B;  1EXJ A;  2BCC E;  5KTB A;  3H1K G;  2Y9Z A;  3H6P A;  3A0B H;  5B66 E;  3H32 A;  1DD3 A;  1J1E B;  1P84 I;  2YFI A;  5B66 H;  4KT0 J;  1BSH A;  2HMO A;  4HM5 A;  1EXI A;  2WSF H;  1JUN A;  3H1J D;  4YXD C;  1RFS A;  3V2R A;  5E79 H;  4UB6 E;  2N1T C;  1N7S D;  3HE5 A;  4Y99 B;  4B86 A;  3HD7 B;  3OA7 A;  1FDO A;  1Z56 A;  2WSC H;  3BCC D;  1O7M A;  4HJG H;  3GF3 A;  5KKZ C;  1N73 A;  1K04 A;  3FXE A;  5KLV G;  1AVY A;  1EZV D;  5CBN A;  2WPS A;  3L74 J;  2JP3 A;  4BWN A;  3VMH D;  1GU4 A;  2KYV A;  3GG2 A;  4HYT B;  3BRT B;  1RE3 C;  3M0D C;  3B4S A;  3H1H G;  2OYI C;  1J1E C;  3GL2 A;  5TIS E;  2OYH B;  2OTK E;  2ZFC A;  5KJ7 A;  2NWF A;  1L0L J;  1KIL D;  1SQV K;  2B88 A;  4GT1 A;  2NVF A;  1CSB A;  2XSO A;  2W83 C;  3CCL P;  3H1H D;  3HD7 A;  3SWF A;  1HUC A;  4LLH A;  2IYP A;  4LGD E;  4EYY Q;  2E42 A;  1GL2 A;  3GHG B;  4D6T E;  2QEX P;  2QA4 P;  3T97 B;  5AVQ B;  1FJP A;  1FAV A;  2C9N Y;  3Q3D A;  2YVJ B;  1N7S B;  3KPE A;  1JY2 N;  4U3F J;  2W6A A;  4JBZ A;  2WT7 A;  1FZC A;  4QMA A;  2QJP C;  1G1I A;  4WY4 C;  4ZNC A;  2KZJ A;  1LJ2 A;  3TYY A;  1NTK D;  1BE3 D;  1LTS C;  2E76 D;  1L4A A;  2XND H;  2G8Y A;  1FZG A;  4YXW H;  1OIP A;  5APX A;  1OVV A;  2OTL P;  1A02 J;  3C0D A;  1R5S A;  1VQ7 P;  2FYZ A;  1NO4 A;  3CCS P;  1SQP J;  2KZI A;  1SQP K;  3VCP A;  1E79 H;  1VL2 A;  2B9B A;  3H1L J;  5APT A;  4LC1 A;  4QDF A;  3L4F A;  2QJK C;  1FZC C;  2XSH A;  4QDD A;  1BGY J;  2ZVO B;  2WPR A;  1FDM A;  3L70 E;  1JTH A;  3IF4 A;  2W6B A;  1LTJ A;  1ULI A;  2ZYD A;  3H1J J;  3V4Q A;  4PD4 D;  2XKM A;  2HOD B;  2IPP A;  1T2K C;  1NDO A;  1NTZ G;  1ZR4 A;  3D70 A;  2KK7 A;  1URQ D;  3IAO A;  5KLV K;  3TGU J;  3VMG D;  1Q86 Q;  2IX7 C;  3GKE A;  5C39 A;  1M90 Q;  1RE4 A;  2HOD A;  4NPE A;  3CMA P;  4PD4 E;  1RF1 B;  2NVG A;  1BGY G;  2IFN A;  3AEG C;  3H1I E;  4GOE A;  1SQV G;  1PP9 J;  3CCE P;  1Q90 C;  1JOC A;  3EQQ A;  4R4M A;  1NU1 D;  4OGQ C;  2MJZ A;  3V5B A;  1SQX K;  4N78 E;  4NPD A;  3G9R A;  3I56 P;  1BGY D;  4IFF A;  4HM4 A;  3M91 A;  3M0D A;  4DZO A;  1IFI A;  1KYO I;  3CX5 D;  1ZN5 A;  1L2P A;  1YIT P;  2QJP B;  1S9K D;  2ZJS E;  3M9H A;  4QUR A;  1JCC A;  2JWA A;  2YMK A;  1M1J A;  1VQN P;  2JO1 A;  2E74 D;  2W8Z A;  3E7K A;  3M9Q A;  2NVE A;  3HUS C;  2LXC B;  1GDT A;  4O9B A;  3L75 D;  3L35 A;  2E5T A;  1NTZ J;  2KNC B;  1RIE A;  1VM9 A;  2NZ2 A;  3GTE A;  3CXH H;  5CCG A;  2HML A;  5AVZ B;  5BOK A;  5CCH D;  2D2C D;  2P58 A;  3L72 D;  2AEM A;  2GBW A;  3A7O A;  4W7Y A;  5APS A;  1NTZ E;  2IDB A;  3WU2 H;  3GF7 A;  1DH3 A;  2C9L Y;  2K88 A;  3RK2 C;  5AW6 B;  2WPV B;  3AE6 C;  3A5T A;  3GCE A;  5AW4 B;  3ABV C;  4DT0 A;  1PIX A;  3LW5 H;  3MP7 B;  1HJ0 A;  1RE4 C;  3L73 G;  4RES B;  5CXM A;  1SQX E;  4OGQ D;  2Y0D A;  3E1R A;  3FWN A;  2FYN B;  2E74 C;  2NPS D;  1LTI C;  3CCQ P;  1SQQ D;  1S1C X;  3HTK A;  2KB7 P;  2YO3 A;  2XV5 A;  2ZXE B;  1OZH A;  4WWI A;  2FXO A;  2KLV A;  4W7Z A;  1PPJ G;  3MUD C;  2HYN A;  3L70 D;  1SQQ E;  5AVX B;  1T8Z A;  3IN6 A;  1WRG A;  1CZQ A;  3H1L D;  1YBK A;  1PGP A;  5BU8 B;  1GTW A;  4NBF D;  1L0N J;  3TF5 A;  2DE7 D;  2WSF J;  1QL1 A;  4L76 A;  2PAJ A;  5AVR B;  1UIX A;  4U7J A;  2JZA A;  1NYH A;  2LKM A;  1KC8 Q;  1FZF A;  2OYO A;  4UB8 H;  5AVW B;  3B8E B;  3O6Q B;  4L74 A;  4H0L C;  1LNQ A;  1UUW A;  2KLU A;  1HJB A;  3F5H A;  3L73 J;  1OVU A;  3VMX A;  3QWO C;  2ZT9 C;  3OW2 O;  1SQX G;  1FZB A;  2YMY A;  4U3F D;  3RK3 C;  3UIA A;  4IFD K;  3H1L E;  2R3S A;  2HMM A;  1LP1 B;  5AW3 B;  4I1L A;  3H32 B;  1IO4 A;  1SQQ K;  1SFC C;  3H1H E;  2FFD C;  1FOS F;  2NUM A;  2C0W A;  2AEJ A;  2RN0 A;  3CCM P;  3FXD A;  2YXQ B;  2KNC A;  1LT9 C;  3CLQ A;  5AVT B;  3JCU E;  1OMI A;  3HD7 D;  4HKV A;  1SQV J;  1EZV I;  3AE1 C;  2YFJ A;  3CXH E;  1SQP D;  1S9K E;  1QL2 A;  3OAK A;  3VYI A;  1Q90 D;  2GA1 A;  1D7M A;  3PP5 A;  3N0Q A;  3AE9 C;  1SVF A;  3AEE C;  2FYN C;  1SQB G;  1K9M Q;  2I8D A;  2H8P D;  5AW5 B;  4OWF A;  2FKW B;  1SQV E;  3NXS A;  4QDC A;  1OW7 A;  5E79 E;  3Q1M A;  4K35 A;  4BRY B;  1JY3 O;  2A06 D;  2IFM A;  2RMZ A;  1YHQ P;  3L71 E;  2K9Y A;  4AYC A;  1VF5 D;  2OTJ P;  1HBW A;  2ZYL A;  2JWD A;  4I6M C;  2Z5I A;  2B87 A;  2M3E A;  3TGU G;  3WMM 0;  2QRX A;  2WVR A;  2E76 B;  3DQY A; 
#chains in the Genus database with same CATH homology
 3L75 E;  1WQL A;  1VCK A;  3VMG D;  2YFI A;  2I7F A;  4D6T E;  4AAY B;  1O7W A;  4QUQ A;  4NB9 D;  4NBA D;  5CXM A;  3GTS A;  3GKE A;  3H1H E;  1SQX E;  2NUM A;  1O7P A;  4OGQ D;  2E4P A;  1O7G A;  3L73 E;  1KYO E;  2HMO A;  4NBC D;  4QCK A;  2B24 A;  2NUK A;  4HM5 A;  2YVJ B;  3H1K E;  2FYU E;  2GBX A;  5HL4 A;  2XRX A;  3FOU A;  1RFS A;  4PD4 E;  5AEW A;  2QJP C;  3GOB A;  2NVG A;  1PPJ E;  4QDF B;  5KLI C;  1UUV A;  4HKV A;  3H1I E;  2YFJ A;  3AZC A;  3TGU E;  1NTM E;  1JM1 A;  3CXH E;  4NBH D;  3L72 E;  4QUP A;  1Q90 C;  3EQQ A;  2E76 D;  1SQQ E;  1L0N E;  4EMJ B;  1O7M A;  3N0Q A;  1NTK E;  1KB9 E;  1NYK A;  5KKZ C;  3BCC E;  2HMN A;  2FYN C;  2HMJ A;  1O7H A;  1BCC E;  3VCA A;  4HM4 A;  1EG9 A;  2B1X A;  2HMK A;  3GB4 A;  3C0D A;  4HM1 A;  1G8J B;  4HM2 A;  1BGY E;  2DE5 D;  5AEU A;  4NBF D;  3H1J E;  4NBB D;  2DE7 D;  1NU1 E;  4QUR A;  2JO6 A;  1PP9 E;  3VCP A;  1SJG A;  2JZA A;  4HM7 A;  3VMH D;  1G8K B;  2DE6 D;  2E74 D;  2YIU C;  4H0L D;  2NVE A;  2CKF A;  3GZY A;  1SQV E;  2BMO A;  4NBD D;  3CX5 E;  2QPZ A;  1SQB E;  2A06 E;  4QDC A;  5KLV E;  4HJL A;  4QDF A;  2QJK C;  1FQT A;  4H13 D;  1RIE A;  3GL2 A;  1L0L E;  1VM9 A;  2XSH A;  4NBG D;  1O7N A;  3L71 E;  2Q3W A;  3GTE A;  1UUW A;  2IBZ E;  2HML A;  3D89 A;  4QDD A;  1VF5 D;  3GZX A;  2NWF A;  5BOK A;  2D2C D;  2E75 D;  3CWB E;  4HM6 A;  2XR8 A;  2ZYL A;  1BE3 E;  3L70 E;  4NBE D;  2QJY C;  4AIV A;  3L74 E;  3GL0 A;  4U3F E;  2GBW A;  4HM3 A;  1NTZ E;  1ULJ A;  1EZV E;  1ULI A;  1ZRT E;  2ZT9 D;  2YFL A;  4NB8 D;  1SQP E;  2NVF A;  3GCE A;  4H44 D;  3VMI D;  2E4Q A;  2XSO A;  3H1L E;  4P1B H;  1P84 E;  2BCC E;  3EN1 A;  2BMQ A;  1NDO A;  4PV1 D;  2HMM A;  3DQY A;  4P1C H;  4HM8 A;  4HM0 A;  2BMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...