1P84E

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1p84E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1p84E02
2BCCE 2HMLA 1SQXE 4H13D 4NBAD 2NUMA 2BMQA 2NVFA 1NU1E 2ZYLA 2NVGA 1G8KB 1O7HA 5BOKA 3H1KE 1VM9A 4HM0A 1O7PA 4NB8D 1NTKE 2E75D 3VMID 3L71E 2I7FA 1ULJA 1SQBE 2XRXA 3H1JE 2YFIA 3GCEA 1ZRTE 4PV1D 3EQQA 3N0QA 3DQYA 1NYKA 2FYUE 3CXHE 4HM1A 2DE5D 1Q90C 3GKEA 2XSOA 1PP9E 1JM1A 1EG9A 4QUQA 2BMRA 5AEUA 2ZT9D 4NBCD 1BGYE 1O7WA 4NBED 4OGQD 3GZXA 1BCCE 1L0NE 4HM5A 4HJLA 3BCCE 4HM6A 1RIEA 2HMJA 4P1BH 3L75E 2HMOA 2JO6A 3GTEA 3GZYA 1G8JB 4NB9D 1UUWA 1P84E 1SJGA 2E4PA 2QJPC 3L72E 4NBGD 3CX5E 1VF5D 2IBZE 2YIUC 3VCAA 2QJKC 4H44D 3VCPA 4P1CH 3D89A 3GL0A 2CKFA 1EZVE 2YFLA 4NBFD 1VCKA 1PPJE 2QJYC 3EN1A 1KYOE 4EMJB 3GOBA 2E74D 4QCKA 4AAYB 4HM7A 4QDDA 1SQVE 3H1LE 3AZCA 2E76D 1O7GA 3L74E 2FYNC 2NVEA 1ULIA 3L70E 1O7MA 4HKVA 2DE6D 4NBHD 2B24A 1O7NA 5CXMA 5HL4A 2B1XA 1RFSA 4AIVA 1SQPE 1WQLA 3GB4A 2HMMA 2XR8A 2YVJB 3GTSA 4QDCA 1NDOA 1L0LE 4NBBD 4HM3A 2D2CD 2JZAA 3L73E 5KKZC 3VMHD 4HM2A 1BE3E 3TGUE 2YFJA 3CWBE 2E4QA 4QUPA 4HM8A 2HMNA 5KLVE 4QDFB 2Q3WA 4U3FE 2NUKA 1UUVA 2BMOA 2A06E 4PD4E 3VMGD 4D6TE 4H0LD 2QPZA 1KB9E 2GBWA 2XSHA 3GL2A 3FOUA 1NTME 5AEWA 1FQTA 1SQQE 3H1HE 3C0DA 4QURA 2HMKA 2GBXA 1NTZE 4QDFA 3H1IE 2DE7D 4NBDD 4HM4A 2NWFA 5KLIC
chains in the Genus database with same CATH superfamily
1MUUA 4WY4D 1ZR2A 1J1EB 4DJGA 1XTCC 2MKVA 5AW9B 3CLQA 3GF3A 1FJPA 4WWIA 1T6AA 3VMID 3H1ID 4HB1A 1QL1A 2I1KA 1EXJA 2Z5HA 1CW5A 1H0TA 2LXCB 3L75J 3AE4C 2YXQB 3CI9A 5KTBA 3AE5C 3GZXA 1JM0A 1FBMA 2R44A 1L0LJ 3L75E 1HGVA 1OZHA 2HMOA 2MJZA 3O8ZA 3CX5E 2QJKC 1BGYD 2WSEH 1LP1A 1S5LE 2OARA 2LR2A 1OW8A 5H2FE 1LTTC 4QCKA 2ZXEB 2FYUG 1SFCA 1EZVD 1LT9C 3RK3D 5CXMA 3TF5A 1JY3P 1JEKA 1QX8A 1VQKP 1KD1Q 1KB9D 2E4QA 3L37A 3H1JJ 2J59M 2OTLP 2YO2A 2BMOA 4H0LD 2QJKB 5AEWA 4XE5B 2KB7P 2O01N 3B5ND 2NWFA 2L5GB 2PGDA 2QRXA 2JDIH 4IFMA 1IFMA 1YHQP 3QWOC 2ZVOB 4N6JA 1L0LK 1NTKE 1BSHA 2I7FA 3FWNA 1PV3A 3HUSC 3MUDC 4XA4A 2E42A 3VN0A 1NYKA 1S2EA 1GD2E 1JY3N 1JM1A 4OH8B 3E1IA 5CCHD 4R4LA 2FYNB 1NJIQ 2E5YA 3LW5H 3CX5I 4IL6X 2H7HA 3R2PA 1SJGA 3M9HA 4NBGD 4GOEA 3KXDA 2YIUC 5AVWB 1SQBG 4N78E 1P84D 1UIXA 4IFDK 1IFJA 2O1KA 2PRRA 4PJ0H 3L73D 4OVNF 3TGUJ 4KJMA 3L70G 1PGOA 3MGNA 2JZAA 5GTHE 2HR3A 3TGUE 3H32B 2NPSD 2LXBA 3P7KA 1NTMJ 3N7NA 4CPGA 5EFWB 1NAYA 1IFIA 1GU5A 1KYOH 2YIUB 1NTME 3I5CA 1L0NJ 1K9MQ 5AW6B 1SFCC 2K9JA 3AE7C 3V2PA 1AV1A 4WVZA 1PIXA 5TISE 1FDOA 1A02J 1DD4A 3Q1MA 1EDIA 1GDTA 2E75C 2XRXA 3EFFK 3JC22 4PV1C 3MZWB 2J5UA 1LNQA 1Q86Q 3BCCJ 5AEUA 5L8RJ 3CX5D 4NPDA 3BCCE 1OMIA 1PP9G 2QJPC 1AVOA 4LC1A 4C7NA 3G3ZA 1G2CA 3M9QA 4NBFD 5KJ7A 4O9BA 2C0WA 4EOTA 3EN1A 4Y99B 4Y28J 2KIKA 4NPEA 1KC8Q 1BSNA 2OYHB 3G9RA 2FFDB 1L0NK 3V5BA 2WPRA 1X0TA 2N1TC 1DX7A 3AEEC 1JCCA 2M3BA 4UB6E 2D2CC 1JY2P 1QLED 2WPVB 2P58A 3KDPB 1S4XA 4PD4E 4DT0A 1KTMA 3GL2A 4EI2A 1KV4A 3KPEA 2QA4P 3VMAA 1NTKD 1HWTC 1M1JB 2W6BA 1MFTA 2OYIA 1KORA 1FE6A 1YBKA 4HKZH 4JQ0D 2YKOA 1NTZD 3CCEP 4MN4C 4I7ZC 5B5EE 3KYQA 3CL3D 2D2CB 3KZIH 2FYUE 2ZAEB 2KYVA 2XSOA 3D6YA 3L71D 4EYYQ 5K5GB 1SQQK 1BDCA 1VQ6P 1JY2N 4AYCA 2AXTH 3W67A 3GZYA 3OJAB 2Q6QA 1L2PA 2K3RA 2XV5A 4N78D 3H1KG 1QVFO 4W7YA 1LJ2A 2XZRA 2PP6A 3V2NA 4N3YB 1UIIA 2WSFJ 1GZLA 1NO4A 5CJ4A 3BRVB 1JOCA 1ZW0A 4BXLA 4HKVA 1LWUB 3E1RA 3TGUD 5HL4A 4XFJA 2B1XA 4JYBA 1X79B 2QSIA 3L35A 3GTSA 3AE9C 2FXMA 4C7RA 3MIWA 2AEJA 4PD4I 1JY3O 1ZLLA 1N73B 3CXHH 1FAVA 2K9JB 5KJ7C 3P8MC 3H1HE 3JCUH 2M8RA 1K8AQ 4U3FD 1SFCD 2KLUA 2KNCA 3HE4B 2ZYLA 1SQBJ 2QM8A 2Y9ZA 1SQXK 1N7SA 2E75D 3OW2O 2AEFA 1SQBE 4H0LC 4PV1D 1NVOA 2KS1A 1RF1A 2GA1A 5KLVK 4IL6H 4ASWA 1Q81Q 1Q90C 1L4AA 1NGMB 3L70J 3VP9A 1SVFA 1IJDB 5B66E 3P32A 2YNYA 3SFEC 2HMJA 3USSA 3NMDA 3GMAA 3G6EP 2W83C 1VF5C 3M0DA 3VCAA 2YKQA 3VCPA 3D89A 2OYIC 3F89A 1SP4A 1PGPA 2KOGA 2C0XA 3M0AA 2E74C 3MHVA 1MFZA 4EIJA 2I8DA 2P67A 4H0LB 1KILA 2ZFCA 1M1KQ 4R4MA 3L74G 2N1TD 3GB4A 3E7KA 2YXRB 1AFOA 2WSEJ 3B5NB 2D2CD 4W7ZA 3VMHD 4PD4D 3RK2C 1OVRA 2ZJSE 4YXDC 4HH2A 1SQPD 2Q3WA 1IK7A 1PPJG 2FY8A 1VF5B 1PP9J 1AVYA 3H1LG 3GG2A 3VMYA 4TT3H 2OYIB 3CWBD 1W5CE 2KSJA 3PLNA 2BCCE 1KQLA 1K73Q 5KAFH 2ZYAA 4NBAD 1R5SA 1FS0E 3CCVP 2KUBA 5APWA 3SFDC 3RBXA 2KZJA 1VM9A 1JMMA 2FYUD 3S4RA 3Q5PA 3CCJP 1N86A 2N9BA 5AW7B 3SSUA 2JWDA 2E43A 3DQYA 2DE5D 2QG4A 2XU6A 1KB9H 1SQQG 4OGQC 1CSBA 5AW4B 4HM6A 1YJNP 1IFPA 1G8JB 3RL0C 1MKMA 3CC7P 1LTGC 3AEFC 2E4PA 2WMMA 1RH5B 1E5WA 3SWFA 3NFQA 4H44C 1EC5A 1N7SC 2NPSB 2I1JA 5BVZA 3BRTB 1RF1C 2FKWB 3LW5J 1L4AC 1LGHB 1NU1J 1WQLA 4QDCA 1VQOP 1NDOA 1L0LE 3L72G 3S9OA 2YFJA 2IBZG 2JO1A 4OGQB 1VQ7P 1OW6A 4IOIH 3M0DC 2NZ2A 3H1HD 1JY2O 1UUVA 3WU2H 4IFFA 5KJ7D 3UIAA 1KMIZ 1KQSO 4UB8H 2W90A 4HYTB 4QURA 2R5DA 2HMKA 4NPFX 3H1KJ 1M7LA 2A06D 2NVFA 1KILC 1P84H 1X8YA 2NVGA 1GL2A 3WMM0 3H1KE 1FZBA 1SQXG 1M90Q 3L4FA 1KILE 3H1JE 1H8AA 3U1AA 1HJBA 5KLVG 3HE5B 1Q90D 2HODA 5APSA 1EG9A 4HM5A 2SPZA 3H1IG 3GTEA 4JF7A 2KLVA 1LT9B 5AVTB 1NU1K 1J2JB 1VF5D 1FDMA 1U7JA 4AQRD 3TNUA 4ZKPA 1BCCD 2CKFA 1ZMEC 1VCKA 2E74D 1SS1A 2N1TA 2BASA 1GTWA 1YTZI 2FXPA 1EXIA 2G8YA 2O1JA 1Y8AA 3MD0A 2ZYGA 1PFIA 1BGYG 3PTZA 5APXA 2M0BA 1EDKA 1SQVD 1S3JA 5GTIE 2HPCA 3VMZA 1VQMP 1QVGO 4KT0J 3RK2D 2V7QH 1R5LA 1VQLP 3CX5H 5AW1B 4HM8A 2QIWA 4L76A 1YJ9P 1EZVG 3HTKA 2BCCD 4ZMDA 2GBWA 3HUSB 2XSHA 1BE3D 2HG5D 2C9NY 3IR9A 1PZQA 2A45I 2OTKE 1K04A 2W6JH 2Y9YA 1GW3A 4L75A 4H13C 4D6TD 1NOHA 3AE8C 2H89C 5BU8B 3CCMP 3FXEA 1RHZB 5APVA 3CD6P 3A0HH 2P7JA 1ZRTE 5KAIE 1CZQA 1JTHA 2IZ1A 2WPSA 1YIJP 1NTKK 4YXWH 3L74J 2H43A 1QL2A 2BMRA 2YO3A 2ZT9C 5AW8B 2IYPA 1Y9BA 4OGQD 1L0NE 1NTZK 4HJLA 1H0TB 2H88C 3RL0D 2Q3IA 3D71A 1GU4A 1OW7A 1A02F 4H44D 1W2BO 3H1LJ 1R8EA 1GL2C 3R4YA 1N7SD 3WUVA 4H13B 1PPJE 3L75D 3H25A 4AAYB 3V2QA 3FXDA 1S1CX 2Z5IA 3H1LE 1LP1B 2E76C 1L0LD 1S9KE 4HJGH 1O7MA 1L4AD 3HD7A 1HUCA 1VQNP 2W8ZA 3C8VA 5DJUB 3V2RA 1KFNA 3V6IA 1SFCB 2G3AA 1N2DC 1QEXA 1N7LA 1YI2P 3L73G 1VDFA 1SQQJ 3TDKA 2E75B 2FXOA 1U57A 1DEEG 1T2KC 4PV1B 1EQ7A 1VQ5P 3CPWO 1PGQA 1SQQE 2HFED 3B4SA 2GBXA 3AEGC 1CI6A 5APYA 1KILD 3H1JD 1ZN5A 3PHLA 1SLQA 3VTPC 4RO0A 1U7MA 1O7PA 2QJPB 2YFIA 3VOPA 3NTNA 2M5AA 2BEZF 4GIFA 1M56D 4K35A 3OA7A 3U1CA 3CXHE 1T3UA 4RESB 4L74A 4NBCD 1HGZA 3L72J 5AVRB 3JCUE 3PRJA 3PP5A 2DW3A 2P10A 2O01H 2L91A 1NU1G 3L72E 2IBZE 1DH3A 2N1TB 5TISH 4JBZA 3U59A 2GM4A 1T8ZA 2K9YA 4QDDA 3C1LA 2IPPA 1JO5A 1Q82Q 1H89A 2YMKA 2VRSA 4GDOA 3TK1A 3G71P 1SQXJ 3CMEP 2GUSA 4AIVA 2HMMA 3HTKB 5KLVJ 3AEDC 2W6AA 4I2LC 2AEMA 5KLVE 5APTA 3CCRP 3V4QA 3S1KA 3H1IJ 5DJTB 4I7ZB 2E5TA 3TYYA 2IX7C 3C0DA 2K88A 3IAOA 3H1IE 5AW2B 1WT6A 1IO4A 2DE7D 4HM4A 2HLOA 1AA0A 4H13D 2NUMA 1YQ4C 1HJ0A 1SQPK 3HD7C 3A2AA 5AW5B 1JTHB 3L36A 1NTMD 3ITKA 2OTJP 3SWYA 1FZCA 2R32A 2FYZA 1OX3A 2Q1KA 4UB6H 2H8PD 2CPSA 1FU1A 1NKNA 3CXHI 2JWAA 3ABVC 1BGYJ 1L0ND 1NTKG 1DD3A 2Z4EA 1HVVA 2HYNA 4PD4H 1NAFA 1JNMA 1S5LX 2ZT9D 2BEQD 1YITP 1BGYE 3W68A 1NTZG 1K05A 1RIEA 2IBZI 5CMZA 1FJKA 1PPJD 2KSEA 2QM7A 3GLMA 3CCUP 2ZVNB 5BU5A 1GL2D 1USEA 1EZVE 3L71G 2R3CA 2WTYA 1HH0A 3BCCD 3RK3E 4EMJB 3Q5SA 4C7NB 3PH0A 3AE3C 2E76D 3CMAP 1ULIA 1WMKA 1G2CB 3L70E 1J1DC 1EDJA 1N8RQ 4BRYA 4DZOA 1Q2NA 4HM3A 2IFMA 1VQ4P 2AXCA 2M3EA 1T2KD 3FOUA 3A0BH 3BASA 1RQVA 2LKMA 2WSCH 5AVZB 1MZ9A 3TSIA 1FC2C 1DIPA 1URQA 1D7MA 1G1IA 1QGKB 2ITAA 3IFMA 1LT1A 2FBWC 4U3FG 1LTIC 3C9IA 1PP9E 4AUWA 2E74B 4UB8E 1HF9A 1PGJA 3LIDA 4NB9D 4I6MC 3L73J 1P84E 4W80A 1EZVI 3GL0A 1ZR4A 1FZCC 3RK2B 5TJHA 4GKGA 5E79H 3EWKA 3KHUA 1RY3A 3RL0g 2ZYDA 5AVYB 3T97A 2B88A 3WUUA 1FOSF 5B66H 4EDFA 4HM2A 1KQFB 1RE3A 1IZNB 1G1JA 1KN7A 1MV8A 1RQUA 1SQVK 3KQGA 3RBZA 3BATA 3A5TA 1FZCB 4ZNCA 1S72P 5KLIC 2ZXXA 3HD7D 1SQPG 1NU1E 2V7QJ 3M06A 3RL0B 3VYIA 4RJTA 1VQPP 1ULJA 2XDJA 3CWBG 2KNCB 1Y47A 4H44B 3K5BA 4PJ0E 1N7SB 2GUVA 1SQBD 3FGAD 1LTSC 2KS1B 1RF1B 3GF7A 1P84I 2R5BA 5C39A 2C9LY 3F5HA 1LTAC 1UUWA 1L4AB 2Q3EA 3EQ2A 5CCGA 3Q5RA 2Y0DA 3NXSA 5KLIB 3A0HE 2OYHA 1URQC 3L70D 1TU3F 4BRYB 1KYOE 2FFDA 1ZP0C 3VMXA 4HM7A 3AZCA 2KI7B 4BWNA 2FYNC 5CBOA 5CBNA 2WITA 3RGUA 2XR8A 3FWLA 5KKZC 3Q2YA 1NTKJ 1KILB 3B71A 3A7OA 1NTZJ 1M1JA 1T3JA 4WB4A 3N4XA 2Q9IA 1OWAA 1URQB 2OQQA 1NTZE 1VQ9P 5AVXB 2BMQA 1GMJA 3L71J 3H1HG 1NYHA 2B89A 1Z56A 1NHLA 2XKMA 3GHGA 1S5LH 2Q7CA 3L71E 1NH4A 5H2FH 4WBAA 1PP9D 1YTZT 3GCEA 1X9VA 3SWKA 3EQQA 1RE3C 1ZV8A 2CPBA 5APQA 5KKZB 2A06G 3MTUE 2RMZA 2QEXP 4QUQA 1AQTA 2Q5UA 3IF4A 2RN0A 1FZEA 2WPQA 4P1BH 2B87A 1FZAA 2K1AA 2A45H 1VPCA 1KYOI 2JKVA 2IDBA 4C46A 2PAJA 1LWUA 3T97B 4GT1A 1RF0A 3L74E 1IK9A 2UWJE 4WY4A 2WWWA 2B24A 2O01J 1BCCG 2YVJB 1H88A 4OWFA 1N73A 4U3FJ 2QVAA 4Y99C 2B9BA 5CCGC 3KZIE 4U3FE 2OYHC 3HE4A 1VQ8P 2FFDC 1SQVG 3AEAC 4U7JA 1NU1D 2N9YB 3ZDMA 1M8OB 2AXTE 2KK7A 1WRGA 2ZT9B 1G8KB 3O6QA 2BCCG 2RH0A 4NB8D 2P2UA 5GTIH 1BE3G 2WT7A 4YTPC 3II6A 1USDA 3N0QA 1DEBA 1OIPA 1GL2B 3H1KD 4D6TG 1NTMK 1M1JC 1JB0J 1O7WA 4NBED 2E76B 1EDLA 4GODA 1NWQA 2JO6A 1GK4A 2HODB 5GTHH 1OFCX 1JUNA 3V4WA 1KYOD 3M9BA 1URQD 3LIEA 2Y0CA 3GHGC 2QJYC 3GOBA 1KFMA 5KAIH 1YJWP 1IFNA 2PFXA 1SQPJ 3B5NA 3D6ZA 3TNUB 2NVEA 2P1JA 1KQGB 2POHA 3P8CE 3CCLP 4NBHD 1O7NA 5CHXA 5CJ0A 2YMYA 1SQPE 2WZ7A 3CWBJ 3L75G 3Q3DA 4GOFA 2IFNA 3CWBE 1LTJA 1L0LG 4IL6E 4DCKA 2O3JA 2FYUJ 2HPCB 1RE4A 1LWUC 2OGUA 2JP3A 1YQ3C 5CCHA 2OYOA 1ZXGA 2JR8A 4ZKUA 2WSSH 4QDFA 3GHGB 2WQYC 1JCDA 5AVSB 4NBDD 1RF0C 2QJYB 3D70A 2RKLA 2HMLA 1SQXE 4WY4C 1YYCA 2XNXA 1O7HA 1VL2A 5BOKA 3CC4P 1N73C 3AEBC 2A45G 2Y0EA 1GK6A 4KHXA 3OAKA 2WVRA 2WSCJ 3H1JG 2B87B 3GKEA 3A0BE 4I1LA 3AE6C 3A3YB 3AE1C 1ZRTD 1OXZA 3G4SP 2IYOA 1IC2A 1FDIA 4YPCA 2NPSA 4TLFA 4L73A 1LTBC 4Z1MH 3L74D 1Q7YQ 4JYCA 4WY4B 4M3LA 5AVQB 2J58A 2NRGA 2V4HA 2FYUK 3IN6A 3H1HJ 3JSVC 3VP8A 5KAFE 3RK3C 3GW6A 1FZGA 1M57D 1RFSA 2KZIA 3H1LD 2R3SA 1GW4A 1X22A 2CK3H 3PJSK 1S9KD 1AQ5A 3HD7B 5CCGD 3AE2C 5B5EH 3BVHA 2HMNA 3H6PA 2JJLA 2NUKA 2A06E 2QPZA 1KB9E 3WUTA 1FQTA 3B8EB 5E79E 3O6QB 4B86A 4QMAA 3B5NC 4K3AA 2WT7B 1XTGB 3CC2P 2XNDH 3HE5A 4HM0A 1SQQD 1HTLC 1CI6B 3TGUG 5M1BA 1ZOYC 3RK3B 1HBWA 1BDDA 5AW0B 1PL5A 3M91A 1LTJC 5AVVB 1BCCJ 1OVVA 2KP8A 4HM1A 2WSFH 1LT9A 2YKPA 3HRNA 1NTMG 1RE4C 2KXPB 2M5AB 3FX0A 1BCCE 5CCHC 2QE7H 5AVUB 4RKUJ 1J1DB 3EFGA 2K37A 4ASVA 3CXHD 4A7PA 1IFDA 4JPZB 3I56P 1L0NG 3I55P 2IZ0A 3CCSP 4P1CH 1SQVJ 2JEEA 2YFLA 3WU2E 1SQBK 4LLHA 3P8CD 1J1EC 3CCQP 1SQVE 5APUA 3L72D 1JMBA 4DOJA 1AJYA 2IBZD 1OVUA 1O7GA 3MP7B 2DE6D 2BCCJ 1KZUB 1BE3J 1LTJB 1NKZB 3QH9A 3AECC 3BCCG 4NBBD 1W2EA 5AW3B 3L73E 1E79H 3HUSA 1BE3E 3MUDA 2NPSC 4D6TJ 4QUPA 1KB9I 4QDFB 4LGDE 3VMGD 4D6TE 1SQXD 3H32A 1FOSE 2W27A 1FZFA 5KLVD
chains in the Genus database with same CATH topology
2BCCE 2HMLA 1SQXE 4H13D 4NBAD 2NUMA 2BMQA 2NVFA 1NU1E 2ZYLA 2NVGA 1G8KB 1O7HA 5BOKA 3H1KE 1VM9A 4HM0A 1O7PA 4NB8D 1NTKE 2E75D 3VMID 3L71E 2I7FA 1ULJA 1SQBE 2XRXA 3H1JE 2YFIA 3GCEA 1ZRTE 4PV1D 3EQQA 3N0QA 3DQYA 1NYKA 2FYUE 3CXHE 4HM1A 2DE5D 1Q90C 3GKEA 2XSOA 1PP9E 1JM1A 1EG9A 4QUQA 2BMRA 5AEUA 2ZT9D 4NBCD 1BGYE 1O7WA 4NBED 4OGQD 3GZXA 1BCCE 1L0NE 4HM5A 4HJLA 3BCCE 4HM6A 1RIEA 2HMJA 4P1BH 3L75E 2HMOA 2JO6A 3GTEA 3GZYA 1G8JB 4NB9D 1UUWA 1P84E 1SJGA 2E4PA 2QJPC 3L72E 4NBGD 3CX5E 1VF5D 2IBZE 2YIUC 3VCAA 2QJKC 4H44D 3VCPA 4P1CH 3D89A 3GL0A 2CKFA 1EZVE 2YFLA 4NBFD 1VCKA 1PPJE 2QJYC 3EN1A 1KYOE 4EMJB 3GOBA 2E74D 4QCKA 4AAYB 4HM7A 4QDDA 1SQVE 3H1LE 3AZCA 2E76D 1O7GA 3L74E 2FYNC 2NVEA 1ULIA 3L70E 1O7MA 4HKVA 2DE6D 4NBHD 2B24A 1O7NA 5CXMA 5HL4A 2B1XA 1RFSA 4AIVA 1SQPE 1WQLA 3GB4A 2HMMA 2XR8A 2YVJB 3GTSA 4QDCA 1NDOA 1L0LE 4NBBD 4HM3A 2D2CD 2JZAA 3L73E 5KKZC 3VMHD 4HM2A 1BE3E 3TGUE 2YFJA 3CWBE 2E4QA 4QUPA 4HM8A 2HMNA 5KLVE 4QDFB 2Q3WA 4U3FE 2NUKA 1UUVA 2BMOA 2A06E 4PD4E 3VMGD 4D6TE 4H0LD 2QPZA 1KB9E 2GBWA 2XSHA 3GL2A 3FOUA 1NTME 5AEWA 1FQTA 1SQQE 3H1HE 3C0DA 4QURA 2HMKA 2GBXA 1NTZE 4QDFA 3H1IE 2DE7D 4NBDD 4HM4A 2NWFA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC E;  2HML A;  1SQX E;  4H13 D;  4NBA D;  2NUM A;  2BMQ A;  2NVF A;  1NU1 E;  2ZYL A;  2NVG A;  1G8K B;  1O7H A;  5BOK A;  3H1K E;  1VM9 A;  4HM0 A;  1O7P A;  4NB8 D;  1NTK E;  2E75 D;  3VMI D;  3L71 E;  2I7F A;  1ULJ A;  1SQB E;  2XRX A;  3H1J E;  2YFI A;  3GCE A;  1ZRT E;  4PV1 D;  3EQQ A;  3N0Q A;  3DQY A;  1NYK A;  2FYU E;  3CXH E;  4HM1 A;  2DE5 D;  1Q90 C;  3GKE A;  2XSO A;  1PP9 E;  1JM1 A;  1EG9 A;  4QUQ A;  2BMR A;  5AEU A;  2ZT9 D;  4NBC D;  1BGY E;  1O7W A;  4NBE D;  4OGQ D;  3GZX A;  1BCC E;  1L0N E;  4HM5 A;  4HJL A;  3BCC E;  4HM6 A;  1RIE A;  2HMJ A;  4P1B H;  3L75 E;  2HMO A;  2JO6 A;  3GTE A;  3GZY A;  1G8J B;  4NB9 D;  1UUW A;  1P84 E;  1SJG A;  2E4P A;  2QJP C;  3L72 E;  4NBG D;  3CX5 E;  1VF5 D;  2IBZ E;  2YIU C;  3VCA A;  2QJK C;  4H44 D;  3VCP A;  4P1C H;  3D89 A;  3GL0 A;  2CKF A;  1EZV E;  2YFL A;  4NBF D;  1VCK A;  1PPJ E;  2QJY C;  3EN1 A;  1KYO E;  4EMJ B;  3GOB A;  2E74 D;  4QCK A;  4AAY B;  4HM7 A;  4QDD A;  1SQV E;  3H1L E;  3AZC A;  2E76 D;  1O7G A;  3L74 E;  2FYN C;  2NVE A;  1ULI A;  3L70 E;  1O7M A;  4HKV A;  2DE6 D;  4NBH D;  2B24 A;  1O7N A;  5CXM A;  5HL4 A;  2B1X A;  1RFS A;  4AIV A;  1SQP E;  1WQL A;  3GB4 A;  2HMM A;  2XR8 A;  2YVJ B;  3GTS A;  4QDC A;  1NDO A;  1L0L E;  4NBB D;  4HM3 A;  2D2C D;  2JZA A;  3L73 E;  5KKZ C;  3VMH D;  4HM2 A;  1BE3 E;  3TGU E;  2YFJ A;  3CWB E;  2E4Q A;  4QUP A;  4HM8 A;  2HMN A;  5KLV E;  4QDF B;  2Q3W A;  4U3F E;  2NUK A;  1UUV A;  2BMO A;  2A06 E;  4PD4 E;  3VMG D;  4D6T E;  4H0L D;  2QPZ A;  1KB9 E;  2GBW A;  2XSH A;  3GL2 A;  3FOU A;  1NTM E;  5AEW A;  1FQT A;  1SQQ E;  3H1H E;  3C0D A;  4QUR A;  2HMK A;  2GBX A;  1NTZ E;  4QDF A;  3H1I E;  2DE7 D;  4NBD D;  4HM4 A;  2NWF A;  5KLI C; 
#chains in the Genus database with same CATH topology
 1MUU A;  4WY4 D;  1ZR2 A;  1J1E B;  4DJG A;  1XTC C;  2MKV A;  5AW9 B;  3CLQ A;  3GF3 A;  1FJP A;  4WWI A;  1T6A A;  3VMI D;  3H1I D;  4HB1 A;  1QL1 A;  2I1K A;  1EXJ A;  2Z5H A;  1CW5 A;  1H0T A;  2LXC B;  3L75 J;  3AE4 C;  2YXQ B;  3CI9 A;  5KTB A;  3AE5 C;  3GZX A;  1JM0 A;  1FBM A;  2R44 A;  1L0L J;  3L75 E;  1HGV A;  1OZH A;  2HMO A;  2MJZ A;  3O8Z A;  3CX5 E;  2QJK C;  1BGY D;  2WSE H;  1LP1 A;  1S5L E;  2OAR A;  2LR2 A;  1OW8 A;  5H2F E;  1LTT C;  4QCK A;  2ZXE B;  2FYU G;  1SFC A;  1EZV D;  1LT9 C;  3RK3 D;  5CXM A;  3TF5 A;  1JY3 P;  1JEK A;  1QX8 A;  1VQK P;  1KD1 Q;  1KB9 D;  2E4Q A;  3L37 A;  3H1J J;  2J59 M;  2OTL P;  2YO2 A;  2BMO A;  4H0L D;  2QJK B;  5AEW A;  4XE5 B;  2KB7 P;  2O01 N;  3B5N D;  2NWF A;  2L5G B;  2PGD A;  2QRX A;  2JDI H;  4IFM A;  1IFM A;  1YHQ P;  3QWO C;  2ZVO B;  4N6J A;  1L0L K;  1NTK E;  1BSH A;  2I7F A;  3FWN A;  1PV3 A;  3HUS C;  3MUD C;  4XA4 A;  2E42 A;  3VN0 A;  1NYK A;  1S2E A;  1GD2 E;  1JY3 N;  1JM1 A;  4OH8 B;  3E1I A;  5CCH D;  4R4L A;  2FYN B;  1NJI Q;  2E5Y A;  3LW5 H;  3CX5 I;  4IL6 X;  2H7H A;  3R2P A;  1SJG A;  3M9H A;  4NBG D;  4GOE A;  3KXD A;  2YIU C;  5AVW B;  1SQB G;  4N78 E;  1P84 D;  1UIX A;  4IFD K;  1IFJ A;  2O1K A;  2PRR A;  4PJ0 H;  3L73 D;  4OVN F;  3TGU J;  4KJM A;  3L70 G;  1PGO A;  3MGN A;  2JZA A;  5GTH E;  2HR3 A;  3TGU E;  3H32 B;  2NPS D;  2LXB A;  3P7K A;  1NTM J;  3N7N A;  4CPG A;  5EFW B;  1NAY A;  1IFI A;  1GU5 A;  1KYO H;  2YIU B;  1NTM E;  3I5C A;  1L0N J;  1K9M Q;  5AW6 B;  1SFC C;  2K9J A;  3AE7 C;  3V2P A;  1AV1 A;  4WVZ A;  1PIX A;  5TIS E;  1FDO A;  1A02 J;  1DD4 A;  3Q1M A;  1EDI A;  1GDT A;  2E75 C;  2XRX A;  3EFF K;  3JC2 2;  4PV1 C;  3MZW B;  2J5U A;  1LNQ A;  1Q86 Q;  3BCC J;  5AEU A;  5L8R J;  3CX5 D;  4NPD A;  3BCC E;  1OMI A;  1PP9 G;  2QJP C;  1AVO A;  4LC1 A;  4C7N A;  3G3Z A;  1G2C A;  3M9Q A;  4NBF D;  5KJ7 A;  4O9B A;  2C0W A;  4EOT A;  3EN1 A;  4Y99 B;  4Y28 J;  2KIK A;  4NPE A;  1KC8 Q;  1BSN A;  2OYH B;  3G9R A;  2FFD B;  1L0N K;  3V5B A;  2WPR A;  1X0T A;  2N1T C;  1DX7 A;  3AEE C;  1JCC A;  2M3B A;  4UB6 E;  2D2C C;  1JY2 P;  1QLE D;  2WPV B;  2P58 A;  3KDP B;  1S4X A;  4PD4 E;  4DT0 A;  1KTM A;  3GL2 A;  4EI2 A;  1KV4 A;  3KPE A;  2QA4 P;  3VMA A;  1NTK D;  1HWT C;  1M1J B;  2W6B A;  1MFT A;  2OYI A;  1KOR A;  1FE6 A;  1YBK A;  4HKZ H;  4JQ0 D;  2YKO A;  1NTZ D;  3CCE P;  4MN4 C;  4I7Z C;  5B5E E;  3KYQ A;  3CL3 D;  2D2C B;  3KZI H;  2FYU E;  2ZAE B;  2KYV A;  2XSO A;  3D6Y A;  3L71 D;  4EYY Q;  5K5G B;  1SQQ K;  1BDC A;  1VQ6 P;  1JY2 N;  4AYC A;  2AXT H;  3W67 A;  3GZY A;  3OJA B;  2Q6Q A;  1L2P A;  2K3R A;  2XV5 A;  4N78 D;  3H1K G;  1QVF O;  4W7Y A;  1LJ2 A;  2XZR A;  2PP6 A;  3V2N A;  4N3Y B;  1UII A;  2WSF J;  1GZL A;  1NO4 A;  5CJ4 A;  3BRV B;  1JOC A;  1ZW0 A;  4BXL A;  4HKV A;  1LWU B;  3E1R A;  3TGU D;  5HL4 A;  4XFJ A;  2B1X A;  4JYB A;  1X79 B;  2QSI A;  3L35 A;  3GTS A;  3AE9 C;  2FXM A;  4C7R A;  3MIW A;  2AEJ A;  4PD4 I;  1JY3 O;  1ZLL A;  1N73 B;  3CXH H;  1FAV A;  2K9J B;  5KJ7 C;  3P8M C;  3H1H E;  3JCU H;  2M8R A;  1K8A Q;  4U3F D;  1SFC D;  2KLU A;  2KNC A;  3HE4 B;  2ZYL A;  1SQB J;  2QM8 A;  2Y9Z A;  1SQX K;  1N7S A;  2E75 D;  3OW2 O;  2AEF A;  1SQB E;  4H0L C;  4PV1 D;  1NVO A;  2KS1 A;  1RF1 A;  2GA1 A;  5KLV K;  4IL6 H;  4ASW A;  1Q81 Q;  1Q90 C;  1L4A A;  1NGM B;  3L70 J;  3VP9 A;  1SVF A;  1IJD B;  5B66 E;  3P32 A;  2YNY A;  3SFE C;  2HMJ A;  3USS A;  3NMD A;  3GMA A;  3G6E P;  2W83 C;  1VF5 C;  3M0D A;  3VCA A;  2YKQ A;  3VCP A;  3D89 A;  2OYI C;  3F89 A;  1SP4 A;  1PGP A;  2KOG A;  2C0X A;  3M0A A;  2E74 C;  3MHV A;  1MFZ A;  4EIJ A;  2I8D A;  2P67 A;  4H0L B;  1KIL A;  2ZFC A;  1M1K Q;  4R4M A;  3L74 G;  2N1T D;  3GB4 A;  3E7K A;  2YXR B;  1AFO A;  2WSE J;  3B5N B;  2D2C D;  4W7Z A;  3VMH D;  4PD4 D;  3RK2 C;  1OVR A;  2ZJS E;  4YXD C;  4HH2 A;  1SQP D;  2Q3W A;  1IK7 A;  1PPJ G;  2FY8 A;  1VF5 B;  1PP9 J;  1AVY A;  3H1L G;  3GG2 A;  3VMY A;  4TT3 H;  2OYI B;  3CWB D;  1W5C E;  2KSJ A;  3PLN A;  2BCC E;  1KQL A;  1K73 Q;  5KAF H;  2ZYA A;  4NBA D;  1R5S A;  1FS0 E;  3CCV P;  2KUB A;  5APW A;  3SFD C;  3RBX A;  2KZJ A;  1VM9 A;  1JMM A;  2FYU D;  3S4R A;  3Q5P A;  3CCJ P;  1N86 A;  2N9B A;  5AW7 B;  3SSU A;  2JWD A;  2E43 A;  3DQY A;  2DE5 D;  2QG4 A;  2XU6 A;  1KB9 H;  1SQQ G;  4OGQ C;  1CSB A;  5AW4 B;  4HM6 A;  1YJN P;  1IFP A;  1G8J B;  3RL0 C;  1MKM A;  3CC7 P;  1LTG C;  3AEF C;  2E4P A;  2WMM A;  1RH5 B;  1E5W A;  3SWF A;  3NFQ A;  4H44 C;  1EC5 A;  1N7S C;  2NPS B;  2I1J A;  5BVZ A;  3BRT B;  1RF1 C;  2FKW B;  3LW5 J;  1L4A C;  1LGH B;  1NU1 J;  1WQL A;  4QDC A;  1VQO P;  1NDO A;  1L0L E;  3L72 G;  3S9O A;  2YFJ A;  2IBZ G;  2JO1 A;  4OGQ B;  1VQ7 P;  1OW6 A;  4IOI H;  3M0D C;  2NZ2 A;  3H1H D;  1JY2 O;  1UUV A;  3WU2 H;  4IFF A;  5KJ7 D;  3UIA A;  1KMI Z;  1KQS O;  4UB8 H;  2W90 A;  4HYT B;  4QUR A;  2R5D A;  2HMK A;  4NPF X;  3H1K J;  1M7L A;  2A06 D;  2NVF A;  1KIL C;  1P84 H;  1X8Y A;  2NVG A;  1GL2 A;  3WMM 0;  3H1K E;  1FZB A;  1SQX G;  1M90 Q;  3L4F A;  1KIL E;  3H1J E;  1H8A A;  3U1A A;  1HJB A;  5KLV G;  3HE5 B;  1Q90 D;  2HOD A;  5APS A;  1EG9 A;  4HM5 A;  2SPZ A;  3H1I G;  3GTE A;  4JF7 A;  2KLV A;  1LT9 B;  5AVT B;  1NU1 K;  1J2J B;  1VF5 D;  1FDM A;  1U7J A;  4AQR D;  3TNU A;  4ZKP A;  1BCC D;  2CKF A;  1ZME C;  1VCK A;  2E74 D;  1SS1 A;  2N1T A;  2BAS A;  1GTW A;  1YTZ I;  2FXP A;  1EXI A;  2G8Y A;  2O1J A;  1Y8A A;  3MD0 A;  2ZYG A;  1PFI A;  1BGY G;  3PTZ A;  5APX A;  2M0B A;  1EDK A;  1SQV D;  1S3J A;  5GTI E;  2HPC A;  3VMZ A;  1VQM P;  1QVG O;  4KT0 J;  3RK2 D;  2V7Q H;  1R5L A;  1VQL P;  3CX5 H;  5AW1 B;  4HM8 A;  2QIW A;  4L76 A;  1YJ9 P;  1EZV G;  3HTK A;  2BCC D;  4ZMD A;  2GBW A;  3HUS B;  2XSH A;  1BE3 D;  2HG5 D;  2C9N Y;  3IR9 A;  1PZQ A;  2A45 I;  2OTK E;  1K04 A;  2W6J H;  2Y9Y A;  1GW3 A;  4L75 A;  4H13 C;  4D6T D;  1NOH A;  3AE8 C;  2H89 C;  5BU8 B;  3CCM P;  3FXE A;  1RHZ B;  5APV A;  3CD6 P;  3A0H H;  2P7J A;  1ZRT E;  5KAI E;  1CZQ A;  1JTH A;  2IZ1 A;  2WPS A;  1YIJ P;  1NTK K;  4YXW H;  3L74 J;  2H43 A;  1QL2 A;  2BMR A;  2YO3 A;  2ZT9 C;  5AW8 B;  2IYP A;  1Y9B A;  4OGQ D;  1L0N E;  1NTZ K;  4HJL A;  1H0T B;  2H88 C;  3RL0 D;  2Q3I A;  3D71 A;  1GU4 A;  1OW7 A;  1A02 F;  4H44 D;  1W2B O;  3H1L J;  1R8E A;  1GL2 C;  3R4Y A;  1N7S D;  3WUV A;  4H13 B;  1PPJ E;  3L75 D;  3H25 A;  4AAY B;  3V2Q A;  3FXD A;  1S1C X;  2Z5I A;  3H1L E;  1LP1 B;  2E76 C;  1L0L D;  1S9K E;  4HJG H;  1O7M A;  1L4A D;  3HD7 A;  1HUC A;  1VQN P;  2W8Z A;  3C8V A;  5DJU B;  3V2R A;  1KFN A;  3V6I A;  1SFC B;  2G3A A;  1N2D C;  1QEX A;  1N7L A;  1YI2 P;  3L73 G;  1VDF A;  1SQQ J;  3TDK A;  2E75 B;  2FXO A;  1U57 A;  1DEE G;  1T2K C;  4PV1 B;  1EQ7 A;  1VQ5 P;  3CPW O;  1PGQ A;  1SQQ E;  2HFE D;  3B4S A;  2GBX A;  3AEG C;  1CI6 A;  5APY A;  1KIL D;  3H1J D;  1ZN5 A;  3PHL A;  1SLQ A;  3VTP C;  4RO0 A;  1U7M A;  1O7P A;  2QJP B;  2YFI A;  3VOP A;  3NTN A;  2M5A A;  2BEZ F;  4GIF A;  1M56 D;  4K35 A;  3OA7 A;  3U1C A;  3CXH E;  1T3U A;  4RES B;  4L74 A;  4NBC D;  1HGZ A;  3L72 J;  5AVR B;  3JCU E;  3PRJ A;  3PP5 A;  2DW3 A;  2P10 A;  2O01 H;  2L91 A;  1NU1 G;  3L72 E;  2IBZ E;  1DH3 A;  2N1T B;  5TIS H;  4JBZ A;  3U59 A;  2GM4 A;  1T8Z A;  2K9Y A;  4QDD A;  3C1L A;  2IPP A;  1JO5 A;  1Q82 Q;  1H89 A;  2YMK A;  2VRS A;  4GDO A;  3TK1 A;  3G71 P;  1SQX J;  3CME P;  2GUS A;  4AIV A;  2HMM A;  3HTK B;  5KLV J;  3AED C;  2W6A A;  4I2L C;  2AEM A;  5KLV E;  5APT A;  3CCR P;  3V4Q A;  3S1K A;  3H1I J;  5DJT B;  4I7Z B;  2E5T A;  3TYY A;  2IX7 C;  3C0D A;  2K88 A;  3IAO A;  3H1I E;  5AW2 B;  1WT6 A;  1IO4 A;  2DE7 D;  4HM4 A;  2HLO A;  1AA0 A;  4H13 D;  2NUM A;  1YQ4 C;  1HJ0 A;  1SQP K;  3HD7 C;  3A2A A;  5AW5 B;  1JTH B;  3L36 A;  1NTM D;  3ITK A;  2OTJ P;  3SWY A;  1FZC A;  2R32 A;  2FYZ A;  1OX3 A;  2Q1K A;  4UB6 H;  2H8P D;  2CPS A;  1FU1 A;  1NKN A;  3CXH I;  2JWA A;  3ABV C;  1BGY J;  1L0N D;  1NTK G;  1DD3 A;  2Z4E A;  1HVV A;  2HYN A;  4PD4 H;  1NAF A;  1JNM A;  1S5L X;  2ZT9 D;  2BEQ D;  1YIT P;  1BGY E;  3W68 A;  1NTZ G;  1K05 A;  1RIE A;  2IBZ I;  5CMZ A;  1FJK A;  1PPJ D;  2KSE A;  2QM7 A;  3GLM A;  3CCU P;  2ZVN B;  5BU5 A;  1GL2 D;  1USE A;  1EZV E;  3L71 G;  2R3C A;  2WTY A;  1HH0 A;  3BCC D;  3RK3 E;  4EMJ B;  3Q5S A;  4C7N B;  3PH0 A;  3AE3 C;  2E76 D;  3CMA P;  1ULI A;  1WMK A;  1G2C B;  3L70 E;  1J1D C;  1EDJ A;  1N8R Q;  4BRY A;  4DZO A;  1Q2N A;  4HM3 A;  2IFM A;  1VQ4 P;  2AXC A;  2M3E A;  1T2K D;  3FOU A;  3A0B H;  3BAS A;  1RQV A;  2LKM A;  2WSC H;  5AVZ B;  1MZ9 A;  3TSI A;  1FC2 C;  1DIP A;  1URQ A;  1D7M A;  1G1I A;  1QGK B;  2ITA A;  3IFM A;  1LT1 A;  2FBW C;  4U3F G;  1LTI C;  3C9I A;  1PP9 E;  4AUW A;  2E74 B;  4UB8 E;  1HF9 A;  1PGJ A;  3LID A;  4NB9 D;  4I6M C;  3L73 J;  1P84 E;  4W80 A;  1EZV I;  3GL0 A;  1ZR4 A;  1FZC C;  3RK2 B;  5TJH A;  4GKG A;  5E79 H;  3EWK A;  3KHU A;  1RY3 A;  3RL0 g;  2ZYD A;  5AVY B;  3T97 A;  2B88 A;  3WUU A;  1FOS F;  5B66 H;  4EDF A;  4HM2 A;  1KQF B;  1RE3 A;  1IZN B;  1G1J A;  1KN7 A;  1MV8 A;  1RQU A;  1SQV K;  3KQG A;  3RBZ A;  3BAT A;  3A5T A;  1FZC B;  4ZNC A;  1S72 P;  5KLI C;  2ZXX A;  3HD7 D;  1SQP G;  1NU1 E;  2V7Q J;  3M06 A;  3RL0 B;  3VYI A;  4RJT A;  1VQP P;  1ULJ A;  2XDJ A;  3CWB G;  2KNC B;  1Y47 A;  4H44 B;  3K5B A;  4PJ0 E;  1N7S B;  2GUV A;  1SQB D;  3FGA D;  1LTS C;  2KS1 B;  1RF1 B;  3GF7 A;  1P84 I;  2R5B A;  5C39 A;  2C9L Y;  3F5H A;  1LTA C;  1UUW A;  1L4A B;  2Q3E A;  3EQ2 A;  5CCG A;  3Q5R A;  2Y0D A;  3NXS A;  5KLI B;  3A0H E;  2OYH A;  1URQ C;  3L70 D;  1TU3 F;  4BRY B;  1KYO E;  2FFD A;  1ZP0 C;  3VMX A;  4HM7 A;  3AZC A;  2KI7 B;  4BWN A;  2FYN C;  5CBO A;  5CBN A;  2WIT A;  3RGU A;  2XR8 A;  3FWL A;  5KKZ C;  3Q2Y A;  1NTK J;  1KIL B;  3B71 A;  3A7O A;  1NTZ J;  1M1J A;  1T3J A;  4WB4 A;  3N4X A;  2Q9I A;  1OWA A;  1URQ B;  2OQQ A;  1NTZ E;  1VQ9 P;  5AVX B;  2BMQ A;  1GMJ A;  3L71 J;  3H1H G;  1NYH A;  2B89 A;  1Z56 A;  1NHL A;  2XKM A;  3GHG A;  1S5L H;  2Q7C A;  3L71 E;  1NH4 A;  5H2F H;  4WBA A;  1PP9 D;  1YTZ T;  3GCE A;  1X9V A;  3SWK A;  3EQQ A;  1RE3 C;  1ZV8 A;  2CPB A;  5APQ A;  5KKZ B;  2A06 G;  3MTU E;  2RMZ A;  2QEX P;  4QUQ A;  1AQT A;  2Q5U A;  3IF4 A;  2RN0 A;  1FZE A;  2WPQ A;  4P1B H;  2B87 A;  1FZA A;  2K1A A;  2A45 H;  1VPC A;  1KYO I;  2JKV A;  2IDB A;  4C46 A;  2PAJ A;  1LWU A;  3T97 B;  4GT1 A;  1RF0 A;  3L74 E;  1IK9 A;  2UWJ E;  4WY4 A;  2WWW A;  2B24 A;  2O01 J;  1BCC G;  2YVJ B;  1H88 A;  4OWF A;  1N73 A;  4U3F J;  2QVA A;  4Y99 C;  2B9B A;  5CCG C;  3KZI E;  4U3F E;  2OYH C;  3HE4 A;  1VQ8 P;  2FFD C;  1SQV G;  3AEA C;  4U7J A;  1NU1 D;  2N9Y B;  3ZDM A;  1M8O B;  2AXT E;  2KK7 A;  1WRG A;  2ZT9 B;  1G8K B;  3O6Q A;  2BCC G;  2RH0 A;  4NB8 D;  2P2U A;  5GTI H;  1BE3 G;  2WT7 A;  4YTP C;  3II6 A;  1USD A;  3N0Q A;  1DEB A;  1OIP A;  1GL2 B;  3H1K D;  4D6T G;  1NTM K;  1M1J C;  1JB0 J;  1O7W A;  4NBE D;  2E76 B;  1EDL A;  4GOD A;  1NWQ A;  2JO6 A;  1GK4 A;  2HOD B;  5GTH H;  1OFC X;  1JUN A;  3V4W A;  1KYO D;  3M9B A;  1URQ D;  3LIE A;  2Y0C A;  3GHG C;  2QJY C;  3GOB A;  1KFM A;  5KAI H;  1YJW P;  1IFN A;  2PFX A;  1SQP J;  3B5N A;  3D6Z A;  3TNU B;  2NVE A;  2P1J A;  1KQG B;  2POH A;  3P8C E;  3CCL P;  4NBH D;  1O7N A;  5CHX A;  5CJ0 A;  2YMY A;  1SQP E;  2WZ7 A;  3CWB J;  3L75 G;  3Q3D A;  4GOF A;  2IFN A;  3CWB E;  1LTJ A;  1L0L G;  4IL6 E;  4DCK A;  2O3J A;  2FYU J;  2HPC B;  1RE4 A;  1LWU C;  2OGU A;  2JP3 A;  1YQ3 C;  5CCH A;  2OYO A;  1ZXG A;  2JR8 A;  4ZKU A;  2WSS H;  4QDF A;  3GHG B;  2WQY C;  1JCD A;  5AVS B;  4NBD D;  1RF0 C;  2QJY B;  3D70 A;  2RKL A;  2HML A;  1SQX E;  4WY4 C;  1YYC A;  2XNX A;  1O7H A;  1VL2 A;  5BOK A;  3CC4 P;  1N73 C;  3AEB C;  2A45 G;  2Y0E A;  1GK6 A;  4KHX A;  3OAK A;  2WVR A;  2WSC J;  3H1J G;  2B87 B;  3GKE A;  3A0B E;  4I1L A;  3AE6 C;  3A3Y B;  3AE1 C;  1ZRT D;  1OXZ A;  3G4S P;  2IYO A;  1IC2 A;  1FDI A;  4YPC A;  2NPS A;  4TLF A;  4L73 A;  1LTB C;  4Z1M H;  3L74 D;  1Q7Y Q;  4JYC A;  4WY4 B;  4M3L A;  5AVQ B;  2J58 A;  2NRG A;  2V4H A;  2FYU K;  3IN6 A;  3H1H J;  3JSV C;  3VP8 A;  5KAF E;  3RK3 C;  3GW6 A;  1FZG A;  1M57 D;  1RFS A;  2KZI A;  3H1L D;  2R3S A;  1GW4 A;  1X22 A;  2CK3 H;  3PJS K;  1S9K D;  1AQ5 A;  3HD7 B;  5CCG D;  3AE2 C;  5B5E H;  3BVH A;  2HMN A;  3H6P A;  2JJL A;  2NUK A;  2A06 E;  2QPZ A;  1KB9 E;  3WUT A;  1FQT A;  3B8E B;  5E79 E;  3O6Q B;  4B86 A;  4QMA A;  3B5N C;  4K3A A;  2WT7 B;  1XTG B;  3CC2 P;  2XND H;  3HE5 A;  4HM0 A;  1SQQ D;  1HTL C;  1CI6 B;  3TGU G;  5M1B A;  1ZOY C;  3RK3 B;  1HBW A;  1BDD A;  5AW0 B;  1PL5 A;  3M91 A;  1LTJ C;  5AVV B;  1BCC J;  1OVV A;  2KP8 A;  4HM1 A;  2WSF H;  1LT9 A;  2YKP A;  3HRN A;  1NTM G;  1RE4 C;  2KXP B;  2M5A B;  3FX0 A;  1BCC E;  5CCH C;  2QE7 H;  5AVU B;  4RKU J;  1J1D B;  3EFG A;  2K37 A;  4ASV A;  3CXH D;  4A7P A;  1IFD A;  4JPZ B;  3I56 P;  1L0N G;  3I55 P;  2IZ0 A;  3CCS P;  4P1C H;  1SQV J;  2JEE A;  2YFL A;  3WU2 E;  1SQB K;  4LLH A;  3P8C D;  1J1E C;  3CCQ P;  1SQV E;  5APU A;  3L72 D;  1JMB A;  4DOJ A;  1AJY A;  2IBZ D;  1OVU A;  1O7G A;  3MP7 B;  2DE6 D;  2BCC J;  1KZU B;  1BE3 J;  1LTJ B;  1NKZ B;  3QH9 A;  3AEC C;  3BCC G;  4NBB D;  1W2E A;  5AW3 B;  3L73 E;  1E79 H;  3HUS A;  1BE3 E;  3MUD A;  2NPS C;  4D6T J;  4QUP A;  1KB9 I;  4QDF B;  4LGD E;  3VMG D;  4D6T E;  1SQX D;  3H32 A;  1FOS E;  2W27 A;  1FZF A;  5KLV D; 
#chains in the Genus database with same CATH homology
 2BCC E;  2HML A;  1SQX E;  4H13 D;  4NBA D;  2NUM A;  2BMQ A;  2NVF A;  1NU1 E;  2ZYL A;  2NVG A;  1G8K B;  1O7H A;  5BOK A;  3H1K E;  1VM9 A;  4HM0 A;  1O7P A;  4NB8 D;  1NTK E;  2E75 D;  3VMI D;  3L71 E;  2I7F A;  1ULJ A;  1SQB E;  2XRX A;  3H1J E;  2YFI A;  3GCE A;  1ZRT E;  4PV1 D;  3EQQ A;  3N0Q A;  3DQY A;  1NYK A;  2FYU E;  3CXH E;  4HM1 A;  2DE5 D;  1Q90 C;  3GKE A;  2XSO A;  1PP9 E;  1JM1 A;  1EG9 A;  4QUQ A;  2BMR A;  5AEU A;  2ZT9 D;  4NBC D;  1BGY E;  1O7W A;  4NBE D;  4OGQ D;  3GZX A;  1BCC E;  1L0N E;  4HM5 A;  4HJL A;  3BCC E;  4HM6 A;  1RIE A;  2HMJ A;  4P1B H;  3L75 E;  2HMO A;  2JO6 A;  3GTE A;  3GZY A;  1G8J B;  4NB9 D;  1UUW A;  1P84 E;  1SJG A;  2E4P A;  2QJP C;  3L72 E;  4NBG D;  3CX5 E;  1VF5 D;  2IBZ E;  2YIU C;  3VCA A;  2QJK C;  4H44 D;  3VCP A;  4P1C H;  3D89 A;  3GL0 A;  2CKF A;  1EZV E;  2YFL A;  4NBF D;  1VCK A;  1PPJ E;  2QJY C;  3EN1 A;  1KYO E;  4EMJ B;  3GOB A;  2E74 D;  4QCK A;  4AAY B;  4HM7 A;  4QDD A;  1SQV E;  3H1L E;  3AZC A;  2E76 D;  1O7G A;  3L74 E;  2FYN C;  2NVE A;  1ULI A;  3L70 E;  1O7M A;  4HKV A;  2DE6 D;  4NBH D;  2B24 A;  1O7N A;  5CXM A;  5HL4 A;  2B1X A;  1RFS A;  4AIV A;  1SQP E;  1WQL A;  3GB4 A;  2HMM A;  2XR8 A;  2YVJ B;  3GTS A;  4QDC A;  1NDO A;  1L0L E;  4NBB D;  4HM3 A;  2D2C D;  2JZA A;  3L73 E;  5KKZ C;  3VMH D;  4HM2 A;  1BE3 E;  3TGU E;  2YFJ A;  3CWB E;  2E4Q A;  4QUP A;  4HM8 A;  2HMN A;  5KLV E;  4QDF B;  2Q3W A;  4U3F E;  2NUK A;  1UUV A;  2BMO A;  2A06 E;  4PD4 E;  3VMG D;  4D6T E;  4H0L D;  2QPZ A;  1KB9 E;  2GBW A;  2XSH A;  3GL2 A;  3FOU A;  1NTM E;  5AEW A;  1FQT A;  1SQQ E;  3H1H E;  3C0D A;  4QUR A;  2HMK A;  2GBX A;  1NTZ E;  4QDF A;  3H1I E;  2DE7 D;  4NBD D;  4HM4 A;  2NWF A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...