1P84E

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1p84E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1p84E02
3L73E 5AEUA 1EZVE 4HM8A 3H1IE 1FQTA 2JO6A 2Q3WA 4NBED 4QDFB 3DQYA 3N0QA 4QDFA 2XSOA 1VF5D 2HMKA 4HM3A 3GZYA 1RFSA 2A06E 4HM6A 2NWFA 1RIEA 1SJGA 2B1XA 3EQQA 2BMOA 2B24A 4HM7A 3L72E 2ZYLA 1G8JB 4P1BH 2HMMA 4NB8D 4NBFD 1NTKE 1ULIA 4P1CH 4PD4E 2HMJA 1BCCE 3GTEA 1PPJE 1NDOA 3C0DA 4HKVA 2HMNA 2E74D 2YFLA 4QCKA 3VMGD 1O7HA 2QPZA 2NUKA 1NYKA 4NBHD 1BGYE 1JM1A 3AZCA 5AEWA 5HL4A 3H1LE 2E76D 2YVJB 2E4PA 2E75D 4D6TE 4HM1A 1NTME 3L74E 3VMHD 4HJLA 4U3FE 3GTSA 2NUMA 1O7PA 3GL0A 1SQVE 4HM2A 2BMQA 4QUPA 4AIVA 1KB9E 2XRXA 4QURA 4EMJB 1SQPE 2FYUE 1O7NA 1Q90C 5BOKA 1SQXE 3CXHE 3L70E 1NU1E 2XSHA 2E4QA 1WQLA 1O7WA 4H13D 3CWBE 1NTZE 1UUVA 2DE6D 1KYOE 3GB4A 4AAYB 1PP9E 1O7MA 4H44D 1SQQE 2YFJA 3BCCE 3D89A 3H1KE 3VMID 4QDDA 3VCAA 3VCPA 3H1HE 3L71E 2JZAA 4NBCD 5CXMA 1L0NE 2NVFA 3L75E 4PV1D 4QUQA 3GCEA 2NVGA 2YIUC 4HM4A 4HM5A 2GBWA 5KLVE 1UUWA 3GKEA 2QJKC 1ZRTE 2ZT9D 2BCCE 2HMOA 2CKFA 2HMLA 4H0LD 1P84E 3GOBA 3H1JE 4NB9D 1G8KB 1ULJA 2QJYC 2IBZE 1SQBE 2DE7D 2I7FA 2FYNC 2QJPC 2YFIA 4HM0A 1L0LE 4NBGD 5KKZC 2DE5D 1O7GA 2D2CD 3GZXA 3GL2A 4NBAD 4OGQD 1VM9A 3CX5E 2GBXA 4NBBD 2XR8A 3TGUE 4QDCA 2NVEA 2BMRA 1VCKA 1BE3E 5KLIC 4NBDD 3FOUA 1EG9A 3EN1A
chains in the Genus database with same CATH superfamily
1GDTA 3SWYA 1KFNA 2ZYGA 3I5CA 3Q5RA 2Q9IA 2P7JA 1SQXG 3H1KJ 4JF7A 2A06E 2OGUA 1LTJB 1EXIA 1RIEA 1SJGA 3BCCD 3N7NA 5APTA 2XZRA 4P1CH 4I1LA 3M91A 2D2CC 1KORA 3KDPB 3SFEC 4I7ZB 4LLHA 1N86A 1KQFB 1DEEG 3UIAA 3CCRP 3HUSA 2FYUG 4A7PA 3AEBC 1NTME 3RK2B 5KAIH 2NPSC 3TDKA 1OZHA 1N7SC 1SQVE 4GT1A 4PD4D 1NAYA 1VQ8P 1W2EA 3A0HH 1SVFA 5AW5B 4R4MA 3PJSK 4GODA 5APWA 1G1IA 1JNMA 2JJLA 3KZIH 3OW2O 3VYIA 2MJZA 1L4AC 1H0TA 3VN0A 2CPSA 3V6IA 1EQ7A 3NTNA 4NPDA 5AVXB 2JO1A 1SQQK 1FZAA 4TLFA 1HUCA 2P67A 3L74J 1QLED 2IFNA 1L0LE 2ZXXA 1NGMB 3K5BA 1URQC 3CX5E 4U3FD 3L4FA 3C8VA 1S2EA 1J1EB 1SQXJ 3GW6A 1SQPD 2B9BA 2N1TB 2BEZF 5GTIE 5DJUB 4I2LC 3VP9A 3WUUA 3HE4A 5APSA 1VQKP 3B71A 5CJ4A 3HRNA 3HD7C 4BRYA 4YPCA 2B1XA 2IZ1A 1NTKE 3FGAD 1FC2C 1H8AA 2E74D 2QJKB 1GD2E 3AZCA 2OQQA 1VQLP 4HM1A 3H1JG 1S5LE 1P84I 3CCUP 1BE3D 5CCGD 1O7WA 2K3RA 1RF1B 2H88C 3BCCE 3RK3B 3D6ZA 1YBKA 1CI6A 1L0NE 1KZUB 3A5TA 1NTZK 3U1AA 1BSNA 3ABVC 1ZRTE 3QH9A 3Q5PA 4RKUJ 4DT0A 3HUSC 4EI2A 4GOEA 2HLOA 3VMAA 2O01N 1PV3A 3BRTB 1KN7A 3JC22 4WY4A 4DJGA 5CMZA 2E75C 1JY2N 1N73A 3B5ND 2GM4A 2OARA 4PV1C 2WSSH 4C7RA 3V2PA 3SSUA 2IYPA 3CWBG 4PJ0E 2E5TA 3EQQA 2OYIA 3EQ2A 3HE5B 4P1BH 1FZCB 3AE2C 2KK7A 3WU2E 1ZLLA 3P7KA 3L73D 3H1JJ 3KYQA 1BDDA 2KI7B 3AEDC 4NBHD 2KZJA 3KHUA 1FDIA 1JTHB 1Q82Q 1RQVA 2M3EA 4IL6E 4H13B 4U3FE 3O8ZA 3M9HA 1M57D 2V7QH 1H89A 2XRXA 1SQPE 1DH3A 2HODB 1NWQA 1NTMK 3MTUE 3RK2D 1QL2A 3LIDA 3P8CD 3FXDA 5CCHD 2R5BA 5B66E 3H6PA 1SQVK 1J1DB 1BDCA 5TISE 2FXOA 1N7LA 3PTZA 5B5EE 1IZNB 1LP1B 1T2KD 3MZWB 2HMLA 3KQGA 1BGYD 3G71P 2H7HA 1RE3A 2P58A 1M8OB 2QJPC 1KILC 3RL0C 3H1KD 1KC8Q 2GBXA 1ZMEC 1RF0C 1FU1A 3PP5A 2W6AA 1VCKA 1BE3E 1M56D 5KLIC 4PD4H 4GIFA 2YMYA 1JO5A 3IF4A 3CWBJ 1L0LK 2KLVA 2HFED 1PPJG 1GL2A 1J2JB 5E79E 4HM3A 3CMEP 5KJ7D 2JP3A 4H0LC 2QSIA 1SP4A 1IFMA 4HM7A 2N1TD 4K35A 4CPGA 3S4RA 3L75D 3C0DA 1EZVD 3V2QA 4Y28J 2NUKA 4DCKA 3WUTA 1RF1A 4JPZB 1ZV8A 1NTKK 1QX8A 2W90A 1VF5C 4WY4C 3RL0g 3I56P 4IFMA 4XE5B 1N73C 3FX0A 3JCUH 2IDBA 2XSHA 2AEFA 1ZN5A 2Y0EA 3L74D 2OYIC 5CBOA 5KTBA 2WMMA 3TNUB 3L72D 3W68A 4M3LA 2NVFA 4KHXA 2AXTE 2FXMA 1YHQP 1ZR4A 4RO0A 5BU5A 1IK9A 1BCCG 3RK3D 1IFJA 1KB9I 3CXHI 2YFIA 1L0NK 1EDKA 1ZW0A 3WMM0 3LW5J 4L74A 4AUWA 1TU3F 1MUUA 4XFJA 1OVVA 1DD3A 1OFCX 4B86A 1X9VA 2FYUD 4XA4A 5AVYB 3H32B 3P8CE 3AE6C 3BATA 4HJGH 3V4WA 3CC2P 1Q90D 3S9OA 1SQQG 2IBZI 4NBFD 2IZ0A 2BEQD 5APXA 3L71G 1QEXA 3IAOA 2QPZA 1BGYE 3CCSP 2N9YB 2JDIH 1RE3C 2OYHA 3D71A 3O6QA 2O01J 4Y99C 2XNDH 4H44B 2GUVA 4L75A 5GTHE 3CX5I 3L70E 2GA1A 5AVWB 3GLMA 4H13D 1GL2C 3GHGA 2QIWA 4GDOA 5KAIE 1S72P 1SQPK 2SPZA 3IFMA 2WVRA 1BCCJ 1OW7A 1Q86Q 3V2NA 3L75E 2Z5HA 3T97B 3A0HE 3AE9C 1FZGA 2HMOA 2CKFA 2YO3A 3G4SP 2Q3EA 1AA0A 3KZIE 2R5DA 3H1LD 2Q7CA 1SQBE 3U59A 2Y0CA 3AECC 1Z56A 3U1CA 1YTZI 1PGPA 5AW9B 5AEUA 2B87A 4GOFA 2G3AA 3VTPC 3W67A 1SQQJ 2KIKA 1NTZG 2YO2A 4W80A 1E5WA 2Q3IA 3L71J 2B24A 1G2CA 1D7MA 3AE7C 3AEGC 3L72E 3CCJP 4NB8D 3VOPA 2HMJA 3WUVA 2YIUB 1PL5A 2Y9YA 2L91A 3RK3E 2FFDA 2H43A 1FDMA 2YNYA 2ZT9C 1AQ5A 3AE1C 4WWIA 3TNUA 2C0XA 2Z5IA 1S9KE 1NKNA 1KB9E 3TYYA 1EC5A 4AIVA 1T6AA 3H1IJ 2FYUE 4L73A 1MFTA 3VMZA 4N6JA 3CXHE 2W6BA 1M1JB 2KNCB 1AQTA 3I55P 3ITKA 3A2AA 3VMXA 1JCDA 1WMKA 2A06G 3VCAA 2K1AA 2POHA 2K9JB 4OGQB 3EWKA 3H32A 1SFCD 2KS1A 1JMBA 2A45I 3CWBD 2P10A 2OYHC 2IBZE 2DE7D 2J5UA 1PZQA 3CPWO 2XR8A 1NTMG 1T3UA 3Q1MA 1EG9A 1SQVG 2DW3A 1NOHA 1NTZJ 1NJIQ 1NHLA 1PP9J 1GTWA 3GHGC 4WB4A 1LTAC 4C46A 2L5GB 1YQ3C 3M06A 3NMDA 4NPFX 1Q2NA 2ZYLA 1YI2P 1ULIA 3H1HD 1LWUB 1M7LA 3CCEP 4EDFA 2P2UA 1N8RQ 2B88A 4RJTA 1A02F 5HL4A 3H1LE 5CCGA 2E75D 2FYNB 4WVZA 1L0LG 3V4QA 2XNXA 3F5HA 3FWLA 2WITA 1FOSF 2E43A 1LT9A 2M5AB 3A0BH 5AW8B 3AE4C 2BCCG 4H44D 1IK7A 3VMID 2YKQA 1FBMA 5BU8B 3KXDA 2LKMA 1IC2A 1KV4A 1PPJD 1NTKG 4IOIH 2FFDC 2J59M 3B5NA 1NTMJ 3MP7B 2KSJA 2DE5D 5AVZB 1SQVJ 3R4YA 2K9YA 2V4HA 1YJNP 4NBDD 4TT3H 1SQBK 4HM8A 2Q3WA 2KZIA 2WSCJ 2O1KA 4R4LA 1YJWP 2HMKA 2WSCH 1LTJA 4GKGA 1PGJA 2Q5UA 1HJBA 2E76B 5KLVK 4PD4E 1K8AQ 2R44A 2I1JA 1L0NG 4K3AA 1KILD 2LXCB 2KNCA 3QWOC 1U7JA 1L0LJ 1KYOH 1OXZA 5CCHA 2BMQA 4EMJB 3JSVC 1E79H 1BCCD 1DD4A 3II6A 2BCCJ 1IFPA 1GMJA 2JWAA 3V2RA 4HH2A 3NFQA 1X8YA 2E74C 3HTKB 1JOCA 1WRGA 1ZOYC 3SWKA 2PAJA 2I8DA 2YXQB 1NTKJ 4OWFA 1YIJP 2JKVA 2GUSA 3H1HE 5CJ0A 5AW1B 3JCUE 1FZEA 4JQ0D 2D2CB 4YXWH 3CC4P 3CCMP 3AE3C 4JYBA 5CCGC 2LXBA 3MUDA 1JCCA 1ULJA 3B4SA 2H8PD 2I7FA 5KKZC 1SQQD 5AVRB 4ZKUA 1OIPA 2ZAEB 2ZXEB 2NPSB 4OGQD 1VM9A 1MFZA 4HB1A 1EDIA 3L71D 1N7SB 4MN4C 5KJ7A 1LT9C 2N1TA 2AEMA 1NU1D 1NYHA 1SQPG 3EFGA 1GU4A 4QDFB 3GZYA 1L0NJ 2M0BA 2KP8A 1L4AB 4HYTB 1PPJE 2QE7H 1NDOA 2W83C 3CI9A 2IX7C 2HMNA 1YITP 1S3JA 1EDJA 2WPQA 3B5NC 4WBAA 2RKLA 1EZVI 2W8ZA 1VQMP 4LGDE 2B89A 1URQB 2HG5D 5H2FE 2ZVNB 1USDA 2QM8A 1QVFO 4EOTA 1GZLA 2E4QA 3A7OA 1FOSE 4ZMDA 3HD7B 4OH8B 1LTJC 1O7MA 2N9BA 4W7ZA 1KQLA 3GCEA 1OX3A 2NVGA 3CCVP 1JY3O 4HM4A 2YKPA 1KTMA 1MV8A 2MKVA 1AVYA 4I7ZC 1DX7A 3GG2A 1KQSO 3BASA 3L36A 1FZFA 2AEJA 4NBGD 1IJDB 5APYA 3RK2C 1VQOP 3P32A 1SFCB 5CCHC 2HPCB 1SQPJ 4BXLA 2BMRA 4AQRD 1S1CX 3L73E 1K9MQ 1NKZB 2ZYAA 1SQXD 1FQTA 1T2KC 2XSOA 1IFDA 2E42A 3G6EP 2KOGA 2C9NY 3GF7A 2FBWC 3HE5A 4D6TG 1FZCA 3LW5H 2M3BA 4DZOA 1Y9BA 1NYKA 1VQPP 3HUSB 3M0AA 3MUDC 2E76D 5AVTB 2XKMA 1JTHA 2FXPA 1S5LX 3GTSA 1O7PA 5KJ7C 1J1EC 2E75B 3IN6A 3Q3DA 2N1TC 2HODA 3RGUA 1NU1E 2Z4EA 1UIIA 4PV1B 1YQ4C 2DE6D 1P84H 2YXRB 1RH5B 2UWJE 3MGNA 4UB6H 1IFNA 2M8RA 5L8RJ 3H1KE 3AEEC 3M9BA 3SFDC 1JY3P 1OVRA 1H0TB 1JMMA 4QMAA 1M90Q 3E1IA 1LP1A 2O01H 2GBWA 3TGUG 2QJKC 2ZT9D 2FKWB 3EFFK 5EFWB 1T3JA 2VRSA 1BGYG 3H1IG 1HVVA 2D2CD 2XDJA 3CD6P 3D70A 1EZVE 2XU6A 3C9IA 3HE4B 1VQ6P 3TSIA 2WSFJ 3DQYA 2NPSD 3CMAP 3L70G 4D6TJ 1DEBA 1RF1C 1U7MA 4BRYB 1KYOD 5TJHA 3RK3C 1N7SD 1PGQA 2Q6QA 2NWFA 3SWFA 4ZNCA 2ZVOB 4HKZH 5AW0B 3L37A 3L75G 2BCCD 4ASVA 1JM1A 1M1KQ 3H1JD 2QA4P 1KMIZ 1FAVA 1K05A 2QJPB 1L4AD 5APVA 3L74E 1KILB 4IL6X 3RL0B 1Q7YQ 1YTZT 1SQBG 1PP9G 2R3CA 2ZFCA 1NTKD 2FYZA 1Y47A 3MHVA 5KAFH 5KLIB 1HF9A 1Q90C 3GMAA 1AVOA 4UB8H 1SQXE 3E7KA 4L76A 1X0TA 3CCLP 5KLVG 4AAYB 1URQD 1HTLC 1SFCA 2QJYB 4H0LB 2WQYC 3TGUJ 1FZCC 1CI6B 1OMIA 3L72G 1BGYJ 3HD7D 1W5CE 2WWWA 1AV1A 4PD4I 3A0BE 2WPSA 4NB9D 3ZDMA 2E5YA 4HM0A 4H13C 1IO4A 1VF5B 3BVHA 4WY4B 1L0ND 1N73B 3L70J 1FS0E 5GTHH 1LTGC 3PH0A 1ZRTD 4RESB 1YJ9P 4BWNA 4NBED 1SLQA 5AW4B 1QGKB 1J1DC 2R32A 2OYIB 1EXJA 3L75J 1W2BO 5AVSB 1G8JB 4I6MC 5AVQB 3L35A 3F89A 2Y0DA 2QM7A 1JM0A 1SQBJ 1GW3A 1R8EA 2IBZG 2K37A 2PGDA 3RBZA 1R5LA 5KLVJ 3TF5A 3CCQP 1S4XA 3VMYA 3CC7P 1UIXA 4ASWA 1FJKA 1HJ0A 1KYOE 2YFJA 3L72J 5CBNA 2IYOA 5M1BA 3PRJA 1NU1K 2JZAA 4PV1D 3T97A 2BCCE 4U7JA 1OWAA 3H1JE 1G8KB 1RE4A 3H1LG 1LTSC 3TK1A 2CPBA 4Y99B 2WT7B 2NVEA 4QDCA 2FYUJ 1KB9H 4OVNF 1AJYA 3N4XA 1X22A 3CXHH 1PIXA 3N0QA 1GL2B 4O9BA 2QEXP 1USEA 2WPRA 1SFCC 3E1RA 1FZBA 1N2DC 1KILA 2P1JA 4C7NB 2NZ2A 1RF0A 5AVUB 1BSHA 2YFLA 1LJ2A 2W27A 4W7YA 1P84D 2Y9ZA 2KSEA 1KD1Q 4HJLA 1VQNP 2NUMA 1YYCA 2Q1KA 3BCCG 3OA7A 4EIJA 3CL3D 3RL0D 1M1JA 3Q5SA 2OTJP 1OW8A 3CWBE 3R2PA 1R5SA 4QDDA 1KQGB 5BVZA 1SQXK 3CX5H 1G1JA 2K9JA 3FXEA 3AEAC 3PHLA 3GKEA 2KYVA 5GTIH 3H1LJ 4H0LD 3GOBA 1LTIC 3OAKA 2ZT9B 5APQA 4N78D 4D6TD 1DIPA 1EDLA 4IFFA 1H88A 2JEEA 4NBBD 2FYUK 2HR3A 4H44C 1SS1A 1MKMA 3P8MC 1PFIA 3EN1A 2PP6A 3AE5C 4Z1MH 1JY3N 2WZ7A 2A45G 1VQ9P 2K88A 1VF5D 2IFMA 5AW7B 4WY4D 1RFSA 3FWNA 2V7QJ 5AVVB 1S5LH 2PRRA 2J58A 1JUNA 1LWUA 1QL1A 4U3FG 3H1HG 4KJMA 2NRGA 1HBWA 1K73Q 2KB7P 1RE4C 3AEFC 4YTPC 1FDOA 3BCCJ 2OYHB 2E4PA 1QVGO 3O6QB 3VMHD 2BASA 1HWTC 4HM2A 3TGUD 4DOJA 4QURA 1XTGB 2QG4A 5BOKA 1U57A 2M5AA 1WQLA 2KXPB 3H1ID 3M9QA 3A3YB 1UUVA 3GHGB 2R3SA 1JB0J 2W6JH 2G8YA 1LTBC 2OTKE 1JY2O 1HGVA 2WT7A 4NBCD 4YXDC 1VQ4P 2WTYA 4IFDK 2YIUC 2LR2A 1NAFA 1X79B 3L70D 1BE3G 4KT0J 1P84E 2YMKA 4UB6E 2QJYC 1MZ9A 1RQUA 1GU5A 4C7NA 3USSA 3VP8A 4PJ0H 3GL2A 2JWDA 1VQ5P 1LT1A 1T8ZA 3D6YA 1Q81Q 2KLUA 2A45H 2H89C 3WU2H 4LC1A 2B87B 1KILE 2QVAA 4N3YB 1M1JC 1NTZD 3C1LA 2CK3H 1NO4A 1SQBD 1PP9D 5AW2B 3OJAB 4U3FJ 3B8EB 3G3ZA 1HH0A 3H1HJ 1VQ7P 1G2CB 4IL6H 1RY3A 3Q2YA 1ZR2A 3MD0A 1BCCE 1CSBA 1GL2D 4OGQC 4HKVA 5KLVD 2FFDB 3VMGD 3BRVB 2I1KA 5B66H 2AXCA 1GK6A 4N78E 3NXSA 4D6TE 3M0DA 5DJTB 4NPEA 3GL0A 1OVUA 5B5EH 5TISH 3IR9A 1LTTC 1ZXGA 2ITAA 1O7NA 2QRXA 1VDFA 3L73G 1JY2P 1KFMA 3GB4A 3HTKA 1L2PA 1SQQE 3GF3A 2A06D 3S1KA 3MIWA 2YKOA 1GK4A 1BE3J 3VCPA 3L71E 5CXMA 1LWUC 1WT6A 5KAFE 1CZQA 1S9KD 1KB9D 4HM5A 4UB8E 3CXHD 2KS1B 1FE6A 1RHZB 5CHXA 5E79H 3V5BA 2FYNC 1OW6A 1A02J 1NTMD 1O7GA 2WSEJ 3GZXA 2NPSA 2KUBA 4EYYQ 5C39A 3TGUE 3LIEA 2WSEH 5H2FH 1N7SA 1SQVD 2WPVB 3CLQA 1NH4A 3H1IE 2JO6A 1HGZA 4QDFA 2RH0A 2PFXA 1NU1G 2ZYDA 2E74B 1VPCA 2IBZD 5AW6B 4HM6A 3RBXA 2JR8A 4ZKPA 2BMOA 2O1JA 1KYOI 2RN0A 2HMMA 5APUA 2O3JA 3H1KG 2OTLP 1L4AA 1K04A 2XV5A 3GTEA 4QCKA 3H25A 1O7HA 1ZP0C 2FY8A 5AEWA 2YVJB 1GW4A 1LNQA 2OYOA 2WSFH 5KKZB 2ZJSE 1Y8AA 1L0LD 1VL2A 1URQA 3CX5D 3AE8C 4JBZA 4QUPA 2C0WA 3KPEA 3L73J 1LT9B 1LGHB 1XTCC 2RMZA 2AXTH 1NVOA 1NTZE 1EZVG 3HD7A 1PP9E 5K5GB 3D89A 2E76C 1CW5A 4QUQA 5KLVE 1UUWA 4AYCA 3B5NB 1JEKA 3G9RA 5AW3B 3M0DC 1AFOA 1PGOA 3PLNA 4NBAD 2HPCA 1FJPA 3L74G 2HYNA 4JYCA 2C9LY 2IPPA 1NU1J 1IFIA 3FOUA
chains in the Genus database with same CATH topology
3L73E 5AEUA 1EZVE 4HM8A 3H1IE 1FQTA 2JO6A 2Q3WA 4NBED 4QDFB 3DQYA 3N0QA 4QDFA 2XSOA 1VF5D 2HMKA 4HM3A 3GZYA 1RFSA 2A06E 4HM6A 2NWFA 1RIEA 1SJGA 2B1XA 3EQQA 2BMOA 2B24A 4HM7A 3L72E 2ZYLA 1G8JB 4P1BH 2HMMA 4NB8D 4NBFD 1NTKE 1ULIA 4P1CH 4PD4E 2HMJA 1BCCE 3GTEA 1PPJE 1NDOA 3C0DA 4HKVA 2HMNA 2E74D 2YFLA 4QCKA 3VMGD 1O7HA 2QPZA 2NUKA 1NYKA 4NBHD 1BGYE 1JM1A 3AZCA 5AEWA 5HL4A 3H1LE 2E76D 2YVJB 2E4PA 2E75D 4D6TE 4HM1A 1NTME 3L74E 3VMHD 4HJLA 4U3FE 3GTSA 2NUMA 1O7PA 3GL0A 1SQVE 4HM2A 2BMQA 4QUPA 4AIVA 1KB9E 2XRXA 4QURA 4EMJB 1SQPE 2FYUE 1O7NA 1Q90C 5BOKA 1SQXE 3CXHE 3L70E 1NU1E 2XSHA 2E4QA 1WQLA 1O7WA 4H13D 3CWBE 1NTZE 1UUVA 2DE6D 1KYOE 3GB4A 4AAYB 1PP9E 1O7MA 4H44D 1SQQE 2YFJA 3BCCE 3D89A 3H1KE 3VMID 4QDDA 3VCAA 3VCPA 3H1HE 3L71E 2JZAA 4NBCD 5CXMA 1L0NE 2NVFA 3L75E 4PV1D 4QUQA 3GCEA 2NVGA 2YIUC 4HM4A 4HM5A 2GBWA 5KLVE 1UUWA 3GKEA 2QJKC 1ZRTE 2ZT9D 2BCCE 2HMOA 2CKFA 2HMLA 4H0LD 1P84E 3GOBA 3H1JE 4NB9D 1G8KB 1ULJA 2QJYC 2IBZE 1SQBE 2DE7D 2I7FA 2FYNC 2QJPC 2YFIA 4HM0A 1L0LE 4NBGD 5KKZC 2DE5D 1O7GA 2D2CD 3GZXA 3GL2A 4NBAD 4OGQD 1VM9A 3CX5E 2GBXA 4NBBD 2XR8A 3TGUE 4QDCA 2NVEA 2BMRA 1VCKA 1BE3E 5KLIC 4NBDD 3FOUA 1EG9A 3EN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L73 E;  5AEU A;  1EZV E;  4HM8 A;  3H1I E;  1FQT A;  2JO6 A;  2Q3W A;  4NBE D;  4QDF B;  3DQY A;  3N0Q A;  4QDF A;  2XSO A;  1VF5 D;  2HMK A;  4HM3 A;  3GZY A;  1RFS A;  2A06 E;  4HM6 A;  2NWF A;  1RIE A;  1SJG A;  2B1X A;  3EQQ A;  2BMO A;  2B24 A;  4HM7 A;  3L72 E;  2ZYL A;  1G8J B;  4P1B H;  2HMM A;  4NB8 D;  4NBF D;  1NTK E;  1ULI A;  4P1C H;  4PD4 E;  2HMJ A;  1BCC E;  3GTE A;  1PPJ E;  1NDO A;  3C0D A;  4HKV A;  2HMN A;  2E74 D;  2YFL A;  4QCK A;  3VMG D;  1O7H A;  2QPZ A;  2NUK A;  1NYK A;  4NBH D;  1BGY E;  1JM1 A;  3AZC A;  5AEW A;  5HL4 A;  3H1L E;  2E76 D;  2YVJ B;  2E4P A;  2E75 D;  4D6T E;  4HM1 A;  1NTM E;  3L74 E;  3VMH D;  4HJL A;  4U3F E;  3GTS A;  2NUM A;  1O7P A;  3GL0 A;  1SQV E;  4HM2 A;  2BMQ A;  4QUP A;  4AIV A;  1KB9 E;  2XRX A;  4QUR A;  4EMJ B;  1SQP E;  2FYU E;  1O7N A;  1Q90 C;  5BOK A;  1SQX E;  3CXH E;  3L70 E;  1NU1 E;  2XSH A;  2E4Q A;  1WQL A;  1O7W A;  4H13 D;  3CWB E;  1NTZ E;  1UUV A;  2DE6 D;  1KYO E;  3GB4 A;  4AAY B;  1PP9 E;  1O7M A;  4H44 D;  1SQQ E;  2YFJ A;  3BCC E;  3D89 A;  3H1K E;  3VMI D;  4QDD A;  3VCA A;  3VCP A;  3H1H E;  3L71 E;  2JZA A;  4NBC D;  5CXM A;  1L0N E;  2NVF A;  3L75 E;  4PV1 D;  4QUQ A;  3GCE A;  2NVG A;  2YIU C;  4HM4 A;  4HM5 A;  2GBW A;  5KLV E;  1UUW A;  3GKE A;  2QJK C;  1ZRT E;  2ZT9 D;  2BCC E;  2HMO A;  2CKF A;  2HML A;  4H0L D;  1P84 E;  3GOB A;  3H1J E;  4NB9 D;  1G8K B;  1ULJ A;  2QJY C;  2IBZ E;  1SQB E;  2DE7 D;  2I7F A;  2FYN C;  2QJP C;  2YFI A;  4HM0 A;  1L0L E;  4NBG D;  5KKZ C;  2DE5 D;  1O7G A;  2D2C D;  3GZX A;  3GL2 A;  4NBA D;  4OGQ D;  1VM9 A;  3CX5 E;  2GBX A;  4NBB D;  2XR8 A;  3TGU E;  4QDC A;  2NVE A;  2BMR A;  1VCK A;  1BE3 E;  5KLI C;  4NBD D;  3FOU A;  1EG9 A;  3EN1 A; 
#chains in the Genus database with same CATH topology
 1GDT A;  3SWY A;  1KFN A;  2ZYG A;  3I5C A;  3Q5R A;  2Q9I A;  2P7J A;  1SQX G;  3H1K J;  4JF7 A;  2A06 E;  2OGU A;  1LTJ B;  1EXI A;  1RIE A;  1SJG A;  3BCC D;  3N7N A;  5APT A;  2XZR A;  4P1C H;  4I1L A;  3M91 A;  2D2C C;  1KOR A;  3KDP B;  3SFE C;  4I7Z B;  4LLH A;  1N86 A;  1KQF B;  1DEE G;  3UIA A;  3CCR P;  3HUS A;  2FYU G;  4A7P A;  3AEB C;  1NTM E;  3RK2 B;  5KAI H;  2NPS C;  3TDK A;  1OZH A;  1N7S C;  1SQV E;  4GT1 A;  4PD4 D;  1NAY A;  1VQ8 P;  1W2E A;  3A0H H;  1SVF A;  5AW5 B;  4R4M A;  3PJS K;  4GOD A;  5APW A;  1G1I A;  1JNM A;  2JJL A;  3KZI H;  3OW2 O;  3VYI A;  2MJZ A;  1L4A C;  1H0T A;  3VN0 A;  2CPS A;  3V6I A;  1EQ7 A;  3NTN A;  4NPD A;  5AVX B;  2JO1 A;  1SQQ K;  1FZA A;  4TLF A;  1HUC A;  2P67 A;  3L74 J;  1QLE D;  2IFN A;  1L0L E;  2ZXX A;  1NGM B;  3K5B A;  1URQ C;  3CX5 E;  4U3F D;  3L4F A;  3C8V A;  1S2E A;  1J1E B;  1SQX J;  3GW6 A;  1SQP D;  2B9B A;  2N1T B;  2BEZ F;  5GTI E;  5DJU B;  4I2L C;  3VP9 A;  3WUU A;  3HE4 A;  5APS A;  1VQK P;  3B71 A;  5CJ4 A;  3HRN A;  3HD7 C;  4BRY A;  4YPC A;  2B1X A;  2IZ1 A;  1NTK E;  3FGA D;  1FC2 C;  1H8A A;  2E74 D;  2QJK B;  1GD2 E;  3AZC A;  2OQQ A;  1VQL P;  4HM1 A;  3H1J G;  1S5L E;  1P84 I;  3CCU P;  1BE3 D;  5CCG D;  1O7W A;  2K3R A;  1RF1 B;  2H88 C;  3BCC E;  3RK3 B;  3D6Z A;  1YBK A;  1CI6 A;  1L0N E;  1KZU B;  3A5T A;  1NTZ K;  3U1A A;  1BSN A;  3ABV C;  1ZRT E;  3QH9 A;  3Q5P A;  4RKU J;  4DT0 A;  3HUS C;  4EI2 A;  4GOE A;  2HLO A;  3VMA A;  2O01 N;  1PV3 A;  3BRT B;  1KN7 A;  3JC2 2;  4WY4 A;  4DJG A;  5CMZ A;  2E75 C;  1JY2 N;  1N73 A;  3B5N D;  2GM4 A;  2OAR A;  4PV1 C;  2WSS H;  4C7R A;  3V2P A;  3SSU A;  2IYP A;  3CWB G;  4PJ0 E;  2E5T A;  3EQQ A;  2OYI A;  3EQ2 A;  3HE5 B;  4P1B H;  1FZC B;  3AE2 C;  2KK7 A;  3WU2 E;  1ZLL A;  3P7K A;  3L73 D;  3H1J J;  3KYQ A;  1BDD A;  2KI7 B;  3AED C;  4NBH D;  2KZJ A;  3KHU A;  1FDI A;  1JTH B;  1Q82 Q;  1RQV A;  2M3E A;  4IL6 E;  4H13 B;  4U3F E;  3O8Z A;  3M9H A;  1M57 D;  2V7Q H;  1H89 A;  2XRX A;  1SQP E;  1DH3 A;  2HOD B;  1NWQ A;  1NTM K;  3MTU E;  3RK2 D;  1QL2 A;  3LID A;  3P8C D;  3FXD A;  5CCH D;  2R5B A;  5B66 E;  3H6P A;  1SQV K;  1J1D B;  1BDC A;  5TIS E;  2FXO A;  1N7L A;  3PTZ A;  5B5E E;  1IZN B;  1LP1 B;  1T2K D;  3MZW B;  2HML A;  3KQG A;  1BGY D;  3G71 P;  2H7H A;  1RE3 A;  2P58 A;  1M8O B;  2QJP C;  1KIL C;  3RL0 C;  3H1K D;  1KC8 Q;  2GBX A;  1ZME C;  1RF0 C;  1FU1 A;  3PP5 A;  2W6A A;  1VCK A;  1BE3 E;  1M56 D;  5KLI C;  4PD4 H;  4GIF A;  2YMY A;  1JO5 A;  3IF4 A;  3CWB J;  1L0L K;  2KLV A;  2HFE D;  1PPJ G;  1GL2 A;  1J2J B;  5E79 E;  4HM3 A;  3CME P;  5KJ7 D;  2JP3 A;  4H0L C;  2QSI A;  1SP4 A;  1IFM A;  4HM7 A;  2N1T D;  4K35 A;  4CPG A;  3S4R A;  3L75 D;  3C0D A;  1EZV D;  3V2Q A;  4Y28 J;  2NUK A;  4DCK A;  3WUT A;  1RF1 A;  4JPZ B;  1ZV8 A;  1NTK K;  1QX8 A;  2W90 A;  1VF5 C;  4WY4 C;  3RL0 g;  3I56 P;  4IFM A;  4XE5 B;  1N73 C;  3FX0 A;  3JCU H;  2IDB A;  2XSH A;  2AEF A;  1ZN5 A;  2Y0E A;  3L74 D;  2OYI C;  5CBO A;  5KTB A;  2WMM A;  3TNU B;  3L72 D;  3W68 A;  4M3L A;  2NVF A;  4KHX A;  2AXT E;  2FXM A;  1YHQ P;  1ZR4 A;  4RO0 A;  5BU5 A;  1IK9 A;  1BCC G;  3RK3 D;  1IFJ A;  1KB9 I;  3CXH I;  2YFI A;  1L0N K;  1EDK A;  1ZW0 A;  3WMM 0;  3LW5 J;  4L74 A;  4AUW A;  1TU3 F;  1MUU A;  4XFJ A;  1OVV A;  1DD3 A;  1OFC X;  4B86 A;  1X9V A;  2FYU D;  4XA4 A;  5AVY B;  3H32 B;  3P8C E;  3AE6 C;  3BAT A;  4HJG H;  3V4W A;  3CC2 P;  1Q90 D;  3S9O A;  1SQQ G;  2IBZ I;  4NBF D;  2IZ0 A;  2BEQ D;  5APX A;  3L71 G;  1QEX A;  3IAO A;  2QPZ A;  1BGY E;  3CCS P;  2N9Y B;  2JDI H;  1RE3 C;  2OYH A;  3D71 A;  3O6Q A;  2O01 J;  4Y99 C;  2XND H;  4H44 B;  2GUV A;  4L75 A;  5GTH E;  3CX5 I;  3L70 E;  2GA1 A;  5AVW B;  3GLM A;  4H13 D;  1GL2 C;  3GHG A;  2QIW A;  4GDO A;  5KAI E;  1S72 P;  1SQP K;  2SPZ A;  3IFM A;  2WVR A;  1BCC J;  1OW7 A;  1Q86 Q;  3V2N A;  3L75 E;  2Z5H A;  3T97 B;  3A0H E;  3AE9 C;  1FZG A;  2HMO A;  2CKF A;  2YO3 A;  3G4S P;  2Q3E A;  1AA0 A;  3KZI E;  2R5D A;  3H1L D;  2Q7C A;  1SQB E;  3U59 A;  2Y0C A;  3AEC C;  1Z56 A;  3U1C A;  1YTZ I;  1PGP A;  5AW9 B;  5AEU A;  2B87 A;  4GOF A;  2G3A A;  3VTP C;  3W67 A;  1SQQ J;  2KIK A;  1NTZ G;  2YO2 A;  4W80 A;  1E5W A;  2Q3I A;  3L71 J;  2B24 A;  1G2C A;  1D7M A;  3AE7 C;  3AEG C;  3L72 E;  3CCJ P;  4NB8 D;  3VOP A;  2HMJ A;  3WUV A;  2YIU B;  1PL5 A;  2Y9Y A;  2L91 A;  3RK3 E;  2FFD A;  2H43 A;  1FDM A;  2YNY A;  2ZT9 C;  1AQ5 A;  3AE1 C;  4WWI A;  3TNU A;  2C0X A;  2Z5I A;  1S9K E;  1NKN A;  1KB9 E;  3TYY A;  1EC5 A;  4AIV A;  1T6A A;  3H1I J;  2FYU E;  4L73 A;  1MFT A;  3VMZ A;  4N6J A;  3CXH E;  2W6B A;  1M1J B;  2KNC B;  1AQT A;  3I55 P;  3ITK A;  3A2A A;  3VMX A;  1JCD A;  1WMK A;  2A06 G;  3VCA A;  2K1A A;  2POH A;  2K9J B;  4OGQ B;  3EWK A;  3H32 A;  1SFC D;  2KS1 A;  1JMB A;  2A45 I;  3CWB D;  2P10 A;  2OYH C;  2IBZ E;  2DE7 D;  2J5U A;  1PZQ A;  3CPW O;  2XR8 A;  1NTM G;  1T3U A;  3Q1M A;  1EG9 A;  1SQV G;  2DW3 A;  1NOH A;  1NTZ J;  1NJI Q;  1NHL A;  1PP9 J;  1GTW A;  3GHG C;  4WB4 A;  1LTA C;  4C46 A;  2L5G B;  1YQ3 C;  3M06 A;  3NMD A;  4NPF X;  1Q2N A;  2ZYL A;  1YI2 P;  1ULI A;  3H1H D;  1LWU B;  1M7L A;  3CCE P;  4EDF A;  2P2U A;  1N8R Q;  2B88 A;  4RJT A;  1A02 F;  5HL4 A;  3H1L E;  5CCG A;  2E75 D;  2FYN B;  4WVZ A;  1L0L G;  3V4Q A;  2XNX A;  3F5H A;  3FWL A;  2WIT A;  1FOS F;  2E43 A;  1LT9 A;  2M5A B;  3A0B H;  5AW8 B;  3AE4 C;  2BCC G;  4H44 D;  1IK7 A;  3VMI D;  2YKQ A;  1FBM A;  5BU8 B;  3KXD A;  2LKM A;  1IC2 A;  1KV4 A;  1PPJ D;  1NTK G;  4IOI H;  2FFD C;  2J59 M;  3B5N A;  1NTM J;  3MP7 B;  2KSJ A;  2DE5 D;  5AVZ B;  1SQV J;  3R4Y A;  2K9Y A;  2V4H A;  1YJN P;  4NBD D;  4TT3 H;  1SQB K;  4HM8 A;  2Q3W A;  2KZI A;  2WSC J;  2O1K A;  4R4L A;  1YJW P;  2HMK A;  2WSC H;  1LTJ A;  4GKG A;  1PGJ A;  2Q5U A;  1HJB A;  2E76 B;  5KLV K;  4PD4 E;  1K8A Q;  2R44 A;  2I1J A;  1L0N G;  4K3A A;  1KIL D;  2LXC B;  2KNC A;  3QWO C;  1U7J A;  1L0L J;  1KYO H;  1OXZ A;  5CCH A;  2BMQ A;  4EMJ B;  3JSV C;  1E79 H;  1BCC D;  1DD4 A;  3II6 A;  2BCC J;  1IFP A;  1GMJ A;  2JWA A;  3V2R A;  4HH2 A;  3NFQ A;  1X8Y A;  2E74 C;  3HTK B;  1JOC A;  1WRG A;  1ZOY C;  3SWK A;  2PAJ A;  2I8D A;  2YXQ B;  1NTK J;  4OWF A;  1YIJ P;  2JKV A;  2GUS A;  3H1H E;  5CJ0 A;  5AW1 B;  3JCU E;  1FZE A;  4JQ0 D;  2D2C B;  4YXW H;  3CC4 P;  3CCM P;  3AE3 C;  4JYB A;  5CCG C;  2LXB A;  3MUD A;  1JCC A;  1ULJ A;  3B4S A;  2H8P D;  2I7F A;  5KKZ C;  1SQQ D;  5AVR B;  4ZKU A;  1OIP A;  2ZAE B;  2ZXE B;  2NPS B;  4OGQ D;  1VM9 A;  1MFZ A;  4HB1 A;  1EDI A;  3L71 D;  1N7S B;  4MN4 C;  5KJ7 A;  1LT9 C;  2N1T A;  2AEM A;  1NU1 D;  1NYH A;  1SQP G;  3EFG A;  1GU4 A;  4QDF B;  3GZY A;  1L0N J;  2M0B A;  2KP8 A;  1L4A B;  4HYT B;  1PPJ E;  2QE7 H;  1NDO A;  2W83 C;  3CI9 A;  2IX7 C;  2HMN A;  1YIT P;  1S3J A;  1EDJ A;  2WPQ A;  3B5N C;  4WBA A;  2RKL A;  1EZV I;  2W8Z A;  1VQM P;  4LGD E;  2B89 A;  1URQ B;  2HG5 D;  5H2F E;  2ZVN B;  1USD A;  2QM8 A;  1QVF O;  4EOT A;  1GZL A;  2E4Q A;  3A7O A;  1FOS E;  4ZMD A;  3HD7 B;  4OH8 B;  1LTJ C;  1O7M A;  2N9B A;  4W7Z A;  1KQL A;  3GCE A;  1OX3 A;  2NVG A;  3CCV P;  1JY3 O;  4HM4 A;  2YKP A;  1KTM A;  1MV8 A;  2MKV A;  1AVY A;  4I7Z C;  1DX7 A;  3GG2 A;  1KQS O;  3BAS A;  3L36 A;  1FZF A;  2AEJ A;  4NBG D;  1IJD B;  5APY A;  3RK2 C;  1VQO P;  3P32 A;  1SFC B;  5CCH C;  2HPC B;  1SQP J;  4BXL A;  2BMR A;  4AQR D;  1S1C X;  3L73 E;  1K9M Q;  1NKZ B;  2ZYA A;  1SQX D;  1FQT A;  1T2K C;  2XSO A;  1IFD A;  2E42 A;  3G6E P;  2KOG A;  2C9N Y;  3GF7 A;  2FBW C;  3HE5 A;  4D6T G;  1FZC A;  3LW5 H;  2M3B A;  4DZO A;  1Y9B A;  1NYK A;  1VQP P;  3HUS B;  3M0A A;  3MUD C;  2E76 D;  5AVT B;  2XKM A;  1JTH A;  2FXP A;  1S5L X;  3GTS A;  1O7P A;  5KJ7 C;  1J1E C;  2E75 B;  3IN6 A;  3Q3D A;  2N1T C;  2HOD A;  3RGU A;  1NU1 E;  2Z4E A;  1UII A;  4PV1 B;  1YQ4 C;  2DE6 D;  1P84 H;  2YXR B;  1RH5 B;  2UWJ E;  3MGN A;  4UB6 H;  1IFN A;  2M8R A;  5L8R J;  3H1K E;  3AEE C;  3M9B A;  3SFD C;  1JY3 P;  1OVR A;  1H0T B;  1JMM A;  4QMA A;  1M90 Q;  3E1I A;  1LP1 A;  2O01 H;  2GBW A;  3TGU G;  2QJK C;  2ZT9 D;  2FKW B;  3EFF K;  5EFW B;  1T3J A;  2VRS A;  1BGY G;  3H1I G;  1HVV A;  2D2C D;  2XDJ A;  3CD6 P;  3D70 A;  1EZV E;  2XU6 A;  3C9I A;  3HE4 B;  1VQ6 P;  3TSI A;  2WSF J;  3DQY A;  2NPS D;  3CMA P;  3L70 G;  4D6T J;  1DEB A;  1RF1 C;  1U7M A;  4BRY B;  1KYO D;  5TJH A;  3RK3 C;  1N7S D;  1PGQ A;  2Q6Q A;  2NWF A;  3SWF A;  4ZNC A;  2ZVO B;  4HKZ H;  5AW0 B;  3L37 A;  3L75 G;  2BCC D;  4ASV A;  1JM1 A;  1M1K Q;  3H1J D;  2QA4 P;  1KMI Z;  1FAV A;  1K05 A;  2QJP B;  1L4A D;  5APV A;  3L74 E;  1KIL B;  4IL6 X;  3RL0 B;  1Q7Y Q;  1YTZ T;  1SQB G;  1PP9 G;  2R3C A;  2ZFC A;  1NTK D;  2FYZ A;  1Y47 A;  3MHV A;  5KAF H;  5KLI B;  1HF9 A;  1Q90 C;  3GMA A;  1AVO A;  4UB8 H;  1SQX E;  3E7K A;  4L76 A;  1X0T A;  3CCL P;  5KLV G;  4AAY B;  1URQ D;  1HTL C;  1SFC A;  2QJY B;  4H0L B;  2WQY C;  3TGU J;  1FZC C;  1CI6 B;  1OMI A;  3L72 G;  1BGY J;  3HD7 D;  1W5C E;  2WWW A;  1AV1 A;  4PD4 I;  3A0B E;  2WPS A;  4NB9 D;  3ZDM A;  2E5Y A;  4HM0 A;  4H13 C;  1IO4 A;  1VF5 B;  3BVH A;  4WY4 B;  1L0N D;  1N73 B;  3L70 J;  1FS0 E;  5GTH H;  1LTG C;  3PH0 A;  1ZRT D;  4RES B;  1YJ9 P;  4BWN A;  4NBE D;  1SLQ A;  5AW4 B;  1QGK B;  1J1D C;  2R32 A;  2OYI B;  1EXJ A;  3L75 J;  1W2B O;  5AVS B;  1G8J B;  4I6M C;  5AVQ B;  3L35 A;  3F89 A;  2Y0D A;  2QM7 A;  1JM0 A;  1SQB J;  1GW3 A;  1R8E A;  2IBZ G;  2K37 A;  2PGD A;  3RBZ A;  1R5L A;  5KLV J;  3TF5 A;  3CCQ P;  1S4X A;  3VMY A;  3CC7 P;  1UIX A;  4ASW A;  1FJK A;  1HJ0 A;  1KYO E;  2YFJ A;  3L72 J;  5CBN A;  2IYO A;  5M1B A;  3PRJ A;  1NU1 K;  2JZA A;  4PV1 D;  3T97 A;  2BCC E;  4U7J A;  1OWA A;  3H1J E;  1G8K B;  1RE4 A;  3H1L G;  1LTS C;  3TK1 A;  2CPB A;  4Y99 B;  2WT7 B;  2NVE A;  4QDC A;  2FYU J;  1KB9 H;  4OVN F;  1AJY A;  3N4X A;  1X22 A;  3CXH H;  1PIX A;  3N0Q A;  1GL2 B;  4O9B A;  2QEX P;  1USE A;  2WPR A;  1SFC C;  3E1R A;  1FZB A;  1N2D C;  1KIL A;  2P1J A;  4C7N B;  2NZ2 A;  1RF0 A;  5AVU B;  1BSH A;  2YFL A;  1LJ2 A;  2W27 A;  4W7Y A;  1P84 D;  2Y9Z A;  2KSE A;  1KD1 Q;  4HJL A;  1VQN P;  2NUM A;  1YYC A;  2Q1K A;  3BCC G;  3OA7 A;  4EIJ A;  3CL3 D;  3RL0 D;  1M1J A;  3Q5S A;  2OTJ P;  1OW8 A;  3CWB E;  3R2P A;  1R5S A;  4QDD A;  1KQG B;  5BVZ A;  1SQX K;  3CX5 H;  1G1J A;  2K9J A;  3FXE A;  3AEA C;  3PHL A;  3GKE A;  2KYV A;  5GTI H;  3H1L J;  4H0L D;  3GOB A;  1LTI C;  3OAK A;  2ZT9 B;  5APQ A;  4N78 D;  4D6T D;  1DIP A;  1EDL A;  4IFF A;  1H88 A;  2JEE A;  4NBB D;  2FYU K;  2HR3 A;  4H44 C;  1SS1 A;  1MKM A;  3P8M C;  1PFI A;  3EN1 A;  2PP6 A;  3AE5 C;  4Z1M H;  1JY3 N;  2WZ7 A;  2A45 G;  1VQ9 P;  2K88 A;  1VF5 D;  2IFM A;  5AW7 B;  4WY4 D;  1RFS A;  3FWN A;  2V7Q J;  5AVV B;  1S5L H;  2PRR A;  2J58 A;  1JUN A;  1LWU A;  1QL1 A;  4U3F G;  3H1H G;  4KJM A;  2NRG A;  1HBW A;  1K73 Q;  2KB7 P;  1RE4 C;  3AEF C;  4YTP C;  1FDO A;  3BCC J;  2OYH B;  2E4P A;  1QVG O;  3O6Q B;  3VMH D;  2BAS A;  1HWT C;  4HM2 A;  3TGU D;  4DOJ A;  4QUR A;  1XTG B;  2QG4 A;  5BOK A;  1U57 A;  2M5A A;  1WQL A;  2KXP B;  3H1I D;  3M9Q A;  3A3Y B;  1UUV A;  3GHG B;  2R3S A;  1JB0 J;  2W6J H;  2G8Y A;  1LTB C;  2OTK E;  1JY2 O;  1HGV A;  2WT7 A;  4NBC D;  4YXD C;  1VQ4 P;  2WTY A;  4IFD K;  2YIU C;  2LR2 A;  1NAF A;  1X79 B;  3L70 D;  1BE3 G;  4KT0 J;  1P84 E;  2YMK A;  4UB6 E;  2QJY C;  1MZ9 A;  1RQU A;  1GU5 A;  4C7N A;  3USS A;  3VP8 A;  4PJ0 H;  3GL2 A;  2JWD A;  1VQ5 P;  1LT1 A;  1T8Z A;  3D6Y A;  1Q81 Q;  2KLU A;  2A45 H;  2H89 C;  3WU2 H;  4LC1 A;  2B87 B;  1KIL E;  2QVA A;  4N3Y B;  1M1J C;  1NTZ D;  3C1L A;  2CK3 H;  1NO4 A;  1SQB D;  1PP9 D;  5AW2 B;  3OJA B;  4U3F J;  3B8E B;  3G3Z A;  1HH0 A;  3H1H J;  1VQ7 P;  1G2C B;  4IL6 H;  1RY3 A;  3Q2Y A;  1ZR2 A;  3MD0 A;  1BCC E;  1CSB A;  1GL2 D;  4OGQ C;  4HKV A;  5KLV D;  2FFD B;  3VMG D;  3BRV B;  2I1K A;  5B66 H;  2AXC A;  1GK6 A;  4N78 E;  3NXS A;  4D6T E;  3M0D A;  5DJT B;  4NPE A;  3GL0 A;  1OVU A;  5B5E H;  5TIS H;  3IR9 A;  1LTT C;  1ZXG A;  2ITA A;  1O7N A;  2QRX A;  1VDF A;  3L73 G;  1JY2 P;  1KFM A;  3GB4 A;  3HTK A;  1L2P A;  1SQQ E;  3GF3 A;  2A06 D;  3S1K A;  3MIW A;  2YKO A;  1GK4 A;  1BE3 J;  3VCP A;  3L71 E;  5CXM A;  1LWU C;  1WT6 A;  5KAF E;  1CZQ A;  1S9K D;  1KB9 D;  4HM5 A;  4UB8 E;  3CXH D;  2KS1 B;  1FE6 A;  1RHZ B;  5CHX A;  5E79 H;  3V5B A;  2FYN C;  1OW6 A;  1A02 J;  1NTM D;  1O7G A;  2WSE J;  3GZX A;  2NPS A;  2KUB A;  4EYY Q;  5C39 A;  3TGU E;  3LIE A;  2WSE H;  5H2F H;  1N7S A;  1SQV D;  2WPV B;  3CLQ A;  1NH4 A;  3H1I E;  2JO6 A;  1HGZ A;  4QDF A;  2RH0 A;  2PFX A;  1NU1 G;  2ZYD A;  2E74 B;  1VPC A;  2IBZ D;  5AW6 B;  4HM6 A;  3RBX A;  2JR8 A;  4ZKP A;  2BMO A;  2O1J A;  1KYO I;  2RN0 A;  2HMM A;  5APU A;  2O3J A;  3H1K G;  2OTL P;  1L4A A;  1K04 A;  2XV5 A;  3GTE A;  4QCK A;  3H25 A;  1O7H A;  1ZP0 C;  2FY8 A;  5AEW A;  2YVJ B;  1GW4 A;  1LNQ A;  2OYO A;  2WSF H;  5KKZ B;  2ZJS E;  1Y8A A;  1L0L D;  1VL2 A;  1URQ A;  3CX5 D;  3AE8 C;  4JBZ A;  4QUP A;  2C0W A;  3KPE A;  3L73 J;  1LT9 B;  1LGH B;  1XTC C;  2RMZ A;  2AXT H;  1NVO A;  1NTZ E;  1EZV G;  3HD7 A;  1PP9 E;  5K5G B;  3D89 A;  2E76 C;  1CW5 A;  4QUQ A;  5KLV E;  1UUW A;  4AYC A;  3B5N B;  1JEK A;  3G9R A;  5AW3 B;  3M0D C;  1AFO A;  1PGO A;  3PLN A;  4NBA D;  2HPC A;  1FJP A;  3L74 G;  2HYN A;  4JYC A;  2C9L Y;  2IPP A;  1NU1 J;  1IFI A;  3FOU A; 
#chains in the Genus database with same CATH homology
 3L73 E;  5AEU A;  1EZV E;  4HM8 A;  3H1I E;  1FQT A;  2JO6 A;  2Q3W A;  4NBE D;  4QDF B;  3DQY A;  3N0Q A;  4QDF A;  2XSO A;  1VF5 D;  2HMK A;  4HM3 A;  3GZY A;  1RFS A;  2A06 E;  4HM6 A;  2NWF A;  1RIE A;  1SJG A;  2B1X A;  3EQQ A;  2BMO A;  2B24 A;  4HM7 A;  3L72 E;  2ZYL A;  1G8J B;  4P1B H;  2HMM A;  4NB8 D;  4NBF D;  1NTK E;  1ULI A;  4P1C H;  4PD4 E;  2HMJ A;  1BCC E;  3GTE A;  1PPJ E;  1NDO A;  3C0D A;  4HKV A;  2HMN A;  2E74 D;  2YFL A;  4QCK A;  3VMG D;  1O7H A;  2QPZ A;  2NUK A;  1NYK A;  4NBH D;  1BGY E;  1JM1 A;  3AZC A;  5AEW A;  5HL4 A;  3H1L E;  2E76 D;  2YVJ B;  2E4P A;  2E75 D;  4D6T E;  4HM1 A;  1NTM E;  3L74 E;  3VMH D;  4HJL A;  4U3F E;  3GTS A;  2NUM A;  1O7P A;  3GL0 A;  1SQV E;  4HM2 A;  2BMQ A;  4QUP A;  4AIV A;  1KB9 E;  2XRX A;  4QUR A;  4EMJ B;  1SQP E;  2FYU E;  1O7N A;  1Q90 C;  5BOK A;  1SQX E;  3CXH E;  3L70 E;  1NU1 E;  2XSH A;  2E4Q A;  1WQL A;  1O7W A;  4H13 D;  3CWB E;  1NTZ E;  1UUV A;  2DE6 D;  1KYO E;  3GB4 A;  4AAY B;  1PP9 E;  1O7M A;  4H44 D;  1SQQ E;  2YFJ A;  3BCC E;  3D89 A;  3H1K E;  3VMI D;  4QDD A;  3VCA A;  3VCP A;  3H1H E;  3L71 E;  2JZA A;  4NBC D;  5CXM A;  1L0N E;  2NVF A;  3L75 E;  4PV1 D;  4QUQ A;  3GCE A;  2NVG A;  2YIU C;  4HM4 A;  4HM5 A;  2GBW A;  5KLV E;  1UUW A;  3GKE A;  2QJK C;  1ZRT E;  2ZT9 D;  2BCC E;  2HMO A;  2CKF A;  2HML A;  4H0L D;  1P84 E;  3GOB A;  3H1J E;  4NB9 D;  1G8K B;  1ULJ A;  2QJY C;  2IBZ E;  1SQB E;  2DE7 D;  2I7F A;  2FYN C;  2QJP C;  2YFI A;  4HM0 A;  1L0L E;  4NBG D;  5KKZ C;  2DE5 D;  1O7G A;  2D2C D;  3GZX A;  3GL2 A;  4NBA D;  4OGQ D;  1VM9 A;  3CX5 E;  2GBX A;  4NBB D;  2XR8 A;  3TGU E;  4QDC A;  2NVE A;  2BMR A;  1VCK A;  1BE3 E;  5KLI C;  4NBD D;  3FOU A;  1EG9 A;  3EN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...