3H1KE

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 30
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1kE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1kE02
1SQXE 1VM9A 4HKVA 1WQLA 4U3FE 3GZYA 2BCCE 1O7NA 4NB8D 2XSOA 3GL2A 4PV1D 3GTSA 4H44D 4NBCD 1O7MA 3L71E 2YVJB 1Q90C 2FYUE 1O7HA 2I7FA 3H1IE 4QUQA 2HMNA 2JO6A 2HMMA 3TGUE 2B24A 3GL0A 4PD4E 2E76D 2QJPC 5HL4A 2D2CD 2B1XA 2YIUC 4QDFB 2ZT9D 4AIVA 4HM5A 2HMLA 3L73E 3BCCE 1O7GA 2NWFA 3H1JE 5KLVE 3GTEA 3C0DA 2IBZE 4NBFD 1L0NE 5AEUA 1RFSA 1EG9A 3CXHE 2NUKA 4QUPA 1BCCE 1SJGA 5AEWA 3CWBE 3D89A 1SQQE 4HM7A 4HM3A 5KLIC 4H13D 2FYNC 4QDFA 5BOKA 3FOUA 2HMJA 1KYOE 1SQBE 1UUWA 2NVEA 4H0LD 5CXMA 1NTZE 1SQPE 1UUVA 2A06E 3GCEA 2YFIA 4HM0A 1NYKA 1KB9E 2E4QA 1L0LE 1ULIA 2HMOA 2YFLA 3VMID 3L74E 4QDCA 2Q3WA 3VCAA 1O7PA 4HM8A 1PPJE 2CKFA 1BE3E 2XR8A 3N0QA 2JZAA 1NTKE 3GOBA 4EMJB 1SQVE 2ZYLA 2QJYC 3VCPA 4QURA 2NVGA 1RIEA 1ULJA 2BMRA 1G8JB 4OGQD 2HMKA 3L72E 4HM6A 1NU1E 3CX5E 2GBWA 2DE7D 1EZVE 2QPZA 5KKZC 2E74D 4NBED 1ZRTE 3GKEA 2NUMA 1NTME 4HM1A 4HM4A 2E4PA 2BMQA 2YFJA 1BGYE 1P84E 1VCKA 3DQYA 1NDOA 3L70E 3H1KE 1O7WA 1JM1A 4QCKA 3EN1A 4HM2A 1VF5D 4NBAD 2XSHA 4NBBD 4NB9D 2XRXA 3EQQA 4D6TE 2BMOA 2DE5D 4NBDD 4P1BH 3L75E 3H1LE 3GZXA 3GB4A 2DE6D 2GBXA 4NBGD 4AAYB 4P1CH 4NBHD 3AZCA 1G8KB 2NVFA 3VMHD 2QJKC 4QDDA 2E75D 3H1HE 1PP9E 1FQTA 3VMGD 4HJLA
chains in the Genus database with same CATH superfamily
1M1JA 2YVJB 2JDIH 1P84H 4K35A 2JO6A 2O1JA 1SQPJ 2E76D 2FFDB 1ZP0C 1HGVA 3FXEA 5C39A 1NTKG 3D70A 4UB6H 2W6JH 1EG9A 3CXHE 3KYQA 5KLIC 3RBZA 4WB4A 2WSFJ 3G71P 2P58A 1SS1A 1G1IA 3GCEA 3NTNA 2OYOA 2JO1A 2RKLA 3GF3A 3GMAA 3CXHI 3AEBC 4Y99B 2E43A 4YXDC 2LXBA 2M3EA 4L73A 1OW6A 1OVRA 1JY3O 1GMJA 2NVGA 5CBNA 2ZYAA 1SP4A 3CWBD 1VQLP 2J58A 1DIPA 2P67A 2YFJA 3H1ID 3L75J 1VQKP 3DQYA 3CX5H 4HM2A 2N9BA 1NKZB 5DJTB 2ZJSE 1U7MA 1H0TB 3EWKA 1SQBK 4EYYQ 2QJKC 4QDDA 2OARA 2HG5D 4XA4A 2QM8A 4Y99C 4HJLA 3PLNA 1BGYG 1BCCJ 2O01N 2JR8A 2KLUA 2O3JA 2B88A 3HE4B 4TT3H 1KTMA 1SQXD 4W80A 1ZR2A 1FE6A 4I7ZC 2QJKB 2QJPB 1NTMJ 1NVOA 3C0DA 1IK7A 1PV3A 3E1IA 2O1KA 1N2DC 1PGPA 2FYNC 2JJLA 4QDFA 3V2NA 4I6MC 1GL2B 2WT7B 2N1TC 2C9NY 1NU1J 1H8AA 1IK9A 2I1JA 1GZLA 2FXOA 2E4QA 3L74E 3VCAA 2Q3WA 1IFJA 4A7PA 3N0QA 1LT9A 2M5AA 3P8CD 2WZ7A 3CCQP 4QURA 3H1IJ 2I8DA 2YKQA 3LIEA 3Q2YA 1YIJP 1T3JA 2V7QJ 2Y9YA 4W7ZA 3S4RA 4QMAA 1NO4A 2KOGA 3H32B 4D6TD 1OMIA 3QH9A 1EC5A 1LP1A 1FZCC 1RE3A 3MZWB 2HR3A 5GTIE 3AE3C 4OH8B 1KORA 3D6YA 3CMEP 3GZXA 2HODA 3MP7B 1KZUB 3A5TA 2LKMA 3Q3DA 3RK3B 4O9BA 4U3FE 1S5LH 1O7NA 4GOEA 5TISE 1O7HA 4GKGA 2QRXA 3VN0A 1NHLA 5APWA 3VP9A 3VYIA 2BCCJ 5APVA 2A45G 1L4AC 5CJ0A 1JEKA 1XTCC 3L75D 3H1LD 1S2EA 1SQBJ 3BVHA 1AVOA 1SQQE 3ZDMA 3M9QA 1S9KE 4DT0A 1LNQA 2G3AA 2W90A 2M8RA 3WUUA 2Q5UA 1L0LK 4RESB 2FKWB 2YFLA 4I7ZB 4QDCA 2FBWC 2IYPA 1LWUC 2P1JA 1NJIQ 2JZAA 3O8ZA 2JKVA 4IOIH 5H2FE 1BGYJ 2OTLP 1LTGC 1W2BO 3B5ND 2DE7D 3HD7A 2CK3H 4H13B 4IL6E 3G6EP 1PP9J 3F5HA 2IZ1A 2M3BA 3MIWA 1TU3F 3H1KE 4QCKA 2HFED 2L91A 1AA0A 3L4FA 5AVSB 1FZGA 4IFDK 1S4XA 2FXMA 3AEEC 5DJUB 5EFWB 3HTKA 1J1EC 4GODA 2XZRA 1JY2O 1L2PA 4OGQB 5KAFE 1WQLA 3H25A 2QSIA 1LGHB 2P2UA 3P32A 1FZCB 3H1IE 2WPRA 1AVYA 4PD4E 2A45I 2XNDH 2D2CD 1KQFB 3V5BA 2ZT9D 3V2QA 1SQVG 3II6A 2W8ZA 2XDJA 4XFJA 2SPZA 1SJGA 1K8AQ 1ZW0A 4BXLA 4GIFA 3SFDC 1N7SC 2FYNB 4I1LA 1H89A 2WSFH 1LT1A 2QE7H 2K3RA 1SQVK 4KHXA 2YMYA 1O7PA 4AQRD 3AE1C 2YO3A 1NTKE 3GOBA 3BCCG 3FGAD 3ITKA 2FYZA 2PRRA 1RE4A 1S1CX 1LTJA 2BEZF 3Q1MA 2JWAA 2E4PA 3R4YA 1OW7A 1FZBA 3FWNA 2IZ0A 3NFQA 1HTLC 1SQPK 1X0TA 1E5WA 1G2CA 4U3FJ 1Y8AA 3T97B 3SWKA 5TISH 1VQ6P 3P8CE 4PV1B 2KSJA 1NOHA 1YITP 2E75D 4YXWH 1H88A 4OWFA 3P7KA 3CL3D 2ZFCA 3A3YB 1D7MA 1QGKB 1RY3A 2QEXP 1X9VA 3HE5B 2I7FA 4ASVA 2CPSA 1FDIA 2XU6A 4RJTA 1IFMA 2ZVOB 2YKOA 1OWAA 4PV1C 3VMXA 2QA4P 1N73C 1WMKA 1EDKA 3OJAB 5AEWA 1JO5A 1SQXK 2G8YA 2WPVB 4H0LD 2NVEA 1OVVA 2K9JB 5APYA 1BCCD 1KMIZ 2IFNA 2QIWA 1PPJE 3CC7P 2XR8A 2A06D 1YTZI 3H1JG 3KZIE 1J1DC 1SQXG 2IBZI 3AEGC 3IF4A 3T97A 1PGQA 2P7JA 4OGQD 1IFNA 4ZKPA 3L72E 3V4WA 5AVXB 5BU5A 1G2CB 1HH0A 2QPZA 3EQ2A 2B89A 1S5LX 1KFNA 4NBED 2NUMA 2BMQA 5APXA 1JY3P 1IFIA 1FAVA 3L70G 3WU2E 1HWTC 3VMAA 3G9RA 1NTMD 1RQUA 2NVFA 1PL5A 3L72G 1R8EA 4JBZA 1RE3C 5CCGA 1SQXE 3OA7A 1SQBD 1GU5A 1NTZD 3B5NA 3M91A 1R5LA 2FYUE 1VQ5P 4QUQA 1P84D 3VOPA 3HE5A 2OGUA 1O7GA 1RF0C 1SFCC 4YPCA 5BU8B 5K5GB 3A0HE 1SFCA 1RF0A 3PP5A 5KJ7C 2OYIA 1ZXGA 2N1TA 3V6IA 5KAIH 4RKUJ 3A0BE 4GDOA 2YFIA 5KJ7A 4PJ0E 3GLMA 1KB9E 2HMOA 5GTIH 3CWBG 1GK6A 1U7JA 1KYOD 1CI6A 1ZMEC 4PD4D 2IBZG 1IC2A 5B66E 2KLVA 1L0LD 2HPCA 3N4XA 2QJYB 2R5BA 1MFTA 2NZ2A 5KKZC 1NTMK 3L71G 5APUA 5L8RJ 3PJSK 4W7YA 1FJPA 2JWDA 3RGUA 5CCGC 2Y0EA 3IAOA 3CD6P 1P84I 3HUSC 5AW0B 2K9YA 3L70D 1KD1Q 3F89A 1K05A 2JEEA 1QL2A 3JSVC 3S1KA 1T8ZA 4K3AA 3LIDA 1ZLLA 1QL1A 2XSOA 1JCCA 5AVUB 1FDMA 3L71E 1VQOP 2NPSC 1N86A 3HRNA 3JCUH 1BE3D 2IPPA 2KSEA 4DOJA 2GUSA 3U59A 3L36A 4WVZA 3B4SA 1DD3A 3FWLA 2Q1KA 1OZHA 5AEUA 1HF9A 3JC22 4TLFA 1LTTC 2J5UA 2FFDA 2K37A 2OTKE 5GTHH 1VQPP 3I56P 3TGUG 1Q86Q 4HKZH 2Q6QA 1GD2E 2AEFA 3RK3C 1M1KQ 3AEFC 1J1DB 1L0NG 3C1LA 1NTKK 2E76C 1NU1K 3HD7B 3L74J 2YO2A 3CX5E 1KQSO 3WMM0 1GTWA 1SQVJ 2FYUG 1VQMP 1JY2N 2LXCB 3MD0A 2BCCG 3FX0A 1FZFA 1O7WA 1PGJA 4NBAD 2N9YB 3RK2D 2V4HA 3L74D 1ZRTD 3M06A 1MKMA 2Q9IA 3GB4A 2P10A 2DE6D 1LTJC 1NU1G 1QVGO 2I1KA 1OFCX 4WY4D 3MTUE 1KILA 3B5NB 3CCEP 2Y9ZA 1M56D 1M7LA 3TNUA 2E5YA 3GHGC 1JUNA 1K9MQ 5CCHA 2H7HA 3GTEA 4OGQC 4NBFD 4H0LB 1BE3G 1RFSA 4KJMA 1DEBA 1L4AD 4C7RA 5KJ7D 4HM3A 4DJGA 2HMJA 5KLVD 1SQBE 3NMDA 2POHA 1FJKA 1NTZE 1N7SA 1NTKD 5B66H 1USEA 3GG2A 5AVYB 3S9OA 3RL0C 4H0LC 2M0BA 4EMJB 3A0BH 2QJYC 1JNMA 3CCLP 1AFOA 3E7KA 1G8JB 2HYNA 3VP8A 2HMKA 3EFGA 4U7JA 1Q90D 3MUDC 2GBWA 2K9JA 1S9KD 2A45H 2RH0A 1LTAC 1LJ2A 1EDIA 2YMKA 3MHVA 3I5CA 1HGZA 2WITA 3L73D 1K73Q 2GM4A 4NBDD 1RF1A 1L0ND 1N7SB 3HD7C 4AAYB 3EFFK 1SLQA 3CC4P 3VMGD 1Z56A 1OXZA 2KB7P 1LWUA 1FU1A 1XTGB 2KUBA 3AECC 3TYYA 4R4LA 3CX5I 3IN6A 1SQPG 3KZIH 4HM5A 4LC1A 1URQD 2ZYGA 3OW2O 2IYOA 1BCCE 2KS1A 5M1BA 2R44A 1E79H 2WSCJ 5BOKA 4N6JA 3BCCD 3H1JD 1BGYD 1UUVA 2A06E 4AYCA 5AVTB 1URQA 3ABVC 5AW5B 1BE3E 2NPSD 1M8OB 1SQVE 3MGNA 2L5GB 5KLIB 4UB8H 1VQ8P 3VCPA 1NAFA 1RIEA 2UWJE 2WVRA 1JTHA 1VQ7P 3VMYA 2NRGA 3VMZA 3H1LJ 1Y47A 1JMBA 3QWOC 4NPDA 4GT1A 3TGUD 3EN1A 2KK7A 1NH4A 3AE4C 3USSA 1M57D 1AV1A 3Q5PA 1RF1C 1GW3A 1L4AB 1HJ0A 3VMHD 4IFFA 3TSIA 2FYUD 3H1HE 3CI9A 1NKNA 1OVUA 2KS1B 1FZCA 2FY8A 2ITAA 3CX5D 4HKVA 3RL0D 2BCCE 5AVZB 1ZR4A 1BDCA 3GTSA 3G4SP 4DZOA 3GHGB 2WSEJ 3R2PA 2WQYC 1NTZK 5AVQB 2HMNA 4GOFA 3WUTA 2ZT9C 3HTKB 3KPEA 1K04A 2YIUC 1R5SA 2W6AA 2OYHA 1N7SD 3Q5SA 4PD4H 3LW5J 3L71J 3FOUA 2O01J 1KV4A 1KYOE 1YJNP 2E75C 1Y9BA 4HYTB 5CBOA 1HUCA 5KKZB 1L0LE 3SFEC 1SQQG 2OYIB 1S72P 3VMID 5AVVB 1SFCB 3GW6A 3OAKA 2CKFA 1QX8A 3H1KJ 2KNCB 2O01H 5CCHC 1KQGB 1JY2P 1JOCA 1OIPA 1PIXA 1J1EB 4WBAA 1DEEG 4EDFA 1EZVE 2OTJP 3SSUA 5AW1B 1UIIA 4HM4A 1G1JA 1NAYA 1CI6B 4PJ0H 1LTSC 5BVZA 1PP9G 3W68A 2BMOA 4P1BH 2N1TB 4XE5B 4BRYA 1G8KB 3IR9A 1CW5A 1PP9E 2B87B 2W27A 2QVAA 2RMZA 5E79E 3CCMP 3PRJA 1OW8A 3GZYA 2KI7B 4H44D 3CCUP 2B87A 1JCDA 3W67A 3L72J 2IDBA 3BATA 2B24A 2R5DA 4H44B 2B1XA 2Z5IA 1SQBG 3L73E 1CZQA 1GL2D 1X79B 2IBZE 1KILB 4N78D 3AE5C 3L74G 3AE9C 5AW7B 1L0LG 4IL6H 2PP6A 2Q3IA 3KQGA 2WSEH 1UUWA 1BE3J 1SVFA 1NYKA 3H1HJ 1DX7A 1KYOI 4JYCA 1U57A 1YI2P 1FZEA 1JB0J 2W6BA 1NU1E 2IFMA 1GL2C 1JY3N 3CCVP 2NPSA 2YXRB 4JPZB 3D6ZA 2Z4EA 5CCGD 2E42A 1VQ9P 1M1JC 4HM1A 1MZ9A 3AE6C 1BGYE 2PGDA 1EQ7A 1JM0A 5AW4B 3CCRP 2XSHA 4NBBD 2OYHB 2DE5D 1IFPA 1BDDA 3H1LG 3HUSA 2VRSA 1KFMA 4P1CH 4R4MA 4BRYB 2HPCB 2HODB 3BRTB 4L75A 1L0LJ 4C7NA 1RE4C 1T6AA 3FXDA 3V2PA 3CLQA 1VM9A 3TF5A 1T2KC 1SQQJ 1PFIA 1GDTA 3H32A 1T3UA 1L0NJ 2R3SA 4MN4C 2KYVA 3TGUE 1H0TA 3C8VA 1LTJB 1KB9I 1VF5C 2AEJA 5B5EH 4IL6X 3SWYA 1N8RQ 2KIKA 2C0WA 2M5AB 2N1TD 1PGOA 2H8PD 3D89A 4LLHA 4H13D 2E75B 1KN7A 3M9BA 1HJBA 3L73G 5CXMA 2NPSB 1GK4A 5KLVK 1ZN5A 1GW4A 1BCCG 2KP8A 3V4QA 1KYOH 1NTZJ 2ZYLA 2AEMA 1KQLA 3CCSP 1FC2C 1A02F 2OQQA 1LTBC 4D6TJ 1NTME 2AXCA 1VL2A 2JP3A 1JM1A 3CC2P 4CPGA 2ZT9B 2C0XA 3EQQA 3P8MC 1PZQA 4ZKUA 3RBXA 5AW6B 1IZNB 3H1KD 3CXHH 1WRGA 3JCUE 1YBKA 1USDA 3TGUJ 1NTMG 2D2CB 1IO4A 1VQNP 5CJ4A 2WSSH 2IX7C 2HMMA 1YHQP 3GL0A 2FXPA 1URQC 3I55P 3M0DA 2WTYA 3KDPB 2NWFA 3BCCE 1KILE 2GUVA 1FS0E 1EXJA 3U1CA 1BSHA 2D2CC 5AW8B 1BSNA 4C7NB 1FDOA 1NTZG 1N73A 3UIAA 3B8EB 4HM0A 1FOSE 2ZXEB 4EI2A 2WPSA 1QVFO 3A7OA 5TJHA 3N7NA 3O6QA 3TDKA 2IBZD 2DW3A 1ULJA 3H1HG 4YTPC 4HM6A 4U3FD 2ZVNB 2KZJA 4Y28J 2Y0CA 1S3JA 1EXIA 2H43A 2CPBA 5H2FH 1LP1B 1M1JB 3L70E 1NGMB 1YTZT 1WT6A 4HJGH 1YYCA 1AJYA 3H1HD 5KAFH 2PFXA 3H1LE 1NYHA 3PTZA 4NBHD 3AZCA 1Q81Q 3HE4A 3L73J 4HB1A 1N7LA 2B9BA 3H1KG 3L37A 1IFDA 2FYUK 5APTA 4B86A 3GF7A 2YNYA 1Q82Q 3GL2A 4ASWA 4ZNCA 2J59M 2E5TA 4NBCD 1O7MA 4WY4C 3H1JJ 3CPWO 3BCCJ 1KC8Q 2MKVA 1FZAA 4I2LC 3K5BA 2QM7A 1ZOYC 2BEQD 3WU2H 2A06G 4QDFB 2V7QH 3Q5RA 4AIVA 1MV8A 1L0NE 4AUWA 1HBWA 2E76B 2NUKA 5CHXA 1VQ4P 5B5EE 4H13C 1SQPE 3RL0B 3M0AA 3CWBJ 3GHGA 2YIUB 3LW5H 1IJDB 1EDJA 2OYHC 5KLVG 1EZVD 2XV5A 4L74A 2E74B 1AQTA 3RK3D 2BMRA 3CMAP 2HLOA 3E1RA 4Z1MH 1QEXA 1S5LE 4WY4A 2E74D 3PHLA 1MUUA 1ZRTE 3G3ZA 3GKEA 1LT9B 1KILC 2KNCA 2WMMA 5KAIE 4U3FG 1VCKA 1NDOA 3L72D 3L35A 1MFZA 1KB9H 2GA1A 1RHZB 1PP9D 1X8YA 2XRXA 4D6TE 1SFCD 2XKMA 5AW3B 4D6TG 3CXHD 4EIJA 1QLED 4H44C 2RN0A 3RK2B 3HD7D 3A2AA 1LWUB 4NPFX 2QG4A 3D71A 1NTKJ 3AE2C 5GTHE 4PV1D 3KHUA 1YJWP 4UB6E 1URQB 2K1AA 1SQXJ 5CMZA 4WWIA 3CCJP 1AQ5A 5HL4A 1NWQA 1RF1B 2HMLA 2FFDC 5KLVE 4OVNF 1HVVA 4ZMDA 2KXPB 4QUPA 1DD4A 1M90Q 1GU4A 4L76A 3CWBE 5APQA 4HM7A 4KT0J 5E79H 3B71A 5AVRB 1L4AA 1W5CE 2R3CA 2Y0DA 3HUSB 4WY4B 2BCCD 4UB8E 2MJZA 3NXSA 1DH3A 5CCHD 1ZV8A 3H1IG 4EOTA 4DCKA 3AEAC 1NU1D 3AE8C 3RL0g 1KB9D 2K88A 3M0DC 3WUVA 1KILD 4M3LA 5AVWB 1T2KD 1VF5B 5AW2B 1UIXA 5KLVJ 5AW9B 1YQ4C 4IFMA 2R32A 2WPQA 3U1AA 1VF5D 4JF7A 2KZIA 4NB9D 2WWWA 2BASA 2GBXA 2YXQB 3L70J 1CSBA 2W83C 1EZVI 3TNUB 1OX3A 3BRVB 1FQTA 1EDLA 1W2EA 3SWFA 1LT9C 4NB8D 4NPEA 1YJ9P 1Q90C 1RH5B 3MUDA 1SQQK 1LTIC 1PPJD 2QJPC 2H89C 3L71D 3H1JE 2XNXA 5KTBA 1PPJG 2H88C 3KXDA 4BWNA 2Z5HA 4LGDE 2Q3EA 1JMMA 1FOSF 2PAJA 2AXTH 1SQVD 2OYIC 4C46A 1ULIA 1X22A 3A0HH 3O6QB 4RO0A 4HM8A 3H6PA 2ZAEB 1Q2NA 3B5NC 2C9LY 2FYUJ 3BASA 2ZXXA 2E74C 1FBMA 4N78E 2YKPA 1VDFA 4PD4I 3V2RA 3PH0A 1N73B 1A02J 1Q7YQ 3AE7C 4HH2A 3VTPC 2AXTE 1P84E 1YQ3C 1SQPD 3IFMA 2Q7CA 3M9HA 2WSCH 4JQ0D 1J2JB 1L0NK 2ZYDA 1JTHB 3L75E 1VPCA 3C9IA 2LR2A 3L75G 1EZVG 4NBGD 3RK2C 1RQVA 4N3YB 4JYBA 1GL2A 2WT7A 3TK1A 1SQQD 3AEDC 3RK3E 5APSA
chains in the Genus database with same CATH topology
1SQXE 1VM9A 4HKVA 1WQLA 4U3FE 3GZYA 2BCCE 1O7NA 4NB8D 2XSOA 3GL2A 4PV1D 3GTSA 4H44D 4NBCD 1O7MA 3L71E 2YVJB 1Q90C 2FYUE 1O7HA 2I7FA 3H1IE 4QUQA 2HMNA 2JO6A 2HMMA 3TGUE 2B24A 3GL0A 4PD4E 2E76D 2QJPC 5HL4A 2D2CD 2B1XA 2YIUC 4QDFB 2ZT9D 4AIVA 4HM5A 2HMLA 3L73E 3BCCE 1O7GA 2NWFA 3H1JE 5KLVE 3GTEA 3C0DA 2IBZE 4NBFD 1L0NE 5AEUA 1RFSA 1EG9A 3CXHE 2NUKA 4QUPA 1BCCE 1SJGA 5AEWA 3CWBE 3D89A 1SQQE 4HM7A 4HM3A 5KLIC 4H13D 2FYNC 4QDFA 5BOKA 3FOUA 2HMJA 1KYOE 1SQBE 1UUWA 2NVEA 4H0LD 5CXMA 1NTZE 1SQPE 1UUVA 2A06E 3GCEA 2YFIA 4HM0A 1NYKA 1KB9E 2E4QA 1L0LE 1ULIA 2HMOA 2YFLA 3VMID 3L74E 4QDCA 2Q3WA 3VCAA 1O7PA 4HM8A 1PPJE 2CKFA 1BE3E 2XR8A 3N0QA 2JZAA 1NTKE 3GOBA 4EMJB 1SQVE 2ZYLA 2QJYC 3VCPA 4QURA 2NVGA 1RIEA 1ULJA 2BMRA 1G8JB 4OGQD 2HMKA 3L72E 4HM6A 1NU1E 3CX5E 2GBWA 2DE7D 1EZVE 2QPZA 5KKZC 2E74D 4NBED 1ZRTE 3GKEA 2NUMA 1NTME 4HM1A 4HM4A 2E4PA 2BMQA 2YFJA 1BGYE 1P84E 1VCKA 3DQYA 1NDOA 3L70E 3H1KE 1O7WA 1JM1A 4QCKA 3EN1A 4HM2A 1VF5D 4NBAD 2XSHA 4NBBD 4NB9D 2XRXA 3EQQA 4D6TE 2BMOA 2DE5D 4NBDD 4P1BH 3L75E 3H1LE 3GZXA 3GB4A 2DE6D 2GBXA 4NBGD 4AAYB 4P1CH 4NBHD 3AZCA 1G8KB 2NVFA 3VMHD 2QJKC 4QDDA 2E75D 3H1HE 1PP9E 1FQTA 3VMGD 4HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX E;  1VM9 A;  4HKV A;  1WQL A;  4U3F E;  3GZY A;  2BCC E;  1O7N A;  4NB8 D;  2XSO A;  3GL2 A;  4PV1 D;  3GTS A;  4H44 D;  4NBC D;  1O7M A;  3L71 E;  2YVJ B;  1Q90 C;  2FYU E;  1O7H A;  2I7F A;  3H1I E;  4QUQ A;  2HMN A;  2JO6 A;  2HMM A;  3TGU E;  2B24 A;  3GL0 A;  4PD4 E;  2E76 D;  2QJP C;  5HL4 A;  2D2C D;  2B1X A;  2YIU C;  4QDF B;  2ZT9 D;  4AIV A;  4HM5 A;  2HML A;  3L73 E;  3BCC E;  1O7G A;  2NWF A;  3H1J E;  5KLV E;  3GTE A;  3C0D A;  2IBZ E;  4NBF D;  1L0N E;  5AEU A;  1RFS A;  1EG9 A;  3CXH E;  2NUK A;  4QUP A;  1BCC E;  1SJG A;  5AEW A;  3CWB E;  3D89 A;  1SQQ E;  4HM7 A;  4HM3 A;  5KLI C;  4H13 D;  2FYN C;  4QDF A;  5BOK A;  3FOU A;  2HMJ A;  1KYO E;  1SQB E;  1UUW A;  2NVE A;  4H0L D;  5CXM A;  1NTZ E;  1SQP E;  1UUV A;  2A06 E;  3GCE A;  2YFI A;  4HM0 A;  1NYK A;  1KB9 E;  2E4Q A;  1L0L E;  1ULI A;  2HMO A;  2YFL A;  3VMI D;  3L74 E;  4QDC A;  2Q3W A;  3VCA A;  1O7P A;  4HM8 A;  1PPJ E;  2CKF A;  1BE3 E;  2XR8 A;  3N0Q A;  2JZA A;  1NTK E;  3GOB A;  4EMJ B;  1SQV E;  2ZYL A;  2QJY C;  3VCP A;  4QUR A;  2NVG A;  1RIE A;  1ULJ A;  2BMR A;  1G8J B;  4OGQ D;  2HMK A;  3L72 E;  4HM6 A;  1NU1 E;  3CX5 E;  2GBW A;  2DE7 D;  1EZV E;  2QPZ A;  5KKZ C;  2E74 D;  4NBE D;  1ZRT E;  3GKE A;  2NUM A;  1NTM E;  4HM1 A;  4HM4 A;  2E4P A;  2BMQ A;  2YFJ A;  1BGY E;  1P84 E;  1VCK A;  3DQY A;  1NDO A;  3L70 E;  3H1K E;  1O7W A;  1JM1 A;  4QCK A;  3EN1 A;  4HM2 A;  1VF5 D;  4NBA D;  2XSH A;  4NBB D;  4NB9 D;  2XRX A;  3EQQ A;  4D6T E;  2BMO A;  2DE5 D;  4NBD D;  4P1B H;  3L75 E;  3H1L E;  3GZX A;  3GB4 A;  2DE6 D;  2GBX A;  4NBG D;  4AAY B;  4P1C H;  4NBH D;  3AZC A;  1G8K B;  2NVF A;  3VMH D;  2QJK C;  4QDD A;  2E75 D;  3H1H E;  1PP9 E;  1FQT A;  3VMG D;  4HJL A; 
#chains in the Genus database with same CATH topology
 1M1J A;  2YVJ B;  2JDI H;  1P84 H;  4K35 A;  2JO6 A;  2O1J A;  1SQP J;  2E76 D;  2FFD B;  1ZP0 C;  1HGV A;  3FXE A;  5C39 A;  1NTK G;  3D70 A;  4UB6 H;  2W6J H;  1EG9 A;  3CXH E;  3KYQ A;  5KLI C;  3RBZ A;  4WB4 A;  2WSF J;  3G71 P;  2P58 A;  1SS1 A;  1G1I A;  3GCE A;  3NTN A;  2OYO A;  2JO1 A;  2RKL A;  3GF3 A;  3GMA A;  3CXH I;  3AEB C;  4Y99 B;  2E43 A;  4YXD C;  2LXB A;  2M3E A;  4L73 A;  1OW6 A;  1OVR A;  1JY3 O;  1GMJ A;  2NVG A;  5CBN A;  2ZYA A;  1SP4 A;  3CWB D;  1VQL P;  2J58 A;  1DIP A;  2P67 A;  2YFJ A;  3H1I D;  3L75 J;  1VQK P;  3DQY A;  3CX5 H;  4HM2 A;  2N9B A;  1NKZ B;  5DJT B;  2ZJS E;  1U7M A;  1H0T B;  3EWK A;  1SQB K;  4EYY Q;  2QJK C;  4QDD A;  2OAR A;  2HG5 D;  4XA4 A;  2QM8 A;  4Y99 C;  4HJL A;  3PLN A;  1BGY G;  1BCC J;  2O01 N;  2JR8 A;  2KLU A;  2O3J A;  2B88 A;  3HE4 B;  4TT3 H;  1KTM A;  1SQX D;  4W80 A;  1ZR2 A;  1FE6 A;  4I7Z C;  2QJK B;  2QJP B;  1NTM J;  1NVO A;  3C0D A;  1IK7 A;  1PV3 A;  3E1I A;  2O1K A;  1N2D C;  1PGP A;  2FYN C;  2JJL A;  4QDF A;  3V2N A;  4I6M C;  1GL2 B;  2WT7 B;  2N1T C;  2C9N Y;  1NU1 J;  1H8A A;  1IK9 A;  2I1J A;  1GZL A;  2FXO A;  2E4Q A;  3L74 E;  3VCA A;  2Q3W A;  1IFJ A;  4A7P A;  3N0Q A;  1LT9 A;  2M5A A;  3P8C D;  2WZ7 A;  3CCQ P;  4QUR A;  3H1I J;  2I8D A;  2YKQ A;  3LIE A;  3Q2Y A;  1YIJ P;  1T3J A;  2V7Q J;  2Y9Y A;  4W7Z A;  3S4R A;  4QMA A;  1NO4 A;  2KOG A;  3H32 B;  4D6T D;  1OMI A;  3QH9 A;  1EC5 A;  1LP1 A;  1FZC C;  1RE3 A;  3MZW B;  2HR3 A;  5GTI E;  3AE3 C;  4OH8 B;  1KOR A;  3D6Y A;  3CME P;  3GZX A;  2HOD A;  3MP7 B;  1KZU B;  3A5T A;  2LKM A;  3Q3D A;  3RK3 B;  4O9B A;  4U3F E;  1S5L H;  1O7N A;  4GOE A;  5TIS E;  1O7H A;  4GKG A;  2QRX A;  3VN0 A;  1NHL A;  5APW A;  3VP9 A;  3VYI A;  2BCC J;  5APV A;  2A45 G;  1L4A C;  5CJ0 A;  1JEK A;  1XTC C;  3L75 D;  3H1L D;  1S2E A;  1SQB J;  3BVH A;  1AVO A;  1SQQ E;  3ZDM A;  3M9Q A;  1S9K E;  4DT0 A;  1LNQ A;  2G3A A;  2W90 A;  2M8R A;  3WUU A;  2Q5U A;  1L0L K;  4RES B;  2FKW B;  2YFL A;  4I7Z B;  4QDC A;  2FBW C;  2IYP A;  1LWU C;  2P1J A;  1NJI Q;  2JZA A;  3O8Z A;  2JKV A;  4IOI H;  5H2F E;  1BGY J;  2OTL P;  1LTG C;  1W2B O;  3B5N D;  2DE7 D;  3HD7 A;  2CK3 H;  4H13 B;  4IL6 E;  3G6E P;  1PP9 J;  3F5H A;  2IZ1 A;  2M3B A;  3MIW A;  1TU3 F;  3H1K E;  4QCK A;  2HFE D;  2L91 A;  1AA0 A;  3L4F A;  5AVS B;  1FZG A;  4IFD K;  1S4X A;  2FXM A;  3AEE C;  5DJU B;  5EFW B;  3HTK A;  1J1E C;  4GOD A;  2XZR A;  1JY2 O;  1L2P A;  4OGQ B;  5KAF E;  1WQL A;  3H25 A;  2QSI A;  1LGH B;  2P2U A;  3P32 A;  1FZC B;  3H1I E;  2WPR A;  1AVY A;  4PD4 E;  2A45 I;  2XND H;  2D2C D;  1KQF B;  3V5B A;  2ZT9 D;  3V2Q A;  1SQV G;  3II6 A;  2W8Z A;  2XDJ A;  4XFJ A;  2SPZ A;  1SJG A;  1K8A Q;  1ZW0 A;  4BXL A;  4GIF A;  3SFD C;  1N7S C;  2FYN B;  4I1L A;  1H89 A;  2WSF H;  1LT1 A;  2QE7 H;  2K3R A;  1SQV K;  4KHX A;  2YMY A;  1O7P A;  4AQR D;  3AE1 C;  2YO3 A;  1NTK E;  3GOB A;  3BCC G;  3FGA D;  3ITK A;  2FYZ A;  2PRR A;  1RE4 A;  1S1C X;  1LTJ A;  2BEZ F;  3Q1M A;  2JWA A;  2E4P A;  3R4Y A;  1OW7 A;  1FZB A;  3FWN A;  2IZ0 A;  3NFQ A;  1HTL C;  1SQP K;  1X0T A;  1E5W A;  1G2C A;  4U3F J;  1Y8A A;  3T97 B;  3SWK A;  5TIS H;  1VQ6 P;  3P8C E;  4PV1 B;  2KSJ A;  1NOH A;  1YIT P;  2E75 D;  4YXW H;  1H88 A;  4OWF A;  3P7K A;  3CL3 D;  2ZFC A;  3A3Y B;  1D7M A;  1QGK B;  1RY3 A;  2QEX P;  1X9V A;  3HE5 B;  2I7F A;  4ASV A;  2CPS A;  1FDI A;  2XU6 A;  4RJT A;  1IFM A;  2ZVO B;  2YKO A;  1OWA A;  4PV1 C;  3VMX A;  2QA4 P;  1N73 C;  1WMK A;  1EDK A;  3OJA B;  5AEW A;  1JO5 A;  1SQX K;  2G8Y A;  2WPV B;  4H0L D;  2NVE A;  1OVV A;  2K9J B;  5APY A;  1BCC D;  1KMI Z;  2IFN A;  2QIW A;  1PPJ E;  3CC7 P;  2XR8 A;  2A06 D;  1YTZ I;  3H1J G;  3KZI E;  1J1D C;  1SQX G;  2IBZ I;  3AEG C;  3IF4 A;  3T97 A;  1PGQ A;  2P7J A;  4OGQ D;  1IFN A;  4ZKP A;  3L72 E;  3V4W A;  5AVX B;  5BU5 A;  1G2C B;  1HH0 A;  2QPZ A;  3EQ2 A;  2B89 A;  1S5L X;  1KFN A;  4NBE D;  2NUM A;  2BMQ A;  5APX A;  1JY3 P;  1IFI A;  1FAV A;  3L70 G;  3WU2 E;  1HWT C;  3VMA A;  3G9R A;  1NTM D;  1RQU A;  2NVF A;  1PL5 A;  3L72 G;  1R8E A;  4JBZ A;  1RE3 C;  5CCG A;  1SQX E;  3OA7 A;  1SQB D;  1GU5 A;  1NTZ D;  3B5N A;  3M91 A;  1R5L A;  2FYU E;  1VQ5 P;  4QUQ A;  1P84 D;  3VOP A;  3HE5 A;  2OGU A;  1O7G A;  1RF0 C;  1SFC C;  4YPC A;  5BU8 B;  5K5G B;  3A0H E;  1SFC A;  1RF0 A;  3PP5 A;  5KJ7 C;  2OYI A;  1ZXG A;  2N1T A;  3V6I A;  5KAI H;  4RKU J;  3A0B E;  4GDO A;  2YFI A;  5KJ7 A;  4PJ0 E;  3GLM A;  1KB9 E;  2HMO A;  5GTI H;  3CWB G;  1GK6 A;  1U7J A;  1KYO D;  1CI6 A;  1ZME C;  4PD4 D;  2IBZ G;  1IC2 A;  5B66 E;  2KLV A;  1L0L D;  2HPC A;  3N4X A;  2QJY B;  2R5B A;  1MFT A;  2NZ2 A;  5KKZ C;  1NTM K;  3L71 G;  5APU A;  5L8R J;  3PJS K;  4W7Y A;  1FJP A;  2JWD A;  3RGU A;  5CCG C;  2Y0E A;  3IAO A;  3CD6 P;  1P84 I;  3HUS C;  5AW0 B;  2K9Y A;  3L70 D;  1KD1 Q;  3F89 A;  1K05 A;  2JEE A;  1QL2 A;  3JSV C;  3S1K A;  1T8Z A;  4K3A A;  3LID A;  1ZLL A;  1QL1 A;  2XSO A;  1JCC A;  5AVU B;  1FDM A;  3L71 E;  1VQO P;  2NPS C;  1N86 A;  3HRN A;  3JCU H;  1BE3 D;  2IPP A;  2KSE A;  4DOJ A;  2GUS A;  3U59 A;  3L36 A;  4WVZ A;  3B4S A;  1DD3 A;  3FWL A;  2Q1K A;  1OZH A;  5AEU A;  1HF9 A;  3JC2 2;  4TLF A;  1LTT C;  2J5U A;  2FFD A;  2K37 A;  2OTK E;  5GTH H;  1VQP P;  3I56 P;  3TGU G;  1Q86 Q;  4HKZ H;  2Q6Q A;  1GD2 E;  2AEF A;  3RK3 C;  1M1K Q;  3AEF C;  1J1D B;  1L0N G;  3C1L A;  1NTK K;  2E76 C;  1NU1 K;  3HD7 B;  3L74 J;  2YO2 A;  3CX5 E;  1KQS O;  3WMM 0;  1GTW A;  1SQV J;  2FYU G;  1VQM P;  1JY2 N;  2LXC B;  3MD0 A;  2BCC G;  3FX0 A;  1FZF A;  1O7W A;  1PGJ A;  4NBA D;  2N9Y B;  3RK2 D;  2V4H A;  3L74 D;  1ZRT D;  3M06 A;  1MKM A;  2Q9I A;  3GB4 A;  2P10 A;  2DE6 D;  1LTJ C;  1NU1 G;  1QVG O;  2I1K A;  1OFC X;  4WY4 D;  3MTU E;  1KIL A;  3B5N B;  3CCE P;  2Y9Z A;  1M56 D;  1M7L A;  3TNU A;  2E5Y A;  3GHG C;  1JUN A;  1K9M Q;  5CCH A;  2H7H A;  3GTE A;  4OGQ C;  4NBF D;  4H0L B;  1BE3 G;  1RFS A;  4KJM A;  1DEB A;  1L4A D;  4C7R A;  5KJ7 D;  4HM3 A;  4DJG A;  2HMJ A;  5KLV D;  1SQB E;  3NMD A;  2POH A;  1FJK A;  1NTZ E;  1N7S A;  1NTK D;  5B66 H;  1USE A;  3GG2 A;  5AVY B;  3S9O A;  3RL0 C;  4H0L C;  2M0B A;  4EMJ B;  3A0B H;  2QJY C;  1JNM A;  3CCL P;  1AFO A;  3E7K A;  1G8J B;  2HYN A;  3VP8 A;  2HMK A;  3EFG A;  4U7J A;  1Q90 D;  3MUD C;  2GBW A;  2K9J A;  1S9K D;  2A45 H;  2RH0 A;  1LTA C;  1LJ2 A;  1EDI A;  2YMK A;  3MHV A;  3I5C A;  1HGZ A;  2WIT A;  3L73 D;  1K73 Q;  2GM4 A;  4NBD D;  1RF1 A;  1L0N D;  1N7S B;  3HD7 C;  4AAY B;  3EFF K;  1SLQ A;  3CC4 P;  3VMG D;  1Z56 A;  1OXZ A;  2KB7 P;  1LWU A;  1FU1 A;  1XTG B;  2KUB A;  3AEC C;  3TYY A;  4R4L A;  3CX5 I;  3IN6 A;  1SQP G;  3KZI H;  4HM5 A;  4LC1 A;  1URQ D;  2ZYG A;  3OW2 O;  2IYO A;  1BCC E;  2KS1 A;  5M1B A;  2R44 A;  1E79 H;  2WSC J;  5BOK A;  4N6J A;  3BCC D;  3H1J D;  1BGY D;  1UUV A;  2A06 E;  4AYC A;  5AVT B;  1URQ A;  3ABV C;  5AW5 B;  1BE3 E;  2NPS D;  1M8O B;  1SQV E;  3MGN A;  2L5G B;  5KLI B;  4UB8 H;  1VQ8 P;  3VCP A;  1NAF A;  1RIE A;  2UWJ E;  2WVR A;  1JTH A;  1VQ7 P;  3VMY A;  2NRG A;  3VMZ A;  3H1L J;  1Y47 A;  1JMB A;  3QWO C;  4NPD A;  4GT1 A;  3TGU D;  3EN1 A;  2KK7 A;  1NH4 A;  3AE4 C;  3USS A;  1M57 D;  1AV1 A;  3Q5P A;  1RF1 C;  1GW3 A;  1L4A B;  1HJ0 A;  3VMH D;  4IFF A;  3TSI A;  2FYU D;  3H1H E;  3CI9 A;  1NKN A;  1OVU A;  2KS1 B;  1FZC A;  2FY8 A;  2ITA A;  3CX5 D;  4HKV A;  3RL0 D;  2BCC E;  5AVZ B;  1ZR4 A;  1BDC A;  3GTS A;  3G4S P;  4DZO A;  3GHG B;  2WSE J;  3R2P A;  2WQY C;  1NTZ K;  5AVQ B;  2HMN A;  4GOF A;  3WUT A;  2ZT9 C;  3HTK B;  3KPE A;  1K04 A;  2YIU C;  1R5S A;  2W6A A;  2OYH A;  1N7S D;  3Q5S A;  4PD4 H;  3LW5 J;  3L71 J;  3FOU A;  2O01 J;  1KV4 A;  1KYO E;  1YJN P;  2E75 C;  1Y9B A;  4HYT B;  5CBO A;  1HUC A;  5KKZ B;  1L0L E;  3SFE C;  1SQQ G;  2OYI B;  1S72 P;  3VMI D;  5AVV B;  1SFC B;  3GW6 A;  3OAK A;  2CKF A;  1QX8 A;  3H1K J;  2KNC B;  2O01 H;  5CCH C;  1KQG B;  1JY2 P;  1JOC A;  1OIP A;  1PIX A;  1J1E B;  4WBA A;  1DEE G;  4EDF A;  1EZV E;  2OTJ P;  3SSU A;  5AW1 B;  1UII A;  4HM4 A;  1G1J A;  1NAY A;  1CI6 B;  4PJ0 H;  1LTS C;  5BVZ A;  1PP9 G;  3W68 A;  2BMO A;  4P1B H;  2N1T B;  4XE5 B;  4BRY A;  1G8K B;  3IR9 A;  1CW5 A;  1PP9 E;  2B87 B;  2W27 A;  2QVA A;  2RMZ A;  5E79 E;  3CCM P;  3PRJ A;  1OW8 A;  3GZY A;  2KI7 B;  4H44 D;  3CCU P;  2B87 A;  1JCD A;  3W67 A;  3L72 J;  2IDB A;  3BAT A;  2B24 A;  2R5D A;  4H44 B;  2B1X A;  2Z5I A;  1SQB G;  3L73 E;  1CZQ A;  1GL2 D;  1X79 B;  2IBZ E;  1KIL B;  4N78 D;  3AE5 C;  3L74 G;  3AE9 C;  5AW7 B;  1L0L G;  4IL6 H;  2PP6 A;  2Q3I A;  3KQG A;  2WSE H;  1UUW A;  1BE3 J;  1SVF A;  1NYK A;  3H1H J;  1DX7 A;  1KYO I;  4JYC A;  1U57 A;  1YI2 P;  1FZE A;  1JB0 J;  2W6B A;  1NU1 E;  2IFM A;  1GL2 C;  1JY3 N;  3CCV P;  2NPS A;  2YXR B;  4JPZ B;  3D6Z A;  2Z4E A;  5CCG D;  2E42 A;  1VQ9 P;  1M1J C;  4HM1 A;  1MZ9 A;  3AE6 C;  1BGY E;  2PGD A;  1EQ7 A;  1JM0 A;  5AW4 B;  3CCR P;  2XSH A;  4NBB D;  2OYH B;  2DE5 D;  1IFP A;  1BDD A;  3H1L G;  3HUS A;  2VRS A;  1KFM A;  4P1C H;  4R4M A;  4BRY B;  2HPC B;  2HOD B;  3BRT B;  4L75 A;  1L0L J;  4C7N A;  1RE4 C;  1T6A A;  3FXD A;  3V2P A;  3CLQ A;  1VM9 A;  3TF5 A;  1T2K C;  1SQQ J;  1PFI A;  1GDT A;  3H32 A;  1T3U A;  1L0N J;  2R3S A;  4MN4 C;  2KYV A;  3TGU E;  1H0T A;  3C8V A;  1LTJ B;  1KB9 I;  1VF5 C;  2AEJ A;  5B5E H;  4IL6 X;  3SWY A;  1N8R Q;  2KIK A;  2C0W A;  2M5A B;  2N1T D;  1PGO A;  2H8P D;  3D89 A;  4LLH A;  4H13 D;  2E75 B;  1KN7 A;  3M9B A;  1HJB A;  3L73 G;  5CXM A;  2NPS B;  1GK4 A;  5KLV K;  1ZN5 A;  1GW4 A;  1BCC G;  2KP8 A;  3V4Q A;  1KYO H;  1NTZ J;  2ZYL A;  2AEM A;  1KQL A;  3CCS P;  1FC2 C;  1A02 F;  2OQQ A;  1LTB C;  4D6T J;  1NTM E;  2AXC A;  1VL2 A;  2JP3 A;  1JM1 A;  3CC2 P;  4CPG A;  2ZT9 B;  2C0X A;  3EQQ A;  3P8M C;  1PZQ A;  4ZKU A;  3RBX A;  5AW6 B;  1IZN B;  3H1K D;  3CXH H;  1WRG A;  3JCU E;  1YBK A;  1USD A;  3TGU J;  1NTM G;  2D2C B;  1IO4 A;  1VQN P;  5CJ4 A;  2WSS H;  2IX7 C;  2HMM A;  1YHQ P;  3GL0 A;  2FXP A;  1URQ C;  3I55 P;  3M0D A;  2WTY A;  3KDP B;  2NWF A;  3BCC E;  1KIL E;  2GUV A;  1FS0 E;  1EXJ A;  3U1C A;  1BSH A;  2D2C C;  5AW8 B;  1BSN A;  4C7N B;  1FDO A;  1NTZ G;  1N73 A;  3UIA A;  3B8E B;  4HM0 A;  1FOS E;  2ZXE B;  4EI2 A;  2WPS A;  1QVF O;  3A7O A;  5TJH A;  3N7N A;  3O6Q A;  3TDK A;  2IBZ D;  2DW3 A;  1ULJ A;  3H1H G;  4YTP C;  4HM6 A;  4U3F D;  2ZVN B;  2KZJ A;  4Y28 J;  2Y0C A;  1S3J A;  1EXI A;  2H43 A;  2CPB A;  5H2F H;  1LP1 B;  1M1J B;  3L70 E;  1NGM B;  1YTZ T;  1WT6 A;  4HJG H;  1YYC A;  1AJY A;  3H1H D;  5KAF H;  2PFX A;  3H1L E;  1NYH A;  3PTZ A;  4NBH D;  3AZC A;  1Q81 Q;  3HE4 A;  3L73 J;  4HB1 A;  1N7L A;  2B9B A;  3H1K G;  3L37 A;  1IFD A;  2FYU K;  5APT A;  4B86 A;  3GF7 A;  2YNY A;  1Q82 Q;  3GL2 A;  4ASW A;  4ZNC A;  2J59 M;  2E5T A;  4NBC D;  1O7M A;  4WY4 C;  3H1J J;  3CPW O;  3BCC J;  1KC8 Q;  2MKV A;  1FZA A;  4I2L C;  3K5B A;  2QM7 A;  1ZOY C;  2BEQ D;  3WU2 H;  2A06 G;  4QDF B;  2V7Q H;  3Q5R A;  4AIV A;  1MV8 A;  1L0N E;  4AUW A;  1HBW A;  2E76 B;  2NUK A;  5CHX A;  1VQ4 P;  5B5E E;  4H13 C;  1SQP E;  3RL0 B;  3M0A A;  3CWB J;  3GHG A;  2YIU B;  3LW5 H;  1IJD B;  1EDJ A;  2OYH C;  5KLV G;  1EZV D;  2XV5 A;  4L74 A;  2E74 B;  1AQT A;  3RK3 D;  2BMR A;  3CMA P;  2HLO A;  3E1R A;  4Z1M H;  1QEX A;  1S5L E;  4WY4 A;  2E74 D;  3PHL A;  1MUU A;  1ZRT E;  3G3Z A;  3GKE A;  1LT9 B;  1KIL C;  2KNC A;  2WMM A;  5KAI E;  4U3F G;  1VCK A;  1NDO A;  3L72 D;  3L35 A;  1MFZ A;  1KB9 H;  2GA1 A;  1RHZ B;  1PP9 D;  1X8Y A;  2XRX A;  4D6T E;  1SFC D;  2XKM A;  5AW3 B;  4D6T G;  3CXH D;  4EIJ A;  1QLE D;  4H44 C;  2RN0 A;  3RK2 B;  3HD7 D;  3A2A A;  1LWU B;  4NPF X;  2QG4 A;  3D71 A;  1NTK J;  3AE2 C;  5GTH E;  4PV1 D;  3KHU A;  1YJW P;  4UB6 E;  1URQ B;  2K1A A;  1SQX J;  5CMZ A;  4WWI A;  3CCJ P;  1AQ5 A;  5HL4 A;  1NWQ A;  1RF1 B;  2HML A;  2FFD C;  5KLV E;  4OVN F;  1HVV A;  4ZMD A;  2KXP B;  4QUP A;  1DD4 A;  1M90 Q;  1GU4 A;  4L76 A;  3CWB E;  5APQ A;  4HM7 A;  4KT0 J;  5E79 H;  3B71 A;  5AVR B;  1L4A A;  1W5C E;  2R3C A;  2Y0D A;  3HUS B;  4WY4 B;  2BCC D;  4UB8 E;  2MJZ A;  3NXS A;  1DH3 A;  5CCH D;  1ZV8 A;  3H1I G;  4EOT A;  4DCK A;  3AEA C;  1NU1 D;  3AE8 C;  3RL0 g;  1KB9 D;  2K88 A;  3M0D C;  3WUV A;  1KIL D;  4M3L A;  5AVW B;  1T2K D;  1VF5 B;  5AW2 B;  1UIX A;  5KLV J;  5AW9 B;  1YQ4 C;  4IFM A;  2R32 A;  2WPQ A;  3U1A A;  1VF5 D;  4JF7 A;  2KZI A;  4NB9 D;  2WWW A;  2BAS A;  2GBX A;  2YXQ B;  3L70 J;  1CSB A;  2W83 C;  1EZV I;  3TNU B;  1OX3 A;  3BRV B;  1FQT A;  1EDL A;  1W2E A;  3SWF A;  1LT9 C;  4NB8 D;  4NPE A;  1YJ9 P;  1Q90 C;  1RH5 B;  3MUD A;  1SQQ K;  1LTI C;  1PPJ D;  2QJP C;  2H89 C;  3L71 D;  3H1J E;  2XNX A;  5KTB A;  1PPJ G;  2H88 C;  3KXD A;  4BWN A;  2Z5H A;  4LGD E;  2Q3E A;  1JMM A;  1FOS F;  2PAJ A;  2AXT H;  1SQV D;  2OYI C;  4C46 A;  1ULI A;  1X22 A;  3A0H H;  3O6Q B;  4RO0 A;  4HM8 A;  3H6P A;  2ZAE B;  1Q2N A;  3B5N C;  2C9L Y;  2FYU J;  3BAS A;  2ZXX A;  2E74 C;  1FBM A;  4N78 E;  2YKP A;  1VDF A;  4PD4 I;  3V2R A;  3PH0 A;  1N73 B;  1A02 J;  1Q7Y Q;  3AE7 C;  4HH2 A;  3VTP C;  2AXT E;  1P84 E;  1YQ3 C;  1SQP D;  3IFM A;  2Q7C A;  3M9H A;  2WSC H;  4JQ0 D;  1J2J B;  1L0N K;  2ZYD A;  1JTH B;  3L75 E;  1VPC A;  3C9I A;  2LR2 A;  3L75 G;  1EZV G;  4NBG D;  3RK2 C;  1RQV A;  4N3Y B;  4JYB A;  1GL2 A;  2WT7 A;  3TK1 A;  1SQQ D;  3AED C;  3RK3 E;  5APS A; 
#chains in the Genus database with same CATH homology
 1SQX E;  1VM9 A;  4HKV A;  1WQL A;  4U3F E;  3GZY A;  2BCC E;  1O7N A;  4NB8 D;  2XSO A;  3GL2 A;  4PV1 D;  3GTS A;  4H44 D;  4NBC D;  1O7M A;  3L71 E;  2YVJ B;  1Q90 C;  2FYU E;  1O7H A;  2I7F A;  3H1I E;  4QUQ A;  2HMN A;  2JO6 A;  2HMM A;  3TGU E;  2B24 A;  3GL0 A;  4PD4 E;  2E76 D;  2QJP C;  5HL4 A;  2D2C D;  2B1X A;  2YIU C;  4QDF B;  2ZT9 D;  4AIV A;  4HM5 A;  2HML A;  3L73 E;  3BCC E;  1O7G A;  2NWF A;  3H1J E;  5KLV E;  3GTE A;  3C0D A;  2IBZ E;  4NBF D;  1L0N E;  5AEU A;  1RFS A;  1EG9 A;  3CXH E;  2NUK A;  4QUP A;  1BCC E;  1SJG A;  5AEW A;  3CWB E;  3D89 A;  1SQQ E;  4HM7 A;  4HM3 A;  5KLI C;  4H13 D;  2FYN C;  4QDF A;  5BOK A;  3FOU A;  2HMJ A;  1KYO E;  1SQB E;  1UUW A;  2NVE A;  4H0L D;  5CXM A;  1NTZ E;  1SQP E;  1UUV A;  2A06 E;  3GCE A;  2YFI A;  4HM0 A;  1NYK A;  1KB9 E;  2E4Q A;  1L0L E;  1ULI A;  2HMO A;  2YFL A;  3VMI D;  3L74 E;  4QDC A;  2Q3W A;  3VCA A;  1O7P A;  4HM8 A;  1PPJ E;  2CKF A;  1BE3 E;  2XR8 A;  3N0Q A;  2JZA A;  1NTK E;  3GOB A;  4EMJ B;  1SQV E;  2ZYL A;  2QJY C;  3VCP A;  4QUR A;  2NVG A;  1RIE A;  1ULJ A;  2BMR A;  1G8J B;  4OGQ D;  2HMK A;  3L72 E;  4HM6 A;  1NU1 E;  3CX5 E;  2GBW A;  2DE7 D;  1EZV E;  2QPZ A;  5KKZ C;  2E74 D;  4NBE D;  1ZRT E;  3GKE A;  2NUM A;  1NTM E;  4HM1 A;  4HM4 A;  2E4P A;  2BMQ A;  2YFJ A;  1BGY E;  1P84 E;  1VCK A;  3DQY A;  1NDO A;  3L70 E;  3H1K E;  1O7W A;  1JM1 A;  4QCK A;  3EN1 A;  4HM2 A;  1VF5 D;  4NBA D;  2XSH A;  4NBB D;  4NB9 D;  2XRX A;  3EQQ A;  4D6T E;  2BMO A;  2DE5 D;  4NBD D;  4P1B H;  3L75 E;  3H1L E;  3GZX A;  3GB4 A;  2DE6 D;  2GBX A;  4NBG D;  4AAY B;  4P1C H;  4NBH D;  3AZC A;  1G8K B;  2NVF A;  3VMH D;  2QJK C;  4QDD A;  2E75 D;  3H1H E;  1PP9 E;  1FQT A;  3VMG D;  4HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...