3H1KE

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
total genus 30
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1kE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1kE02
4HJLA 2DE7D 1L0NE 3L75E 3L73E 1ULJA 1G8JB 3EN1A 1G8KB 4NBCD 1NTZE 4HM7A 4HM8A 4NB8D 1JM1A 5KLVE 3CX5E 4PV1D 2IBZE 2NWFA 3H1HE 4QUQA 3CWBE 3L74E 2HMNA 1O7HA 2DE6D 3EQQA 1NYKA 4OGQD 2GBXA 1PPJE 1SJGA 3GZYA 4H44D 3VCPA 3H1LE 2YFLA 3BCCE 2ZYLA 3GKEA 5AEUA 1NTME 1SQXE 1RFSA 2HMOA 1SQPE 2XRXA 5BOKA 2FYNC 3TGUE 3GZXA 3H1IE 5CXMA 2NVFA 2I7FA 2E75D 2BCCE 2NVGA 3DQYA 1SQQE 1P84E 1KB9E 1ULIA 2NUKA 4HM2A 4P1CH 4QDCA 2QJPC 2HMKA 1KYOE 1NU1E 4HM3A 4NBED 3VMHD 3GL2A 1VCKA 2XSHA 4QCKA 3L71E 3FOUA 4NBHD 2E74D 3L70E 4AIVA 2QJKC 5AEWA 2D2CD 3GTEA 1O7GA 2QPZA 1BE3E 3VCAA 2A06E 4HM4A 3L72E 2QJYC 4QDDA 1EZVE 2YIUC 3D89A 4NBFD 1Q90C 1NTKE 4HKVA 4HM6A 1FQTA 4EMJB 5KLIC 3C0DA 4NBGD 4HM0A 2E4QA 3H1JE 1WQLA 2DE5D 4H0LD 4NBBD 3VMGD 2E76D 2GBWA 1VF5D 3GL0A 4QDFA 3CXHE 4H13D 1SQBE 3GTSA 4NBDD 2JZAA 2Q3WA 3GCEA 4P1BH 3AZCA 4PD4E 1NDOA 4QUPA 4QURA 2BMOA 5KKZC 2B24A 3VMID 1UUVA 4U3FE 1PP9E 4NBAD 4QDFB 3H1KE 2HMJA 3GB4A 1VM9A 1UUWA 2JO6A 1BGYE 2XSOA 1O7WA 1ZRTE 2BMRA 1EG9A 2HMLA 2NUMA 1L0LE 4HM1A 2YFIA 2HMMA 3GOBA 2YVJB 4NB9D 3N0QA 2XR8A 1RIEA 1O7MA 4HM5A 1BCCE 2BMQA 2B1XA 2NVEA 2E4PA 2YFJA 1O7NA 5HL4A 1O7PA 4D6TE 4AAYB 2FYUE 1SQVE 2ZT9D 2CKFA
chains in the Genus database with same CATH superfamily
1J1EC 3P32A 3CCSP 2FFDA 3EN1A 4N3YB 4OH8B 5AW7B 1EZVG 3A3YB 2QG4A 2Y9YA 3AEGC 1IFJA 4UB8E 3CI9A 2Y9ZA 3H1LE 5AVVB 1CW5A 3L71J 3TNUA 4IFMA 2FFDC 2XRXA 1CI6B 1P84I 2KNCA 3H1IE 3OJAB 3KPEA 3JCUH 1SQQE 1ZP0C 1SQVG 2P58A 3CXHI 5AVSB 1KYOH 1VF5C 1HVVA 4I1LA 3H1LD 3AE6C 2IZ0A 2E42A 2ZXXA 1KQFB 4O9BA 2RMZA 1RQVA 3WUTA 4DCKA 2P7JA 2YIUB 1SQQD 2D2CD 3CWBG 1GL2D 3BATA 3S1KA 2FBWC 3HE4B 3RBXA 4I7ZB 3BASA 1SVFA 5KLIC 4NBGD 4HM0A 1LP1A 3AEAC 1LT9A 4UB6E 2OYIA 2E76D 1ZN5A 3IN6A 3VYIA 2XDJA 4HJGH 4HH2A 2IX7C 2Z5HA 3H1HG 2BMOA 3M0AA 3WMM0 2HODA 2B87A 3AECC 2IBZI 2HYNA 1W2BO 3G3ZA 1H0TB 1HJBA 1ZMEC 2WSFJ 2V7QH 1QX8A 2NVEA 4BRYB 1R5SA 3RL0B 5APTA 3MZWB 3GLMA 2N1TD 1URQD 4ASVA 3BCCJ 1GZLA 1SQXJ 1NHLA 2B88A 1JM1A 3TGUJ 2KSJA 4PV1D 2KLVA 4H44B 3E1RA 3EFFK 4RESB 3II6A 3GZYA 2XZRA 4RJTA 2YFLA 2CK3H 2KP8A 1LT1A 2GA1A 5APYA 2ZXEB 4AUWA 1GW4A 1QVFO 2OYHB 4NPEA 4U3FG 2K9JB 3LIEA 1CSBA 4WVZA 2WSEH 2HPCB 2Q9IA 3FX0A 2AEFA 4QCKA 2W83C 4AIVA 1S1CX 2QIWA 5AEWA 2QPZA 3V2NA 1LTJA 4QDDA 4U7JA 2R3SA 1Y8AA 2P2UA 1BDCA 4HM6A 1PP9J 2E4QA 3FWLA 3CCRP 2WWWA 2JO1A 3CCUP 1VF5D 2W27A 3VTPC 1SQPK 4PD4H 2FXMA 3GF7A 2V7QJ 3RK3B 4W7ZA 1OX3A 1NU1K 1IFIA 1MUUA 1JB0J 1DD4A 5CCHC 2UWJE 4MN4C 1SQQJ 1FZFA 1JUNA 2A45I 2C0WA 1USDA 3A2AA 1IK7A 2E5YA 2MKVA 4NBCD 1FZAA 1VQ8P 2NPSB 1IC2A 4WY4C 1FC2C 1A02J 3A7OA 1JMMA 5AW8B 1YBKA 1KFNA 1K73Q 2FFDB 1SQVK 3LIDA 1WRGA 2WSEJ 1VQPP 1HUCA 1TU3F 1H88A 1A02F 1KB9H 2IYPA 1SLQA 3TNUB 1HGVA 1NTMK 1PV3A 2KNCB 3GL2A 2OQQA 5KJ7C 1EDJA 1R8EA 2PGDA 5KLIB 1JCCA 2H89C 1J1DC 3VMAA 1NTKE 4HKVA 4D6TG 2O1KA 2FYUG 1S3JA 4W80A 3CXHH 2LXBA 5GTIH 1KQLA 2RKLA 1G2CA 3GTSA 4W7YA 5APVA 2Q3WA 1PIXA 2IYOA 1NTKD 1OZHA 1LT9B 2OYIB 1YIJP 4EDFA 1VM9A 1RF1A 1HBWA 2BMRA 1M1KQ 1NOHA 1W5CE 2HODB 4OGQC 2B87B 3IFMA 4HM5A 1FAVA 5AW0B 1O7NA 1KC8Q 3U1CA 4WWIA 3L71G 3FXEA 1S9KE 1L0NE 1G8JB 1NTMJ 1GU5A 4NB8D 3CMAP 3V4QA 4K3AA 3GG2A 1VQ9P 2O1JA 3SSUA 1DX7A 5CCHD 4RO0A 5CBNA 1S9KD 1L0ND 1E5WA 4PJ0E 2PAJA 3M0DC 4R4LA 3GKEA 1RFSA 1XTCC 1VL2A 5E79E 4C7RA 3Q2YA 3SWYA 3AEDC 1KYOI 2N9YB 4HM2A 1EDKA 2M3BA 3AE3C 4WY4D 1NAYA 1VCKA 3VMYA 2FYZA 1QVGO 3USSA 3SWFA 2K1AA 3HRNA 3L72E 4H13B 3ITKA 2O01H 1WQLA 3CC4P 2Q3EA 1LTJB 1BGYJ 3SFDC 1KTMA 3L72D 4NBDD 5K5GB 3AZCA 4K35A 2ZVNB 5KJ7D 1U7MA 1S5LE 3Q5RA 2QM7A 3JSVC 3BCCG 1SQXG 3B5NC 1UUWA 1SQBK 4IL6X 1LTSC 4QMAA 3TGUG 3BVHA 3V2QA 1M57D 4HM1A 1YYCA 2NZ2A 1BCCE 2PP6A 3G6EP 3FXDA 4DJGA 2YFJA 2M5AA 3KZIE 2P1JA 4WY4B 4N6JA 2WQYC 1EXIA 3L36A 2W6AA 1BCCD 3S4RA 3CL3D 2K88A 3M06A 3BRVB 5KAIH 3PRJA 2DE6D 2KS1A 1VQ5P 4OGQD 1SJGA 2H43A 2A45H 3P8CE 3G71P 1GL2A 3PTZA 1JY2O 4H0LC 1LTIC 1Q81Q 1ULIA 1PP9G 2YO2A 1FOSE 3P8CD 2JR8A 3MTUE 3VMXA 2FYUK 2O01J 2D2CC 3L70E 4YPCA 1IJDB 1PGQA 1GL2C 1J1DB 1CZQA 1SQBJ 1O7GA 1U57A 3C1LA 1L4AD 2A06E 3F89A 2WPQA 3IF4A 2V4HA 1GDTA 1L0NJ 5L8RJ 3L70D 4NBBD 1N7SC 3KYQA 1SQQG 2GBWA 1M7LA 2HG5D 2A06D 4Z1MH 2FXOA 2JZAA 3TK1A 2ZT9C 1G2CB 2N1TA 1URQA 3A0BH 2H7HA 3NTNA 1LNQA 2YNYA 1L0LE 3CCVP 3V2PA 1M1JA 3CCJP 1KQGB 1BE3D 2YVJB 3D6YA 2B1XA 1O7PA 3C8VA 3L74J 2YMKA 1T8ZA 2XKMA 1L0LD 3L73E 3O6QA 1ZR2A 1YJWP 4PV1C 1PFIA 3CX5E 3B5ND 1JCDA 5CJ0A 4QUQA 1IFPA 4ZKPA 4GDOA 2HMNA 1K04A 1O7HA 3L73D 3EQQA 1PPJE 4AYCA 5TJHA 3VCPA 4IL6H 2KSEA 3P7KA 3CX5D 1NYHA 2WITA 2QM8A 2I7FA 3T97A 3VP8A 1RE3C 4GT1A 1Q7YQ 5B5EH 1PPJD 3WU2H 2QJPC 2HMKA 4HM3A 1ZR4A 4N78D 3E7KA 2O01N 3O8ZA 2OYOA 3FOUA 4JYCA 3B8EB 5AVYB 1KMIZ 2JDIH 1T3UA 2KZIA 3K5BA 3SWKA 3S9OA 4H0LD 2LXCB 4DT0A 1SQXK 3H1ID 1KZUB 1KV4A 2PFXA 3GF3A 2Q1KA 2ZFCA 3H1KE 1EDLA 1NTMG 1KILC 4EI2A 3L75J 1N7SD 3H1KD 1NKNA 2XNXA 5HL4A 3KXDA 2ZT9D 1HWTC 4HM8A 3GHGC 5KLVE 3NMDA 2M5AB 1YITP 3IAOA 5AVTB 2BCCJ 2NWFA 4UB8H 5TISE 2E74C 2Q5UA 5KLVD 4H0LB 1SQPE 4KT0J 3G9RA 2N9BA 3MD0A 3OA7A 2W6BA 1NWQA 2KS1B 1BE3J 3DQYA 2P67A 5AVQB 2D2CB 1NU1E 1GL2B 3VMHD 2XSHA 1BGYG 2R32A 2QJKC 1SQQK 2E76B 1NU1D 1EZVE 2IFMA 2SPZA 3CCLP 1BSHA 3HUSC 1W2EA 4EMJB 1FJKA 4UB6H 3H1JE 2IZ1A 1ZV8A 1FBMA 4QDFA 2KB7P 2ZT9B 1N73C 2JKVA 2M0BA 1EZVD 4P1BH 2IBZG 2WPRA 2R5DA 4DZOA 1JY3O 3B71A 3H1JD 5KKZC 3MHVA 1X22A 1YQ4C 1YTZT 2NUMA 5CCHA 1O7MA 2N1TB 1URQB 2JWDA 5AVUB 1OW8A 3HD7C 1FS0E 1KILE 2J59M 4NPFX 2QVAA 4PV1B 1KN7A 1PGJA 4DOJA 2E75C 1M1JB 1HF9A 2DE7D 3H1LJ 2KIKA 1K9MQ 3G4SP 1RHZB 1AFOA 1AJYA 5CHXA 3H1IJ 1KILD 1AQTA 3R2PA 3H1HE 4WY4A 2J58A 5AW3B 1EC5A 1NJIQ 3O6QB 1ZLLA 1T2KD 2NRGA 1RF0C 1J1EB 3I56P 1SQBG 4YTPC 2ZVOB 3MUDC 1YJ9P 3H1HD 3FWNA 1FZCC 3Q5SA 2NVGA 1P84E 1LTGC 3VN0A 1L0NG 1PL5A 5H2FE 2QSIA 2B9BA 4WBAA 4OWFA 2AXTE 3CCQP 5AW4B 3T97B 2E74D 4M3LA 1P84D 1GK4A 1LWUA 3VCAA 5KJ7A 1D7MA 3WUUA 1VF5B 2H88C 1SFCC 1Q90C 1PGOA 3HTKA 2IDBA 1E79H 5KLVJ 2L5GB 2QA4P 5B66E 4A7PA 5GTHE 1MFZA 1LWUC 1S72P 1NDOA 2XV5A 3L74G 1FZGA 4U3FE 3A0HE 1DEEG 2WVRA 2A45G 2QRXA 3I55P 1O7WA 3A5TA 2XU6A 4U3FD 2XR8A 1GTWA 4I6MC 1EDIA 1HJ0A 3WUVA 4IFDK 2ZYAA 3AEEC 2OGUA 2WMMA 1JY2N 2ZYDA 3AE2C 4JF7A 3H1JJ 3CLQA 4XA4A 3PHLA 2Q7CA 2POHA 3RK2D 2C9LY 2B89A 2RN0A 3IR9A 2ZYLA 2KI7B 3HD7D 3M0DA 3Q5PA 3GZXA 1L4AA 2AXCA 2E75D 2IFNA 2BASA 2YKOA 1S5LX 1AV1A 1H89A 4NBHD 3GMAA 3E1IA 4Y99C 1L4AC 3F5HA 1N7LA 3JC22 2R5BA 5KAFE 3QWOC 1FQTA 1N73B 5APXA 3L75G 2QEXP 5APQA 2I1KA 5AW2B 5KKZB 2BEQD 4JBZA 1NTKK 1USEA 2Q3IA 4QURA 2KUBA 3D6ZA 3V2RA 2W90A 2B24A 4QDFB 4TT3H 3GB4A 1Q90D 1SFCD 2XSOA 2ZYGA 1ZRTE 3L35A 2JWAA 3B5NA 2BCCG 1VQ7P 1NKZB 1LTAC 1RIEA 4LGDE 1M8OB 3AE8C 3D70A 2E75B 1VQNP 2E4PA 4D6TE 4AAYB 2FYUE 1ZRTD 1NTZE 1BE3G 4OVNF 1OW6A 4KHXA 4D6TD 3U1AA 2FYUD 4PJ0H 3MGNA 2KZJA 1L0NK 1NTZD 5DJUB 5E79H 1RE4C 1BSNA 2ZAEB 2NVFA 2YO3A 3PJSK 2WPVB 4I7ZC 1IZNB 4L74A 1NTKJ 4LLHA 3L71E 3OAKA 2JP3A 1SFCB 1VQOP 1YTZI 1FE6A 3L71D 3C0DA 1OVRA 5AW6B 3VMGD 1LWUB 1DD3A 1N7SA 2CPSA 4YXDC 3HTKB 3CCMP 5AW1B 2W6JH 1ZW0A 1FDIA 3H1LG 3RL0C 2WZ7A 4EOTA 1NH4A 3H1IG 1OW7A 4C7NA 1JTHA 4H44C 2YKQA 3KZIH 1HTLC 1PGPA 1IFNA 1VQLP 1LTBC 1YHQP 1GK6A 4OGQB 2JJLA 1K8AQ 1VQ6P 2OYHC 2Z4EA 1EZVI 3OW2O 1FDOA 3BCCE 1NGMB 1SQXE 3TGUE 3V4WA 4P1CH 3L72J 3JCUE 1QEXA 1RE3A 3BCCD 1KYOE 1SQXD 1Y47A 2OARA 2I8DA 5KLVG 1L4AB 3TGUD 3Q1MA 4B86A 4TLFA 1IFMA 4HM4A 1KYOD 1JY3N 2R44A 3RK3C 3CPWO 3HE5A 1OVVA 4R4MA 1NTZJ 4Y28J 2BEZF 1BDDA 5CCGC 1Y9BA 3P8MC 1BCCJ 2I1JA 1PP9E 3PP5A 3PLNA 1ZOYC 5AVWB 2QE7H 2YXRB 1FZBA 1KILA 1OXZA 2NPSC 2IPPA 1HGZA 1VPCA 2OTKE 4NB9D 1PP9D 3H1JG 5BU8B 1X9VA 2WT7A 3B5NB 4HKZH 1EXJA 4GIFA 2CKFA 1L0LK 1G8KB 3CX5H 2WSSH 2DW3A 3RL0D 2J5UA 3RL0g 3ZDMA 3GHGA 1X0TA 2KXPB 1T2KC 4L73A 2GBXA 3W68A 1ZXGA 2GUSA 2H8PD 4H44D 5CJ4A 5AEUA 1JMBA 2FYNC 1L2PA 3L70J 3L37A 3R4YA 1IFDA 1FOSF 4QDCA 3VMZA 1R5LA 1IO4A 1DH3A 1NAFA 4IFFA 2VRSA 2AEMA 1LT9C 2OYIC 2WSCH 1X79B 3HUSA 2K9YA 3TSIA 1AQ5A 4I2LC 1GU4A 1SQPD 3AEFC 3AE1C 1L0LJ 2G8YA 5AVZB 3RK3E 4PD4E 1N73A 1JNMA 3VMID 4NBAD 1MZ9A 2GUVA 1Q86Q 2HMJA 1N7SB 3RK3D 3KQGA 4GKGA 3L73J 4PD4D 1OMIA 3VOPA 2ITAA 1Q2NA 1X8YA 5CCGD 2Z5IA 3HD7A 1JEKA 4EIJA 4C7NB 1SQVE 1JTHB 4BXLA 1WT6A 1WMKA 5TISH 2K37A 1AA0A 1NTKG 2YKPA 3CWBE 3RK2C 1SQVD 2NPSD 2OTLP 1NTME 2XNDH 5KLVK 2HMOA 1OWAA 1HH0A 3QH9A 1EQ7A 1RF0A 2C0XA 1U7JA 4EYYQ 1GMJA 3CWBD 3MUDA 1N8RQ 1KB9E 2W8ZA 1NO4A 1LJ2A 1FZEA 1FZCA 3M91A 4H13C 4GOEA 1NTMD 3H25A 3H32A 1H8AA 5CBOA 2WSCJ 2M8RA 1QL2A 4JQ0D 1LTJC 1KB9D 2E43A 4WB4A 2QJYC 1PZQA 4XE5B 2QJPB 2WPSA 1SFCA 3H1KJ 2DE5D 1JY2P 3CXHE 1M56D 5GTIE 1MFTA 1YI2P 3HE5B 5BVZA 1MKMA 4QUPA 3CD6P 4XFJA 3RGUA 2FKWB 3C9IA 3CXHD 2GM4A 2JO6A 1BGYE 1AVYA 1RH5B 3CC2P 1KQSO 3GOBA 1RY3A 2BMQA 1YJNP 2Q6QA 1BGYD 3SFEC 1KILB 5BU5A 4HJLA 3AE9C 5APUA 2WTYA 3M9HA 4HM7A 1SQPJ 1M90Q 2KOGA 3L72G 2WT7B 2IBZE 2KK7A 2Y0EA 4IOIH 2FYNB 1NU1J 1JM0A 3GHGB 1SS1A 2IBZD 1IK9A 1P84H 5H2FH 2NUKA 2E74B 1XTGB 2G3AA 1NTZG 2AXTH 3UIAA 1SP4A 4NBED 1LP1B 5CMZA 2R3CA 1BCCG 4NPDA 3D89A 1VDFA 1FU1A 2C9NY 1SQVJ 2PRRA 1UIIA 1KORA 3TF5A 3FGAD 2FY8A 3PH0A 3GL0A 2QJKB 5B66H 5GTHH 4H13D 1SQBE 3V5BA 3RBZA 3GCEA 3LW5H 1QLED 1G1JA 3CWBJ 4YXWH 1LTTC 3HUSB 1RF1C 3A0HH 5M1BA 5DJTB 1SQBD 2HR3A 1GD2E 2YFIA 4ZKUA 4L75A 2MJZA 3M9BA 2O3JA 3MIWA 3H1HJ 3CMEP 1YQ3C 3L70G 3ABVC 3CX5I 1ULJA 3AEBC 1N86A 2AEJA 3RK2B 2A06G 3CC7P 1CI6A 2ZJSE 3GW6A 3HD7B 3L74E 5KAIE 1NYKA 1QL1A 1JO5A 2LR2A 5BOKA 1GW3A 2YXQB 2OTJP 1J2JB 3L4FA 1JOCA 1RE4A 1KD1Q 3L74D 5AVXB 3H6PA 3HE4A 3W67A 4GODA 2QJYB 1L0LG 2HFED 3GTEA 1FZCB 1LGHB 1NVOA 5KAFH 1Z56A 4RKUJ 2YIUC 3H32B 3LW5J 4HB1A 1OVUA 1UIXA 4JYBA 3I5CA 4U3FJ 5AW9B 3L73G 4ASWA 1OIPA 3TDKA 1H0TA 3VP9A 1MV8A 1OFCX 4ZNCA 3N4XA 1UUVA 1PPJG 3N7NA 1G1IA 5AW5B 3KHUA 4BRYA 3A0BE 2E5TA 3Q3DA 2HMMA 3M9QA 4C46A 1FDMA 1FJPA 3NXSA 1S5LH 3EFGA 5C39A 2Y0DA 2KLUA 3L75E 3NFQA 1JY3P 4JPZB 5EFWB 4BWNA 1VQKP 4AQRD 2KYVA 3L75D 1S2EA 2OYHA 1NTZK 1KFMA 2K9JA 1RQUA 4IL6E 2HPCA 5CXMA 4LC1A 2BCCE 2E76C 2YMYA 3H1KG 2RH0A 1QGKB 1N2DC 5B5EE 2P10A 3WU2E 4PD4I 1T3JA 2Y0CA 1K05A 3V6IA 2BCCD 1BE3E 2LKMA 5APWA 3AE5C 5AVRB 1AVOA 2JEEA 4NBFD 2CPBA 2M3EA 3EWKA 1S4XA 2HLOA 4GOFA 2L91A 1T6AA 3KDPB 4HYTB 5APSA 4ZMDA 4Y99B 1RF1B 1DIPA 3MP7B 5CCGA 3EQ2A 3BRTB 3U59A 2N1TC 1URQC 1DEBA 5KTBA 4CPGA 3TYYA 3D71A 4D6TJ 3AE4C 4L76A 1SQPG 2FYUJ 4KJMA 1M1JC 1EG9A 2HMLA 1VQMP 3N0QA 2FXPA 2NPSA 1NU1G 2K3RA 4N78E 1VQ4P 3CCEP 1KB9I 2WSFH 3B4SA 3AE7C 1Q82Q
chains in the Genus database with same CATH topology
4HJLA 2DE7D 1L0NE 3L75E 3L73E 1ULJA 1G8JB 3EN1A 1G8KB 4NBCD 1NTZE 4HM7A 4HM8A 4NB8D 1JM1A 5KLVE 3CX5E 4PV1D 2IBZE 2NWFA 3H1HE 4QUQA 3CWBE 3L74E 2HMNA 1O7HA 2DE6D 3EQQA 1NYKA 4OGQD 2GBXA 1PPJE 1SJGA 3GZYA 4H44D 3VCPA 3H1LE 2YFLA 3BCCE 2ZYLA 3GKEA 5AEUA 1NTME 1SQXE 1RFSA 2HMOA 1SQPE 2XRXA 5BOKA 2FYNC 3TGUE 3GZXA 3H1IE 5CXMA 2NVFA 2I7FA 2E75D 2BCCE 2NVGA 3DQYA 1SQQE 1P84E 1KB9E 1ULIA 2NUKA 4HM2A 4P1CH 4QDCA 2QJPC 2HMKA 1KYOE 1NU1E 4HM3A 4NBED 3VMHD 3GL2A 1VCKA 2XSHA 4QCKA 3L71E 3FOUA 4NBHD 2E74D 3L70E 4AIVA 2QJKC 5AEWA 2D2CD 3GTEA 1O7GA 2QPZA 1BE3E 3VCAA 2A06E 4HM4A 3L72E 2QJYC 4QDDA 1EZVE 2YIUC 3D89A 4NBFD 1Q90C 1NTKE 4HKVA 4HM6A 1FQTA 4EMJB 5KLIC 3C0DA 4NBGD 4HM0A 2E4QA 3H1JE 1WQLA 2DE5D 4H0LD 4NBBD 3VMGD 2E76D 2GBWA 1VF5D 3GL0A 4QDFA 3CXHE 4H13D 1SQBE 3GTSA 4NBDD 2JZAA 2Q3WA 3GCEA 4P1BH 3AZCA 4PD4E 1NDOA 4QUPA 4QURA 2BMOA 5KKZC 2B24A 3VMID 1UUVA 4U3FE 1PP9E 4NBAD 4QDFB 3H1KE 2HMJA 3GB4A 1VM9A 1UUWA 2JO6A 1BGYE 2XSOA 1O7WA 1ZRTE 2BMRA 1EG9A 2HMLA 2NUMA 1L0LE 4HM1A 2YFIA 2HMMA 3GOBA 2YVJB 4NB9D 3N0QA 2XR8A 1RIEA 1O7MA 4HM5A 1BCCE 2BMQA 2B1XA 2NVEA 2E4PA 2YFJA 1O7NA 5HL4A 1O7PA 4D6TE 4AAYB 2FYUE 1SQVE 2ZT9D 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJL A;  2DE7 D;  1L0N E;  3L75 E;  3L73 E;  1ULJ A;  1G8J B;  3EN1 A;  1G8K B;  4NBC D;  1NTZ E;  4HM7 A;  4HM8 A;  4NB8 D;  1JM1 A;  5KLV E;  3CX5 E;  4PV1 D;  2IBZ E;  2NWF A;  3H1H E;  4QUQ A;  3CWB E;  3L74 E;  2HMN A;  1O7H A;  2DE6 D;  3EQQ A;  1NYK A;  4OGQ D;  2GBX A;  1PPJ E;  1SJG A;  3GZY A;  4H44 D;  3VCP A;  3H1L E;  2YFL A;  3BCC E;  2ZYL A;  3GKE A;  5AEU A;  1NTM E;  1SQX E;  1RFS A;  2HMO A;  1SQP E;  2XRX A;  5BOK A;  2FYN C;  3TGU E;  3GZX A;  3H1I E;  5CXM A;  2NVF A;  2I7F A;  2E75 D;  2BCC E;  2NVG A;  3DQY A;  1SQQ E;  1P84 E;  1KB9 E;  1ULI A;  2NUK A;  4HM2 A;  4P1C H;  4QDC A;  2QJP C;  2HMK A;  1KYO E;  1NU1 E;  4HM3 A;  4NBE D;  3VMH D;  3GL2 A;  1VCK A;  2XSH A;  4QCK A;  3L71 E;  3FOU A;  4NBH D;  2E74 D;  3L70 E;  4AIV A;  2QJK C;  5AEW A;  2D2C D;  3GTE A;  1O7G A;  2QPZ A;  1BE3 E;  3VCA A;  2A06 E;  4HM4 A;  3L72 E;  2QJY C;  4QDD A;  1EZV E;  2YIU C;  3D89 A;  4NBF D;  1Q90 C;  1NTK E;  4HKV A;  4HM6 A;  1FQT A;  4EMJ B;  5KLI C;  3C0D A;  4NBG D;  4HM0 A;  2E4Q A;  3H1J E;  1WQL A;  2DE5 D;  4H0L D;  4NBB D;  3VMG D;  2E76 D;  2GBW A;  1VF5 D;  3GL0 A;  4QDF A;  3CXH E;  4H13 D;  1SQB E;  3GTS A;  4NBD D;  2JZA A;  2Q3W A;  3GCE A;  4P1B H;  3AZC A;  4PD4 E;  1NDO A;  4QUP A;  4QUR A;  2BMO A;  5KKZ C;  2B24 A;  3VMI D;  1UUV A;  4U3F E;  1PP9 E;  4NBA D;  4QDF B;  3H1K E;  2HMJ A;  3GB4 A;  1VM9 A;  1UUW A;  2JO6 A;  1BGY E;  2XSO A;  1O7W A;  1ZRT E;  2BMR A;  1EG9 A;  2HML A;  2NUM A;  1L0L E;  4HM1 A;  2YFI A;  2HMM A;  3GOB A;  2YVJ B;  4NB9 D;  3N0Q A;  2XR8 A;  1RIE A;  1O7M A;  4HM5 A;  1BCC E;  2BMQ A;  2B1X A;  2NVE A;  2E4P A;  2YFJ A;  1O7N A;  5HL4 A;  1O7P A;  4D6T E;  4AAY B;  2FYU E;  1SQV E;  2ZT9 D;  2CKF A; 
#chains in the Genus database with same CATH topology
 1J1E C;  3P32 A;  3CCS P;  2FFD A;  3EN1 A;  4N3Y B;  4OH8 B;  5AW7 B;  1EZV G;  3A3Y B;  2QG4 A;  2Y9Y A;  3AEG C;  1IFJ A;  4UB8 E;  3CI9 A;  2Y9Z A;  3H1L E;  5AVV B;  1CW5 A;  3L71 J;  3TNU A;  4IFM A;  2FFD C;  2XRX A;  1CI6 B;  1P84 I;  2KNC A;  3H1I E;  3OJA B;  3KPE A;  3JCU H;  1SQQ E;  1ZP0 C;  1SQV G;  2P58 A;  3CXH I;  5AVS B;  1KYO H;  1VF5 C;  1HVV A;  4I1L A;  3H1L D;  3AE6 C;  2IZ0 A;  2E42 A;  2ZXX A;  1KQF B;  4O9B A;  2RMZ A;  1RQV A;  3WUT A;  4DCK A;  2P7J A;  2YIU B;  1SQQ D;  2D2C D;  3CWB G;  1GL2 D;  3BAT A;  3S1K A;  2FBW C;  3HE4 B;  3RBX A;  4I7Z B;  3BAS A;  1SVF A;  5KLI C;  4NBG D;  4HM0 A;  1LP1 A;  3AEA C;  1LT9 A;  4UB6 E;  2OYI A;  2E76 D;  1ZN5 A;  3IN6 A;  3VYI A;  2XDJ A;  4HJG H;  4HH2 A;  2IX7 C;  2Z5H A;  3H1H G;  2BMO A;  3M0A A;  3WMM 0;  2HOD A;  2B87 A;  3AEC C;  2IBZ I;  2HYN A;  1W2B O;  3G3Z A;  1H0T B;  1HJB A;  1ZME C;  2WSF J;  2V7Q H;  1QX8 A;  2NVE A;  4BRY B;  1R5S A;  3RL0 B;  5APT A;  3MZW B;  3GLM A;  2N1T D;  1URQ D;  4ASV A;  3BCC J;  1GZL A;  1SQX J;  1NHL A;  2B88 A;  1JM1 A;  3TGU J;  2KSJ A;  4PV1 D;  2KLV A;  4H44 B;  3E1R A;  3EFF K;  4RES B;  3II6 A;  3GZY A;  2XZR A;  4RJT A;  2YFL A;  2CK3 H;  2KP8 A;  1LT1 A;  2GA1 A;  5APY A;  2ZXE B;  4AUW A;  1GW4 A;  1QVF O;  2OYH B;  4NPE A;  4U3F G;  2K9J B;  3LIE A;  1CSB A;  4WVZ A;  2WSE H;  2HPC B;  2Q9I A;  3FX0 A;  2AEF A;  4QCK A;  2W83 C;  4AIV A;  1S1C X;  2QIW A;  5AEW A;  2QPZ A;  3V2N A;  1LTJ A;  4QDD A;  4U7J A;  2R3S A;  1Y8A A;  2P2U A;  1BDC A;  4HM6 A;  1PP9 J;  2E4Q A;  3FWL A;  3CCR P;  2WWW A;  2JO1 A;  3CCU P;  1VF5 D;  2W27 A;  3VTP C;  1SQP K;  4PD4 H;  2FXM A;  3GF7 A;  2V7Q J;  3RK3 B;  4W7Z A;  1OX3 A;  1NU1 K;  1IFI A;  1MUU A;  1JB0 J;  1DD4 A;  5CCH C;  2UWJ E;  4MN4 C;  1SQQ J;  1FZF A;  1JUN A;  2A45 I;  2C0W A;  1USD A;  3A2A A;  1IK7 A;  2E5Y A;  2MKV A;  4NBC D;  1FZA A;  1VQ8 P;  2NPS B;  1IC2 A;  4WY4 C;  1FC2 C;  1A02 J;  3A7O A;  1JMM A;  5AW8 B;  1YBK A;  1KFN A;  1K73 Q;  2FFD B;  1SQV K;  3LID A;  1WRG A;  2WSE J;  1VQP P;  1HUC A;  1TU3 F;  1H88 A;  1A02 F;  1KB9 H;  2IYP A;  1SLQ A;  3TNU B;  1HGV A;  1NTM K;  1PV3 A;  2KNC B;  3GL2 A;  2OQQ A;  5KJ7 C;  1EDJ A;  1R8E A;  2PGD A;  5KLI B;  1JCC A;  2H89 C;  1J1D C;  3VMA A;  1NTK E;  4HKV A;  4D6T G;  2O1K A;  2FYU G;  1S3J A;  4W80 A;  3CXH H;  2LXB A;  5GTI H;  1KQL A;  2RKL A;  1G2C A;  3GTS A;  4W7Y A;  5APV A;  2Q3W A;  1PIX A;  2IYO A;  1NTK D;  1OZH A;  1LT9 B;  2OYI B;  1YIJ P;  4EDF A;  1VM9 A;  1RF1 A;  1HBW A;  2BMR A;  1M1K Q;  1NOH A;  1W5C E;  2HOD B;  4OGQ C;  2B87 B;  3IFM A;  4HM5 A;  1FAV A;  5AW0 B;  1O7N A;  1KC8 Q;  3U1C A;  4WWI A;  3L71 G;  3FXE A;  1S9K E;  1L0N E;  1G8J B;  1NTM J;  1GU5 A;  4NB8 D;  3CMA P;  3V4Q A;  4K3A A;  3GG2 A;  1VQ9 P;  2O1J A;  3SSU A;  1DX7 A;  5CCH D;  4RO0 A;  5CBN A;  1S9K D;  1L0N D;  1E5W A;  4PJ0 E;  2PAJ A;  3M0D C;  4R4L A;  3GKE A;  1RFS A;  1XTC C;  1VL2 A;  5E79 E;  4C7R A;  3Q2Y A;  3SWY A;  3AED C;  1KYO I;  2N9Y B;  4HM2 A;  1EDK A;  2M3B A;  3AE3 C;  4WY4 D;  1NAY A;  1VCK A;  3VMY A;  2FYZ A;  1QVG O;  3USS A;  3SWF A;  2K1A A;  3HRN A;  3L72 E;  4H13 B;  3ITK A;  2O01 H;  1WQL A;  3CC4 P;  2Q3E A;  1LTJ B;  1BGY J;  3SFD C;  1KTM A;  3L72 D;  4NBD D;  5K5G B;  3AZC A;  4K35 A;  2ZVN B;  5KJ7 D;  1U7M A;  1S5L E;  3Q5R A;  2QM7 A;  3JSV C;  3BCC G;  1SQX G;  3B5N C;  1UUW A;  1SQB K;  4IL6 X;  1LTS C;  4QMA A;  3TGU G;  3BVH A;  3V2Q A;  1M57 D;  4HM1 A;  1YYC A;  2NZ2 A;  1BCC E;  2PP6 A;  3G6E P;  3FXD A;  4DJG A;  2YFJ A;  2M5A A;  3KZI E;  2P1J A;  4WY4 B;  4N6J A;  2WQY C;  1EXI A;  3L36 A;  2W6A A;  1BCC D;  3S4R A;  3CL3 D;  2K88 A;  3M06 A;  3BRV B;  5KAI H;  3PRJ A;  2DE6 D;  2KS1 A;  1VQ5 P;  4OGQ D;  1SJG A;  2H43 A;  2A45 H;  3P8C E;  3G71 P;  1GL2 A;  3PTZ A;  1JY2 O;  4H0L C;  1LTI C;  1Q81 Q;  1ULI A;  1PP9 G;  2YO2 A;  1FOS E;  3P8C D;  2JR8 A;  3MTU E;  3VMX A;  2FYU K;  2O01 J;  2D2C C;  3L70 E;  4YPC A;  1IJD B;  1PGQ A;  1GL2 C;  1J1D B;  1CZQ A;  1SQB J;  1O7G A;  1U57 A;  3C1L A;  1L4A D;  2A06 E;  3F89 A;  2WPQ A;  3IF4 A;  2V4H A;  1GDT A;  1L0N J;  5L8R J;  3L70 D;  4NBB D;  1N7S C;  3KYQ A;  1SQQ G;  2GBW A;  1M7L A;  2HG5 D;  2A06 D;  4Z1M H;  2FXO A;  2JZA A;  3TK1 A;  2ZT9 C;  1G2C B;  2N1T A;  1URQ A;  3A0B H;  2H7H A;  3NTN A;  1LNQ A;  2YNY A;  1L0L E;  3CCV P;  3V2P A;  1M1J A;  3CCJ P;  1KQG B;  1BE3 D;  2YVJ B;  3D6Y A;  2B1X A;  1O7P A;  3C8V A;  3L74 J;  2YMK A;  1T8Z A;  2XKM A;  1L0L D;  3L73 E;  3O6Q A;  1ZR2 A;  1YJW P;  4PV1 C;  1PFI A;  3CX5 E;  3B5N D;  1JCD A;  5CJ0 A;  4QUQ A;  1IFP A;  4ZKP A;  4GDO A;  2HMN A;  1K04 A;  1O7H A;  3L73 D;  3EQQ A;  1PPJ E;  4AYC A;  5TJH A;  3VCP A;  4IL6 H;  2KSE A;  3P7K A;  3CX5 D;  1NYH A;  2WIT A;  2QM8 A;  2I7F A;  3T97 A;  3VP8 A;  1RE3 C;  4GT1 A;  1Q7Y Q;  5B5E H;  1PPJ D;  3WU2 H;  2QJP C;  2HMK A;  4HM3 A;  1ZR4 A;  4N78 D;  3E7K A;  2O01 N;  3O8Z A;  2OYO A;  3FOU A;  4JYC A;  3B8E B;  5AVY B;  1KMI Z;  2JDI H;  1T3U A;  2KZI A;  3K5B A;  3SWK A;  3S9O A;  4H0L D;  2LXC B;  4DT0 A;  1SQX K;  3H1I D;  1KZU B;  1KV4 A;  2PFX A;  3GF3 A;  2Q1K A;  2ZFC A;  3H1K E;  1EDL A;  1NTM G;  1KIL C;  4EI2 A;  3L75 J;  1N7S D;  3H1K D;  1NKN A;  2XNX A;  5HL4 A;  3KXD A;  2ZT9 D;  1HWT C;  4HM8 A;  3GHG C;  5KLV E;  3NMD A;  2M5A B;  1YIT P;  3IAO A;  5AVT B;  2BCC J;  2NWF A;  4UB8 H;  5TIS E;  2E74 C;  2Q5U A;  5KLV D;  4H0L B;  1SQP E;  4KT0 J;  3G9R A;  2N9B A;  3MD0 A;  3OA7 A;  2W6B A;  1NWQ A;  2KS1 B;  1BE3 J;  3DQY A;  2P67 A;  5AVQ B;  2D2C B;  1NU1 E;  1GL2 B;  3VMH D;  2XSH A;  1BGY G;  2R32 A;  2QJK C;  1SQQ K;  2E76 B;  1NU1 D;  1EZV E;  2IFM A;  2SPZ A;  3CCL P;  1BSH A;  3HUS C;  1W2E A;  4EMJ B;  1FJK A;  4UB6 H;  3H1J E;  2IZ1 A;  1ZV8 A;  1FBM A;  4QDF A;  2KB7 P;  2ZT9 B;  1N73 C;  2JKV A;  2M0B A;  1EZV D;  4P1B H;  2IBZ G;  2WPR A;  2R5D A;  4DZO A;  1JY3 O;  3B71 A;  3H1J D;  5KKZ C;  3MHV A;  1X22 A;  1YQ4 C;  1YTZ T;  2NUM A;  5CCH A;  1O7M A;  2N1T B;  1URQ B;  2JWD A;  5AVU B;  1OW8 A;  3HD7 C;  1FS0 E;  1KIL E;  2J59 M;  4NPF X;  2QVA A;  4PV1 B;  1KN7 A;  1PGJ A;  4DOJ A;  2E75 C;  1M1J B;  1HF9 A;  2DE7 D;  3H1L J;  2KIK A;  1K9M Q;  3G4S P;  1RHZ B;  1AFO A;  1AJY A;  5CHX A;  3H1I J;  1KIL D;  1AQT A;  3R2P A;  3H1H E;  4WY4 A;  2J58 A;  5AW3 B;  1EC5 A;  1NJI Q;  3O6Q B;  1ZLL A;  1T2K D;  2NRG A;  1RF0 C;  1J1E B;  3I56 P;  1SQB G;  4YTP C;  2ZVO B;  3MUD C;  1YJ9 P;  3H1H D;  3FWN A;  1FZC C;  3Q5S A;  2NVG A;  1P84 E;  1LTG C;  3VN0 A;  1L0N G;  1PL5 A;  5H2F E;  2QSI A;  2B9B A;  4WBA A;  4OWF A;  2AXT E;  3CCQ P;  5AW4 B;  3T97 B;  2E74 D;  4M3L A;  1P84 D;  1GK4 A;  1LWU A;  3VCA A;  5KJ7 A;  1D7M A;  3WUU A;  1VF5 B;  2H88 C;  1SFC C;  1Q90 C;  1PGO A;  3HTK A;  2IDB A;  1E79 H;  5KLV J;  2L5G B;  2QA4 P;  5B66 E;  4A7P A;  5GTH E;  1MFZ A;  1LWU C;  1S72 P;  1NDO A;  2XV5 A;  3L74 G;  1FZG A;  4U3F E;  3A0H E;  1DEE G;  2WVR A;  2A45 G;  2QRX A;  3I55 P;  1O7W A;  3A5T A;  2XU6 A;  4U3F D;  2XR8 A;  1GTW A;  4I6M C;  1EDI A;  1HJ0 A;  3WUV A;  4IFD K;  2ZYA A;  3AEE C;  2OGU A;  2WMM A;  1JY2 N;  2ZYD A;  3AE2 C;  4JF7 A;  3H1J J;  3CLQ A;  4XA4 A;  3PHL A;  2Q7C A;  2POH A;  3RK2 D;  2C9L Y;  2B89 A;  2RN0 A;  3IR9 A;  2ZYL A;  2KI7 B;  3HD7 D;  3M0D A;  3Q5P A;  3GZX A;  1L4A A;  2AXC A;  2E75 D;  2IFN A;  2BAS A;  2YKO A;  1S5L X;  1AV1 A;  1H89 A;  4NBH D;  3GMA A;  3E1I A;  4Y99 C;  1L4A C;  3F5H A;  1N7L A;  3JC2 2;  2R5B A;  5KAF E;  3QWO C;  1FQT A;  1N73 B;  5APX A;  3L75 G;  2QEX P;  5APQ A;  2I1K A;  5AW2 B;  5KKZ B;  2BEQ D;  4JBZ A;  1NTK K;  1USE A;  2Q3I A;  4QUR A;  2KUB A;  3D6Z A;  3V2R A;  2W90 A;  2B24 A;  4QDF B;  4TT3 H;  3GB4 A;  1Q90 D;  1SFC D;  2XSO A;  2ZYG A;  1ZRT E;  3L35 A;  2JWA A;  3B5N A;  2BCC G;  1VQ7 P;  1NKZ B;  1LTA C;  1RIE A;  4LGD E;  1M8O B;  3AE8 C;  3D70 A;  2E75 B;  1VQN P;  2E4P A;  4D6T E;  4AAY B;  2FYU E;  1ZRT D;  1NTZ E;  1BE3 G;  4OVN F;  1OW6 A;  4KHX A;  4D6T D;  3U1A A;  2FYU D;  4PJ0 H;  3MGN A;  2KZJ A;  1L0N K;  1NTZ D;  5DJU B;  5E79 H;  1RE4 C;  1BSN A;  2ZAE B;  2NVF A;  2YO3 A;  3PJS K;  2WPV B;  4I7Z C;  1IZN B;  4L74 A;  1NTK J;  4LLH A;  3L71 E;  3OAK A;  2JP3 A;  1SFC B;  1VQO P;  1YTZ I;  1FE6 A;  3L71 D;  3C0D A;  1OVR A;  5AW6 B;  3VMG D;  1LWU B;  1DD3 A;  1N7S A;  2CPS A;  4YXD C;  3HTK B;  3CCM P;  5AW1 B;  2W6J H;  1ZW0 A;  1FDI A;  3H1L G;  3RL0 C;  2WZ7 A;  4EOT A;  1NH4 A;  3H1I G;  1OW7 A;  4C7N A;  1JTH A;  4H44 C;  2YKQ A;  3KZI H;  1HTL C;  1PGP A;  1IFN A;  1VQL P;  1LTB C;  1YHQ P;  1GK6 A;  4OGQ B;  2JJL A;  1K8A Q;  1VQ6 P;  2OYH C;  2Z4E A;  1EZV I;  3OW2 O;  1FDO A;  3BCC E;  1NGM B;  1SQX E;  3TGU E;  3V4W A;  4P1C H;  3L72 J;  3JCU E;  1QEX A;  1RE3 A;  3BCC D;  1KYO E;  1SQX D;  1Y47 A;  2OAR A;  2I8D A;  5KLV G;  1L4A B;  3TGU D;  3Q1M A;  4B86 A;  4TLF A;  1IFM A;  4HM4 A;  1KYO D;  1JY3 N;  2R44 A;  3RK3 C;  3CPW O;  3HE5 A;  1OVV A;  4R4M A;  1NTZ J;  4Y28 J;  2BEZ F;  1BDD A;  5CCG C;  1Y9B A;  3P8M C;  1BCC J;  2I1J A;  1PP9 E;  3PP5 A;  3PLN A;  1ZOY C;  5AVW B;  2QE7 H;  2YXR B;  1FZB A;  1KIL A;  1OXZ A;  2NPS C;  2IPP A;  1HGZ A;  1VPC A;  2OTK E;  4NB9 D;  1PP9 D;  3H1J G;  5BU8 B;  1X9V A;  2WT7 A;  3B5N B;  4HKZ H;  1EXJ A;  4GIF A;  2CKF A;  1L0L K;  1G8K B;  3CX5 H;  2WSS H;  2DW3 A;  3RL0 D;  2J5U A;  3RL0 g;  3ZDM A;  3GHG A;  1X0T A;  2KXP B;  1T2K C;  4L73 A;  2GBX A;  3W68 A;  1ZXG A;  2GUS A;  2H8P D;  4H44 D;  5CJ4 A;  5AEU A;  1JMB A;  2FYN C;  1L2P A;  3L70 J;  3L37 A;  3R4Y A;  1IFD A;  1FOS F;  4QDC A;  3VMZ A;  1R5L A;  1IO4 A;  1DH3 A;  1NAF A;  4IFF A;  2VRS A;  2AEM A;  1LT9 C;  2OYI C;  2WSC H;  1X79 B;  3HUS A;  2K9Y A;  3TSI A;  1AQ5 A;  4I2L C;  1GU4 A;  1SQP D;  3AEF C;  3AE1 C;  1L0L J;  2G8Y A;  5AVZ B;  3RK3 E;  4PD4 E;  1N73 A;  1JNM A;  3VMI D;  4NBA D;  1MZ9 A;  2GUV A;  1Q86 Q;  2HMJ A;  1N7S B;  3RK3 D;  3KQG A;  4GKG A;  3L73 J;  4PD4 D;  1OMI A;  3VOP A;  2ITA A;  1Q2N A;  1X8Y A;  5CCG D;  2Z5I A;  3HD7 A;  1JEK A;  4EIJ A;  4C7N B;  1SQV E;  1JTH B;  4BXL A;  1WT6 A;  1WMK A;  5TIS H;  2K37 A;  1AA0 A;  1NTK G;  2YKP A;  3CWB E;  3RK2 C;  1SQV D;  2NPS D;  2OTL P;  1NTM E;  2XND H;  5KLV K;  2HMO A;  1OWA A;  1HH0 A;  3QH9 A;  1EQ7 A;  1RF0 A;  2C0X A;  1U7J A;  4EYY Q;  1GMJ A;  3CWB D;  3MUD A;  1N8R Q;  1KB9 E;  2W8Z A;  1NO4 A;  1LJ2 A;  1FZE A;  1FZC A;  3M91 A;  4H13 C;  4GOE A;  1NTM D;  3H25 A;  3H32 A;  1H8A A;  5CBO A;  2WSC J;  2M8R A;  1QL2 A;  4JQ0 D;  1LTJ C;  1KB9 D;  2E43 A;  4WB4 A;  2QJY C;  1PZQ A;  4XE5 B;  2QJP B;  2WPS A;  1SFC A;  3H1K J;  2DE5 D;  1JY2 P;  3CXH E;  1M56 D;  5GTI E;  1MFT A;  1YI2 P;  3HE5 B;  5BVZ A;  1MKM A;  4QUP A;  3CD6 P;  4XFJ A;  3RGU A;  2FKW B;  3C9I A;  3CXH D;  2GM4 A;  2JO6 A;  1BGY E;  1AVY A;  1RH5 B;  3CC2 P;  1KQS O;  3GOB A;  1RY3 A;  2BMQ A;  1YJN P;  2Q6Q A;  1BGY D;  3SFE C;  1KIL B;  5BU5 A;  4HJL A;  3AE9 C;  5APU A;  2WTY A;  3M9H A;  4HM7 A;  1SQP J;  1M90 Q;  2KOG A;  3L72 G;  2WT7 B;  2IBZ E;  2KK7 A;  2Y0E A;  4IOI H;  2FYN B;  1NU1 J;  1JM0 A;  3GHG B;  1SS1 A;  2IBZ D;  1IK9 A;  1P84 H;  5H2F H;  2NUK A;  2E74 B;  1XTG B;  2G3A A;  1NTZ G;  2AXT H;  3UIA A;  1SP4 A;  4NBE D;  1LP1 B;  5CMZ A;  2R3C A;  1BCC G;  4NPD A;  3D89 A;  1VDF A;  1FU1 A;  2C9N Y;  1SQV J;  2PRR A;  1UII A;  1KOR A;  3TF5 A;  3FGA D;  2FY8 A;  3PH0 A;  3GL0 A;  2QJK B;  5B66 H;  5GTH H;  4H13 D;  1SQB E;  3V5B A;  3RBZ A;  3GCE A;  3LW5 H;  1QLE D;  1G1J A;  3CWB J;  4YXW H;  1LTT C;  3HUS B;  1RF1 C;  3A0H H;  5M1B A;  5DJT B;  1SQB D;  2HR3 A;  1GD2 E;  2YFI A;  4ZKU A;  4L75 A;  2MJZ A;  3M9B A;  2O3J A;  3MIW A;  3H1H J;  3CME P;  1YQ3 C;  3L70 G;  3ABV C;  3CX5 I;  1ULJ A;  3AEB C;  1N86 A;  2AEJ A;  3RK2 B;  2A06 G;  3CC7 P;  1CI6 A;  2ZJS E;  3GW6 A;  3HD7 B;  3L74 E;  5KAI E;  1NYK A;  1QL1 A;  1JO5 A;  2LR2 A;  5BOK A;  1GW3 A;  2YXQ B;  2OTJ P;  1J2J B;  3L4F A;  1JOC A;  1RE4 A;  1KD1 Q;  3L74 D;  5AVX B;  3H6P A;  3HE4 A;  3W67 A;  4GOD A;  2QJY B;  1L0L G;  2HFE D;  3GTE A;  1FZC B;  1LGH B;  1NVO A;  5KAF H;  1Z56 A;  4RKU J;  2YIU C;  3H32 B;  3LW5 J;  4HB1 A;  1OVU A;  1UIX A;  4JYB A;  3I5C A;  4U3F J;  5AW9 B;  3L73 G;  4ASW A;  1OIP A;  3TDK A;  1H0T A;  3VP9 A;  1MV8 A;  1OFC X;  4ZNC A;  3N4X A;  1UUV A;  1PPJ G;  3N7N A;  1G1I A;  5AW5 B;  3KHU A;  4BRY A;  3A0B E;  2E5T A;  3Q3D A;  2HMM A;  3M9Q A;  4C46 A;  1FDM A;  1FJP A;  3NXS A;  1S5L H;  3EFG A;  5C39 A;  2Y0D A;  2KLU A;  3L75 E;  3NFQ A;  1JY3 P;  4JPZ B;  5EFW B;  4BWN A;  1VQK P;  4AQR D;  2KYV A;  3L75 D;  1S2E A;  2OYH A;  1NTZ K;  1KFM A;  2K9J A;  1RQU A;  4IL6 E;  2HPC A;  5CXM A;  4LC1 A;  2BCC E;  2E76 C;  2YMY A;  3H1K G;  2RH0 A;  1QGK B;  1N2D C;  5B5E E;  2P10 A;  3WU2 E;  4PD4 I;  1T3J A;  2Y0C A;  1K05 A;  3V6I A;  2BCC D;  1BE3 E;  2LKM A;  5APW A;  3AE5 C;  5AVR B;  1AVO A;  2JEE A;  4NBF D;  2CPB A;  2M3E A;  3EWK A;  1S4X A;  2HLO A;  4GOF A;  2L91 A;  1T6A A;  3KDP B;  4HYT B;  5APS A;  4ZMD A;  4Y99 B;  1RF1 B;  1DIP A;  3MP7 B;  5CCG A;  3EQ2 A;  3BRT B;  3U59 A;  2N1T C;  1URQ C;  1DEB A;  5KTB A;  4CPG A;  3TYY A;  3D71 A;  4D6T J;  3AE4 C;  4L76 A;  1SQP G;  2FYU J;  4KJM A;  1M1J C;  1EG9 A;  2HML A;  1VQM P;  3N0Q A;  2FXP A;  2NPS A;  1NU1 G;  2K3R A;  4N78 E;  1VQ4 P;  3CCE P;  1KB9 I;  2WSF H;  3B4S A;  3AE7 C;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 4HJL A;  2DE7 D;  1L0N E;  3L75 E;  3L73 E;  1ULJ A;  1G8J B;  3EN1 A;  1G8K B;  4NBC D;  1NTZ E;  4HM7 A;  4HM8 A;  4NB8 D;  1JM1 A;  5KLV E;  3CX5 E;  4PV1 D;  2IBZ E;  2NWF A;  3H1H E;  4QUQ A;  3CWB E;  3L74 E;  2HMN A;  1O7H A;  2DE6 D;  3EQQ A;  1NYK A;  4OGQ D;  2GBX A;  1PPJ E;  1SJG A;  3GZY A;  4H44 D;  3VCP A;  3H1L E;  2YFL A;  3BCC E;  2ZYL A;  3GKE A;  5AEU A;  1NTM E;  1SQX E;  1RFS A;  2HMO A;  1SQP E;  2XRX A;  5BOK A;  2FYN C;  3TGU E;  3GZX A;  3H1I E;  5CXM A;  2NVF A;  2I7F A;  2E75 D;  2BCC E;  2NVG A;  3DQY A;  1SQQ E;  1P84 E;  1KB9 E;  1ULI A;  2NUK A;  4HM2 A;  4P1C H;  4QDC A;  2QJP C;  2HMK A;  1KYO E;  1NU1 E;  4HM3 A;  4NBE D;  3VMH D;  3GL2 A;  1VCK A;  2XSH A;  4QCK A;  3L71 E;  3FOU A;  4NBH D;  2E74 D;  3L70 E;  4AIV A;  2QJK C;  5AEW A;  2D2C D;  3GTE A;  1O7G A;  2QPZ A;  1BE3 E;  3VCA A;  2A06 E;  4HM4 A;  3L72 E;  2QJY C;  4QDD A;  1EZV E;  2YIU C;  3D89 A;  4NBF D;  1Q90 C;  1NTK E;  4HKV A;  4HM6 A;  1FQT A;  4EMJ B;  5KLI C;  3C0D A;  4NBG D;  4HM0 A;  2E4Q A;  3H1J E;  1WQL A;  2DE5 D;  4H0L D;  4NBB D;  3VMG D;  2E76 D;  2GBW A;  1VF5 D;  3GL0 A;  4QDF A;  3CXH E;  4H13 D;  1SQB E;  3GTS A;  4NBD D;  2JZA A;  2Q3W A;  3GCE A;  4P1B H;  3AZC A;  4PD4 E;  1NDO A;  4QUP A;  4QUR A;  2BMO A;  5KKZ C;  2B24 A;  3VMI D;  1UUV A;  4U3F E;  1PP9 E;  4NBA D;  4QDF B;  3H1K E;  2HMJ A;  3GB4 A;  1VM9 A;  1UUW A;  2JO6 A;  1BGY E;  2XSO A;  1O7W A;  1ZRT E;  2BMR A;  1EG9 A;  2HML A;  2NUM A;  1L0L E;  4HM1 A;  2YFI A;  2HMM A;  3GOB A;  2YVJ B;  4NB9 D;  3N0Q A;  2XR8 A;  1RIE A;  1O7M A;  4HM5 A;  1BCC E;  2BMQ A;  2B1X A;  2NVE A;  2E4P A;  2YFJ A;  1O7N A;  5HL4 A;  1O7P A;  4D6T E;  4AAY B;  2FYU E;  1SQV E;  2ZT9 D;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...