3H1KE

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 30
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1kE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1kE02
1BE3E 2YFIA 2A06E 3L72E 2DE5D 2QJKC 3L70E 4P1BH 4QDFA 1NU1E 5KKZC 1ZRTE 2XSOA 3AZCA 4HKVA 3H1JE 3L75E 1BGYE 4QCKA 2E75D 2HMKA 1NDOA 4HM0A 4PD4E 3GKEA 3L71E 2GBWA 2XRXA 4P1CH 3N0QA 2XR8A 3VCPA 5KLVE 4NB9D 4HM4A 2HMOA 1VF5D 5CXMA 4QDFB 3EQQA 4QDDA 1SQXE 1G8JB 4NBDD 4H0LD 2NWFA 4OGQD 3GL0A 2ZYLA 3GTSA 3DQYA 3GL2A 3VMID 1FQTA 2NVFA 2XSHA 4HM2A 4QUQA 3C0DA 3GTEA 4HM5A 2FYNC 2HMJA 5AEUA 3L73E 3H1HE 4HM7A 1RIEA 3D89A 4NBHD 4EMJB 4HM6A 1SJGA 2NUMA 4NBGD 1UUWA 3GOBA 2CKFA 4AIVA 1BCCE 2Q3WA 4QUPA 3GZXA 3H1IE 1O7NA 2DE6D 2FYUE 1SQBE 4H44D 4HM8A 2JZAA 1KYOE 3H1LE 3L74E 2QJPC 4H13D 3EN1A 4HM3A 4PV1D 1SQVE 2GBXA 4HJLA 1L0LE 1EG9A 3VCAA 1EZVE 2E74D 2YFJA 3FOUA 2ZT9D 5HL4A 2BMRA 2HMNA 2YVJB 5BOKA 2JO6A 2BMQA 2E4PA 2E4QA 4HM1A 4NBAD 4AAYB 1O7HA 1UUVA 2HMMA 1PP9E 1ULIA 2B24A 2HMLA 2BMOA 2D2CD 2NVGA 3CXHE 4QURA 3GCEA 1SQQE 1KB9E 2YIUC 2B1XA 2YFLA 1NTZE 1SQPE 2IBZE 1G8KB 1VCKA 2NUKA 1Q90C 1L0NE 3BCCE 1P84E 3GB4A 5AEWA 1RFSA 3CX5E 4NBFD 2NVEA 2QJYC 1PPJE 4D6TE 1JM1A 4U3FE 1NTME 1NYKA 1O7WA 3GZYA 3VMHD 2BCCE 4NBCD 5KLIC 3TGUE 3H1KE 2I7FA 2E76D 1O7MA 4QDCA 3VMGD 4NBED 4NB8D 1ULJA 1O7PA 2QPZA 2DE7D 1NTKE 4NBBD 1O7GA 3CWBE 1WQLA 1VM9A
chains in the Genus database with same CATH superfamily
3R4YA 2PFXA 4YXWH 2QVAA 2B88A 2E5YA 3MIWA 2XSOA 1N7SA 1HUCA 4C7NA 2HPCB 1SFCC 2XR8A 3HRNA 1PGJA 1FDOA 1NTMJ 4GOEA 2JWAA 4AQRD 3CCMP 3RL0g 4ZMDA 1XTCC 2YO2A 1EDKA 3B5NC 2A45H 5AW3B 5H2FH 4QUPA 4HJGH 1LGHB 1NTKG 2BASA 4H44B 1NTKK 3M9HA 3G3ZA 1SQPK 3EN1A 4PV1D 3BATA 1EZVE 1L0LK 2Q7CA 4JF7A 3RK3E 1JCDA 1BCCG 1GK4A 2HMLA 5AW9B 3D6ZA 2XNDH 2FYUD 4LGDE 1N86A 4U3FE 1KILD 1QEXA 1HGZA 1O7WA 2FXOA 4OH8B 1LWUA 3D71A 1X8YA 1K04A 3GHGC 1FZGA 3JCUH 2O01H 4IL6H 1BGYG 1AV1A 1Q82Q 4UB8H 4P1BH 4KJMA 3PRJA 2R44A 1OWAA 1QVGO 1KC8Q 3R2PA 2GBWA 1NKZB 4N3YB 3VCPA 2OYHC 4QDFB 3T97B 2XZRA 3A0HE 3L70G 1LP1A 1G1JA 2ZXEB 2FYNC 3P8CD 2RN0A 1RQVA 3N7NA 1BGYJ 5CCGD 1UUWA 5CCHA 2A45I 1BCCE 3EFGA 3GLMA 3H1LG 1M8OB 2QJPC 1NU1K 4H13D 4JYCA 1X79B 2N1TA 4K3AA 3FX0A 5AW8B 3VCAA 1L0LD 3IN6A 3JCUE 2QIWA 4AAYB 4RESB 3IAOA 3FXEA 3W67A 1NO4A 3S1KA 2J59M 3GCEA 3MP7B 2AEJA 3VOPA 3D6YA 2BCCG 3F5HA 1SFCD 1DH3A 3O6QB 1N7SD 3T97A 3CCQP 1H0TA 2XU6A 1VL2A 3H1LJ 2I1JA 4I7ZC 1O7MA 3L72J 4IFDK 5GTHE 1OFCX 1MV8A 2YNYA 1JTHB 3TK1A 1O7GA 4YTPC 1FZEA 2KI7B 1SQVK 1ZN5A 2KP8A 1LTIC 3AZCA 2OYHB 1SQQG 1GTWA 3RGUA 3L74J 1KILC 4N78D 1E79H 2BCCJ 1N7SB 3U1CA 3LIDA 3LW5J 2HR3A 1NTZK 1JCCA 2PGDA 3CC4P 1FAVA 1NHLA 3H1KG 4HM5A 2HYNA 3MGNA 3CLQA 2D2CC 5KJ7D 1NAFA 1EDLA 1MUUA 3K5BA 2ZYDA 4HM8A 2JZAA 2JO1A 3LIEA 5AW0B 5AVVB 4R4LA 3CX5H 1N2DC 3H1HJ 2HMNA 1RQUA 2BMQA 1GL2A 5KLIB 2JWDA 4BWNA 5KLVK 1SQXD 2Q9IA 1KB9D 1PPJD 2M3BA 2W27A 1KQSO 4N6JA 1MFTA 3L74G 3PHLA 2JDIH 1QLED 1NOHA 3A3YB 2E75B 2WZ7A 4C46A 4NBFD 4D6TJ 1NTME 1BDCA 1AVYA 3CL3D 1U7JA 2E76D 2L91A 1USEA 3I5CA 1FS0E 2YXQB 4WVZA 3SSUA 1IJDB 2ZFCA 2W6AA 1NU1E 3AEAC 1SQQD 5AW5B 1VQPP 2FY8A 3RK2B 1D7MA 2FFDC 2KLUA 3Q3DA 1YITP 1QVFO 1SQVG 3EQQA 2FXMA 1DD3A 3KDPB 1FE6A 2NVFA 2Z5IA 5AVQB 3VMYA 3CC7P 1SJGA 4Y99B 3H1KJ 1PL5A 4IL6E 4UB6H 2CK3H 3AE1C 3TGUG 3GZXA 2Q3IA 3AE9C 2FFDB 1NTZJ 2FYNB 3VN0A 1JY3N 1OVRA 1L4AD 1M1JC 4IL6X 4RJTA 1VPCA 3CPWO 3GW6A 3HUSC 4OGQB 4PD4H 3M0DC 2E4QA 4GOFA 1UUVA 2ZYGA 3P32A 2QJYB 1CI6B 3H1HD 2NVGA 1URQC 4EYYQ 3BASA 2ZT9C 2KS1B 2IBZE 5KKZB 1VCKA 2UWJE 1VQNP 3IFMA 3E1RA 5CBOA 1NYKA 3CWBJ 1JEKA 3L70D 2RMZA 3H1KE 1DEEG 1JOCA 4I2LC 3MHVA 3AEBC 1WT6A 5H2FE 4NBBD 3TF5A 3CWBE 3BRVB 1S5LH 5GTHH 1RHZB 2IFMA 3L72G 4DCKA 1YI2P 2YKQA 1EXIA 1SQXG 1H8AA 3VP9A 3RL0D 1NU1J 3C1LA 3E7KA 5KLVE 5APWA 1RY3A 3GHGB 1VF5D 1SQXE 4NBDD 1KQGB 4HB1A 3KZIE 2D2CB 3H6PA 1FQTA 1ZR2A 4QUQA 3GTEA 2XKMA 4K35A 4QMAA 2HMJA 2AXCA 2FYUJ 2WSEJ 1DX7A 2XDJA 1S72P 3GOBA 2OTLP 5KAFE 2H7HA 3SWKA 2OTKE 3OA7A 2K9YA 3RBZA 1EC5A 4XFJA 3AEEC 2K37A 3H1JJ 1KFMA 1SFCB 3WUTA 3A5TA 1S9KD 1VF5B 4GKGA 5CCHD 1JTHA 1SQQE 2K3RA 1AQTA 1CI6A 5BVZA 3H1JG 2GUVA 5AVUB 1P84E 1JNMA 3GB4A 2QJKB 3CX5E 3RL0C 2QJYC 4EIJA 1G1IA 3GZYA 2N1TD 1YTZT 1K9MQ 2B87A 3BRTB 4QDCA 3VMGD 3A2AA 2QPZA 3VP8A 3TNUB 3H1IG 2Z4EA 1BE3E 3HD7D 2KIKA 1LTAC 2Y0DA 3CXHH 3O6QA 3H1JE 3CCJP 2P67A 2B9BA 4R4MA 2KLVA 3L73J 2N1TB 1HF9A 1S2EA 1PP9J 1N7LA 2OGUA 4L74A 3KQGA 4NPDA 5AW4B 4OGQD 3GL0A 2OARA 3MTUE 2WPVB 2XSHA 1RF1C 4BRYB 1QL1A 1OW7A 5AEUA 2P58A 1NH4A 3CXHD 2FYUE 1BE3J 2YKPA 4IOIH 4I6MC 2POHA 3EWKA 3RK3C 3TGUJ 3FOUA 1NTMK 4HM1A 1PP9E 1SQPD 2LXCB 4PD4I 1Q7YQ 2D2CD 2LR2A 2Y9YA 1NKNA 4H0LB 2W90A 1T6AA 2BEZF 2WPQA 1T2KC 1KMIZ 1SQPE 4ASWA 3MZWB 1UIXA 5CMZA 4KT0J 5CHXA 1NU1G 1KB9H 5AVYB 5TISH 1YTZI 1TU3F 1KQLA 3IF4A 3TYYA 1IK7A 3CCLP 2HLOA 2W8ZA 1BSHA 2YIUB 5APXA 1W5CE 2C9NY 1UIIA 1ZXGA 3AE8C 4W7ZA 2YO3A 2OYIB 3SFEC 5B66H 4JBZA 2E75D 3GF7A 3AE4C 2RH0A 1L0LG 1VQ6P 3GKEA 3BCCG 4P1CH 2H88C 3FXDA 2JR8A 2IBZG 1S9KE 1SQXJ 1SQXK 1EZVG 5BU8B 4I7ZB 3VMID 3B5NB 4OVNF 1HJ0A 2NPSD 1FZCB 3CMEP 4HM6A 3V2RA 1OX3A 1L0ND 2KNCA 1L4AB 2Q3WA 2OQQA 1SQBE 2Z5HA 2GBXA 3EFFK 1KILA 2JO6A 1ZOYC 3M06A 1KYOD 1FZAA 2B24A 5CCGC 4GIFA 3V4QA 1SQQK 3JSVC 4HYTB 5CCGA 4WY4B 3M91A 1FOSF 1HVVA 1LTSC 1BCCJ 2AXTH 1AA0A 1KYOH 2WT7B 4NB8D 3V2QA 1LT9B 3V2PA 3USSA 3HTKA 2PAJA 1RF0C 1NVOA 2GUSA 3L70E 4QDFA 4GDOA 4H0LC 3L75E 3WU2E 2QSIA 1KFNA 1M1JA 2WMMA 4HM0A 3VMXA 4PD4E 2HG5D 1VQOP 5CXMA 2NWFA 1FZBA 1VQ9P 3NXSA 5DJUB 1ZLLA 1HJBA 1RIEA 4NBHD 4NPFX 4EMJB 2IFNA 4NBGD 3UIAA 1A02F 4ASVA 3H1IE 4GODA 1H89A 1O7NA 1A02J 1JB0J 3CWBG 4BXLA 3RK3B 1GW3A 3VMAA 3SWFA 1LWUB 1LTGC 1OIPA 2BMRA 3N4XA 4NBAD 1LTJA 3AEGC 3L36A 1YJNP 3CCVP 1GMJA 1HWTC 1QX8A 3ABVC 1NJIQ 2KSJA 1LT9C 1BCCD 3HUSB 3PJSK 1FZFA 2K9JB 3L71G 1EDIA 2V7QH 1NU1D 1IC2A 2Y9ZA 2O1JA 1Q90C 1T3JA 1PPJE 1JM1A 1S1CX 3G4SP 1IO4A 2R32A 5CCHC 1EQ7A 2WVRA 3TGUE 3HD7A 5B66E 2I7FA 1O7PA 1SQBD 1Q90D 3L75D 3H1ID 1KORA 1GU4A 2NPSC 1PGPA 3P8MC 4OWFA 2YFIA 1SQBG 2QJKC 2A06D 3WUUA 4QCKA 4B86A 1NDOA 2HPCA 2G3AA 1VF5C 3II6A 5CJ4A 1OZHA 1L0NG 2Y0EA 4WWIA 1L4AC 2N9YB 3L75J 5B5EE 3RK2D 1NWQA 4HM4A 2HMOA 3S9OA 1P84I 4AYCA 3CI9A 3FWLA 1G8JB 1PZQA 3HE5A 2C0XA 1L0LJ 3GTSA 3CD6P 1NTKJ 3L73E 1SQPJ 2KYVA 5AW6B 2E43A 5E79E 2GA1A 3BCCD 2MKVA 3F89A 1H88A 2IPPA 2HFED 3AE2C 1Q81Q 3H1LE 1GDTA 2J58A 2NPSB 3CCRP 1RF0A 1M57D 5E79H 3B5ND 4RO0A 1ZR4A 5BOKA 1L2PA 1FDIA 4EOTA 4QURA 2MJZA 2YIUC 2B1XA 2HODA 2YFLA 4IFMA 1RH5B 1L0NE 3H1JD 2NVEA 4D6TE 1OXZA 1BSNA 5AVRB 5AW7B 2R5DA 1KN7A 2R3CA 4NBED 2KUBA 1DEBA 2CPBA 3MUDA 2YKOA 5KKZC 3PP5A 1QGKB 2P10A 5KAFH 3M0AA 1RE3C 3H32A 1SS1A 3M9QA 3QWOC 4U3FG 4M3LA 2LKMA 1YQ4C 1AQ5A 1IFNA 4YXDC 1JY3O 1NGMB 1OVUA 3KZIH 2WSFJ 5AVTB 2E74B 4IFFA 1K05A 3P7KA 1OW8A 4WY4C 2O01J 4D6TG 4PV1B 1ZW0A 3Q5SA 2N1TC 3TNUA 4H44D 1M7LA 3AE7C 4JQ0D 4HM3A 3C8VA 2E76B 2FKWB 4UB8E 2NPSA 5TISE 1M1JB 3P8CE 1NTMG 1MKMA 2QG4A 1URQA 1KZUB 3B4SA 3L70J 3CCEP 5APYA 4D6TD 1HBWA 3L35A 1SQVD 2JP3A 1LT9A 2W6BA 3RK3D 1IFPA 2IZ0A 3AE3C 3HE5B 4I1LA 4H13B 2IBZI 1IFDA 5L8RJ 4NBCD 1E5WA 2J5UA 2G8YA 2P1JA 2FYUG 1Y9BA 5KTBA 2E74C 4NPEA 1IFJA 4U7JA 2GM4A 1ZMEC 1KYOI 4WB4A 1J1EB 1GZLA 3AECC 1VQ7P 2AXTE 2HMKA 4RKUJ 3U1AA 1FZCC 2XRXA 3Q5RA 2Q3EA 5M1BA 3G9RA 4ZKPA 4JYBA 1YBKA 4EI2A 1EZVD 1YIJP 5APTA 1JM0A 5GTIH 1K8AQ 2JEEA 2H89C 1LWUC 1PPJG 2AEFA 1T2KD 1SQBK 1JMBA 2HODB 3QH9A 3HE4A 5AW2B 1OW6A 2M0BA 1GL2D 2K9JA 3PTZA 4WY4D 1GL2C 1YJWP 1FJPA 2ZT9D 1O7HA 2BMOA 1BDDA 1W2BO 3A0BE 3CX5I 2QE7H 1LP1B 1FJKA 3BCCE 2OYHA 2N9BA 4U3FJ 4TT3H 3A0BH 2KZIA 3SWYA 4DZOA 3TGUD 3KPEA 3BVHA 2DE7D 1M1KQ 1FOSE 1DD4A 1Y47A 2A06E 3V2NA 3ITKA 2XNXA 1JY2N 1R5SA 1NAYA 4OGQC 3NMDA 1R8EA 1NTZG 2P7JA 3VYIA 2OYOA 1N73C 3D70A 1H0TB 1LTJC 3AEFC 1S5LX 2BEQD 1HGVA 2H43A 1JO5A 3BCCJ 4HKZH 3G6EP 2QJPB 4Y99C 1YHQP 2QM8A 3GMAA 3CCUP 2IX7C 2NRGA 3H1HE 4HM7A 3CC2P 1IFMA 1S5LE 2IZ1A 2K1AA 3OAKA 4AUWA 1LTJB 2O01N 2DE6D 3H1HG 2IDBA 5KJ7A 4PJ0H 4DJGA 2IBZD 3AEDC 1L0NK 2YFJA 5APVA 5GTIE 2YVJB 1DIPA 2L5GB 4MN4C 2E4PA 2KNCB 3H1LD 2QA4P 1ULIA 2P2UA 4PV1C 2KB7P 1FZCA 1EXJA 3I55P 2I1KA 1S4XA 5BU5A 1AFOA 5C39A 1G8KB 1IZNB 2B89A 1RF1A 2QM7A 2A45G 2O1KA 1PP9D 3ZDMA 4PJ0E 2BCCE 2ZXXA 1G2CB 5EFWB 1LT1A 5AVSB 1SQQJ 4UB6E 1T8ZA 2JKVA 1XTGB 1WQLA 1KQFB 2DE5D 3V5BA 1X22A 1ZRTE 3OW2O 1U7MA 2E5TA 1X9VA 1JMMA 1KD1Q 3L4FA 3RBXA 1RE4C 1MFZA 1P84H 1LJ2A 2ZJSE 4NB9D 3L73G 3Q1MA 4LC1A 3Q2YA 3HTKB 2FYZA 1J1DC 1VQ4P 2QEXP 2Q5UA 3HD7C 3OJAB 1P84D 2KSEA 3TDKA 1GK6A 3GHGA 1Y8AA 4JPZB 4DT0A 2KZJA 2ZAEB 1N7SC 3AE6C 3U59A 5CJ0A 4L73A 1BE3G 3KXDA 1EG9A 3VMZA 5HL4A 1PGQA 1VQ8P 1L4AA 3A0HH 2V4HA 2HMMA 3LW5H 3NTNA 1RF1B 1OMIA 2O3JA 1FC2C 1JY3P 2PRRA 4Y28J 1J2JB 1LTTC 2PP6A 4H13C 3FGAD 4EDFA 3V6IA 3H1IJ 2OTJP 3H25A 3MD0A 3IR9A 3A7OA 3PH0A 1CSBA 1ZP0C 2Y0CA 4C7NB 1IK9A 5KAIE 4O9BA 2KK7A 2V7QJ 1VDFA 1SQVJ 1NTZD 1X0TA 3E1IA 2E76C 5AVWB 5TJHA 1USDA 1VQKP 3C9IA 3M0DA 1NYHA 2B87B 3RL0B 4Z1MH 3O8ZA 1KILE 2OYIA 2FFDA 4QDDA 3CX5D 1ZV8A 1N73A 1L0NJ 1KB9I 2ZVOB 5K5GB 1JUNA 3DQYA 2C9LY 3S4RA 2WPSA 3JC22 2IYPA 1CZQA 2A06G 3KYQA 1NTMD 1G2CA 3CMAP 3D89A 1FU1A 3RK2C 1AVOA 1S3JA 2NUMA 4YPCA 1GU5A 1GW4A 4WBAA 1SQPG 2Q1KA 2ITAA 1KYOE 1SQVE 3L73D 3H32B 4HH2A 5KJ7C 4W7YA 5KAIH 2WWWA 3H1KD 3L71D 4L75A 1SVFA 1SP4A 1LTBC 2C0WA 1J1DB 1RE4A 2FBWC 2YMYA 3CXHE 2M5AA 2RKLA 2WSSH 1NTZE 2M3EA 3SFDC 5AEWA 1RFSA 2I8DA 2XV5A 2AEMA 4WY4A 3NFQA 5KLIC 4BRYA 4CPGA 1ULJA 4A7PA 1VM9A 1MZ9A 1VQ5P 2R3SA 1KILB 2LXBA 3FWNA 1CW5A 1PP9G 2YXRB 2SPZA 2ZYAA 1EDJA 3L72D 3L71E 5AW1B 3KHUA 1JY2P 5AVZB 5DJTB 1PV3A 3B8EB 4H0LD 1FDMA 2FYUK 3L37A 1KTMA 2WSEH 2ZT9B 1LNQA 2VRSA 3B5NA 2M8RA 2WITA 2WSCJ 2KXPB 1SQBJ 1VQLP 1EZVI 1YYCA 1Q86Q 1J1EC 1N8RQ 5APUA 1Q2NA 3TSIA 3W68A 3WU2H 5APQA 2WQYC 2KS1A 4ZNCA 2YMKA 4TLFA 2KOGA 1L0LE 2W6JH 4KHXA 4U3FD 1SFCA 3I56P 1R5LA 1QL2A 1OVVA 1Z56A 2DW3A 2FXPA 3HE4B 3VTPC 2OYIC 3AE5C 3L75G 1BE3D 1N73B 3Q5PA 4C7RA 3GG2A 3WUVA 1U57A 4XE5B 4PD4D 5CBNA 2WPRA 1NTKE 4XA4A 3MUDC 3HD7B 5KLVD 3PLNA 1PIXA 4N78E 3L74D 3L72E 4L76A 2BCCD 1HTLC 2WSCH 1W2EA 3V4WA 2ZVNB 4HKVA 3M9BA 1BGYE 2W83C 1T3UA 1YQ3C 1KV4A 2NZ2A 2M5AB 3HUSA 3N0QA 3G71P 1SLQA 1HH0A 1ZRTD 2E75C 2CPSA 1WMKA 1URQD 4GT1A 2ZYLA 3GL2A 4HM2A 3C0DA 1M90Q 2WTYA 2JJLA 1M56D 5KLVJ 4W80A 2CKFA 4AIVA 1GL2B 3CWBD 2K88A 1NTKD 1K73Q 2R5BA 3L74E 4HJLA 2WSFH 1PFIA 4ZKUA 5B5EH 1RE3A 5KLVG 3EQ2A 2E74D 1PGOA 1URQB 2IYOA 5APSA 5AVXB 1IFIA 4DOJA 1WRGA 4H44C 1KB9E 2NUKA 3CCSP 3GF3A 4LLHA 2E42A 1BGYD 1AJYA 1YJ9P 3VMHD 1JY2O 3CXHI 3L71J 1FBMA 1GD2E 2H8PD 1VQMP 3WMM0 2Q6QA 2WT7A 3B71A 2QRXA
chains in the Genus database with same CATH topology
1BE3E 2YFIA 2A06E 3L72E 2DE5D 2QJKC 3L70E 4P1BH 4QDFA 1NU1E 5KKZC 1ZRTE 2XSOA 3AZCA 4HKVA 3H1JE 3L75E 1BGYE 4QCKA 2E75D 2HMKA 1NDOA 4HM0A 4PD4E 3GKEA 3L71E 2GBWA 2XRXA 4P1CH 3N0QA 2XR8A 3VCPA 5KLVE 4NB9D 4HM4A 2HMOA 1VF5D 5CXMA 4QDFB 3EQQA 4QDDA 1SQXE 1G8JB 4NBDD 4H0LD 2NWFA 4OGQD 3GL0A 2ZYLA 3GTSA 3DQYA 3GL2A 3VMID 1FQTA 2NVFA 2XSHA 4HM2A 4QUQA 3C0DA 3GTEA 4HM5A 2FYNC 2HMJA 5AEUA 3L73E 3H1HE 4HM7A 1RIEA 3D89A 4NBHD 4EMJB 4HM6A 1SJGA 2NUMA 4NBGD 1UUWA 3GOBA 2CKFA 4AIVA 1BCCE 2Q3WA 4QUPA 3GZXA 3H1IE 1O7NA 2DE6D 2FYUE 1SQBE 4H44D 4HM8A 2JZAA 1KYOE 3H1LE 3L74E 2QJPC 4H13D 3EN1A 4HM3A 4PV1D 1SQVE 2GBXA 4HJLA 1L0LE 1EG9A 3VCAA 1EZVE 2E74D 2YFJA 3FOUA 2ZT9D 5HL4A 2BMRA 2HMNA 2YVJB 5BOKA 2JO6A 2BMQA 2E4PA 2E4QA 4HM1A 4NBAD 4AAYB 1O7HA 1UUVA 2HMMA 1PP9E 1ULIA 2B24A 2HMLA 2BMOA 2D2CD 2NVGA 3CXHE 4QURA 3GCEA 1SQQE 1KB9E 2YIUC 2B1XA 2YFLA 1NTZE 1SQPE 2IBZE 1G8KB 1VCKA 2NUKA 1Q90C 1L0NE 3BCCE 1P84E 3GB4A 5AEWA 1RFSA 3CX5E 4NBFD 2NVEA 2QJYC 1PPJE 4D6TE 1JM1A 4U3FE 1NTME 1NYKA 1O7WA 3GZYA 3VMHD 2BCCE 4NBCD 5KLIC 3TGUE 3H1KE 2I7FA 2E76D 1O7MA 4QDCA 3VMGD 4NBED 4NB8D 1ULJA 1O7PA 2QPZA 2DE7D 1NTKE 4NBBD 1O7GA 3CWBE 1WQLA 1VM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BE3 E;  2YFI A;  2A06 E;  3L72 E;  2DE5 D;  2QJK C;  3L70 E;  4P1B H;  4QDF A;  1NU1 E;  5KKZ C;  1ZRT E;  2XSO A;  3AZC A;  4HKV A;  3H1J E;  3L75 E;  1BGY E;  4QCK A;  2E75 D;  2HMK A;  1NDO A;  4HM0 A;  4PD4 E;  3GKE A;  3L71 E;  2GBW A;  2XRX A;  4P1C H;  3N0Q A;  2XR8 A;  3VCP A;  5KLV E;  4NB9 D;  4HM4 A;  2HMO A;  1VF5 D;  5CXM A;  4QDF B;  3EQQ A;  4QDD A;  1SQX E;  1G8J B;  4NBD D;  4H0L D;  2NWF A;  4OGQ D;  3GL0 A;  2ZYL A;  3GTS A;  3DQY A;  3GL2 A;  3VMI D;  1FQT A;  2NVF A;  2XSH A;  4HM2 A;  4QUQ A;  3C0D A;  3GTE A;  4HM5 A;  2FYN C;  2HMJ A;  5AEU A;  3L73 E;  3H1H E;  4HM7 A;  1RIE A;  3D89 A;  4NBH D;  4EMJ B;  4HM6 A;  1SJG A;  2NUM A;  4NBG D;  1UUW A;  3GOB A;  2CKF A;  4AIV A;  1BCC E;  2Q3W A;  4QUP A;  3GZX A;  3H1I E;  1O7N A;  2DE6 D;  2FYU E;  1SQB E;  4H44 D;  4HM8 A;  2JZA A;  1KYO E;  3H1L E;  3L74 E;  2QJP C;  4H13 D;  3EN1 A;  4HM3 A;  4PV1 D;  1SQV E;  2GBX A;  4HJL A;  1L0L E;  1EG9 A;  3VCA A;  1EZV E;  2E74 D;  2YFJ A;  3FOU A;  2ZT9 D;  5HL4 A;  2BMR A;  2HMN A;  2YVJ B;  5BOK A;  2JO6 A;  2BMQ A;  2E4P A;  2E4Q A;  4HM1 A;  4NBA D;  4AAY B;  1O7H A;  1UUV A;  2HMM A;  1PP9 E;  1ULI A;  2B24 A;  2HML A;  2BMO A;  2D2C D;  2NVG A;  3CXH E;  4QUR A;  3GCE A;  1SQQ E;  1KB9 E;  2YIU C;  2B1X A;  2YFL A;  1NTZ E;  1SQP E;  2IBZ E;  1G8K B;  1VCK A;  2NUK A;  1Q90 C;  1L0N E;  3BCC E;  1P84 E;  3GB4 A;  5AEW A;  1RFS A;  3CX5 E;  4NBF D;  2NVE A;  2QJY C;  1PPJ E;  4D6T E;  1JM1 A;  4U3F E;  1NTM E;  1NYK A;  1O7W A;  3GZY A;  3VMH D;  2BCC E;  4NBC D;  5KLI C;  3TGU E;  3H1K E;  2I7F A;  2E76 D;  1O7M A;  4QDC A;  3VMG D;  4NBE D;  4NB8 D;  1ULJ A;  1O7P A;  2QPZ A;  2DE7 D;  1NTK E;  4NBB D;  1O7G A;  3CWB E;  1WQL A;  1VM9 A; 
#chains in the Genus database with same CATH topology
 3R4Y A;  2PFX A;  4YXW H;  2QVA A;  2B88 A;  2E5Y A;  3MIW A;  2XSO A;  1N7S A;  1HUC A;  4C7N A;  2HPC B;  1SFC C;  2XR8 A;  3HRN A;  1PGJ A;  1FDO A;  1NTM J;  4GOE A;  2JWA A;  4AQR D;  3CCM P;  3RL0 g;  4ZMD A;  1XTC C;  2YO2 A;  1EDK A;  3B5N C;  2A45 H;  5AW3 B;  5H2F H;  4QUP A;  4HJG H;  1LGH B;  1NTK G;  2BAS A;  4H44 B;  1NTK K;  3M9H A;  3G3Z A;  1SQP K;  3EN1 A;  4PV1 D;  3BAT A;  1EZV E;  1L0L K;  2Q7C A;  4JF7 A;  3RK3 E;  1JCD A;  1BCC G;  1GK4 A;  2HML A;  5AW9 B;  3D6Z A;  2XND H;  2FYU D;  4LGD E;  1N86 A;  4U3F E;  1KIL D;  1QEX A;  1HGZ A;  1O7W A;  2FXO A;  4OH8 B;  1LWU A;  3D71 A;  1X8Y A;  1K04 A;  3GHG C;  1FZG A;  3JCU H;  2O01 H;  4IL6 H;  1BGY G;  1AV1 A;  1Q82 Q;  4UB8 H;  4P1B H;  4KJM A;  3PRJ A;  2R44 A;  1OWA A;  1QVG O;  1KC8 Q;  3R2P A;  2GBW A;  1NKZ B;  4N3Y B;  3VCP A;  2OYH C;  4QDF B;  3T97 B;  2XZR A;  3A0H E;  3L70 G;  1LP1 A;  1G1J A;  2ZXE B;  2FYN C;  3P8C D;  2RN0 A;  1RQV A;  3N7N A;  1BGY J;  5CCG D;  1UUW A;  5CCH A;  2A45 I;  1BCC E;  3EFG A;  3GLM A;  3H1L G;  1M8O B;  2QJP C;  1NU1 K;  4H13 D;  4JYC A;  1X79 B;  2N1T A;  4K3A A;  3FX0 A;  5AW8 B;  3VCA A;  1L0L D;  3IN6 A;  3JCU E;  2QIW A;  4AAY B;  4RES B;  3IAO A;  3FXE A;  3W67 A;  1NO4 A;  3S1K A;  2J59 M;  3GCE A;  3MP7 B;  2AEJ A;  3VOP A;  3D6Y A;  2BCC G;  3F5H A;  1SFC D;  1DH3 A;  3O6Q B;  1N7S D;  3T97 A;  3CCQ P;  1H0T A;  2XU6 A;  1VL2 A;  3H1L J;  2I1J A;  4I7Z C;  1O7M A;  3L72 J;  4IFD K;  5GTH E;  1OFC X;  1MV8 A;  2YNY A;  1JTH B;  3TK1 A;  1O7G A;  4YTP C;  1FZE A;  2KI7 B;  1SQV K;  1ZN5 A;  2KP8 A;  1LTI C;  3AZC A;  2OYH B;  1SQQ G;  1GTW A;  3RGU A;  3L74 J;  1KIL C;  4N78 D;  1E79 H;  2BCC J;  1N7S B;  3U1C A;  3LID A;  3LW5 J;  2HR3 A;  1NTZ K;  1JCC A;  2PGD A;  3CC4 P;  1FAV A;  1NHL A;  3H1K G;  4HM5 A;  2HYN A;  3MGN A;  3CLQ A;  2D2C C;  5KJ7 D;  1NAF A;  1EDL A;  1MUU A;  3K5B A;  2ZYD A;  4HM8 A;  2JZA A;  2JO1 A;  3LIE A;  5AW0 B;  5AVV B;  4R4L A;  3CX5 H;  1N2D C;  3H1H J;  2HMN A;  1RQU A;  2BMQ A;  1GL2 A;  5KLI B;  2JWD A;  4BWN A;  5KLV K;  1SQX D;  2Q9I A;  1KB9 D;  1PPJ D;  2M3B A;  2W27 A;  1KQS O;  4N6J A;  1MFT A;  3L74 G;  3PHL A;  2JDI H;  1QLE D;  1NOH A;  3A3Y B;  2E75 B;  2WZ7 A;  4C46 A;  4NBF D;  4D6T J;  1NTM E;  1BDC A;  1AVY A;  3CL3 D;  1U7J A;  2E76 D;  2L91 A;  1USE A;  3I5C A;  1FS0 E;  2YXQ B;  4WVZ A;  3SSU A;  1IJD B;  2ZFC A;  2W6A A;  1NU1 E;  3AEA C;  1SQQ D;  5AW5 B;  1VQP P;  2FY8 A;  3RK2 B;  1D7M A;  2FFD C;  2KLU A;  3Q3D A;  1YIT P;  1QVF O;  1SQV G;  3EQQ A;  2FXM A;  1DD3 A;  3KDP B;  1FE6 A;  2NVF A;  2Z5I A;  5AVQ B;  3VMY A;  3CC7 P;  1SJG A;  4Y99 B;  3H1K J;  1PL5 A;  4IL6 E;  4UB6 H;  2CK3 H;  3AE1 C;  3TGU G;  3GZX A;  2Q3I A;  3AE9 C;  2FFD B;  1NTZ J;  2FYN B;  3VN0 A;  1JY3 N;  1OVR A;  1L4A D;  1M1J C;  4IL6 X;  4RJT A;  1VPC A;  3CPW O;  3GW6 A;  3HUS C;  4OGQ B;  4PD4 H;  3M0D C;  2E4Q A;  4GOF A;  1UUV A;  2ZYG A;  3P32 A;  2QJY B;  1CI6 B;  3H1H D;  2NVG A;  1URQ C;  4EYY Q;  3BAS A;  2ZT9 C;  2KS1 B;  2IBZ E;  5KKZ B;  1VCK A;  2UWJ E;  1VQN P;  3IFM A;  3E1R A;  5CBO A;  1NYK A;  3CWB J;  1JEK A;  3L70 D;  2RMZ A;  3H1K E;  1DEE G;  1JOC A;  4I2L C;  3MHV A;  3AEB C;  1WT6 A;  5H2F E;  4NBB D;  3TF5 A;  3CWB E;  3BRV B;  1S5L H;  5GTH H;  1RHZ B;  2IFM A;  3L72 G;  4DCK A;  1YI2 P;  2YKQ A;  1EXI A;  1SQX G;  1H8A A;  3VP9 A;  3RL0 D;  1NU1 J;  3C1L A;  3E7K A;  5KLV E;  5APW A;  1RY3 A;  3GHG B;  1VF5 D;  1SQX E;  4NBD D;  1KQG B;  4HB1 A;  3KZI E;  2D2C B;  3H6P A;  1FQT A;  1ZR2 A;  4QUQ A;  3GTE A;  2XKM A;  4K35 A;  4QMA A;  2HMJ A;  2AXC A;  2FYU J;  2WSE J;  1DX7 A;  2XDJ A;  1S72 P;  3GOB A;  2OTL P;  5KAF E;  2H7H A;  3SWK A;  2OTK E;  3OA7 A;  2K9Y A;  3RBZ A;  1EC5 A;  4XFJ A;  3AEE C;  2K37 A;  3H1J J;  1KFM A;  1SFC B;  3WUT A;  3A5T A;  1S9K D;  1VF5 B;  4GKG A;  5CCH D;  1JTH A;  1SQQ E;  2K3R A;  1AQT A;  1CI6 A;  5BVZ A;  3H1J G;  2GUV A;  5AVU B;  1P84 E;  1JNM A;  3GB4 A;  2QJK B;  3CX5 E;  3RL0 C;  2QJY C;  4EIJ A;  1G1I A;  3GZY A;  2N1T D;  1YTZ T;  1K9M Q;  2B87 A;  3BRT B;  4QDC A;  3VMG D;  3A2A A;  2QPZ A;  3VP8 A;  3TNU B;  3H1I G;  2Z4E A;  1BE3 E;  3HD7 D;  2KIK A;  1LTA C;  2Y0D A;  3CXH H;  3O6Q A;  3H1J E;  3CCJ P;  2P67 A;  2B9B A;  4R4M A;  2KLV A;  3L73 J;  2N1T B;  1HF9 A;  1S2E A;  1PP9 J;  1N7L A;  2OGU A;  4L74 A;  3KQG A;  4NPD A;  5AW4 B;  4OGQ D;  3GL0 A;  2OAR A;  3MTU E;  2WPV B;  2XSH A;  1RF1 C;  4BRY B;  1QL1 A;  1OW7 A;  5AEU A;  2P58 A;  1NH4 A;  3CXH D;  2FYU E;  1BE3 J;  2YKP A;  4IOI H;  4I6M C;  2POH A;  3EWK A;  3RK3 C;  3TGU J;  3FOU A;  1NTM K;  4HM1 A;  1PP9 E;  1SQP D;  2LXC B;  4PD4 I;  1Q7Y Q;  2D2C D;  2LR2 A;  2Y9Y A;  1NKN A;  4H0L B;  2W90 A;  1T6A A;  2BEZ F;  2WPQ A;  1T2K C;  1KMI Z;  1SQP E;  4ASW A;  3MZW B;  1UIX A;  5CMZ A;  4KT0 J;  5CHX A;  1NU1 G;  1KB9 H;  5AVY B;  5TIS H;  1YTZ I;  1TU3 F;  1KQL A;  3IF4 A;  3TYY A;  1IK7 A;  3CCL P;  2HLO A;  2W8Z A;  1BSH A;  2YIU B;  5APX A;  1W5C E;  2C9N Y;  1UII A;  1ZXG A;  3AE8 C;  4W7Z A;  2YO3 A;  2OYI B;  3SFE C;  5B66 H;  4JBZ A;  2E75 D;  3GF7 A;  3AE4 C;  2RH0 A;  1L0L G;  1VQ6 P;  3GKE A;  3BCC G;  4P1C H;  2H88 C;  3FXD A;  2JR8 A;  2IBZ G;  1S9K E;  1SQX J;  1SQX K;  1EZV G;  5BU8 B;  4I7Z B;  3VMI D;  3B5N B;  4OVN F;  1HJ0 A;  2NPS D;  1FZC B;  3CME P;  4HM6 A;  3V2R A;  1OX3 A;  1L0N D;  2KNC A;  1L4A B;  2Q3W A;  2OQQ A;  1SQB E;  2Z5H A;  2GBX A;  3EFF K;  1KIL A;  2JO6 A;  1ZOY C;  3M06 A;  1KYO D;  1FZA A;  2B24 A;  5CCG C;  4GIF A;  3V4Q A;  1SQQ K;  3JSV C;  4HYT B;  5CCG A;  4WY4 B;  3M91 A;  1FOS F;  1HVV A;  1LTS C;  1BCC J;  2AXT H;  1AA0 A;  1KYO H;  2WT7 B;  4NB8 D;  3V2Q A;  1LT9 B;  3V2P A;  3USS A;  3HTK A;  2PAJ A;  1RF0 C;  1NVO A;  2GUS A;  3L70 E;  4QDF A;  4GDO A;  4H0L C;  3L75 E;  3WU2 E;  2QSI A;  1KFN A;  1M1J A;  2WMM A;  4HM0 A;  3VMX A;  4PD4 E;  2HG5 D;  1VQO P;  5CXM A;  2NWF A;  1FZB A;  1VQ9 P;  3NXS A;  5DJU B;  1ZLL A;  1HJB A;  1RIE A;  4NBH D;  4NPF X;  4EMJ B;  2IFN A;  4NBG D;  3UIA A;  1A02 F;  4ASV A;  3H1I E;  4GOD A;  1H89 A;  1O7N A;  1A02 J;  1JB0 J;  3CWB G;  4BXL A;  3RK3 B;  1GW3 A;  3VMA A;  3SWF A;  1LWU B;  1LTG C;  1OIP A;  2BMR A;  3N4X A;  4NBA D;  1LTJ A;  3AEG C;  3L36 A;  1YJN P;  3CCV P;  1GMJ A;  1HWT C;  1QX8 A;  3ABV C;  1NJI Q;  2KSJ A;  1LT9 C;  1BCC D;  3HUS B;  3PJS K;  1FZF A;  2K9J B;  3L71 G;  1EDI A;  2V7Q H;  1NU1 D;  1IC2 A;  2Y9Z A;  2O1J A;  1Q90 C;  1T3J A;  1PPJ E;  1JM1 A;  1S1C X;  3G4S P;  1IO4 A;  2R32 A;  5CCH C;  1EQ7 A;  2WVR A;  3TGU E;  3HD7 A;  5B66 E;  2I7F A;  1O7P A;  1SQB D;  1Q90 D;  3L75 D;  3H1I D;  1KOR A;  1GU4 A;  2NPS C;  1PGP A;  3P8M C;  4OWF A;  2YFI A;  1SQB G;  2QJK C;  2A06 D;  3WUU A;  4QCK A;  4B86 A;  1NDO A;  2HPC A;  2G3A A;  1VF5 C;  3II6 A;  5CJ4 A;  1OZH A;  1L0N G;  2Y0E A;  4WWI A;  1L4A C;  2N9Y B;  3L75 J;  5B5E E;  3RK2 D;  1NWQ A;  4HM4 A;  2HMO A;  3S9O A;  1P84 I;  4AYC A;  3CI9 A;  3FWL A;  1G8J B;  1PZQ A;  3HE5 A;  2C0X A;  1L0L J;  3GTS A;  3CD6 P;  1NTK J;  3L73 E;  1SQP J;  2KYV A;  5AW6 B;  2E43 A;  5E79 E;  2GA1 A;  3BCC D;  2MKV A;  3F89 A;  1H88 A;  2IPP A;  2HFE D;  3AE2 C;  1Q81 Q;  3H1L E;  1GDT A;  2J58 A;  2NPS B;  3CCR P;  1RF0 A;  1M57 D;  5E79 H;  3B5N D;  4RO0 A;  1ZR4 A;  5BOK A;  1L2P A;  1FDI A;  4EOT A;  4QUR A;  2MJZ A;  2YIU C;  2B1X A;  2HOD A;  2YFL A;  4IFM A;  1RH5 B;  1L0N E;  3H1J D;  2NVE A;  4D6T E;  1OXZ A;  1BSN A;  5AVR B;  5AW7 B;  2R5D A;  1KN7 A;  2R3C A;  4NBE D;  2KUB A;  1DEB A;  2CPB A;  3MUD A;  2YKO A;  5KKZ C;  3PP5 A;  1QGK B;  2P10 A;  5KAF H;  3M0A A;  1RE3 C;  3H32 A;  1SS1 A;  3M9Q A;  3QWO C;  4U3F G;  4M3L A;  2LKM A;  1YQ4 C;  1AQ5 A;  1IFN A;  4YXD C;  1JY3 O;  1NGM B;  1OVU A;  3KZI H;  2WSF J;  5AVT B;  2E74 B;  4IFF A;  1K05 A;  3P7K A;  1OW8 A;  4WY4 C;  2O01 J;  4D6T G;  4PV1 B;  1ZW0 A;  3Q5S A;  2N1T C;  3TNU A;  4H44 D;  1M7L A;  3AE7 C;  4JQ0 D;  4HM3 A;  3C8V A;  2E76 B;  2FKW B;  4UB8 E;  2NPS A;  5TIS E;  1M1J B;  3P8C E;  1NTM G;  1MKM A;  2QG4 A;  1URQ A;  1KZU B;  3B4S A;  3L70 J;  3CCE P;  5APY A;  4D6T D;  1HBW A;  3L35 A;  1SQV D;  2JP3 A;  1LT9 A;  2W6B A;  3RK3 D;  1IFP A;  2IZ0 A;  3AE3 C;  3HE5 B;  4I1L A;  4H13 B;  2IBZ I;  1IFD A;  5L8R J;  4NBC D;  1E5W A;  2J5U A;  2G8Y A;  2P1J A;  2FYU G;  1Y9B A;  5KTB A;  2E74 C;  4NPE A;  1IFJ A;  4U7J A;  2GM4 A;  1ZME C;  1KYO I;  4WB4 A;  1J1E B;  1GZL A;  3AEC C;  1VQ7 P;  2AXT E;  2HMK A;  4RKU J;  3U1A A;  1FZC C;  2XRX A;  3Q5R A;  2Q3E A;  5M1B A;  3G9R A;  4ZKP A;  4JYB A;  1YBK A;  4EI2 A;  1EZV D;  1YIJ P;  5APT A;  1JM0 A;  5GTI H;  1K8A Q;  2JEE A;  2H89 C;  1LWU C;  1PPJ G;  2AEF A;  1T2K D;  1SQB K;  1JMB A;  2HOD B;  3QH9 A;  3HE4 A;  5AW2 B;  1OW6 A;  2M0B A;  1GL2 D;  2K9J A;  3PTZ A;  4WY4 D;  1GL2 C;  1YJW P;  1FJP A;  2ZT9 D;  1O7H A;  2BMO A;  1BDD A;  1W2B O;  3A0B E;  3CX5 I;  2QE7 H;  1LP1 B;  1FJK A;  3BCC E;  2OYH A;  2N9B A;  4U3F J;  4TT3 H;  3A0B H;  2KZI A;  3SWY A;  4DZO A;  3TGU D;  3KPE A;  3BVH A;  2DE7 D;  1M1K Q;  1FOS E;  1DD4 A;  1Y47 A;  2A06 E;  3V2N A;  3ITK A;  2XNX A;  1JY2 N;  1R5S A;  1NAY A;  4OGQ C;  3NMD A;  1R8E A;  1NTZ G;  2P7J A;  3VYI A;  2OYO A;  1N73 C;  3D70 A;  1H0T B;  1LTJ C;  3AEF C;  1S5L X;  2BEQ D;  1HGV A;  2H43 A;  1JO5 A;  3BCC J;  4HKZ H;  3G6E P;  2QJP B;  4Y99 C;  1YHQ P;  2QM8 A;  3GMA A;  3CCU P;  2IX7 C;  2NRG A;  3H1H E;  4HM7 A;  3CC2 P;  1IFM A;  1S5L E;  2IZ1 A;  2K1A A;  3OAK A;  4AUW A;  1LTJ B;  2O01 N;  2DE6 D;  3H1H G;  2IDB A;  5KJ7 A;  4PJ0 H;  4DJG A;  2IBZ D;  3AED C;  1L0N K;  2YFJ A;  5APV A;  5GTI E;  2YVJ B;  1DIP A;  2L5G B;  4MN4 C;  2E4P A;  2KNC B;  3H1L D;  2QA4 P;  1ULI A;  2P2U A;  4PV1 C;  2KB7 P;  1FZC A;  1EXJ A;  3I55 P;  2I1K A;  1S4X A;  5BU5 A;  1AFO A;  5C39 A;  1G8K B;  1IZN B;  2B89 A;  1RF1 A;  2QM7 A;  2A45 G;  2O1K A;  1PP9 D;  3ZDM A;  4PJ0 E;  2BCC E;  2ZXX A;  1G2C B;  5EFW B;  1LT1 A;  5AVS B;  1SQQ J;  4UB6 E;  1T8Z A;  2JKV A;  1XTG B;  1WQL A;  1KQF B;  2DE5 D;  3V5B A;  1X22 A;  1ZRT E;  3OW2 O;  1U7M A;  2E5T A;  1X9V A;  1JMM A;  1KD1 Q;  3L4F A;  3RBX A;  1RE4 C;  1MFZ A;  1P84 H;  1LJ2 A;  2ZJS E;  4NB9 D;  3L73 G;  3Q1M A;  4LC1 A;  3Q2Y A;  3HTK B;  2FYZ A;  1J1D C;  1VQ4 P;  2QEX P;  2Q5U A;  3HD7 C;  3OJA B;  1P84 D;  2KSE A;  3TDK A;  1GK6 A;  3GHG A;  1Y8A A;  4JPZ B;  4DT0 A;  2KZJ A;  2ZAE B;  1N7S C;  3AE6 C;  3U59 A;  5CJ0 A;  4L73 A;  1BE3 G;  3KXD A;  1EG9 A;  3VMZ A;  5HL4 A;  1PGQ A;  1VQ8 P;  1L4A A;  3A0H H;  2V4H A;  2HMM A;  3LW5 H;  3NTN A;  1RF1 B;  1OMI A;  2O3J A;  1FC2 C;  1JY3 P;  2PRR A;  4Y28 J;  1J2J B;  1LTT C;  2PP6 A;  4H13 C;  3FGA D;  4EDF A;  3V6I A;  3H1I J;  2OTJ P;  3H25 A;  3MD0 A;  3IR9 A;  3A7O A;  3PH0 A;  1CSB A;  1ZP0 C;  2Y0C A;  4C7N B;  1IK9 A;  5KAI E;  4O9B A;  2KK7 A;  2V7Q J;  1VDF A;  1SQV J;  1NTZ D;  1X0T A;  3E1I A;  2E76 C;  5AVW B;  5TJH A;  1USD A;  1VQK P;  3C9I A;  3M0D A;  1NYH A;  2B87 B;  3RL0 B;  4Z1M H;  3O8Z A;  1KIL E;  2OYI A;  2FFD A;  4QDD A;  3CX5 D;  1ZV8 A;  1N73 A;  1L0N J;  1KB9 I;  2ZVO B;  5K5G B;  1JUN A;  3DQY A;  2C9L Y;  3S4R A;  2WPS A;  3JC2 2;  2IYP A;  1CZQ A;  2A06 G;  3KYQ A;  1NTM D;  1G2C A;  3CMA P;  3D89 A;  1FU1 A;  3RK2 C;  1AVO A;  1S3J A;  2NUM A;  4YPC A;  1GU5 A;  1GW4 A;  4WBA A;  1SQP G;  2Q1K A;  2ITA A;  1KYO E;  1SQV E;  3L73 D;  3H32 B;  4HH2 A;  5KJ7 C;  4W7Y A;  5KAI H;  2WWW A;  3H1K D;  3L71 D;  4L75 A;  1SVF A;  1SP4 A;  1LTB C;  2C0W A;  1J1D B;  1RE4 A;  2FBW C;  2YMY A;  3CXH E;  2M5A A;  2RKL A;  2WSS H;  1NTZ E;  2M3E A;  3SFD C;  5AEW A;  1RFS A;  2I8D A;  2XV5 A;  2AEM A;  4WY4 A;  3NFQ A;  5KLI C;  4BRY A;  4CPG A;  1ULJ A;  4A7P A;  1VM9 A;  1MZ9 A;  1VQ5 P;  2R3S A;  1KIL B;  2LXB A;  3FWN A;  1CW5 A;  1PP9 G;  2YXR B;  2SPZ A;  2ZYA A;  1EDJ A;  3L72 D;  3L71 E;  5AW1 B;  3KHU A;  1JY2 P;  5AVZ B;  5DJT B;  1PV3 A;  3B8E B;  4H0L D;  1FDM A;  2FYU K;  3L37 A;  1KTM A;  2WSE H;  2ZT9 B;  1LNQ A;  2VRS A;  3B5N A;  2M8R A;  2WIT A;  2WSC J;  2KXP B;  1SQB J;  1VQL P;  1EZV I;  1YYC A;  1Q86 Q;  1J1E C;  1N8R Q;  5APU A;  1Q2N A;  3TSI A;  3W68 A;  3WU2 H;  5APQ A;  2WQY C;  2KS1 A;  4ZNC A;  2YMK A;  4TLF A;  2KOG A;  1L0L E;  2W6J H;  4KHX A;  4U3F D;  1SFC A;  3I56 P;  1R5L A;  1QL2 A;  1OVV A;  1Z56 A;  2DW3 A;  2FXP A;  3HE4 B;  3VTP C;  2OYI C;  3AE5 C;  3L75 G;  1BE3 D;  1N73 B;  3Q5P A;  4C7R A;  3GG2 A;  3WUV A;  1U57 A;  4XE5 B;  4PD4 D;  5CBN A;  2WPR A;  1NTK E;  4XA4 A;  3MUD C;  3HD7 B;  5KLV D;  3PLN A;  1PIX A;  4N78 E;  3L74 D;  3L72 E;  4L76 A;  2BCC D;  1HTL C;  2WSC H;  1W2E A;  3V4W A;  2ZVN B;  4HKV A;  3M9B A;  1BGY E;  2W83 C;  1T3U A;  1YQ3 C;  1KV4 A;  2NZ2 A;  2M5A B;  3HUS A;  3N0Q A;  3G71 P;  1SLQ A;  1HH0 A;  1ZRT D;  2E75 C;  2CPS A;  1WMK A;  1URQ D;  4GT1 A;  2ZYL A;  3GL2 A;  4HM2 A;  3C0D A;  1M90 Q;  2WTY A;  2JJL A;  1M56 D;  5KLV J;  4W80 A;  2CKF A;  4AIV A;  1GL2 B;  3CWB D;  2K88 A;  1NTK D;  1K73 Q;  2R5B A;  3L74 E;  4HJL A;  2WSF H;  1PFI A;  4ZKU A;  5B5E H;  1RE3 A;  5KLV G;  3EQ2 A;  2E74 D;  1PGO A;  1URQ B;  2IYO A;  5APS A;  5AVX B;  1IFI A;  4DOJ A;  1WRG A;  4H44 C;  1KB9 E;  2NUK A;  3CCS P;  3GF3 A;  4LLH A;  2E42 A;  1BGY D;  1AJY A;  1YJ9 P;  3VMH D;  1JY2 O;  3CXH I;  3L71 J;  1FBM A;  1GD2 E;  2H8P D;  1VQM P;  3WMM 0;  2Q6Q A;  2WT7 A;  3B71 A;  2QRX A; 
#chains in the Genus database with same CATH homology
 1BE3 E;  2YFI A;  2A06 E;  3L72 E;  2DE5 D;  2QJK C;  3L70 E;  4P1B H;  4QDF A;  1NU1 E;  5KKZ C;  1ZRT E;  2XSO A;  3AZC A;  4HKV A;  3H1J E;  3L75 E;  1BGY E;  4QCK A;  2E75 D;  2HMK A;  1NDO A;  4HM0 A;  4PD4 E;  3GKE A;  3L71 E;  2GBW A;  2XRX A;  4P1C H;  3N0Q A;  2XR8 A;  3VCP A;  5KLV E;  4NB9 D;  4HM4 A;  2HMO A;  1VF5 D;  5CXM A;  4QDF B;  3EQQ A;  4QDD A;  1SQX E;  1G8J B;  4NBD D;  4H0L D;  2NWF A;  4OGQ D;  3GL0 A;  2ZYL A;  3GTS A;  3DQY A;  3GL2 A;  3VMI D;  1FQT A;  2NVF A;  2XSH A;  4HM2 A;  4QUQ A;  3C0D A;  3GTE A;  4HM5 A;  2FYN C;  2HMJ A;  5AEU A;  3L73 E;  3H1H E;  4HM7 A;  1RIE A;  3D89 A;  4NBH D;  4EMJ B;  4HM6 A;  1SJG A;  2NUM A;  4NBG D;  1UUW A;  3GOB A;  2CKF A;  4AIV A;  1BCC E;  2Q3W A;  4QUP A;  3GZX A;  3H1I E;  1O7N A;  2DE6 D;  2FYU E;  1SQB E;  4H44 D;  4HM8 A;  2JZA A;  1KYO E;  3H1L E;  3L74 E;  2QJP C;  4H13 D;  3EN1 A;  4HM3 A;  4PV1 D;  1SQV E;  2GBX A;  4HJL A;  1L0L E;  1EG9 A;  3VCA A;  1EZV E;  2E74 D;  2YFJ A;  3FOU A;  2ZT9 D;  5HL4 A;  2BMR A;  2HMN A;  2YVJ B;  5BOK A;  2JO6 A;  2BMQ A;  2E4P A;  2E4Q A;  4HM1 A;  4NBA D;  4AAY B;  1O7H A;  1UUV A;  2HMM A;  1PP9 E;  1ULI A;  2B24 A;  2HML A;  2BMO A;  2D2C D;  2NVG A;  3CXH E;  4QUR A;  3GCE A;  1SQQ E;  1KB9 E;  2YIU C;  2B1X A;  2YFL A;  1NTZ E;  1SQP E;  2IBZ E;  1G8K B;  1VCK A;  2NUK A;  1Q90 C;  1L0N E;  3BCC E;  1P84 E;  3GB4 A;  5AEW A;  1RFS A;  3CX5 E;  4NBF D;  2NVE A;  2QJY C;  1PPJ E;  4D6T E;  1JM1 A;  4U3F E;  1NTM E;  1NYK A;  1O7W A;  3GZY A;  3VMH D;  2BCC E;  4NBC D;  5KLI C;  3TGU E;  3H1K E;  2I7F A;  2E76 D;  1O7M A;  4QDC A;  3VMG D;  4NBE D;  4NB8 D;  1ULJ A;  1O7P A;  2QPZ A;  2DE7 D;  1NTK E;  4NBB D;  1O7G A;  3CWB E;  1WQL A;  1VM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...