3H1KE

Chicken cytochrome bc1 complex with zn++ and an iodinated derivative of kresoxim-methyl bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Crystallographic location of two Zn(2+)-binding sites in the avian cytochrome bc(1) complex
pubmed rcsb
molecule tags Oxidoreductase
total genus 30
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1kE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1kE02
2E75D 5CXMA 1BE3E 4NBHD 1VCKA 3DQYA 5BOKA 2HMJA 1SJGA 2ZYLA 2XSOA 2HMMA 1G8KB 2Q3WA 3CWBE 2QPZA 3BCCE 1FQTA 1O7HA 4HJLA 2IBZE 4HM2A 4PD4E 4H13D 1O7WA 1BGYE 4QDCA 3VCPA 2E74D 1EG9A 2NUMA 1NU1E 3L75E 2JZAA 3VMID 2E76D 1P84E 2DE7D 4QDFB 4QURA 2NVGA 2YIUC 3D89A 3L74E 2QJYC 3N0QA 4U3FE 1WQLA 4OGQD 4D6TE 4NBDD 4QCKA 5AEWA 1NTZE 4HM0A 1O7NA 2NWFA 5HL4A 2DE5D 2QJKC 3H1KE 4NBED 4H44D 2NVFA 2E4PA 2B24A 4QUPA 2YFLA 2XR8A 1VM9A 3L72E 4NBFD 4HM6A 3AZCA 2JO6A 4QDDA 4HM3A 2DE6D 2CKFA 2HMNA 1NTKE 3GL2A 1PP9E 3L70E 5AEUA 2FYNC 3GOBA 3VMHD 3GZXA 4NBGD 1L0LE 1VF5D 4NBAD 3L71E 4HKVA 1NTME 1SQPE 3GB4A 2YFJA 1ULJA 4NBBD 1O7MA 4QDFA 3VCAA 2GBWA 1SQBE 1RIEA 2XSHA 4NB8D 1UUWA 5KLVE 4NB9D 4HM7A 1BCCE 2YVJB 1NYKA 2FYUE 2HMKA 3CX5E 3L73E 1G8JB 2BCCE 4HM4A 1JM1A 1L0NE 4P1CH 2BMQA 4P1BH 4AAYB 2GBXA 3GCEA 1ULIA 4NBCD 2B1XA 3FOUA 3GTSA 2HMOA 1SQVE 2E4QA 3H1JE 2A06E 1SQQE 2YFIA 3H1LE 1O7GA 4AIVA 2I7FA 4H0LD 4PV1D 1O7PA 2NUKA 2D2CD 2BMRA 1PPJE 3H1IE 3EQQA 1KYOE 1RFSA 4HM1A 5KKZC 3TGUE 1KB9E 3GZYA 1NDOA 2NVEA 2ZT9D 3EN1A 3H1HE 4QUQA 1Q90C 5KLIC 3GTEA 1EZVE 3CXHE 3GL0A 4HM5A 2BMOA 3C0DA 1SQXE 3VMGD 3GKEA 2XRXA 2HMLA 4HM8A 2QJPC 1UUVA 1ZRTE 4EMJB
chains in the Genus database with same CATH superfamily
1PPJG 1SFCA 1MUUA 1UIIA 1VL2A 3H1IG 4L73A 1L0LJ 1SP4A 1VCKA 3H1LJ 4W80A 1O7HA 3SFEC 1YHQP 2RMZA 5KJ7D 3SFDC 1ZXGA 1BE3G 3L74E 1LTJA 4GT1A 1WQLA 3RL0g 1HGVA 3CWBG 1GL2C 3I55P 2KSJA 4ASVA 2XR8A 1RF0C 1IK7A 5CJ4A 4NBFD 3A0BH 2CKFA 3A0BE 2VRSA 1FZFA 1NAFA 1GW3A 5AEUA 2K1AA 1ZW0A 1U57A 1VF5D 4NBAD 2P67A 5AVQB 4C7NB 3D70A 2KB7P 2M5AA 3VCAA 3WU2H 3WU2E 3NXSA 3Q5PA 5KAIE 3UIAA 1SFCD 3WMM0 1PGPA 2KK7A 3L71G 1NTMG 2FXPA 4PD4D 4AAYB 1WRGA 1EZVD 1GK6A 3CCSP 1U7MA 4AIVA 5H2FH 4GODA 5H2FE 1SQPJ 3TDKA 1JNMA 3L73G 4DOJA 5E79H 2W6JH 5E79E 1JMMA 3H1LG 3VMGD 3RK3B 1X0TA 3L70D 3AE8C 3RK2B 4I2LC 1T8ZA 5CCHC 2HODA 1AQ5A 2YNYA 3GHGC 1SQVJ 2QEXP 3BCCE 2JEEA 2A45I 3BRVB 5AVZB 5AW4B 2JWDA 3OA7A 1S2EA 1LGHB 4ZKUA 2E76D 1JY2N 3ABVC 2QJYC 4U3FE 1NTZK 5AEWA 1S4XA 2NWFA 2P58A 2J5UA 3LW5H 2IBZI 5AVUB 4QDDA 4YTPC 1ZR4A 4OVNF 4MN4C 3GL2A 5AW2B 5KJ7C 1EDKA 1LTTC 2W83C 2FYUD 1L0LE 3WUTA 1JB0J 3MTUE 1HTLC 2Z5HA 1NVOA 1KZUB 3CX5H 1JY3N 3CX5E 4B86A 1SQPG 5AW6B 1VF5C 3AE2C 2WSCJ 1KV4A 2I7FA 2KNCB 3CC4P 1SFCC 2IPPA 3E7KA 5KLIC 3JC22 1SQVG 2IYPA 3GKEA 2Q5UA 1VQ5P 3H25A 2KI7B 4EMJB 2CPBA 3B5NB 2HMJA 1VQ4P 1LTJC 2J58A 4HJLA 4PD4E 1DEEG 1TU3F 4AYCA 3VMID 2JWAA 1OX3A 3NTNA 4QURA 3Q5SA 4XFJA 5AW5B 2GM4A 1JCCA 3CCVP 4RJTA 2K37A 1KN7A 2ZYAA 1EDLA 2QVAA 4K35A 2BEZF 3CCRP 1J1DC 2E76C 2L91A 2NZ2A 3L70E 1N7SA 4PJ0E 2C9LY 2NRGA 4ZMDA 1BGYJ 2AXCA 1IO4A 3BVHA 3MZWB 3A7OA 4NBBD 3V2PA 3GHGB 4D6TJ 2GBWA 1SLQA 1CW5A 1NGMB 3OJAB 1KILA 2HFED 1DX7A 3M0DC 2HPCB 4W7YA 1CI6B 3B8EB 4R4MA 3D6ZA 1S9KD 2QJYB 1YYCA 4OWFA 3AEFC 4H0LD 1PGOA 4YXWH 1J2JB 3EQQA 2YKPA 4WY4A 1QGKB 4JQ0D 1SQBJ 1N73A 4Y99B 2AXTE 1FZCA 2IBZD 3C0DA 1NTKJ 2HMLA 2YIUB 3F89A 1K05A 4AQRD 1FAVA 4IOIH 3TGUG 1N7SD 2MJZA 3PHLA 5APUA 1FJKA 4Z1MH 1IFDA 3IF4A 4H13D 1O7WA 1EG9A 1W2EA 3AE4C 5DJUB 1S1CX 2K3RA 3NFQA 1LWUA 2W90A 4DZOA 2Q7CA 1KILD 1GZLA 1G2CB 2LKMA 2K88A 1AJYA 2YFLA 1R5LA 1BGYG 2Z5IA 3O8ZA 2PP6A 4DJGA 3HTKA 3CMEP 1EC5A 4I6MC 2WT7B 4EDFA 1D7MA 2R5BA 4D6TG 4JYCA 1LTBC 3SWKA 4WY4D 1UIXA 1OWAA 5M1BA 3SWYA 4NB9D 3HE4A 2WWWA 3I56P 1M1JB 1FZGA 3GCEA 2QA4P 3HD7B 2O3JA 1LJ2A 1ZMEC 1SQBG 2E4QA 3LIEA 4JYBA 2BASA 2QM7A 4OH8B 4PV1B 1JY2O 2OYHB 2D2CB 3CX5I 3BATA 1NDOA 1VDFA 3IN6A 3EN1A 1OXZA 4UB8H 3GTEA 1YIJP 4UB8E 2K9JB 3OAKA 2FFDC 1PP9J 1H88A 1SQQK 1T2KD 1KQGB 1RE3A 4H0LC 4NBHD 4EI2A 4GOFA 4L74A 1YI2P 3VTPC 2OARA 4YXDC 1S9KE 5KLVJ 3A3YB 1SQXK 4N3YB 1DH3A 1JM0A 3H1HJ 5AW3B 2H88C 3A2AA 1JY3O 4NPEA 1N7SC 4PD4I 2DE6D 4H13C 1NTKE 3H1IJ 2KSEA 2FYNC 5BVZA 1KILC 2Y9YA 1NU1J 1KTMA 3GB4A 3V2NA 2OYIB 1NH4A 1QVFO 2K9YA 2E42A 1BE3D 1AA0A 4I1LA 2YVJB 3TK1A 5KAFH 1URQB 1ZOYC 2E74C 3VMYA 5KAFE 3CWBJ 4P1CH 1KD1Q 4LC1A 4WY4C 3AE6C 1FZCC 2N1TC 2YMYA 3AE1C 2BCCG 1MFTA 3R2PA 2NVEA 2POHA 4QUQA 2KLUA 1FDOA 3TNUB 3GL0A 1SQQG 4HM8A 1L0NJ 2OTKE 2YKOA 3RL0D 3A0HH 2KS1B 3AEAC 1MKMA 3A0HE 4JPZB 3L71J 4U3FD 1NTMJ 3H1HG 2LR2A 3RK3E 2JJLA 1SQXG 1Z56A 3G3ZA 1CZQA 3AE3C 2JZAA 1FU1A 1X79B 3L73D 3PJSK 1T2KC 2M0BA 1XTCC 4HM0A 3PH0A 2O01H 2DE5D 1L0LD 2E4PA 4QUPA 3CMAP 3L72E 3H1LD 1NU1G 3P8CE 1PP9E 4YPCA 3VMHD 3P8MC 1L0LK 3CX5D 2WT7A 4HKVA 3G71P 2FFDB 3BASA 1HUCA 5GTHH 2G8YA 2FY8A 1AVOA 1RE4A 2IFMA 5GTHE 1H0TB 4QDFA 1VQ6P 2Y9ZA 5KLVE 4HM7A 5AW7B 2KP8A 1EDIA 1HGZA 3SWFA 2N9BA 2BMQA 4P1BH 3FGAD 2XDJA 3PTZA 3TYYA 1VQ9P 1M1JA 1HH0A 3PLNA 1PPJE 3H1IE 1NHLA 1L0NG 3G4SP 1L4AB 2R44A 2WMMA 3HUSA 2QSIA 2ZT9B 1SVFA 2A06G 5AVVB 3VMZA 3HE5A 3CL3D 1DD4A 4HKZH 3CCLP 1NOHA 1FOSE 1N8RQ 1UUVA 1ZRTE 3G6EP 1BE3E 1DIPA 1SQPD 1SJGA 1GTWA 3CWBE 1FDIA 2CK3H 4BRYB 3Q3DA 2E74B 2WQYC 2W6AA 3KYQA 1IZNB 3RL0C 3IAOA 1O7NA 1FDMA 1RQUA 3RBXA 2QJKC 4K3AA 1RF1A 4H44D 1SQVD 2N1TB 2YXRB 5AW9B 3N7NA 4TLFA 1VQLP 1G1JA 2HMNA 1LT9B 1NJIQ 1VQOP 2Z4EA 2NPSA 1YTZT 4KHXA 1IJDB 2JR8A 3F5HA 3B71A 3L71E 1NTME 3BRTB 1ULJA 2KLVA 4IL6X 1NTZJ 1JCDA 1NYKA 3CXHH 4I7ZB 3L73E 1JMBA 1G1IA 2PAJA 3RBZA 1ULIA 3FOUA 2Y0EA 1URQA 2IZ1A 2OTJP 4QMAA 3K5BA 3H1LE 3IFMA 3GW6A 4HYTB 4ASWA 1O7PA 1CSBA 2ZJSE 2OQQA 2FYUK 3U59A 1NKNA 1K04A 1Y9BA 2QIWA 2I8DA 3V6IA 1YTZI 3L37A 1KORA 3I5CA 1N7LA 1LP1A 4M3LA 1BDCA 2E75D 3TNUA 2NPSD 1NO4A 1GL2B 3H1JJ 3O6QB 3MHVA 1ZLLA 4EIJA 1EZVG 1FS0E 1FE6A 1KFMA 1KQSO 1HBWA 3AEEC 1PFIA 4OGQD 4A7PA 1USDA 2Q6QA 3T97A 3AZCA 1S5LX 3ITKA 3M9BA 1RE4C 1BSNA 1MV8A 1RQVA 1NTZG 3TGUJ 2HLOA 3L75J 1SQPE 1VQMP 3TSIA 4H44C 2XV5A 2B89A 5AVSB 2KOGA 3AECC 1KB9H 4ZKPA 3GLMA 3U1AA 1Q90D 1OW8A 4GKGA 1SQVE 2H43A 3M0AA 3PRJA 1S72P 2O1KA 1QL1A 1NAYA 4D6TD 2FYUG 2RKLA 2BMRA 4L75A 5KKZC 2B87B 4C7NA 3GF7A 3H1JG 3CCEP 4EYYQ 2XNDH 3NMDA 1GK4A 2C9NY 4BWNA 5GTIH 3QWOC 5GTIE 5AVYB 2XSOA 1PZQA 4HM2A 1SQBD 2H89C 1JOCA 2FXOA 2PFXA 2ZFCA 4GDOA 2RN0A 3D89A 1VPCA 1NTKD 1PGJA 4O9BA 1OW6A 3HRNA 4QCKA 2E75C 4Y28J 5TISH 1JTHB 5TISE 2NVFA 1VM9A 1H89A 2JO6A 3L75G 2Q1KA 5APTA 2WSCH 3CCQP 2AEFA 5AVTB 1IC2A 1HF9A 3CPWO 3L35A 1OVRA 2B9BA 4OGQC 1VF5B 4HH2A 5APSA 2W6BA 1K73Q 4U7JA 3GG2A 2OTLP 2XSHA 3H32B 1IK9A 3H1KJ 3MIWA 2P2UA 1MFZA 3C9IA 1SFCB 5KTBA 2C0XA 3QH9A 4HM4A 4JF7A 5KLIB 4KJMA 2N9YB 1HWTC 1WT6A 4WB4A 3FXDA 2ZXXA 4HM1A 3TGUE 1LTJB 3TF5A 1P84H 1Q90C 1BCCJ 1RH5B 3G9RA 2IYOA 3RK3D 2XRXA 3RK2D 3M9QA 1USEA 3P7KA 3Q2YA 1GU5A 2HMMA 2W8ZA 2A45G 3KQGA 1BGYE 3LIDA 3L72D 2KNCA 1FOSF 2IZ0A 1J1DB 2M5AB 2E76B 3WUVA 1Q86Q 2V7QJ 1BDDA 3P8CD 1EDJA 1PP9D 4D6TE 2BCCJ 3E1IA 3M06A 1AQTA 3AE7C 2IBZG 1ZN5A 4XA4A 3VP8A 3L36A 3IR9A 3AEDC 1SQQJ 1FBMA 1HVVA 3B5NA 3EQ2A 4ZNCA 5KLVD 3H1HD 3H1KG 1N86A 4RO0A 1Q82Q 1SQXJ 3L74J 1SQBE 4UB6H 3AEGC 1UUWA 2KZJA 4UB6E 5APWA 2H7HA 2XU6A 1IFIA 1OW7A 2HODB 1K9MQ 2FYZA 1PPJD 3H1ID 2M8RA 1FZAA 1QX8A 1NU1D 2QE7H 1IFJA 1BCCG 3D6YA 5L8RJ 3L4FA 1M57D 1KB9I 1ZRTD 2C0WA 3CLQA 1NKZB 2WPSA 1VQNP 4WWIA 1S5LH 3GHGA 2SPZA 3CWBD 1YQ4C 2XZRA 2KZIA 2QRXA 2QJPC 5APQA 2R3CA 1N73C 2PRRA 3B5ND 2HPCA 1PL5A 3EFGA 5EFWB 2AEMA 1YJNP 1CI6A 1IFPA 2KYVA 1YJWP 2Q3WA 3AE5C 2ZXEB 1QLED 3RK3C 2Y0CA 1L0ND 1S3JA 4NBDD 3CC7P 1QEXA 4NBED 1OVUA 3L71D 1NTMD 2A06D 1LWUC 1OVVA 1OIPA 3L74G 2I1KA 3BCCJ 1YJ9P 5AVWB 3CXHD 2YFJA 4N78E 4U3FJ 2M3EA 2V7QH 1ZP0C 1G2CA 1OZHA 2WTYA 3II6A 3LW5J 1Q7YQ 2BCCE 3H32A 1W2BO 4HJGH 1KC8Q 2G3AA 2JDIH 1A02J 1SQQE 1OFCX 2B88A 4H0LB 1KYOH 1KYOE 2KIKA 5CMZA 3H1HE 1SQXE 1IFNA 4IFFA 2GA1A 1N7SB 3HD7A 1JEKA 2KXPB 2UWJE 3MD0A 5APVA 3AEBC 1U7JA 1P84I 1RE3C 4H13B 1VQ7P 1NU1E 4GOEA 2OYHA 2FYNB 1PIXA 1KILB 3B5NC 2JO1A 4L76A 3BCCG 2LXBA 2KUBA 5C39A 5CBOA 1K8AQ 2Q9IA 2K9JA 5K5GB 5KAIH 1Y47A 2H8PD 1VQPP 2IDBA 2WSSH 2R5DA 4U3FG 4KT0J 1KB9D 1W5CE 2R3SA 4NBGD 1IFMA 1GU4A 3V2RA 1SQPK 2IFNA 2QJPB 1T3JA 4WY4B 1L2PA 1N73B 1VQKP 1QL2A 3M0DA 3P32A 1FZCB 4NB8D 3FX0A 1FZBA 1GMJA 1L0LG 3W67A 1L0NE 3CI9A 3MUDA 2LXCB 3HD7D 4GIFA 1SQVK 3L70J 3GTSA 1ZR2A 2A06E 1Q2NA 1O7GA 1Q81Q 3S4RA 4PV1D 3U1CA 2GUVA 1X9VA 2D2CD 1NTZD 1LWUB 5DJTB 2Q3IA 3VYIA 2OYIA 3R4YA 1JO5A 2GUSA 3CXHE 4C7RA 4TT3H 2WITA 3HTKB 3FWLA 1AV1A 3Q1MA 1FJPA 1X8YA 2PGDA 3DQYA 2FXMA 3AE9C 3CCMP 2QPZA 3C1LA 4Y99C 2YO2A 1LTGC 5B66H 2NVGA 2YIUC 2FYUJ 5B66E 1LTIC 1M7LA 3WUUA 3HE4B 3H1JD 5B5EH 5B5EE 1AVYA 1ZV8A 5CBNA 1YITP 1RHZB 2KS1A 1Y8AA 2L5GB 3GZXA 1QVGO 1E5WA 3KHUA 3KXDA 1R8EA 4WVZA 1BSHA 3E1RA 3V4QA 1JUNA 1O7MA 3L70G 2CPSA 3KPEA 1URQD 2P7JA 2M3BA 1GD2E 2FKWB 2AEJA 3TGUD 2GBXA 2B1XA 2FBWC 3L75D 3W68A 2R32A 1P84D 4IFMA 3C8VA 2WSFJ 1JY2P 3OW2O 4PD4H 1DEBA 2FFDA 1KB9E 3GZYA 2WZ7A 2ZYDA 3VN0A 3VP9A 1M1JC 2XNXA 1EZVE 1H0TA 3B4SA 1DD3A 3HD7C 1BGYD 3KZIH 3HUSC 5AW1B 3RL0B 1EXIA 3KZIE 5CXMA 2YXQB 4PV1C 2OYHC 5CCGA 2D2CC 1KYOI 2QJKB 2ZAEB 2WPRA 4PJ0H 3VMAA 2W27A 4DT0A 2IX7C 3FWNA 2I1JA 2DE7D 2O01N 3N0QA 1L4AA 1NYHA 1JY3P 1NTZE 5HL4A 1X22A 3N4XA 4HM6A 2YKQA 2ZYGA 4HM3A 4WBAA 4N6JA 2HR3A 2XKMA 1RF1C 3GOBA 1FZEA 3PP5A 4BRYA 3MUDC 3M9HA 2NPSC 1SQBK 1YBKA 1PGQA 1FC2C 3CCJP 2AXTH 1M90Q 2FYUE 3V4WA 2HMKA 1NTKK 2P10A 2N1TA 5CCGD 1HJBA 4DCKA 1E79H 2RH0A 4NBCD 2HMOA 2OYIC 1LT9A 1KMIZ 3H1JE 3EFFK 1M8OB 1T3UA 3H1KD 1EQ7A 1URQC 1L4AD 2ZT9D 1N2DC 4C46A 3FXEA 5AW0B 1H8AA 2BMOA 1LT1A 2P1JA 3CC2P 2WSEJ 2E5YA 1J1EC 5BOKA 3H6PA 2ZYLA 1G8KB 1FQTA 1KQFB 3CXHI 3VCPA 2E74D 2NUMA 3L75E 1BCCD 3V2QA 1P84E 4QDFB 2WSFH 4RKUJ 1VQ8P 5BU5A 2WPVB 4JBZA 3VOPA 3JCUH 4AUWA 2N1TD 3JCUE 4W7ZA 4H44B 2Y0DA 2B24A 3GMAA 2WPQA 3MGNA 4IL6H 4N78D 1NWQA 4IL6E 1GL2A 3O6QA 1RF0A 2OYOA 4BXLA 2V4HA 1T6AA 2BCCD 2J59M 3HUSB 3MP7B 1GDTA 3KDPB 3SSUA 1RIEA 1NTKG 3HE5B 5TJHA 1SQQD 3VMXA 2O01J 5CHXA 5AVXB 5KKZB 3L72J 3CD6P 1G8JB 1OMIA 1XTGB 1KYOD 1HJ0A 1MZ9A 4NPDA 2YFIA 1R5SA 1SQXD 3L74D 3M91A 2OGUA 4IFDK 5KLVK 1RFSA 2QG4A 2A45H 5APYA 5CCGC 2ITAA 5AVRB 2E43A 1RF1B 2E5TA 2QM8A 1RY3A 3EWKA 3A5TA 2E75B 1GL2D 3ZDMA 1M1KQ 2NPSB 4HB1A 5APXA 4CPGA 1L4AC 2IBZE 2ZT9C 1EZVI 2DW3A 1SS1A 5CCHA 1NU1K 4QDCA 1S5LE 1LTSC 4NPFX 2B87A 4OGQB 1M56D 1KFNA 3H1KE 1PV3A 2YO3A 1BE3J 1A02F 2ZVOB 4LGDE 2MKVA 2JP3A 1KILE 2WSEH 1WMKA 1LTAC 3JSVC 2HG5D 3RK2C 1LNQA 1GW4A 4RESB 3L72G 1KQLA 2WVRA 1J1EB 5KJ7A 1PP9G 1BCCE 1LT9C 2HYNA 1EXJA 1AFOA 2Q3EA 1LP1B 1JTHA 4XE5B 1L0NK 3BCCD 1JM1A 5CJ0A 3CCUP 1NTMK 3D71A 5KLVG 5CCHD 3RGUA 4EOTA 3V5BA 4LLHA 2NUKA 2YMKA 4I7ZC 5BU8B 2ZVNB 2BEQD 5AW8B 3S1KA 2JKVA 3S9OA 4HM5A 1YQ3C 3GF3A 3T97B 3L73J 3Q5RA 2O1JA 4R4LA 3USSA
chains in the Genus database with same CATH topology
2E75D 5CXMA 1BE3E 4NBHD 1VCKA 3DQYA 5BOKA 2HMJA 1SJGA 2ZYLA 2XSOA 2HMMA 1G8KB 2Q3WA 3CWBE 2QPZA 3BCCE 1FQTA 1O7HA 4HJLA 2IBZE 4HM2A 4PD4E 4H13D 1O7WA 1BGYE 4QDCA 3VCPA 2E74D 1EG9A 2NUMA 1NU1E 3L75E 2JZAA 3VMID 2E76D 1P84E 2DE7D 4QDFB 4QURA 2NVGA 2YIUC 3D89A 3L74E 2QJYC 3N0QA 4U3FE 1WQLA 4OGQD 4D6TE 4NBDD 4QCKA 5AEWA 1NTZE 4HM0A 1O7NA 2NWFA 5HL4A 2DE5D 2QJKC 3H1KE 4NBED 4H44D 2NVFA 2E4PA 2B24A 4QUPA 2YFLA 2XR8A 1VM9A 3L72E 4NBFD 4HM6A 3AZCA 2JO6A 4QDDA 4HM3A 2DE6D 2CKFA 2HMNA 1NTKE 3GL2A 1PP9E 3L70E 5AEUA 2FYNC 3GOBA 3VMHD 3GZXA 4NBGD 1L0LE 1VF5D 4NBAD 3L71E 4HKVA 1NTME 1SQPE 3GB4A 2YFJA 1ULJA 4NBBD 1O7MA 4QDFA 3VCAA 2GBWA 1SQBE 1RIEA 2XSHA 4NB8D 1UUWA 5KLVE 4NB9D 4HM7A 1BCCE 2YVJB 1NYKA 2FYUE 2HMKA 3CX5E 3L73E 1G8JB 2BCCE 4HM4A 1JM1A 1L0NE 4P1CH 2BMQA 4P1BH 4AAYB 2GBXA 3GCEA 1ULIA 4NBCD 2B1XA 3FOUA 3GTSA 2HMOA 1SQVE 2E4QA 3H1JE 2A06E 1SQQE 2YFIA 3H1LE 1O7GA 4AIVA 2I7FA 4H0LD 4PV1D 1O7PA 2NUKA 2D2CD 2BMRA 1PPJE 3H1IE 3EQQA 1KYOE 1RFSA 4HM1A 5KKZC 3TGUE 1KB9E 3GZYA 1NDOA 2NVEA 2ZT9D 3EN1A 3H1HE 4QUQA 1Q90C 5KLIC 3GTEA 1EZVE 3CXHE 3GL0A 4HM5A 2BMOA 3C0DA 1SQXE 3VMGD 3GKEA 2XRXA 2HMLA 4HM8A 2QJPC 1UUVA 1ZRTE 4EMJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 D;  5CXM A;  1BE3 E;  4NBH D;  1VCK A;  3DQY A;  5BOK A;  2HMJ A;  1SJG A;  2ZYL A;  2XSO A;  2HMM A;  1G8K B;  2Q3W A;  3CWB E;  2QPZ A;  3BCC E;  1FQT A;  1O7H A;  4HJL A;  2IBZ E;  4HM2 A;  4PD4 E;  4H13 D;  1O7W A;  1BGY E;  4QDC A;  3VCP A;  2E74 D;  1EG9 A;  2NUM A;  1NU1 E;  3L75 E;  2JZA A;  3VMI D;  2E76 D;  1P84 E;  2DE7 D;  4QDF B;  4QUR A;  2NVG A;  2YIU C;  3D89 A;  3L74 E;  2QJY C;  3N0Q A;  4U3F E;  1WQL A;  4OGQ D;  4D6T E;  4NBD D;  4QCK A;  5AEW A;  1NTZ E;  4HM0 A;  1O7N A;  2NWF A;  5HL4 A;  2DE5 D;  2QJK C;  3H1K E;  4NBE D;  4H44 D;  2NVF A;  2E4P A;  2B24 A;  4QUP A;  2YFL A;  2XR8 A;  1VM9 A;  3L72 E;  4NBF D;  4HM6 A;  3AZC A;  2JO6 A;  4QDD A;  4HM3 A;  2DE6 D;  2CKF A;  2HMN A;  1NTK E;  3GL2 A;  1PP9 E;  3L70 E;  5AEU A;  2FYN C;  3GOB A;  3VMH D;  3GZX A;  4NBG D;  1L0L E;  1VF5 D;  4NBA D;  3L71 E;  4HKV A;  1NTM E;  1SQP E;  3GB4 A;  2YFJ A;  1ULJ A;  4NBB D;  1O7M A;  4QDF A;  3VCA A;  2GBW A;  1SQB E;  1RIE A;  2XSH A;  4NB8 D;  1UUW A;  5KLV E;  4NB9 D;  4HM7 A;  1BCC E;  2YVJ B;  1NYK A;  2FYU E;  2HMK A;  3CX5 E;  3L73 E;  1G8J B;  2BCC E;  4HM4 A;  1JM1 A;  1L0N E;  4P1C H;  2BMQ A;  4P1B H;  4AAY B;  2GBX A;  3GCE A;  1ULI A;  4NBC D;  2B1X A;  3FOU A;  3GTS A;  2HMO A;  1SQV E;  2E4Q A;  3H1J E;  2A06 E;  1SQQ E;  2YFI A;  3H1L E;  1O7G A;  4AIV A;  2I7F A;  4H0L D;  4PV1 D;  1O7P A;  2NUK A;  2D2C D;  2BMR A;  1PPJ E;  3H1I E;  3EQQ A;  1KYO E;  1RFS A;  4HM1 A;  5KKZ C;  3TGU E;  1KB9 E;  3GZY A;  1NDO A;  2NVE A;  2ZT9 D;  3EN1 A;  3H1H E;  4QUQ A;  1Q90 C;  5KLI C;  3GTE A;  1EZV E;  3CXH E;  3GL0 A;  4HM5 A;  2BMO A;  3C0D A;  1SQX E;  3VMG D;  3GKE A;  2XRX A;  2HML A;  4HM8 A;  2QJP C;  1UUV A;  1ZRT E;  4EMJ B; 
#chains in the Genus database with same CATH topology
 1PPJ G;  1SFC A;  1MUU A;  1UII A;  1VL2 A;  3H1I G;  4L73 A;  1L0L J;  1SP4 A;  1VCK A;  3H1L J;  4W80 A;  1O7H A;  3SFE C;  1YHQ P;  2RMZ A;  5KJ7 D;  3SFD C;  1ZXG A;  1BE3 G;  3L74 E;  1LTJ A;  4GT1 A;  1WQL A;  3RL0 g;  1HGV A;  3CWB G;  1GL2 C;  3I55 P;  2KSJ A;  4ASV A;  2XR8 A;  1RF0 C;  1IK7 A;  5CJ4 A;  4NBF D;  3A0B H;  2CKF A;  3A0B E;  2VRS A;  1FZF A;  1NAF A;  1GW3 A;  5AEU A;  2K1A A;  1ZW0 A;  1U57 A;  1VF5 D;  4NBA D;  2P67 A;  5AVQ B;  4C7N B;  3D70 A;  2KB7 P;  2M5A A;  3VCA A;  3WU2 H;  3WU2 E;  3NXS A;  3Q5P A;  5KAI E;  3UIA A;  1SFC D;  3WMM 0;  1PGP A;  2KK7 A;  3L71 G;  1NTM G;  2FXP A;  4PD4 D;  4AAY B;  1WRG A;  1EZV D;  1GK6 A;  3CCS P;  1U7M A;  4AIV A;  5H2F H;  4GOD A;  5H2F E;  1SQP J;  3TDK A;  1JNM A;  3L73 G;  4DOJ A;  5E79 H;  2W6J H;  5E79 E;  1JMM A;  3H1L G;  3VMG D;  3RK3 B;  1X0T A;  3L70 D;  3AE8 C;  3RK2 B;  4I2L C;  1T8Z A;  5CCH C;  2HOD A;  1AQ5 A;  2YNY A;  3GHG C;  1SQV J;  2QEX P;  3BCC E;  2JEE A;  2A45 I;  3BRV B;  5AVZ B;  5AW4 B;  2JWD A;  3OA7 A;  1S2E A;  1LGH B;  4ZKU A;  2E76 D;  1JY2 N;  3ABV C;  2QJY C;  4U3F E;  1NTZ K;  5AEW A;  1S4X A;  2NWF A;  2P58 A;  2J5U A;  3LW5 H;  2IBZ I;  5AVU B;  4QDD A;  4YTP C;  1ZR4 A;  4OVN F;  4MN4 C;  3GL2 A;  5AW2 B;  5KJ7 C;  1EDK A;  1LTT C;  2W83 C;  2FYU D;  1L0L E;  3WUT A;  1JB0 J;  3MTU E;  1HTL C;  2Z5H A;  1NVO A;  1KZU B;  3CX5 H;  1JY3 N;  3CX5 E;  4B86 A;  1SQP G;  5AW6 B;  1VF5 C;  3AE2 C;  2WSC J;  1KV4 A;  2I7F A;  2KNC B;  3CC4 P;  1SFC C;  2IPP A;  3E7K A;  5KLI C;  3JC2 2;  1SQV G;  2IYP A;  3GKE A;  2Q5U A;  1VQ5 P;  3H25 A;  2KI7 B;  4EMJ B;  2CPB A;  3B5N B;  2HMJ A;  1VQ4 P;  1LTJ C;  2J58 A;  4HJL A;  4PD4 E;  1DEE G;  1TU3 F;  4AYC A;  3VMI D;  2JWA A;  1OX3 A;  3NTN A;  4QUR A;  3Q5S A;  4XFJ A;  5AW5 B;  2GM4 A;  1JCC A;  3CCV P;  4RJT A;  2K37 A;  1KN7 A;  2ZYA A;  1EDL A;  2QVA A;  4K35 A;  2BEZ F;  3CCR P;  1J1D C;  2E76 C;  2L91 A;  2NZ2 A;  3L70 E;  1N7S A;  4PJ0 E;  2C9L Y;  2NRG A;  4ZMD A;  1BGY J;  2AXC A;  1IO4 A;  3BVH A;  3MZW B;  3A7O A;  4NBB D;  3V2P A;  3GHG B;  4D6T J;  2GBW A;  1SLQ A;  1CW5 A;  1NGM B;  3OJA B;  1KIL A;  2HFE D;  1DX7 A;  3M0D C;  2HPC B;  4W7Y A;  1CI6 B;  3B8E B;  4R4M A;  3D6Z A;  1S9K D;  2QJY B;  1YYC A;  4OWF A;  3AEF C;  4H0L D;  1PGO A;  4YXW H;  1J2J B;  3EQQ A;  2YKP A;  4WY4 A;  1QGK B;  4JQ0 D;  1SQB J;  1N73 A;  4Y99 B;  2AXT E;  1FZC A;  2IBZ D;  3C0D A;  1NTK J;  2HML A;  2YIU B;  3F89 A;  1K05 A;  4AQR D;  1FAV A;  4IOI H;  3TGU G;  1N7S D;  2MJZ A;  3PHL A;  5APU A;  1FJK A;  4Z1M H;  1IFD A;  3IF4 A;  4H13 D;  1O7W A;  1EG9 A;  1W2E A;  3AE4 C;  5DJU B;  1S1C X;  2K3R A;  3NFQ A;  1LWU A;  2W90 A;  4DZO A;  2Q7C A;  1KIL D;  1GZL A;  1G2C B;  2LKM A;  2K88 A;  1AJY A;  2YFL A;  1R5L A;  1BGY G;  2Z5I A;  3O8Z A;  2PP6 A;  4DJG A;  3HTK A;  3CME P;  1EC5 A;  4I6M C;  2WT7 B;  4EDF A;  1D7M A;  2R5B A;  4D6T G;  4JYC A;  1LTB C;  3SWK A;  4WY4 D;  1UIX A;  1OWA A;  5M1B A;  3SWY A;  4NB9 D;  3HE4 A;  2WWW A;  3I56 P;  1M1J B;  1FZG A;  3GCE A;  2QA4 P;  3HD7 B;  2O3J A;  1LJ2 A;  1ZME C;  1SQB G;  2E4Q A;  3LIE A;  4JYB A;  2BAS A;  2QM7 A;  4OH8 B;  4PV1 B;  1JY2 O;  2OYH B;  2D2C B;  3CX5 I;  3BAT A;  1NDO A;  1VDF A;  3IN6 A;  3EN1 A;  1OXZ A;  4UB8 H;  3GTE A;  1YIJ P;  4UB8 E;  2K9J B;  3OAK A;  2FFD C;  1PP9 J;  1H88 A;  1SQQ K;  1T2K D;  1KQG B;  1RE3 A;  4H0L C;  4NBH D;  4EI2 A;  4GOF A;  4L74 A;  1YI2 P;  3VTP C;  2OAR A;  4YXD C;  1S9K E;  5KLV J;  3A3Y B;  1SQX K;  4N3Y B;  1DH3 A;  1JM0 A;  3H1H J;  5AW3 B;  2H88 C;  3A2A A;  1JY3 O;  4NPE A;  1N7S C;  4PD4 I;  2DE6 D;  4H13 C;  1NTK E;  3H1I J;  2KSE A;  2FYN C;  5BVZ A;  1KIL C;  2Y9Y A;  1NU1 J;  1KTM A;  3GB4 A;  3V2N A;  2OYI B;  1NH4 A;  1QVF O;  2K9Y A;  2E42 A;  1BE3 D;  1AA0 A;  4I1L A;  2YVJ B;  3TK1 A;  5KAF H;  1URQ B;  1ZOY C;  2E74 C;  3VMY A;  5KAF E;  3CWB J;  4P1C H;  1KD1 Q;  4LC1 A;  4WY4 C;  3AE6 C;  1FZC C;  2N1T C;  2YMY A;  3AE1 C;  2BCC G;  1MFT A;  3R2P A;  2NVE A;  2POH A;  4QUQ A;  2KLU A;  1FDO A;  3TNU B;  3GL0 A;  1SQQ G;  4HM8 A;  1L0N J;  2OTK E;  2YKO A;  3RL0 D;  3A0H H;  2KS1 B;  3AEA C;  1MKM A;  3A0H E;  4JPZ B;  3L71 J;  4U3F D;  1NTM J;  3H1H G;  2LR2 A;  3RK3 E;  2JJL A;  1SQX G;  1Z56 A;  3G3Z A;  1CZQ A;  3AE3 C;  2JZA A;  1FU1 A;  1X79 B;  3L73 D;  3PJS K;  1T2K C;  2M0B A;  1XTC C;  4HM0 A;  3PH0 A;  2O01 H;  2DE5 D;  1L0L D;  2E4P A;  4QUP A;  3CMA P;  3L72 E;  3H1L D;  1NU1 G;  3P8C E;  1PP9 E;  4YPC A;  3VMH D;  3P8M C;  1L0L K;  3CX5 D;  2WT7 A;  4HKV A;  3G71 P;  2FFD B;  3BAS A;  1HUC A;  5GTH H;  2G8Y A;  2FY8 A;  1AVO A;  1RE4 A;  2IFM A;  5GTH E;  1H0T B;  4QDF A;  1VQ6 P;  2Y9Z A;  5KLV E;  4HM7 A;  5AW7 B;  2KP8 A;  1EDI A;  1HGZ A;  3SWF A;  2N9B A;  2BMQ A;  4P1B H;  3FGA D;  2XDJ A;  3PTZ A;  3TYY A;  1VQ9 P;  1M1J A;  1HH0 A;  3PLN A;  1PPJ E;  3H1I E;  1NHL A;  1L0N G;  3G4S P;  1L4A B;  2R44 A;  2WMM A;  3HUS A;  2QSI A;  2ZT9 B;  1SVF A;  2A06 G;  5AVV B;  3VMZ A;  3HE5 A;  3CL3 D;  1DD4 A;  4HKZ H;  3CCL P;  1NOH A;  1FOS E;  1N8R Q;  1UUV A;  1ZRT E;  3G6E P;  1BE3 E;  1DIP A;  1SQP D;  1SJG A;  1GTW A;  3CWB E;  1FDI A;  2CK3 H;  4BRY B;  3Q3D A;  2E74 B;  2WQY C;  2W6A A;  3KYQ A;  1IZN B;  3RL0 C;  3IAO A;  1O7N A;  1FDM A;  1RQU A;  3RBX A;  2QJK C;  4K3A A;  1RF1 A;  4H44 D;  1SQV D;  2N1T B;  2YXR B;  5AW9 B;  3N7N A;  4TLF A;  1VQL P;  1G1J A;  2HMN A;  1LT9 B;  1NJI Q;  1VQO P;  2Z4E A;  2NPS A;  1YTZ T;  4KHX A;  1IJD B;  2JR8 A;  3F5H A;  3B71 A;  3L71 E;  1NTM E;  3BRT B;  1ULJ A;  2KLV A;  4IL6 X;  1NTZ J;  1JCD A;  1NYK A;  3CXH H;  4I7Z B;  3L73 E;  1JMB A;  1G1I A;  2PAJ A;  3RBZ A;  1ULI A;  3FOU A;  2Y0E A;  1URQ A;  2IZ1 A;  2OTJ P;  4QMA A;  3K5B A;  3H1L E;  3IFM A;  3GW6 A;  4HYT B;  4ASW A;  1O7P A;  1CSB A;  2ZJS E;  2OQQ A;  2FYU K;  3U59 A;  1NKN A;  1K04 A;  1Y9B A;  2QIW A;  2I8D A;  3V6I A;  1YTZ I;  3L37 A;  1KOR A;  3I5C A;  1N7L A;  1LP1 A;  4M3L A;  1BDC A;  2E75 D;  3TNU A;  2NPS D;  1NO4 A;  1GL2 B;  3H1J J;  3O6Q B;  3MHV A;  1ZLL A;  4EIJ A;  1EZV G;  1FS0 E;  1FE6 A;  1KFM A;  1KQS O;  1HBW A;  3AEE C;  1PFI A;  4OGQ D;  4A7P A;  1USD A;  2Q6Q A;  3T97 A;  3AZC A;  1S5L X;  3ITK A;  3M9B A;  1RE4 C;  1BSN A;  1MV8 A;  1RQV A;  1NTZ G;  3TGU J;  2HLO A;  3L75 J;  1SQP E;  1VQM P;  3TSI A;  4H44 C;  2XV5 A;  2B89 A;  5AVS B;  2KOG A;  3AEC C;  1KB9 H;  4ZKP A;  3GLM A;  3U1A A;  1Q90 D;  1OW8 A;  4GKG A;  1SQV E;  2H43 A;  3M0A A;  3PRJ A;  1S72 P;  2O1K A;  1QL1 A;  1NAY A;  4D6T D;  2FYU G;  2RKL A;  2BMR A;  4L75 A;  5KKZ C;  2B87 B;  4C7N A;  3GF7 A;  3H1J G;  3CCE P;  4EYY Q;  2XND H;  3NMD A;  1GK4 A;  2C9N Y;  4BWN A;  5GTI H;  3QWO C;  5GTI E;  5AVY B;  2XSO A;  1PZQ A;  4HM2 A;  1SQB D;  2H89 C;  1JOC A;  2FXO A;  2PFX A;  2ZFC A;  4GDO A;  2RN0 A;  3D89 A;  1VPC A;  1NTK D;  1PGJ A;  4O9B A;  1OW6 A;  3HRN A;  4QCK A;  2E75 C;  4Y28 J;  5TIS H;  1JTH B;  5TIS E;  2NVF A;  1VM9 A;  1H89 A;  2JO6 A;  3L75 G;  2Q1K A;  5APT A;  2WSC H;  3CCQ P;  2AEF A;  5AVT B;  1IC2 A;  1HF9 A;  3CPW O;  3L35 A;  1OVR A;  2B9B A;  4OGQ C;  1VF5 B;  4HH2 A;  5APS A;  2W6B A;  1K73 Q;  4U7J A;  3GG2 A;  2OTL P;  2XSH A;  3H32 B;  1IK9 A;  3H1K J;  3MIW A;  2P2U A;  1MFZ A;  3C9I A;  1SFC B;  5KTB A;  2C0X A;  3QH9 A;  4HM4 A;  4JF7 A;  5KLI B;  4KJM A;  2N9Y B;  1HWT C;  1WT6 A;  4WB4 A;  3FXD A;  2ZXX A;  4HM1 A;  3TGU E;  1LTJ B;  3TF5 A;  1P84 H;  1Q90 C;  1BCC J;  1RH5 B;  3G9R A;  2IYO A;  3RK3 D;  2XRX A;  3RK2 D;  3M9Q A;  1USE A;  3P7K A;  3Q2Y A;  1GU5 A;  2HMM A;  2W8Z A;  2A45 G;  3KQG A;  1BGY E;  3LID A;  3L72 D;  2KNC A;  1FOS F;  2IZ0 A;  1J1D B;  2M5A B;  2E76 B;  3WUV A;  1Q86 Q;  2V7Q J;  1BDD A;  3P8C D;  1EDJ A;  1PP9 D;  4D6T E;  2BCC J;  3E1I A;  3M06 A;  1AQT A;  3AE7 C;  2IBZ G;  1ZN5 A;  4XA4 A;  3VP8 A;  3L36 A;  3IR9 A;  3AED C;  1SQQ J;  1FBM A;  1HVV A;  3B5N A;  3EQ2 A;  4ZNC A;  5KLV D;  3H1H D;  3H1K G;  1N86 A;  4RO0 A;  1Q82 Q;  1SQX J;  3L74 J;  1SQB E;  4UB6 H;  3AEG C;  1UUW A;  2KZJ A;  4UB6 E;  5APW A;  2H7H A;  2XU6 A;  1IFI A;  1OW7 A;  2HOD B;  1K9M Q;  2FYZ A;  1PPJ D;  3H1I D;  2M8R A;  1FZA A;  1QX8 A;  1NU1 D;  2QE7 H;  1IFJ A;  1BCC G;  3D6Y A;  5L8R J;  3L4F A;  1M57 D;  1KB9 I;  1ZRT D;  2C0W A;  3CLQ A;  1NKZ B;  2WPS A;  1VQN P;  4WWI A;  1S5L H;  3GHG A;  2SPZ A;  3CWB D;  1YQ4 C;  2XZR A;  2KZI A;  2QRX A;  2QJP C;  5APQ A;  2R3C A;  1N73 C;  2PRR A;  3B5N D;  2HPC A;  1PL5 A;  3EFG A;  5EFW B;  2AEM A;  1YJN P;  1CI6 A;  1IFP A;  2KYV A;  1YJW P;  2Q3W A;  3AE5 C;  2ZXE B;  1QLE D;  3RK3 C;  2Y0C A;  1L0N D;  1S3J A;  4NBD D;  3CC7 P;  1QEX A;  4NBE D;  1OVU A;  3L71 D;  1NTM D;  2A06 D;  1LWU C;  1OVV A;  1OIP A;  3L74 G;  2I1K A;  3BCC J;  1YJ9 P;  5AVW B;  3CXH D;  2YFJ A;  4N78 E;  4U3F J;  2M3E A;  2V7Q H;  1ZP0 C;  1G2C A;  1OZH A;  2WTY A;  3II6 A;  3LW5 J;  1Q7Y Q;  2BCC E;  3H32 A;  1W2B O;  4HJG H;  1KC8 Q;  2G3A A;  2JDI H;  1A02 J;  1SQQ E;  1OFC X;  2B88 A;  4H0L B;  1KYO H;  1KYO E;  2KIK A;  5CMZ A;  3H1H E;  1SQX E;  1IFN A;  4IFF A;  2GA1 A;  1N7S B;  3HD7 A;  1JEK A;  2KXP B;  2UWJ E;  3MD0 A;  5APV A;  3AEB C;  1U7J A;  1P84 I;  1RE3 C;  4H13 B;  1VQ7 P;  1NU1 E;  4GOE A;  2OYH A;  2FYN B;  1PIX A;  1KIL B;  3B5N C;  2JO1 A;  4L76 A;  3BCC G;  2LXB A;  2KUB A;  5C39 A;  5CBO A;  1K8A Q;  2Q9I A;  2K9J A;  5K5G B;  5KAI H;  1Y47 A;  2H8P D;  1VQP P;  2IDB A;  2WSS H;  2R5D A;  4U3F G;  4KT0 J;  1KB9 D;  1W5C E;  2R3S A;  4NBG D;  1IFM A;  1GU4 A;  3V2R A;  1SQP K;  2IFN A;  2QJP B;  1T3J A;  4WY4 B;  1L2P A;  1N73 B;  1VQK P;  1QL2 A;  3M0D A;  3P32 A;  1FZC B;  4NB8 D;  3FX0 A;  1FZB A;  1GMJ A;  1L0L G;  3W67 A;  1L0N E;  3CI9 A;  3MUD A;  2LXC B;  3HD7 D;  4GIF A;  1SQV K;  3L70 J;  3GTS A;  1ZR2 A;  2A06 E;  1Q2N A;  1O7G A;  1Q81 Q;  3S4R A;  4PV1 D;  3U1C A;  2GUV A;  1X9V A;  2D2C D;  1NTZ D;  1LWU B;  5DJT B;  2Q3I A;  3VYI A;  2OYI A;  3R4Y A;  1JO5 A;  2GUS A;  3CXH E;  4C7R A;  4TT3 H;  2WIT A;  3HTK B;  3FWL A;  1AV1 A;  3Q1M A;  1FJP A;  1X8Y A;  2PGD A;  3DQY A;  2FXM A;  3AE9 C;  3CCM P;  2QPZ A;  3C1L A;  4Y99 C;  2YO2 A;  1LTG C;  5B66 H;  2NVG A;  2YIU C;  2FYU J;  5B66 E;  1LTI C;  1M7L A;  3WUU A;  3HE4 B;  3H1J D;  5B5E H;  5B5E E;  1AVY A;  1ZV8 A;  5CBN A;  1YIT P;  1RHZ B;  2KS1 A;  1Y8A A;  2L5G B;  3GZX A;  1QVG O;  1E5W A;  3KHU A;  3KXD A;  1R8E A;  4WVZ A;  1BSH A;  3E1R A;  3V4Q A;  1JUN A;  1O7M A;  3L70 G;  2CPS A;  3KPE A;  1URQ D;  2P7J A;  2M3B A;  1GD2 E;  2FKW B;  2AEJ A;  3TGU D;  2GBX A;  2B1X A;  2FBW C;  3L75 D;  3W68 A;  2R32 A;  1P84 D;  4IFM A;  3C8V A;  2WSF J;  1JY2 P;  3OW2 O;  4PD4 H;  1DEB A;  2FFD A;  1KB9 E;  3GZY A;  2WZ7 A;  2ZYD A;  3VN0 A;  3VP9 A;  1M1J C;  2XNX A;  1EZV E;  1H0T A;  3B4S A;  1DD3 A;  3HD7 C;  1BGY D;  3KZI H;  3HUS C;  5AW1 B;  3RL0 B;  1EXI A;  3KZI E;  5CXM A;  2YXQ B;  4PV1 C;  2OYH C;  5CCG A;  2D2C C;  1KYO I;  2QJK B;  2ZAE B;  2WPR A;  4PJ0 H;  3VMA A;  2W27 A;  4DT0 A;  2IX7 C;  3FWN A;  2I1J A;  2DE7 D;  2O01 N;  3N0Q A;  1L4A A;  1NYH A;  1JY3 P;  1NTZ E;  5HL4 A;  1X22 A;  3N4X A;  4HM6 A;  2YKQ A;  2ZYG A;  4HM3 A;  4WBA A;  4N6J A;  2HR3 A;  2XKM A;  1RF1 C;  3GOB A;  1FZE A;  3PP5 A;  4BRY A;  3MUD C;  3M9H A;  2NPS C;  1SQB K;  1YBK A;  1PGQ A;  1FC2 C;  3CCJ P;  2AXT H;  1M90 Q;  2FYU E;  3V4W A;  2HMK A;  1NTK K;  2P10 A;  2N1T A;  5CCG D;  1HJB A;  4DCK A;  1E79 H;  2RH0 A;  4NBC D;  2HMO A;  2OYI C;  1LT9 A;  1KMI Z;  3H1J E;  3EFF K;  1M8O B;  1T3U A;  3H1K D;  1EQ7 A;  1URQ C;  1L4A D;  2ZT9 D;  1N2D C;  4C46 A;  3FXE A;  5AW0 B;  1H8A A;  2BMO A;  1LT1 A;  2P1J A;  3CC2 P;  2WSE J;  2E5Y A;  1J1E C;  5BOK A;  3H6P A;  2ZYL A;  1G8K B;  1FQT A;  1KQF B;  3CXH I;  3VCP A;  2E74 D;  2NUM A;  3L75 E;  1BCC D;  3V2Q A;  1P84 E;  4QDF B;  2WSF H;  4RKU J;  1VQ8 P;  5BU5 A;  2WPV B;  4JBZ A;  3VOP A;  3JCU H;  4AUW A;  2N1T D;  3JCU E;  4W7Z A;  4H44 B;  2Y0D A;  2B24 A;  3GMA A;  2WPQ A;  3MGN A;  4IL6 H;  4N78 D;  1NWQ A;  4IL6 E;  1GL2 A;  3O6Q A;  1RF0 A;  2OYO A;  4BXL A;  2V4H A;  1T6A A;  2BCC D;  2J59 M;  3HUS B;  3MP7 B;  1GDT A;  3KDP B;  3SSU A;  1RIE A;  1NTK G;  3HE5 B;  5TJH A;  1SQQ D;  3VMX A;  2O01 J;  5CHX A;  5AVX B;  5KKZ B;  3L72 J;  3CD6 P;  1G8J B;  1OMI A;  1XTG B;  1KYO D;  1HJ0 A;  1MZ9 A;  4NPD A;  2YFI A;  1R5S A;  1SQX D;  3L74 D;  3M91 A;  2OGU A;  4IFD K;  5KLV K;  1RFS A;  2QG4 A;  2A45 H;  5APY A;  5CCG C;  2ITA A;  5AVR B;  2E43 A;  1RF1 B;  2E5T A;  2QM8 A;  1RY3 A;  3EWK A;  3A5T A;  2E75 B;  1GL2 D;  3ZDM A;  1M1K Q;  2NPS B;  4HB1 A;  5APX A;  4CPG A;  1L4A C;  2IBZ E;  2ZT9 C;  1EZV I;  2DW3 A;  1SS1 A;  5CCH A;  1NU1 K;  4QDC A;  1S5L E;  1LTS C;  4NPF X;  2B87 A;  4OGQ B;  1M56 D;  1KFN A;  3H1K E;  1PV3 A;  2YO3 A;  1BE3 J;  1A02 F;  2ZVO B;  4LGD E;  2MKV A;  2JP3 A;  1KIL E;  2WSE H;  1WMK A;  1LTA C;  3JSV C;  2HG5 D;  3RK2 C;  1LNQ A;  1GW4 A;  4RES B;  3L72 G;  1KQL A;  2WVR A;  1J1E B;  5KJ7 A;  1PP9 G;  1BCC E;  1LT9 C;  2HYN A;  1EXJ A;  1AFO A;  2Q3E A;  1LP1 B;  1JTH A;  4XE5 B;  1L0N K;  3BCC D;  1JM1 A;  5CJ0 A;  3CCU P;  1NTM K;  3D71 A;  5KLV G;  5CCH D;  3RGU A;  4EOT A;  3V5B A;  4LLH A;  2NUK A;  2YMK A;  4I7Z C;  5BU8 B;  2ZVN B;  2BEQ D;  5AW8 B;  3S1K A;  2JKV A;  3S9O A;  4HM5 A;  1YQ3 C;  3GF3 A;  3T97 B;  3L73 J;  3Q5R A;  2O1J A;  4R4L A;  3USS A; 
#chains in the Genus database with same CATH homology
 2E75 D;  5CXM A;  1BE3 E;  4NBH D;  1VCK A;  3DQY A;  5BOK A;  2HMJ A;  1SJG A;  2ZYL A;  2XSO A;  2HMM A;  1G8K B;  2Q3W A;  3CWB E;  2QPZ A;  3BCC E;  1FQT A;  1O7H A;  4HJL A;  2IBZ E;  4HM2 A;  4PD4 E;  4H13 D;  1O7W A;  1BGY E;  4QDC A;  3VCP A;  2E74 D;  1EG9 A;  2NUM A;  1NU1 E;  3L75 E;  2JZA A;  3VMI D;  2E76 D;  1P84 E;  2DE7 D;  4QDF B;  4QUR A;  2NVG A;  2YIU C;  3D89 A;  3L74 E;  2QJY C;  3N0Q A;  4U3F E;  1WQL A;  4OGQ D;  4D6T E;  4NBD D;  4QCK A;  5AEW A;  1NTZ E;  4HM0 A;  1O7N A;  2NWF A;  5HL4 A;  2DE5 D;  2QJK C;  3H1K E;  4NBE D;  4H44 D;  2NVF A;  2E4P A;  2B24 A;  4QUP A;  2YFL A;  2XR8 A;  1VM9 A;  3L72 E;  4NBF D;  4HM6 A;  3AZC A;  2JO6 A;  4QDD A;  4HM3 A;  2DE6 D;  2CKF A;  2HMN A;  1NTK E;  3GL2 A;  1PP9 E;  3L70 E;  5AEU A;  2FYN C;  3GOB A;  3VMH D;  3GZX A;  4NBG D;  1L0L E;  1VF5 D;  4NBA D;  3L71 E;  4HKV A;  1NTM E;  1SQP E;  3GB4 A;  2YFJ A;  1ULJ A;  4NBB D;  1O7M A;  4QDF A;  3VCA A;  2GBW A;  1SQB E;  1RIE A;  2XSH A;  4NB8 D;  1UUW A;  5KLV E;  4NB9 D;  4HM7 A;  1BCC E;  2YVJ B;  1NYK A;  2FYU E;  2HMK A;  3CX5 E;  3L73 E;  1G8J B;  2BCC E;  4HM4 A;  1JM1 A;  1L0N E;  4P1C H;  2BMQ A;  4P1B H;  4AAY B;  2GBX A;  3GCE A;  1ULI A;  4NBC D;  2B1X A;  3FOU A;  3GTS A;  2HMO A;  1SQV E;  2E4Q A;  3H1J E;  2A06 E;  1SQQ E;  2YFI A;  3H1L E;  1O7G A;  4AIV A;  2I7F A;  4H0L D;  4PV1 D;  1O7P A;  2NUK A;  2D2C D;  2BMR A;  1PPJ E;  3H1I E;  3EQQ A;  1KYO E;  1RFS A;  4HM1 A;  5KKZ C;  3TGU E;  1KB9 E;  3GZY A;  1NDO A;  2NVE A;  2ZT9 D;  3EN1 A;  3H1H E;  4QUQ A;  1Q90 C;  5KLI C;  3GTE A;  1EZV E;  3CXH E;  3GL0 A;  4HM5 A;  2BMO A;  3C0D A;  1SQX E;  3VMG D;  3GKE A;  2XRX A;  2HML A;  4HM8 A;  2QJP C;  1UUV A;  1ZRT E;  4EMJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...