1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
2Q3WA 4QUPA 4EMJB 3H1JE 2BMRA 4HM2A 1O7MA 2B1XA 4KT0J 1NYKA 1EG9A 2NVFA 2NVGA 3EN1A 2YFJA 4NB9D 1O7NA 4QUQA 4Y28J 2E4PA 2FYUE 3H1IE 4H44B 4PV1D 1O7GA 1ULIA 2YVJB 2XR8A 4P1CH 4QDDA 1Q90C 1S5LX 4PD4E 1VCKA 1P84E 1L0NE 1NU1E 2BCCE 2WSFJ 4NBFD 2HMKA 4HM5A 3GB4A 4P1BH 3DQYA 1G8KB 2HMJA 2D2CB 1VM9A 3BCCE 2NVEA 2E74D 4H13B 5KLIC 5AEUA 3GZXA 5BOKA 4NBGD 3C8VA 2ZT9D 2YFLA 3EQQA 2E76B 3VMID 2DE5D 2I7FA 1SQBE 4OGQD 2JZAA 1RIEA 1ULJA 2E75D 4HM8A 2QIWA 4NBDD 2GBWA 4HM4A 4H0LD 5HL4A 4QDCA 4OGQB 1NTZE 3FOUA 4AIVA 4NBHD 1NTKE 1O7PA 4QDFA 4NBBD 2DE6D 2WSCJ 4PV1B 1SQPE 3L71E 2HMOA 4AAYB 2YFIA 4U3FE 3TGUE 5KLVE 1NTME 1EZVE 2JO6A 3LW5J 1JM1A 2HMLA 4HM0A 2E4QA 3VCAA 1JB0J 3L74E 4HJLA 3C0DA 2K9YA 4IL6X 2XRXA 3N0QA 2E74B 3H1LE 1O7WA 1KB9E 1RFSA 1VF5D 2WPVB 5KKZC 2B24A 4NBCD 3D89A 1SJGA 2ZT9B 3L70E 2BMQA 2BMOA 4NBED 1BE3E 2NUKA 1Q90D 3L72E 2E75B 1SQVE 3L75E 3VMGD 4HM6A 5CXMA 2ZYLA 4H0LB 2HMNA 5L8RJ 4I7ZB 1SQQE 2QPZA 2DE7D 4QCKA 1BCCE 2QJPC 2WSEJ 2CKFA 2QJKC 1O7HA 4HM1A 3GTSA 4HM3A 4HM7A 3AZCA 4RKUJ 3CXHE 4H44D 2GBXA 1SQXE 1UUVA 3H1HE 2A06E 1KYOE 2XSHA 3H1KE 4QURA 1G8JB 2NUMA 1UUWA 1ZRTE 3VCPA 3CX5E 2IBZE 1PPJE 2HMMA 1FQTA 2O01J 1L0LE 3GOBA 2FYNC 3CWBE 4HKVA 1VF5B 5AEWA 3L73E 3GCEA 2YIUC 2D2CD 3GL2A 3GKEA 4NB8D 4QDFB 2NWFA 4H13D 1PP9E 1NDOA 2XSOA 3GL0A 4NBAD 2QSIA 3GTEA 1WQLA 2E76D 2QJYC 3VMHD 3GZYA
chains in the Genus database with same CATH superfamily
3L73J 1BE3J 3L72J 5APUA 2NVGA 4I1LA 3BATA 5AVVB 3AEEC 3CMAP 1ULIA 1BDCA 1URQA 3VMXA 2YO2A 5B66E 1WRGA 4XFJA 4XA4A 1Y47A 2Y9ZA 3EFFK 3RL0D 2O1JA 3M9BA 2OYIB 1EQ7A 5TISH 1N7LA 2GM4A 1UIXA 2V7QH 2KNCA 1Q81Q 4HJGH 2OYHA 2FBWC 2WPSA 5GTHE 1NH4A 1SQQG 4QDFA 3HE4B 3AE2C 5BVZA 1N73B 4Y99C 3CCMP 1NTME 1J1DC 1T3UA 3B5NB 4NPEA 1A02J 3LW5J 1GU4A 3PP5A 3WUUA 3N0QA 3PH0A 1X22A 1QGKB 2HPCA 3IF4A 3HE5B 1SQQD 3A3YB 3TGUD 4D6TD 1Q90D 2M5AB 1GZLA 1QL1A 2WWWA 2IZ1A 2FXMA 2BASA 2IZ0A 4GOEA 4HM3A 3GHGB 4A7PA 1EDKA 1LP1A 2W90A 3RBZA 2WVRA 1AQTA 3D6ZA 2IBZG 3CL3D 1CI6B 1ZRTE 4OVNF 2V7QJ 1T6AA 3L73E 3GCEA 3H1KJ 1X9VA 1ZP0C 3A0HE 2IBZD 3R4YA 1YJNP 3T97A 5CCGC 4QUQA 4H44B 1LWUB 1DH3A 2XV5A 4QDDA 1JY2N 3B5ND 1KMIZ 4JBZA 5KAIE 1JMBA 1QX8A 4UB8E 1SVFA 2D2CB 1Y8AA 5BU8B 1PL5A 3KHUA 2I7FA 3IAOA 1BSHA 4QDCA 4OGQB 5AVQB 3L35A 4KJMA 1BCCG 2HMOA 1MFTA 4U3FE 1JUNA 2JO6A 3MUDA 4DOJA 3H32B 2BEZF 5CJ4A 1G2CA 1FOSE 1URQC 2LXCB 2E42A 1RF1A 2BMOA 2C0XA 3WMM0 2WSFH 3CMEP 1NTMK 2YMYA 4W7ZA 2RH0A 4HM6A 3V2PA 2FXOA 2HR3A 5APYA 5TISE 2YIUB 2K88A 5AW2B 3RL0g 4H44D 1W2BO 1KTMA 2OYHC 1FS0E 2IYOA 3H1KE 2JKVA 3KZIH 1BGYJ 3CX5E 1OVVA 3VCPA 2OYOA 3CC4P 2BCCG 4WBAA 2D2CD 4W7YA 3A0BH 5CBNA 1KYOD 1FDOA 3G3ZA 3I55P 4C7NB 2K9JB 3N7NA 1IO4A 3PRJA 3V2RA 2GA1A 2Q3IA 1AVYA 4AUWA 1BDDA 1RE4A 4K3AA 5APQA 2WSFJ 3TK1A 4P1BH 2M8RA 2ZXEB 1VQOP 1VM9A 1D7MA 5KJ7C 3EQQA 1SFCB 1IK7A 1FAVA 3VTPC 1JY3P 2CK3H 1SQPE 1N7SB 1NTMG 1KQLA 5KLVE 3FWNA 3KDPB 3M9QA 2E76C 4QMAA 1EDJA 3CD6P 2JP3A 2R32A 2QJKB 2Y0CA 1UIIA 1M56D 1JNMA 2BMQA 1NTMD 3PLNA 1QL2A 1K05A 5L8RJ 3D70A 1BGYE 1Q7YQ 1KORA 1JY3O 2XSHA 5AW8B 1SQQJ 2HYNA 3AE5C 3L73G 2JJLA 3CCRP 5GTIH 2Q6QA 3MUDC 2M3EA 1SFCD 1ZRTD 3LIEA 3L73D 2YFJA 1KV4A 1VQ6P 4IOIH 1N7SD 3HUSA 2ZYAA 5AVXB 3I56P 3P32A 2R3CA 3D6YA 1KB9H 2W6JH 1PGPA 1HWTC 3OAKA 2HMJA 4Y99B 2HFED 3KZIE 5KLIC 2YNYA 5BOKA 4NBGD 4NPDA 1U7JA 1J1DB 1VQMP 1YQ3C 2HODB 3HTKB 2KSEA 4U3FG 1GW3A 1SQBJ 1FC2C 1JM1A 3VCAA 1JMMA 1M1JC 1RE4C 1YBKA 4JYBA 2FFDA 1EXIA 3L37A 1NAYA 1LTGC 1JTHB 3MGNA 1PZQA 3I5CA 1IFDA 1SQPK 4U3FD 4PV1C 5CMZA 5APVA 5KLVK 2KK7A 3HD7A 4JYCA 3V6IA 1SQQE 2B9BA 2A45H 4L74A 4HM1A 1KQGB 3V2NA 2JO1A 3L36A 2MJZA 4OGQC 1UUWA 1HBWA 3TDKA 1BCCJ 3PTZA 3NMDA 1JCDA 4HKVA 1ZLLA 1NOHA 1KFMA 2JWDA 3GKEA 2KXPB 2WSEH 3P7KA 1PP9E 3GL0A 3H1KD 2QSIA 3VMHD 1M90Q 3CX5D 2FXPA 4QUPA 3K5BA 2C0WA 2KSJA 2GUSA 1EG9A 3S1KA 2WT7A 3NTNA 3GF7A 4YTPC 4DZOA 3CX5I 4NB9D 1YJ9P 2UWJE 2POHA 3CCQP 1FZAA 2XR8A 1VCKA 1DD3A 1FOSF 1IFPA 3V4QA 2NPSA 2YFLA 1GD2E 1NO4A 1ZOYC 1SQBE 2BCCJ 2R5BA 2W27A 3N4XA 4L76A 5APSA 4HM8A 1VPCA 5GTIE 1VQNP 2YKQA 1NAFA 1HH0A 3C9IA 1SQPG 3AE4C 1Q82Q 1URQB 5KLVG 4OWFA 1EZVE 1PGQA 3H6PA 1YYCA 4HJLA 5CCGD 3HUSC 1O7WA 1KB9E 2OYHB 1SQPD 1LTJA 1RQUA 5KLVD 3RBXA 2M0BA 4NBED 1IFMA 1XTCC 2B88A 2YXQB 1BCCE 5DJUB 2CKFA 1DX7A 4RKUJ 1SQXE 4YXWH 2HPCB 1WT6A 1LTTC 1NTMJ 4BXLA 2Z5IA 2B87A 2XDJA 1E79H 2NZ2A 3VP9A 1LTBC 2V4HA 2FFDC 1YI2P 1ZMEC 1LP1B 2NVFA 3AEAC 5M1BA 3H1IE 1URQD 3FWLA 1OW7A 4RO0A 1Q86Q 3M06A 3H25A 3S4RA 3M0DA 3SWFA 4WB4A 2BCCE 1CZQA 4I6MC 3AE6C 3T97B 2E76B 3EFGA 1W5CE 1XTGB 1ULJA 2YKOA 2QIWA 3E7KA 3Q5SA 5HL4A 2K37A 3PJSK 4AIVA 4N6JA 2Q9IA 5CCHA 3ZDMA 1OMIA 3JC22 2I8DA 1SQBK 1AJYA 1IK9A 1GL2A 2K9YA 2XRXA 3SSUA 1NKNA 1RFSA 1Y9BA 1TU3F 2J59M 1S9KE 1DIPA 3AEDC 1VQLP 2QPZA 5H2FH 1VL2A 1YIJP 2ZXXA 3GTSA 4EIJA 5KJ7D 3OW2O 2WITA 1G2CB 4U3FJ 1S2EA 4H0LC 3NFQA 5AEWA 1PP9G 2NWFA 3CCJP 3Q5RA 4C7RA 1SQXK 3RK2C 5AW6B 5AW7B 2E76D 4IFMA 2KP8A 3AE3C 1FZCA 2KUBA 2GUVA 1LTJC 1YITP 1QLED 4WY4C 3O6QA 5KLIB 3TNUA 3WUVA 1PP9D 2Y0DA 2QA4P 1S5LX 1SP4A 5BU5A 4HB1A 1L0NE 4NBFD 2HMKA 1KC8Q 3GF3A 1G8KB 1OFCX 1H0TA 3Q1MA 3H1LG 1SQBG 5AW0B 2Y0EA 3CCUP 2DE5D 1VQ9P 2IBZI 1M1JB 1DD4A 1R8EA 3L75G 3Q2YA 1JM0A 1OW6A 1T8ZA 4GDOA 2XNXA 4PV1B 3CC2P 1EZVG 2N9BA 3SFEC 2W83C 1SQBD 1IJDB 1NHLA 1HVVA 4YXDC 3L75D 2NRGA 2WPVB 3AECC 1EZVD 3KYQA 1L2PA 1KILA 1R5LA 2WSSH 2JWAA 4PD4H 1KB9D 4ASVA 1SQXG 4R4MA 2E74C 5AVWB 2OYIA 4PJ0H 3V2QA 3KPEA 1GTWA 1SQPJ 1ZV8A 5KLVJ 2HMMA 3QH9A 5TJHA 1IFJA 3B8EB 5CBOA 1BCCD 1OVUA 2IFMA 1N73A 3GL2A 1MZ9A 1ZW0A 1SQXD 4TT3H 4NBAD 1GL2C 2Q3WA 1OW8A 3H1IG 2ZAEB 4R4LA 3A5TA 2H8PD 1O7NA 2E4PA 2FYUE 4PV1D 3VYIA 2PGDA 2A45G 2M5AA 1E5WA 5H2FE 3LIDA 2P7JA 4M3LA 4IFFA 3AE7C 5AW4B 3L74G 2LKMA 3BCCE 3F5HA 1VQ8P 3H1ID 3GZXA 1K9MQ 1KYOI 4OGQD 2JZAA 4JPZB 2BCCD 2KS1A 1L0NK 3HUSB 1LGHB 1NTKE 1FJKA 3W67A 1JOCA 4TLFA 4HM0A 1HJBA 5AW9B 1LTIC 3CPWO 1SQVK 2YXRB 1W2EA 1KD1Q 1LWUA 2KI7B 1NYHA 3O8ZA 1X8YA 2WSCH 1S72P 1AV1A 5EFWB 1JO5A 2HMNA 4BWNA 5AW3B 3MHVA 2E43A 2QJPC 3M0AA 1UUVA 3W68A 1OVRA 2FFDB 2P10A 1S9KD 1YHQP 1OXZA 1QEXA 1AFOA 1ZXGA 2H7HA 1KZUB 1J1EC 4GKGA 3GMAA 2FYZA 2AEJA 3H1JE 2AXCA 2OQQA 3H32A 1GMJA 1ZN5A 1VF5C 1KILC 3A2AA 4KHXA 1M8OB 1VQ7P 1QVFO 2ZYDA 1L0NG 4PD4E 3IFMA 4PJ0E 3WUTA 2FYUK 5KTBA 2B89A 4K35A 2WT7B 1RF1C 1PP9J 3CCLP 1L0ND 3RK3C 1SQVG 5KAFH 1NTZE 1KFNA 1QVGO 4DT0A 3U59A 2DE6D 1EDLA 4GODA 1RHZB 4H13C 2QM8A 4C7NA 2VRSA 2IFNA 1GW4A 3TF5A 3ITKA 3CCVP 1NTKK 5AW1B 3A0BE 1IFNA 2KLVA 4BRYB 3U1AA 4H0LB 2WPQA 3H1LJ 1KQFB 1YJWP 3SFDC 1JY3N 1RF0A 1L4AA 3RK2B 1NJIQ 3L75J 1L0LK 4JF7A 5AW5B 2WQYC 2H89C 1LTJB 1FQTA 2JDIH 4WY4B 1FZEA 3CWBE 2R44A 2ITAA 3EWKA 3AE8C 3NXSA 1N2DC 3MTUE 2FYUG 1U57A 1M7LA 1LT9A 3MIWA 2XU6A 4L75A 1SQXJ 2B87B 4ZMDA 1K8AQ 3BCCG 3GB4A 2IDBA 3CC7P 2FYUD 3BRVB 4NPFX 3C8VA 3AEGC 2K3RA 4CPGA 2P58A 1NTKG 4H0LD 2WPRA 3V5BA 3BCCD 4I2LC 1GK4A 1KILE 5CHXA 1S4XA 5AVRB 3G6EP 1KQSO 3RK2D 3H1IJ 2XZRA 1HJ0A 2N1TA 1NTKD 1NTZK 4WY4D 2E74B 3H1LE 3MZWB 3IN6A 1L0LG 1WMKA 3D89A 1YTZT 3L70E 4RJTA 2P67A 3L74J 3L75E 3CCEP 2ZYLA 3RK3E 2W6AA 2WSEJ 3AZCA 1KN7A 4EOTA 1L0LD 1GL2B 5KAFE 2ZT9C 4LC1A 4UB6H 1FZGA 2KNCB 2QM7A 3A7OA 4QDFB 2QJYC 3H1JG 2RKLA 3TSIA 2ZJSE 4RESB 1O7MA 4KT0J 2Q7CA 3Q5PA 3CI9A 1S5LH 1JTHA 5B5EH 3MD0A 2YVJB 3IR9A 1VQKP 2H88C 2PRRA 3H1JD 1FE6A 2O3JA 1FU1A 1L4AC 1IZNB 1G1JA 2E74D 2Y9YA 4XE5B 3A0HH 2L5GB 2CPSA 2C9NY 3VMID 3AE1C 3O6QB 4PD4D 3TNUB 3CXHH 1NTZG 2QRXA 3HD7C 2GBWA 4HM4A 3FOUA 4AQRD 4PD4I 4NBBD 1GL2D 1SS1A 2A06G 1H0TB 1LT9C 2E4QA 3L74E 3JCUH 1NTZD 2QJPB 1L0NJ 1FBMA 1N8RQ 3KXDA 3II6A 3ABVC 5CXMA 5APWA 3LW5H 1OX3A 4OH8B 1J1EB 2KOGA 1P84H 1RQVA 2YKPA 1SQVJ 2Q1KA 2ZVOB 4DJGA 1JY2P 2G3AA 2E75C 1FDMA 4WVZA 1PPJE 3CWBG 2C9LY 4I7ZC 4ASWA 1VF5B 1HGVA 1KILB 4EYYQ 3VP8A 2N1TC 2NPSC 1LTSC 5K5GB 3CWBD 4ZNCA 1O7GA 4HKZH 2RN0A 1RF1B 3CX5H 3TGUG 2I1KA 4D6TG 1JY2O 4HH2A 3RK3B 1NU1E 3DQYA 4UB6E 3PHLA 2NVEA 4H13B 1FJPA 1HTLC 1OZHA 2AEMA 4IFDK 5AVTB 2YMKA 4B86A 4GIFA 4O9BA 1EC5A 2OTJP 4NBHD 1O7PA 3G71P 3Q3DA 4AAYB 2Z4EA 3P8CE 2FYUJ 3M9HA 1S5LE 5B5EE 1JB0J 1IFIA 2WZ7A 3C0DA 3L70G 1VF5D 2CPBA 1KILD 5KJ7A 2KS1B 2ZYGA 3BCCJ 1BE3E 3BRTB 3L72E 1SQVE 3VMGD 3C1LA 3E1IA 3GG2A 3H1LD 1YQ4C 3VMYA 2KLUA 4HM7A 3CXHE 3L70D 4GOFA 2GBXA 1NTKJ 1T2KC 2NUMA 2AEFA 1GK6A 3RK3D 3M0DC 2FYNC 2E5TA 4NB8D 1LNQA 4H13D 3L4FA 1VQ5P 3JCUE 2K1AA 1EZVI 2R3SA 3BASA 1DEBA 1L0LJ 2FKWB 4HM2A 4DCKA 1RE3A 3EN1A 1VQ4P 1KB9I 3VN0A 4MN4C 5CCHC 3L71G 3HE4A 1P84E 1VQPP 3V4WA 2RMZA 3VMZA 2N9YB 3B5NA 1OIPA 5APTA 1NWQA 5AEUA 1S3JA 2XNDH 3L71D 3VMAA 3HE5A 3QWOC 3G4SP 2G8YA 1NU1K 3H1JJ 5AVYB 4LGDE 1BSNA 1MKMA 5AVZB 2FY8A 3H1HG 1J2JB 1K73Q 2HMLA 3GHGA 2LXBA 1HUCA 2WTYA 2B24A 4GT1A 5KKZC 1CI6A 2ZT9B 5C39A 3JSVC 1DEEG 1PGOA 2A45I 2P2UA 1S1CX 3H1HD 3L74D 1FZCC 1CW5A 1O7HA 1NTZJ 3RL0C 1MUUA 2QJYB 2KIKA 2PP6A 1PPJG 1M1JA 3CLQA 2P1JA 1L0LE 1PV3A 1PIXA 2XSOA 3SWKA 2WMMA 4C46A 4ZKPA 1L4AB 1PPJD 1NYKA 2AXTH 2KB7P 2MKVA 1USEA 3U1CA 1X79B 3OA7A 2Z5HA 2QVAA 3AE9C 1Q90C 1NU1G 3HD7B 1SLQA 2W8ZA 4HM5A 3B71A 2KYVA 2E5YA 1H8AA 3CWBJ 2ZT9D 2PFXA 1MFZA 1RIEA 1LT9B 1NU1D 2OTKE 1MV8A 2WSCJ 3S9OA 1R5SA 1M57D 1VDFA 2OYIC 1RE3C 1T3JA 3TGUJ 4D6TJ 1SJGA 1ZR4A 1BE3G 1N73C 3L72G 2ZVNB 3P8CD 3R2PA 2NUKA 2E75B 3B5NC 2J5UA 2OARA 1L4AD 1FDIA 4I7ZB 2O01N 3UIAA 1NVOA 2L91A 2K9JA 1HGZA 1IC2A 1Z56A 2HLOA 1HF9A 2A06E 4L73A 1BE3D 2N1TB 2NPSB 2QE7H 3L72D 1SQVD 4N78E 4U7JA 3HD7D 3TYYA 3OJAB 2Q3EA 5E79H 2HG5D 3CXHD 2M3BA 4JQ0D 3GHGC 3L70J 3CXHI 4EMJB 3FX0A 2BMRA 2B1XA 4ZKUA 1SFCA 3WU2H 4Y28J 3GLMA 3AEBC 1NGMB 4P1CH 2IPPA 1YTZI 3FXDA 3KQGA 1AA0A 1N7SA 4IL6H 2BEQD 3P8MC 3B4SA 2JEEA 4H44C 3BVHA 1FZBA 1LWUC 2E75D 1P84D 1GU5A 4NBDD 1KYOH 2J58A 3EQ2A 3VOPA 1P84I 2IYPA 2D2CC 3SWYA 2YFIA 3TGUE 4D6TE 2AXTE 2R5DA 2N1TD 2NPSD 3H1KG 3G9RA 2IX7C 1EXJA 1AVOA 3L71J 3FGAD 4NBCD 1K04A 2KZIA 2KZJA 3AEFC 5AVSB 1U7MA 2OTLP 3GW6A 1A02F 2FYNB 2DE7D 3RGUA 2LR2A 2ZFCA 3MP7B 2OGUA 2SPZA 5B66H 4YPCA 1EDIA 4QURA 1LJ2A 5CJ0A 2DW3A 2IBZE 4Z1MH 4WWIA 2XKMA 1NKZB 3H1HJ 2YIUC 2QEXP 1NDOA 1JCCA 1G1IA 5APXA 2Q5UA 5GTHH 1WQLA 3GTEA 3GZYA 1X0TA 3USSA 1PFIA 2HODA 3FXEA 2I1JA 3HTKA 1GDTA 4N3YB 1CSBA 4BRYA 3HRNA 1M1KQ 1Q2NA 3D71A 1ZR2A 1RH5B 4W80A 1T2KD 2W6BA 2O01H 4LLHA 2H43A 5E79E 4HYTB 1RY3A 3E1RA 4WY4A 2PAJA 5KKZB 1JEKA 1BGYG 1RF0C 3L71E 1PGJA 1SFCC 3WU2E 2JR8A 1N86A 1FZCB 4IL6X 3M91A 4EDFA 1NU1J 3RL0B 5CCHD 1H88A 1BGYD 1SQQK 4IL6E 1USDA 5CCGA 1N7SC 2QG4A 1OWAA 4EI2A 1AQ5A 5DJTB 1FZFA 5AVUB 4QCKA 2QJKC 5KAIH 3H1HE 1KYOE 3F89A 4UB8H 1G8JB 1LT1A 1H89A 1LTAC 2YO3A 3CCSP 4AYCA 2O01J 3GOBA 2A06D 2O1KA 4N78D
chains in the Genus database with same CATH topology
4QUPA 3H1JE 4HM2A 2OQQA 1EG9A 2NVGA 3EN1A 1GMJA 3GF7A 4YTPC 4NB9D 1VF5C 3AEEC 1ULIA 2XR8A 4PD4E 1VCKA 1DD3A 1P84E 4XFJA 5AEUA 2YFLA 1ZOYC 1SQBE 1UIXA 4HM8A 2G8YA 2FBWC 1NTZE 3AE4C 4QDFA 3AE2C 2DE6D 4H13C 1MKMA 1NTME 1EZVE 3LW5J 2HMLA 4HJLA 3N0QA 1O7WA 1KB9E 2B24A 5KKZC 2ZT9B 1RQUA 4NBED 1Q90D 1S1CX 4H0LB 1KQFB 3SFDC 1BCCE 2CKFA 1O7HA 4HM3A 4RKUJ 1SQXE 3D6ZA 1ZRTE 2WQYC 2H89C 1FQTA 1L0LE 2V7QJ 3CWBE 3L73E 3GCEA 1PV3A 1PIXA 2XSOA 2NZ2A 1ZP0C 3EWKA 3AE8C 1ZMEC 3R4YA 1NYKA 2NVFA 3AEAC 2MKVA 1U57A 4QUQA 5M1BA 3H1IE 4H44B 1OW7A 3H25A 4QDDA 3AE9C 1Q90C 1KMIZ 2BCCE 4HM5A 3GB4A 3B71A 2IDBA 2D2CB 3AE6C 3C8VA 3T97B 2ZT9D 2E76B 3AEGC 1PL5A 2I7FA 1RIEA 1ULJA 2QIWA 3IAOA 4H0LD 3Q5SA 5HL4A 4QDCA 4OGQB 4AIVA 1KILE 2WSCJ 1OMIA 2HMOA 3S9OA 4U3FE 2JO6A 1AJYA 1HJ0A 2K9YA 2XRXA 2BEZF 2E74B 3H1LE 1RFSA 3IN6A 1Y9BA 1WMKA 3D89A 1SJGA 3L70E 1TU3F 2BMOA 2NUKA 2E75B 3L75E 2J5UA 4HM6A 1FDIA 2ZYLA 1DIPA 3AEDC 4I7ZB 3RK3E 2QPZA 1VL2A 2WSEJ 3RL0g 3GTSA 4H44D 3AZCA 1KTMA 1HF9A 2A06E 2ZT9C 3H1KE 3VCPA 3CX5E 4U7JA 4H0LC 5AEWA 2D2CD 4QDFB 2NWFA 3Q5RA 1FDOA 2E76D 2QJYC 3AE3C 4EMJB 2BMRA 1O7MA 2B1XA 4KT0J 3Q5PA 3O6QA 4Y28J 3GLMA 3AEBC 2YVJB 1NGMB 4P1CH 2H88C 1S5LX 1L0NE 2WSFJ 4NBFD 2HMKA 4P1BH 3GF3A 1G8KB 1VM9A 2BEQD 2E74D 3Q1MA 4H44C 3EQQA 1IK7A 2DE5D 3AE1C 3VMID 2E75D 4NBDD 2GBWA 1DD4A 4HM4A 1R8EA 3Q2YA 3FOUA 1OW6A 4GDOA 2D2CC 4NBBD 4PV1B 1SQPE 2YFIA 3TGUE 5KLVE 3SFEC 2E76C 3G9RA 2E4QA 3L74E 1EXJA 2JP3A 4YXDC 3FGAD 4NBCD 2WPVB 1K04A 2BMQA 3AECC 1K05A 3AEFC 3ABVC 5CXMA 5L8RJ 3D70A 2DE7D 4R4MA 1KORA 2E74C 1RQVA 2XSHA 4QURA 2G3AA 3AE5C 2E75C 2IBZE 4Z1MH 1PPJE 2HMMA 4I7ZC 1VF5B 2YIUC 3GL2A 1NDOA 4TT3H 4NBAD 3GTEA 1WQLA 3GZYA 2Q3WA 1OW8A 4R4LA 2YFJA 1O7NA 2E4PA 2FYUE 4PV1D 1O7GA 3D6YA 3AE7C 1NU1E 3D71A 3DQYA 2HMJA 3BCCE 2NVEA 4H13B 5KLIC 3GZXA 5BOKA 4NBGD 1YQ3C 4OGQD 2JZAA 2YMKA 4NBHD 1NTKE 1O7PA 3L71E 3Q3DA 4AAYB 1JM1A 4HM0A 3VCAA 1JB0J 3C0DA 4IL6X 1EXIA 1VF5D 1NYHA 4PV1C 1BE3E 3L72E 1SQVE 3VMGD 2HMNA 1SQQE 4QCKA 2QJPC 2QJKC 1YQ4C 4HM1A 4HM7A 1KQGB 3CXHE 2JO1A 2GBXA 1UUVA 3H1HE 1KYOE 1G8JB 2P10A 4OGQC 2NUMA 1UUWA 2O01J 3GOBA 2FYNC 4HKVA 3GKEA 4NB8D 3GMAA 4H13D 1PP9E 3GL0A 2QSIA 3VMHD 2FXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3W A;  4QUP A;  4EMJ B;  3H1J E;  2BMR A;  4HM2 A;  1O7M A;  2B1X A;  4KT0 J;  1NYK A;  1EG9 A;  2NVF A;  2NVG A;  3EN1 A;  2YFJ A;  4NB9 D;  1O7N A;  4QUQ A;  4Y28 J;  2E4P A;  2FYU E;  3H1I E;  4H44 B;  4PV1 D;  1O7G A;  1ULI A;  2YVJ B;  2XR8 A;  4P1C H;  4QDD A;  1Q90 C;  1S5L X;  4PD4 E;  1VCK A;  1P84 E;  1L0N E;  1NU1 E;  2BCC E;  2WSF J;  4NBF D;  2HMK A;  4HM5 A;  3GB4 A;  4P1B H;  3DQY A;  1G8K B;  2HMJ A;  2D2C B;  1VM9 A;  3BCC E;  2NVE A;  2E74 D;  4H13 B;  5KLI C;  5AEU A;  3GZX A;  5BOK A;  4NBG D;  3C8V A;  2ZT9 D;  2YFL A;  3EQQ A;  2E76 B;  3VMI D;  2DE5 D;  2I7F A;  1SQB E;  4OGQ D;  2JZA A;  1RIE A;  1ULJ A;  2E75 D;  4HM8 A;  2QIW A;  4NBD D;  2GBW A;  4HM4 A;  4H0L D;  5HL4 A;  4QDC A;  4OGQ B;  1NTZ E;  3FOU A;  4AIV A;  4NBH D;  1NTK E;  1O7P A;  4QDF A;  4NBB D;  2DE6 D;  2WSC J;  4PV1 B;  1SQP E;  3L71 E;  2HMO A;  4AAY B;  2YFI A;  4U3F E;  3TGU E;  5KLV E;  1NTM E;  1EZV E;  2JO6 A;  3LW5 J;  1JM1 A;  2HML A;  4HM0 A;  2E4Q A;  3VCA A;  1JB0 J;  3L74 E;  4HJL A;  3C0D A;  2K9Y A;  4IL6 X;  2XRX A;  3N0Q A;  2E74 B;  3H1L E;  1O7W A;  1KB9 E;  1RFS A;  1VF5 D;  2WPV B;  5KKZ C;  2B24 A;  4NBC D;  3D89 A;  1SJG A;  2ZT9 B;  3L70 E;  2BMQ A;  2BMO A;  4NBE D;  1BE3 E;  2NUK A;  1Q90 D;  3L72 E;  2E75 B;  1SQV E;  3L75 E;  3VMG D;  4HM6 A;  5CXM A;  2ZYL A;  4H0L B;  2HMN A;  5L8R J;  4I7Z B;  1SQQ E;  2QPZ A;  2DE7 D;  4QCK A;  1BCC E;  2QJP C;  2WSE J;  2CKF A;  2QJK C;  1O7H A;  4HM1 A;  3GTS A;  4HM3 A;  4HM7 A;  3AZC A;  4RKU J;  3CXH E;  4H44 D;  2GBX A;  1SQX E;  1UUV A;  3H1H E;  2A06 E;  1KYO E;  2XSH A;  3H1K E;  4QUR A;  1G8J B;  2NUM A;  1UUW A;  1ZRT E;  3VCP A;  3CX5 E;  2IBZ E;  1PPJ E;  2HMM A;  1FQT A;  2O01 J;  1L0L E;  3GOB A;  2FYN C;  3CWB E;  4HKV A;  1VF5 B;  5AEW A;  3L73 E;  3GCE A;  2YIU C;  2D2C D;  3GL2 A;  3GKE A;  4NB8 D;  4QDF B;  2NWF A;  4H13 D;  1PP9 E;  1NDO A;  2XSO A;  3GL0 A;  4NBA D;  2QSI A;  3GTE A;  1WQL A;  2E76 D;  2QJY C;  3VMH D;  3GZY A; 
#chains in the Genus database with same CATH topology
 3L73 J;  1BE3 J;  3L72 J;  5APU A;  2NVG A;  4I1L A;  3BAT A;  5AVV B;  3AEE C;  3CMA P;  1ULI A;  1BDC A;  1URQ A;  3VMX A;  2YO2 A;  5B66 E;  1WRG A;  4XFJ A;  4XA4 A;  1Y47 A;  2Y9Z A;  3EFF K;  3RL0 D;  2O1J A;  3M9B A;  2OYI B;  1EQ7 A;  5TIS H;  1N7L A;  2GM4 A;  1UIX A;  2V7Q H;  2KNC A;  1Q81 Q;  4HJG H;  2OYH A;  2FBW C;  2WPS A;  5GTH E;  1NH4 A;  1SQQ G;  4QDF A;  3HE4 B;  3AE2 C;  5BVZ A;  1N73 B;  4Y99 C;  3CCM P;  1NTM E;  1J1D C;  1T3U A;  3B5N B;  4NPE A;  1A02 J;  3LW5 J;  1GU4 A;  3PP5 A;  3WUU A;  3N0Q A;  3PH0 A;  1X22 A;  1QGK B;  2HPC A;  3IF4 A;  3HE5 B;  1SQQ D;  3A3Y B;  3TGU D;  4D6T D;  1Q90 D;  2M5A B;  1GZL A;  1QL1 A;  2WWW A;  2IZ1 A;  2FXM A;  2BAS A;  2IZ0 A;  4GOE A;  4HM3 A;  3GHG B;  4A7P A;  1EDK A;  1LP1 A;  2W90 A;  3RBZ A;  2WVR A;  1AQT A;  3D6Z A;  2IBZ G;  3CL3 D;  1CI6 B;  1ZRT E;  4OVN F;  2V7Q J;  1T6A A;  3L73 E;  3GCE A;  3H1K J;  1X9V A;  1ZP0 C;  3A0H E;  2IBZ D;  3R4Y A;  1YJN P;  3T97 A;  5CCG C;  4QUQ A;  4H44 B;  1LWU B;  1DH3 A;  2XV5 A;  4QDD A;  1JY2 N;  3B5N D;  1KMI Z;  4JBZ A;  5KAI E;  1JMB A;  1QX8 A;  4UB8 E;  1SVF A;  2D2C B;  1Y8A A;  5BU8 B;  1PL5 A;  3KHU A;  2I7F A;  3IAO A;  1BSH A;  4QDC A;  4OGQ B;  5AVQ B;  3L35 A;  4KJM A;  1BCC G;  2HMO A;  1MFT A;  4U3F E;  1JUN A;  2JO6 A;  3MUD A;  4DOJ A;  3H32 B;  2BEZ F;  5CJ4 A;  1G2C A;  1FOS E;  1URQ C;  2LXC B;  2E42 A;  1RF1 A;  2BMO A;  2C0X A;  3WMM 0;  2WSF H;  3CME P;  1NTM K;  2YMY A;  4W7Z A;  2RH0 A;  4HM6 A;  3V2P A;  2FXO A;  2HR3 A;  5APY A;  5TIS E;  2YIU B;  2K88 A;  5AW2 B;  3RL0 g;  4H44 D;  1W2B O;  1KTM A;  2OYH C;  1FS0 E;  2IYO A;  3H1K E;  2JKV A;  3KZI H;  1BGY J;  3CX5 E;  1OVV A;  3VCP A;  2OYO A;  3CC4 P;  2BCC G;  4WBA A;  2D2C D;  4W7Y A;  3A0B H;  5CBN A;  1KYO D;  1FDO A;  3G3Z A;  3I55 P;  4C7N B;  2K9J B;  3N7N A;  1IO4 A;  3PRJ A;  3V2R A;  2GA1 A;  2Q3I A;  1AVY A;  4AUW A;  1BDD A;  1RE4 A;  4K3A A;  5APQ A;  2WSF J;  3TK1 A;  4P1B H;  2M8R A;  2ZXE B;  1VQO P;  1VM9 A;  1D7M A;  5KJ7 C;  3EQQ A;  1SFC B;  1IK7 A;  1FAV A;  3VTP C;  1JY3 P;  2CK3 H;  1SQP E;  1N7S B;  1NTM G;  1KQL A;  5KLV E;  3FWN A;  3KDP B;  3M9Q A;  2E76 C;  4QMA A;  1EDJ A;  3CD6 P;  2JP3 A;  2R32 A;  2QJK B;  2Y0C A;  1UII A;  1M56 D;  1JNM A;  2BMQ A;  1NTM D;  3PLN A;  1QL2 A;  1K05 A;  5L8R J;  3D70 A;  1BGY E;  1Q7Y Q;  1KOR A;  1JY3 O;  2XSH A;  5AW8 B;  1SQQ J;  2HYN A;  3AE5 C;  3L73 G;  2JJL A;  3CCR P;  5GTI H;  2Q6Q A;  3MUD C;  2M3E A;  1SFC D;  1ZRT D;  3LIE A;  3L73 D;  2YFJ A;  1KV4 A;  1VQ6 P;  4IOI H;  1N7S D;  3HUS A;  2ZYA A;  5AVX B;  3I56 P;  3P32 A;  2R3C A;  3D6Y A;  1KB9 H;  2W6J H;  1PGP A;  1HWT C;  3OAK A;  2HMJ A;  4Y99 B;  2HFE D;  3KZI E;  5KLI C;  2YNY A;  5BOK A;  4NBG D;  4NPD A;  1U7J A;  1J1D B;  1VQM P;  1YQ3 C;  2HOD B;  3HTK B;  2KSE A;  4U3F G;  1GW3 A;  1SQB J;  1FC2 C;  1JM1 A;  3VCA A;  1JMM A;  1M1J C;  1RE4 C;  1YBK A;  4JYB A;  2FFD A;  1EXI A;  3L37 A;  1NAY A;  1LTG C;  1JTH B;  3MGN A;  1PZQ A;  3I5C A;  1IFD A;  1SQP K;  4U3F D;  4PV1 C;  5CMZ A;  5APV A;  5KLV K;  2KK7 A;  3HD7 A;  4JYC A;  3V6I A;  1SQQ E;  2B9B A;  2A45 H;  4L74 A;  4HM1 A;  1KQG B;  3V2N A;  2JO1 A;  3L36 A;  2MJZ A;  4OGQ C;  1UUW A;  1HBW A;  3TDK A;  1BCC J;  3PTZ A;  3NMD A;  1JCD A;  4HKV A;  1ZLL A;  1NOH A;  1KFM A;  2JWD A;  3GKE A;  2KXP B;  2WSE H;  3P7K A;  1PP9 E;  3GL0 A;  3H1K D;  2QSI A;  3VMH D;  1M90 Q;  3CX5 D;  2FXP A;  4QUP A;  3K5B A;  2C0W A;  2KSJ A;  2GUS A;  1EG9 A;  3S1K A;  2WT7 A;  3NTN A;  3GF7 A;  4YTP C;  4DZO A;  3CX5 I;  4NB9 D;  1YJ9 P;  2UWJ E;  2POH A;  3CCQ P;  1FZA A;  2XR8 A;  1VCK A;  1DD3 A;  1FOS F;  1IFP A;  3V4Q A;  2NPS A;  2YFL A;  1GD2 E;  1NO4 A;  1ZOY C;  1SQB E;  2BCC J;  2R5B A;  2W27 A;  3N4X A;  4L76 A;  5APS A;  4HM8 A;  1VPC A;  5GTI E;  1VQN P;  2YKQ A;  1NAF A;  1HH0 A;  3C9I A;  1SQP G;  3AE4 C;  1Q82 Q;  1URQ B;  5KLV G;  4OWF A;  1EZV E;  1PGQ A;  3H6P A;  1YYC A;  4HJL A;  5CCG D;  3HUS C;  1O7W A;  1KB9 E;  2OYH B;  1SQP D;  1LTJ A;  1RQU A;  5KLV D;  3RBX A;  2M0B A;  4NBE D;  1IFM A;  1XTC C;  2B88 A;  2YXQ B;  1BCC E;  5DJU B;  2CKF A;  1DX7 A;  4RKU J;  1SQX E;  4YXW H;  2HPC B;  1WT6 A;  1LTT C;  1NTM J;  4BXL A;  2Z5I A;  2B87 A;  2XDJ A;  1E79 H;  2NZ2 A;  3VP9 A;  1LTB C;  2V4H A;  2FFD C;  1YI2 P;  1ZME C;  1LP1 B;  2NVF A;  3AEA C;  5M1B A;  3H1I E;  1URQ D;  3FWL A;  1OW7 A;  4RO0 A;  1Q86 Q;  3M06 A;  3H25 A;  3S4R A;  3M0D A;  3SWF A;  4WB4 A;  2BCC E;  1CZQ A;  4I6M C;  3AE6 C;  3T97 B;  2E76 B;  3EFG A;  1W5C E;  1XTG B;  1ULJ A;  2YKO A;  2QIW A;  3E7K A;  3Q5S A;  5HL4 A;  2K37 A;  3PJS K;  4AIV A;  4N6J A;  2Q9I A;  5CCH A;  3ZDM A;  1OMI A;  3JC2 2;  2I8D A;  1SQB K;  1AJY A;  1IK9 A;  1GL2 A;  2K9Y A;  2XRX A;  3SSU A;  1NKN A;  1RFS A;  1Y9B A;  1TU3 F;  2J59 M;  1S9K E;  1DIP A;  3AED C;  1VQL P;  2QPZ A;  5H2F H;  1VL2 A;  1YIJ P;  2ZXX A;  3GTS A;  4EIJ A;  5KJ7 D;  3OW2 O;  2WIT A;  1G2C B;  4U3F J;  1S2E A;  4H0L C;  3NFQ A;  5AEW A;  1PP9 G;  2NWF A;  3CCJ P;  3Q5R A;  4C7R A;  1SQX K;  3RK2 C;  5AW6 B;  5AW7 B;  2E76 D;  4IFM A;  2KP8 A;  3AE3 C;  1FZC A;  2KUB A;  2GUV A;  1LTJ C;  1YIT P;  1QLE D;  4WY4 C;  3O6Q A;  5KLI B;  3TNU A;  3WUV A;  1PP9 D;  2Y0D A;  2QA4 P;  1S5L X;  1SP4 A;  5BU5 A;  4HB1 A;  1L0N E;  4NBF D;  2HMK A;  1KC8 Q;  3GF3 A;  1G8K B;  1OFC X;  1H0T A;  3Q1M A;  3H1L G;  1SQB G;  5AW0 B;  2Y0E A;  3CCU P;  2DE5 D;  1VQ9 P;  2IBZ I;  1M1J B;  1DD4 A;  1R8E A;  3L75 G;  3Q2Y A;  1JM0 A;  1OW6 A;  1T8Z A;  4GDO A;  2XNX A;  4PV1 B;  3CC2 P;  1EZV G;  2N9B A;  3SFE C;  2W83 C;  1SQB D;  1IJD B;  1NHL A;  1HVV A;  4YXD C;  3L75 D;  2NRG A;  2WPV B;  3AEC C;  1EZV D;  3KYQ A;  1L2P A;  1KIL A;  1R5L A;  2WSS H;  2JWA A;  4PD4 H;  1KB9 D;  4ASV A;  1SQX G;  4R4M A;  2E74 C;  5AVW B;  2OYI A;  4PJ0 H;  3V2Q A;  3KPE A;  1GTW A;  1SQP J;  1ZV8 A;  5KLV J;  2HMM A;  3QH9 A;  5TJH A;  1IFJ A;  3B8E B;  5CBO A;  1BCC D;  1OVU A;  2IFM A;  1N73 A;  3GL2 A;  1MZ9 A;  1ZW0 A;  1SQX D;  4TT3 H;  4NBA D;  1GL2 C;  2Q3W A;  1OW8 A;  3H1I G;  2ZAE B;  4R4L A;  3A5T A;  2H8P D;  1O7N A;  2E4P A;  2FYU E;  4PV1 D;  3VYI A;  2PGD A;  2A45 G;  2M5A A;  1E5W A;  5H2F E;  3LID A;  2P7J A;  4M3L A;  4IFF A;  3AE7 C;  5AW4 B;  3L74 G;  2LKM A;  3BCC E;  3F5H A;  1VQ8 P;  3H1I D;  3GZX A;  1K9M Q;  1KYO I;  4OGQ D;  2JZA A;  4JPZ B;  2BCC D;  2KS1 A;  1L0N K;  3HUS B;  1LGH B;  1NTK E;  1FJK A;  3W67 A;  1JOC A;  4TLF A;  4HM0 A;  1HJB A;  5AW9 B;  1LTI C;  3CPW O;  1SQV K;  2YXR B;  1W2E A;  1KD1 Q;  1LWU A;  2KI7 B;  1NYH A;  3O8Z A;  1X8Y A;  2WSC H;  1S72 P;  1AV1 A;  5EFW B;  1JO5 A;  2HMN A;  4BWN A;  5AW3 B;  3MHV A;  2E43 A;  2QJP C;  3M0A A;  1UUV A;  3W68 A;  1OVR A;  2FFD B;  2P10 A;  1S9K D;  1YHQ P;  1OXZ A;  1QEX A;  1AFO A;  1ZXG A;  2H7H A;  1KZU B;  1J1E C;  4GKG A;  3GMA A;  2FYZ A;  2AEJ A;  3H1J E;  2AXC A;  2OQQ A;  3H32 A;  1GMJ A;  1ZN5 A;  1VF5 C;  1KIL C;  3A2A A;  4KHX A;  1M8O B;  1VQ7 P;  1QVF O;  2ZYD A;  1L0N G;  4PD4 E;  3IFM A;  4PJ0 E;  3WUT A;  2FYU K;  5KTB A;  2B89 A;  4K35 A;  2WT7 B;  1RF1 C;  1PP9 J;  3CCL P;  1L0N D;  3RK3 C;  1SQV G;  5KAF H;  1NTZ E;  1KFN A;  1QVG O;  4DT0 A;  3U59 A;  2DE6 D;  1EDL A;  4GOD A;  1RHZ B;  4H13 C;  2QM8 A;  4C7N A;  2VRS A;  2IFN A;  1GW4 A;  3TF5 A;  3ITK A;  3CCV P;  1NTK K;  5AW1 B;  3A0B E;  1IFN A;  2KLV A;  4BRY B;  3U1A A;  4H0L B;  2WPQ A;  3H1L J;  1KQF B;  1YJW P;  3SFD C;  1JY3 N;  1RF0 A;  1L4A A;  3RK2 B;  1NJI Q;  3L75 J;  1L0L K;  4JF7 A;  5AW5 B;  2WQY C;  2H89 C;  1LTJ B;  1FQT A;  2JDI H;  4WY4 B;  1FZE A;  3CWB E;  2R44 A;  2ITA A;  3EWK A;  3AE8 C;  3NXS A;  1N2D C;  3MTU E;  2FYU G;  1U57 A;  1M7L A;  1LT9 A;  3MIW A;  2XU6 A;  4L75 A;  1SQX J;  2B87 B;  4ZMD A;  1K8A Q;  3BCC G;  3GB4 A;  2IDB A;  3CC7 P;  2FYU D;  3BRV B;  4NPF X;  3C8V A;  3AEG C;  2K3R A;  4CPG A;  2P58 A;  1NTK G;  4H0L D;  2WPR A;  3V5B A;  3BCC D;  4I2L C;  1GK4 A;  1KIL E;  5CHX A;  1S4X A;  5AVR B;  3G6E P;  1KQS O;  3RK2 D;  3H1I J;  2XZR A;  1HJ0 A;  2N1T A;  1NTK D;  1NTZ K;  4WY4 D;  2E74 B;  3H1L E;  3MZW B;  3IN6 A;  1L0L G;  1WMK A;  3D89 A;  1YTZ T;  3L70 E;  4RJT A;  2P67 A;  3L74 J;  3L75 E;  3CCE P;  2ZYL A;  3RK3 E;  2W6A A;  2WSE J;  3AZC A;  1KN7 A;  4EOT A;  1L0L D;  1GL2 B;  5KAF E;  2ZT9 C;  4LC1 A;  4UB6 H;  1FZG A;  2KNC B;  2QM7 A;  3A7O A;  4QDF B;  2QJY C;  3H1J G;  2RKL A;  3TSI A;  2ZJS E;  4RES B;  1O7M A;  4KT0 J;  2Q7C A;  3Q5P A;  3CI9 A;  1S5L H;  1JTH A;  5B5E H;  3MD0 A;  2YVJ B;  3IR9 A;  1VQK P;  2H88 C;  2PRR A;  3H1J D;  1FE6 A;  2O3J A;  1FU1 A;  1L4A C;  1IZN B;  1G1J A;  2E74 D;  2Y9Y A;  4XE5 B;  3A0H H;  2L5G B;  2CPS A;  2C9N Y;  3VMI D;  3AE1 C;  3O6Q B;  4PD4 D;  3TNU B;  3CXH H;  1NTZ G;  2QRX A;  3HD7 C;  2GBW A;  4HM4 A;  3FOU A;  4AQR D;  4PD4 I;  4NBB D;  1GL2 D;  1SS1 A;  2A06 G;  1H0T B;  1LT9 C;  2E4Q A;  3L74 E;  3JCU H;  1NTZ D;  2QJP B;  1L0N J;  1FBM A;  1N8R Q;  3KXD A;  3II6 A;  3ABV C;  5CXM A;  5APW A;  3LW5 H;  1OX3 A;  4OH8 B;  1J1E B;  2KOG A;  1P84 H;  1RQV A;  2YKP A;  1SQV J;  2Q1K A;  2ZVO B;  4DJG A;  1JY2 P;  2G3A A;  2E75 C;  1FDM A;  4WVZ A;  1PPJ E;  3CWB G;  2C9L Y;  4I7Z C;  4ASW A;  1VF5 B;  1HGV A;  1KIL B;  4EYY Q;  3VP8 A;  2N1T C;  2NPS C;  1LTS C;  5K5G B;  3CWB D;  4ZNC A;  1O7G A;  4HKZ H;  2RN0 A;  1RF1 B;  3CX5 H;  3TGU G;  2I1K A;  4D6T G;  1JY2 O;  4HH2 A;  3RK3 B;  1NU1 E;  3DQY A;  4UB6 E;  3PHL A;  2NVE A;  4H13 B;  1FJP A;  1HTL C;  1OZH A;  2AEM A;  4IFD K;  5AVT B;  2YMK A;  4B86 A;  4GIF A;  4O9B A;  1EC5 A;  2OTJ P;  4NBH D;  1O7P A;  3G71 P;  3Q3D A;  4AAY B;  2Z4E A;  3P8C E;  2FYU J;  3M9H A;  1S5L E;  5B5E E;  1JB0 J;  1IFI A;  2WZ7 A;  3C0D A;  3L70 G;  1VF5 D;  2CPB A;  1KIL D;  5KJ7 A;  2KS1 B;  2ZYG A;  3BCC J;  1BE3 E;  3BRT B;  3L72 E;  1SQV E;  3VMG D;  3C1L A;  3E1I A;  3GG2 A;  3H1L D;  1YQ4 C;  3VMY A;  2KLU A;  4HM7 A;  3CXH E;  3L70 D;  4GOF A;  2GBX A;  1NTK J;  1T2K C;  2NUM A;  2AEF A;  1GK6 A;  3RK3 D;  3M0D C;  2FYN C;  2E5T A;  4NB8 D;  1LNQ A;  4H13 D;  3L4F A;  1VQ5 P;  3JCU E;  2K1A A;  1EZV I;  2R3S A;  3BAS A;  1DEB A;  1L0L J;  2FKW B;  4HM2 A;  4DCK A;  1RE3 A;  3EN1 A;  1VQ4 P;  1KB9 I;  3VN0 A;  4MN4 C;  5CCH C;  3L71 G;  3HE4 A;  1P84 E;  1VQP P;  3V4W A;  2RMZ A;  3VMZ A;  2N9Y B;  3B5N A;  1OIP A;  5APT A;  1NWQ A;  5AEU A;  1S3J A;  2XND H;  3L71 D;  3VMA A;  3HE5 A;  3QWO C;  3G4S P;  2G8Y A;  1NU1 K;  3H1J J;  5AVY B;  4LGD E;  1BSN A;  1MKM A;  5AVZ B;  2FY8 A;  3H1H G;  1J2J B;  1K73 Q;  2HML A;  3GHG A;  2LXB A;  1HUC A;  2WTY A;  2B24 A;  4GT1 A;  5KKZ C;  1CI6 A;  2ZT9 B;  5C39 A;  3JSV C;  1DEE G;  1PGO A;  2A45 I;  2P2U A;  1S1C X;  3H1H D;  3L74 D;  1FZC C;  1CW5 A;  1O7H A;  1NTZ J;  3RL0 C;  1MUU A;  2QJY B;  2KIK A;  2PP6 A;  1PPJ G;  1M1J A;  3CLQ A;  2P1J A;  1L0L E;  1PV3 A;  1PIX A;  2XSO A;  3SWK A;  2WMM A;  4C46 A;  4ZKP A;  1L4A B;  1PPJ D;  1NYK A;  2AXT H;  2KB7 P;  2MKV A;  1USE A;  3U1C A;  1X79 B;  3OA7 A;  2Z5H A;  2QVA A;  3AE9 C;  1Q90 C;  1NU1 G;  3HD7 B;  1SLQ A;  2W8Z A;  4HM5 A;  3B71 A;  2KYV A;  2E5Y A;  1H8A A;  3CWB J;  2ZT9 D;  2PFX A;  1MFZ A;  1RIE A;  1LT9 B;  1NU1 D;  2OTK E;  1MV8 A;  2WSC J;  3S9O A;  1R5S A;  1M57 D;  1VDF A;  2OYI C;  1RE3 C;  1T3J A;  3TGU J;  4D6T J;  1SJG A;  1ZR4 A;  1BE3 G;  1N73 C;  3L72 G;  2ZVN B;  3P8C D;  3R2P A;  2NUK A;  2E75 B;  3B5N C;  2J5U A;  2OAR A;  1L4A D;  1FDI A;  4I7Z B;  2O01 N;  3UIA A;  1NVO A;  2L91 A;  2K9J A;  1HGZ A;  1IC2 A;  1Z56 A;  2HLO A;  1HF9 A;  2A06 E;  4L73 A;  1BE3 D;  2N1T B;  2NPS B;  2QE7 H;  3L72 D;  1SQV D;  4N78 E;  4U7J A;  3HD7 D;  3TYY A;  3OJA B;  2Q3E A;  5E79 H;  2HG5 D;  3CXH D;  2M3B A;  4JQ0 D;  3GHG C;  3L70 J;  3CXH I;  4EMJ B;  3FX0 A;  2BMR A;  2B1X A;  4ZKU A;  1SFC A;  3WU2 H;  4Y28 J;  3GLM A;  3AEB C;  1NGM B;  4P1C H;  2IPP A;  1YTZ I;  3FXD A;  3KQG A;  1AA0 A;  1N7S A;  4IL6 H;  2BEQ D;  3P8M C;  3B4S A;  2JEE A;  4H44 C;  3BVH A;  1FZB A;  1LWU C;  2E75 D;  1P84 D;  1GU5 A;  4NBD D;  1KYO H;  2J58 A;  3EQ2 A;  3VOP A;  1P84 I;  2IYP A;  2D2C C;  3SWY A;  2YFI A;  3TGU E;  4D6T E;  2AXT E;  2R5D A;  2N1T D;  2NPS D;  3H1K G;  3G9R A;  2IX7 C;  1EXJ A;  1AVO A;  3L71 J;  3FGA D;  4NBC D;  1K04 A;  2KZI A;  2KZJ A;  3AEF C;  5AVS B;  1U7M A;  2OTL P;  3GW6 A;  1A02 F;  2FYN B;  2DE7 D;  3RGU A;  2LR2 A;  2ZFC A;  3MP7 B;  2OGU A;  2SPZ A;  5B66 H;  4YPC A;  1EDI A;  4QUR A;  1LJ2 A;  5CJ0 A;  2DW3 A;  2IBZ E;  4Z1M H;  4WWI A;  2XKM A;  1NKZ B;  3H1H J;  2YIU C;  2QEX P;  1NDO A;  1JCC A;  1G1I A;  5APX A;  2Q5U A;  5GTH H;  1WQL A;  3GTE A;  3GZY A;  1X0T A;  3USS A;  1PFI A;  2HOD A;  3FXE A;  2I1J A;  3HTK A;  1GDT A;  4N3Y B;  1CSB A;  4BRY A;  3HRN A;  1M1K Q;  1Q2N A;  3D71 A;  1ZR2 A;  1RH5 B;  4W80 A;  1T2K D;  2W6B A;  2O01 H;  4LLH A;  2H43 A;  5E79 E;  4HYT B;  1RY3 A;  3E1R A;  4WY4 A;  2PAJ A;  5KKZ B;  1JEK A;  1BGY G;  1RF0 C;  3L71 E;  1PGJ A;  1SFC C;  3WU2 E;  2JR8 A;  1N86 A;  1FZC B;  4IL6 X;  3M91 A;  4EDF A;  1NU1 J;  3RL0 B;  5CCH D;  1H88 A;  1BGY D;  1SQQ K;  4IL6 E;  1USD A;  5CCG A;  1N7S C;  2QG4 A;  1OWA A;  4EI2 A;  1AQ5 A;  5DJT B;  1FZF A;  5AVU B;  4QCK A;  2QJK C;  5KAI H;  3H1H E;  1KYO E;  3F89 A;  4UB8 H;  1G8J B;  1LT1 A;  1H89 A;  1LTA C;  2YO3 A;  3CCS P;  4AYC A;  2O01 J;  3GOB A;  2A06 D;  2O1K A;  4N78 D; 
#chains in the Genus database with same CATH homology
 4QUP A;  3H1J E;  4HM2 A;  2OQQ A;  1EG9 A;  2NVG A;  3EN1 A;  1GMJ A;  3GF7 A;  4YTP C;  4NB9 D;  1VF5 C;  3AEE C;  1ULI A;  2XR8 A;  4PD4 E;  1VCK A;  1DD3 A;  1P84 E;  4XFJ A;  5AEU A;  2YFL A;  1ZOY C;  1SQB E;  1UIX A;  4HM8 A;  2G8Y A;  2FBW C;  1NTZ E;  3AE4 C;  4QDF A;  3AE2 C;  2DE6 D;  4H13 C;  1MKM A;  1NTM E;  1EZV E;  3LW5 J;  2HML A;  4HJL A;  3N0Q A;  1O7W A;  1KB9 E;  2B24 A;  5KKZ C;  2ZT9 B;  1RQU A;  4NBE D;  1Q90 D;  1S1C X;  4H0L B;  1KQF B;  3SFD C;  1BCC E;  2CKF A;  1O7H A;  4HM3 A;  4RKU J;  1SQX E;  3D6Z A;  1ZRT E;  2WQY C;  2H89 C;  1FQT A;  1L0L E;  2V7Q J;  3CWB E;  3L73 E;  3GCE A;  1PV3 A;  1PIX A;  2XSO A;  2NZ2 A;  1ZP0 C;  3EWK A;  3AE8 C;  1ZME C;  3R4Y A;  1NYK A;  2NVF A;  3AEA C;  2MKV A;  1U57 A;  4QUQ A;  5M1B A;  3H1I E;  4H44 B;  1OW7 A;  3H25 A;  4QDD A;  3AE9 C;  1Q90 C;  1KMI Z;  2BCC E;  4HM5 A;  3GB4 A;  3B71 A;  2IDB A;  2D2C B;  3AE6 C;  3C8V A;  3T97 B;  2ZT9 D;  2E76 B;  3AEG C;  1PL5 A;  2I7F A;  1RIE A;  1ULJ A;  2QIW A;  3IAO A;  4H0L D;  3Q5S A;  5HL4 A;  4QDC A;  4OGQ B;  4AIV A;  1KIL E;  2WSC J;  1OMI A;  2HMO A;  3S9O A;  4U3F E;  2JO6 A;  1AJY A;  1HJ0 A;  2K9Y A;  2XRX A;  2BEZ F;  2E74 B;  3H1L E;  1RFS A;  3IN6 A;  1Y9B A;  1WMK A;  3D89 A;  1SJG A;  3L70 E;  1TU3 F;  2BMO A;  2NUK A;  2E75 B;  3L75 E;  2J5U A;  4HM6 A;  1FDI A;  2ZYL A;  1DIP A;  3AED C;  4I7Z B;  3RK3 E;  2QPZ A;  1VL2 A;  2WSE J;  3RL0 g;  3GTS A;  4H44 D;  3AZC A;  1KTM A;  1HF9 A;  2A06 E;  2ZT9 C;  3H1K E;  3VCP A;  3CX5 E;  4U7J A;  4H0L C;  5AEW A;  2D2C D;  4QDF B;  2NWF A;  3Q5R A;  1FDO A;  2E76 D;  2QJY C;  3AE3 C;  4EMJ B;  2BMR A;  1O7M A;  2B1X A;  4KT0 J;  3Q5P A;  3O6Q A;  4Y28 J;  3GLM A;  3AEB C;  2YVJ B;  1NGM B;  4P1C H;  2H88 C;  1S5L X;  1L0N E;  2WSF J;  4NBF D;  2HMK A;  4P1B H;  3GF3 A;  1G8K B;  1VM9 A;  2BEQ D;  2E74 D;  3Q1M A;  4H44 C;  3EQQ A;  1IK7 A;  2DE5 D;  3AE1 C;  3VMI D;  2E75 D;  4NBD D;  2GBW A;  1DD4 A;  4HM4 A;  1R8E A;  3Q2Y A;  3FOU A;  1OW6 A;  4GDO A;  2D2C C;  4NBB D;  4PV1 B;  1SQP E;  2YFI A;  3TGU E;  5KLV E;  3SFE C;  2E76 C;  3G9R A;  2E4Q A;  3L74 E;  1EXJ A;  2JP3 A;  4YXD C;  3FGA D;  4NBC D;  2WPV B;  1K04 A;  2BMQ A;  3AEC C;  1K05 A;  3AEF C;  3ABV C;  5CXM A;  5L8R J;  3D70 A;  2DE7 D;  4R4M A;  1KOR A;  2E74 C;  1RQV A;  2XSH A;  4QUR A;  2G3A A;  3AE5 C;  2E75 C;  2IBZ E;  4Z1M H;  1PPJ E;  2HMM A;  4I7Z C;  1VF5 B;  2YIU C;  3GL2 A;  1NDO A;  4TT3 H;  4NBA D;  3GTE A;  1WQL A;  3GZY A;  2Q3W A;  1OW8 A;  4R4L A;  2YFJ A;  1O7N A;  2E4P A;  2FYU E;  4PV1 D;  1O7G A;  3D6Y A;  3AE7 C;  1NU1 E;  3D71 A;  3DQY A;  2HMJ A;  3BCC E;  2NVE A;  4H13 B;  5KLI C;  3GZX A;  5BOK A;  4NBG D;  1YQ3 C;  4OGQ D;  2JZA A;  2YMK A;  4NBH D;  1NTK E;  1O7P A;  3L71 E;  3Q3D A;  4AAY B;  1JM1 A;  4HM0 A;  3VCA A;  1JB0 J;  3C0D A;  4IL6 X;  1EXI A;  1VF5 D;  1NYH A;  4PV1 C;  1BE3 E;  3L72 E;  1SQV E;  3VMG D;  2HMN A;  1SQQ E;  4QCK A;  2QJP C;  2QJK C;  1YQ4 C;  4HM1 A;  4HM7 A;  1KQG B;  3CXH E;  2JO1 A;  2GBX A;  1UUV A;  3H1H E;  1KYO E;  1G8J B;  2P10 A;  4OGQ C;  2NUM A;  1UUW A;  2O01 J;  3GOB A;  2FYN C;  4HKV A;  3GKE A;  4NB8 D;  3GMA A;  4H13 D;  1PP9 E;  3GL0 A;  2QSI A;  3VMH D;  2FXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...