1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
molecule keywords Cytochrome b
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
4QUQA 2YIUC 3AZCA 2QSIA 1NDOA 2HMOA 2CKFA 1ZRTE 2QJPC 3FOUA 4NBED 3VCPA 1VCKA 1EG9A 4RKUJ 1ULJA 4I7ZB 4HM2A 3L74E 1SQXE 2HMNA 5CXMA 3BCCE 4QURA 1O7NA 1VM9A 4P1CH 4EMJB 3L72E 1Q90C 4PD4E 1SQPE 1PP9E 3N0QA 3EN1A 2XRXA 2FYNC 4H44B 2B1XA 4QCKA 3VCAA 3H1JE 1BE3E 2NVFA 2K9YA 2E4PA 1PPJE 2BMQA 3DQYA 3H1HE 5AEWA 1JM1A 1JB0J 1KYOE 1G8KB 4HM3A 5KLVE 3GTEA 2YVJB 2BCCE 4NB9D 4HKVA 2JO6A 2XSOA 1O7MA 4QDFB 2E76D 4NBCD 3VMGD 3EQQA 4PV1D 2WSFJ 5HL4A 2E75B 1UUVA 2D2CB 1SQVE 1UUWA 2DE5D 3GZXA 1O7GA 3L75E 4HM4A 5AEUA 4P1BH 2IBZE 2QJKC 1NTZE 4OGQD 1SJGA 2WSCJ 4H0LB 3GKEA 1VF5D 4H13D 2Q3WA 4HM6A 2DE7D 3LW5J 1L0NE 3CXHE 3VMHD 1BCCE 2QIWA 1NU1E 4IL6X 3C8VA 4HM1A 2D2CD 3D89A 5L8RJ 2E75D 2BMOA 2QPZA 3L73E 1L0LE 2HMJA 3C0DA 2JZAA 1O7PA 5KKZC 3L70E 2E76B 4KT0J 1EZVE 2NUKA 4NBBD 4HM5A 2E74B 1KB9E 2GBWA 4NB8D 4HM8A 4NBGD 5KLIC 4NBAD 4QDCA 5BOKA 3CX5E 4AIVA 4Y28J 3GB4A 2O01J 2B24A 1VF5B 2HMLA 2YFLA 1Q90D 4AAYB 1P84E 2DE6D 2QJYC 3GOBA 2E4QA 4QUPA 1S5LX 1WQLA 2ZT9B 2HMMA 2YFJA 2ZT9D 1NYKA 2XSHA 3GCEA 2YFIA 2XR8A 3GL0A 1RFSA 4PV1B 2NUMA 4NBHD 3VMID 4H13B 4H0LD 3L71E 3H1IE 4NBDD 1RIEA 4NBFD 1FQTA 1NTME 2HMKA 2ZYLA 1NTKE 3GZYA 2E74D 3GTSA 4HM0A 2WSEJ 4U3FE 3GL2A 2I7FA 2FYUE 1SQQE 3H1LE 1O7HA 2NVEA 4HM7A 4QDDA 4H44D 1SQBE 2GBXA 1ULIA 1O7WA 2NVGA 2NWFA 2BMRA 3TGUE 2WPVB 3CWBE 4OGQB 4QDFA 2A06E 1G8JB 3H1KE 4HJLA
chains in the Genus database with same CATH superfamily
1LWUA 1EZVI 1KILA 1SLQA 3D70A 1KV4A 2NPSD 2VRSA 2Z4EA 3KZIH 1NU1G 3BCCE 4QMAA 1RQUA 2YKOA 2QVAA 1JNMA 3P8CD 2KS1A 1EDLA 1S5LH 3VOPA 2RH0A 5DJUB 1X9VA 1BDCA 1YTZT 4BXLA 1Q7YQ 1KC8Q 4K35A 1USDA 3FGAD 1L0NE 1OX3A 2QIWA 1LTJA 3C8VA 3D89A 2E75D 3P32A 1O7PA 3OJAB 1EZVE 1J1DB 2BCCJ 4C7NB 4NBGD 1T3JA 2HMLA 1Y9BA 4ZMDA 1H89A 2P58A 3EFGA 2ZT9D 2YFJA 5KAIH 3RL0B 3AE6C 3H32A 3PLNA 4H0LD 1QL2A 4NPFX 3RK3C 1NTME 2HMKA 3H1HD 1LWUC 2XKMA 4HM0A 3D6ZA 1CI6A 3B4SA 1SQQE 2HLOA 2QE7H 3IR9A 2FYZA 3RK3E 3GHGB 2KXPB 3BCCD 3AE2C 4HJLA 2WPQA 2H7HA 4I2LC 2CKFA 3A0BE 2D2CC 3VCPA 1VQNP 2PRRA 1S9KE 1VDFA 1NHLA 2JR8A 3HE4A 1PZQA 1LTSC 1EDJA 1L0ND 3HE5B 2E4PA 3H1HE 3L36A 5KLIB 3HD7A 2G8YA 2Q3IA 1CW5A 4NB9D 1UUWA 5AEUA 2QG4A 2WVRA 1D7MA 5B5EH 1VF5D 2E5TA 3L37A 3K5BA 2QJKB 4RO0A 1BE3D 3AECC 4HM1A 2QPZA 2GA1A 3EFFK 1JTHB 3AEFC 3JSVC 1NTMK 2JWAA 3S1KA 1QGKB 4LLHA 2KIKA 2WTYA 2DE6D 4L75A 3PRJA 3GCEA 3GL0A 3H1LG 2XU6A 4H13B 2KI7B 5CJ4A 3RK3D 1LTJB 3GZYA 3CXHD 5CBOA 1S9KD 2WSEJ 2R32A 2R5DA 1JY2N 2HYNA 2FFDA 2B88A 1HH0A 3E1IA 2L91A 2XNXA 3CWBE 3BRTB 4WVZA 1PFIA 4MN4C 5AVRB 1JY3N 2FYUG 1ZRTE 1N7SA 3L74E 2ZXEB 4PV1C 4JPZB 1P84H 2B87A 2QJYB 1OW6A 1SQPG 2A06D 1BE3E 5CCGC 1DEBA 1NTZD 4GIFA 1KILB 3F89A 2N9BA 2WT7A 2YO2A 4LGDE 2W83C 2E76D 2OARA 3L71J 2H88C 3BCCJ 4P1BH 3CWBD 2G3AA 1CSBA 2SPZA 1ZMEC 1PGPA 2I1JA 5AVUB 4N3YB 2D2CD 2PP6A 3H1HJ 3G6EP 2M0BA 2UWJE 2IPPA 3C0DA 2GUSA 2YNYA 3M0DA 4EI2A 5APTA 1GTWA 2N1TC 2GBWA 3OW2O 2Z5IA 4AIVA 3KQGA 4GKGA 1QLED 2B24A 1KN7A 3C9IA 1BCCJ 3U59A 4ZNCA 1WQLA 2HMMA 3V4WA 1U7JA 4NBHD 3VMID 1Q81Q 5CJ0A 1SQBG 2P67A 2FXMA 3CCVP 2BEQD 3MGNA 1LJ2A 1S5LE 1GL2D 1AQ5A 1O7WA 3H1ID 5E79E 2HPCA 2A06E 1L0LD 1NTMJ 2W6AA 1KB9I 1FJKA 3A5TA 4YPCA 2M5AA 3MZWB 3L75D 4D6TE 2POHA 1NGMB 1M8OB 2E43A 4IOIH 5CCGA 2Y9YA 4PD4E 1PP9G 1JY3P 1YYCA 2B1XA 2BASA 1KB9D 2HG5D 2AEFA 3JCUE 4DT0A 2IBZI 1AVOA 4I7ZC 1EDIA 1GL2B 1LP1A 3CCUP 5GTHH 1KILD 1O7MA 2LKMA 3V2QA 2NRGA 3B5ND 3SWYA 2M3BA 1PL5A 3L71D 5KTBA 5CMZA 1CZQA 1L4AA 3HUSC 2BCCD 3L74G 4DZOA 3L71G 1VQ8P 3H1JG 2JZAA 3CX5I 1SQXD 3HRNA 3CMAP 4IFFA 2HODB 4HH2A 1T2KC 3CCLP 2YO3A 2JKVA 1KFNA 5APUA 2M8RA 3A7OA 2E4QA 1S5LX 2LXCB 4L73A 4NPEA 1NYKA 1XTGB 1RFSA 1PP9D 1FQTA 1PPJD 2ZYLA 3I56P 2E74D 3MUDC 1J2JB 5BU5A 1T3UA 1T2KD 1KTMA 2FYUE 3CX5H 1YTZI 2P2UA 3PH0A 3GHGC 1BGYE 2LXBA 1RH5B 5GTHE 2IBZD 2WPRA 3CWBG 2J58A 1NTZJ 2H89C 1SFCD 3H1IJ 1KMIZ 1VQLP 5KJ7A 3IN6A 2QJPC 2AXCA 1OFCX 3RK3B 1JMBA 1NTZG 4PD4I 2Q3EA 1KILC 3BCCG 1O7NA 3CCSP 1GDTA 2KSJA 5KAFE 2YXRB 1PP9J 1SS1A 2IBZG 3W67A 3H1JE 1FZFA 1NAFA 1FC2C 2K9YA 1PPJE 2O1JA 4WB4A 2YMKA 1KFMA 2XSOA 1PPJG 3Q5PA 2DE5D 1G2CB 2FXPA 2IBZE 2C9LY 4JYBA 4OGQD 1RE4C 4H13D 4Z1MH 5AVZB 2QA4P 1KB9H 2OYOA 2Y0DA 5CCHD 5B66H 5L8RJ 4OVNF 3G4SP 3M9HA 3HD7D 1AV1A 1XTCC 2RKLA 2IFMA 1LTJC 1SQBJ 1MV8A 2R3CA 5AW7B 4I6MC 3L74D 5AVYB 2NUMA 2O3JA 4IL6E 3TDKA 4K3AA 4OWFA 1RF0C 4WY4D 3AE1C 3LW5H 5AVTB 2I7FA 2OTKE 5CHXA 4HYTB 2NVEA 1MKMA 4NPDA 1NKNA 1FOSF 3JC22 2NVGA 2BMRA 1JY2O 1LNQA 3QH9A 3GG2A 4QUQA 1KQFB 5BU8B 3MD0A 2E75C 3L73D 5APVA 1URQD 5APYA 2QM7A 1HWTC 4HM2A 3CC7P 1RY3A 1IC2A 1WT6A 1L0NG 2JO1A 4P1CH 1NTKD 2CPSA 3H1IG 3VMYA 5CCGD 4KHXA 3MUDA 2N1TA 1WMKA 3A0BH 3E7KA 4UB6H 2JO6A 1ZR2A 4XFJA 5HL4A 1FZEA 1IFIA 4C7RA 3AEDC 2KNCA 2M5AB 4H0LC 1KYOD 1ZXGA 2IFNA 1ZP0C 5DJTB 1NU1E 3M91A 2BMOA 1L0LE 2P1JA 3RGUA 5AW9B 1KILE 2JDIH 3NTNA 1KB9E 1DD3A 2BEZF 1FZGA 3H1LJ 2ZYDA 4D6TJ 1KYOH 3B5NA 5CCHC 1HBWA 3VN0A 2A45G 2P10A 4PD4D 3PHLA 2E42A 1RIEA 4D6TG 1J1EC 1DD4A 2QEXP 4LC1A 3CD6P 3U1CA 1G1JA 1TU3F 1BDDA 1L4AD 1SQVG 1T6AA 1KQSO 3P8MC 3CWBJ 2ZVNB 5KLVG 2KLVA 1GK6A 4OH8B 1W2EA 1EG9A 2K9JA 2I1KA 3L70D 1DX7A 1SQXE 2WSFH 4EMJB 1BSNA 3SFEC 1FAVA 4H44C 1IK9A 1HGZA 4H44B 1EZVD 3H1KD 1JM1A 1S1CX 1NVOA 3CX5D 1OW8A 1NO4A 2Q7CA 1EXJA 2WSFJ 2Z5HA 5GTIE 4BWNA 2HR3A 1GW3A 4HM6A 1ZOYC 1VQPP 1N7SB 1SQVK 2RMZA 3CCQP 4IL6X 1JOCA 2ZFCA 1NTMD 4Y99B 1BE3J 3AEBC 1J1EB 2ZVOB 2B89A 3H32B 1BE3G 1YHQP 4AUWA 3EWKA 3L35A 4PV1B 1L2PA 3WUTA 1BCCD 2L5GB 3GL2A 3H1LE 1O7HA 1HJBA 1VQ6P 4UB8E 1G2CA 1LP1B 1L0NJ 1PGOA 2NWFA 3TGUE 3BRVB 3RL0D 2M3EA 2OYHC 3TGUJ 1JUNA 2YIUC 3I5CA 1DH3A 5M1BA 1VL2A 2HMOA 2J5UA 1H0TB 4RJTA 2GUVA 1N2DC 2K37A 4YXDC 2XZRA 4IFMA 3CC2P 3A0HE 1LTIC 3SWFA 1FZAA 1JY3O 1GK4A 2B9BA 2E74C 2BCCE 2OQQA 2XV5A 3EQQA 2ZXXA 2NPSB 3H1HG 1UUVA 4HM4A 1A02F 1N7SD 3LIEA 2QJKC 1FU1A 3B5NC 5CCHA 4C7NA 3CXHE 1L0NK 2XNDH 1M1KQ 3WU2E 2Y0EA 4U3FG 3P7KA 1OVRA 3GMAA 2NUKA 4HM5A 2N1TD 4JYCA 3SWKA 4NB8D 4HM8A 1Z56A 3GW6A 1M1JC 3VP9A 1SVFA 5K5GB 3RK2C 1FS0E 2YFIA 3VTPC 1SQQG 2Q1KA 1SQPK 4IL6H 5APXA 4NBFD 2A45I 3CC4P 1PGQA 1LT9C 5KLVJ 2E76C 4U3FE 2C0XA 2MKVA 5AVXB 3VP8A 1FZCA 3R2PA 1NU1J 1GMJA 1FDIA 1USEA 2CPBA 3RBXA 3WUUA 3BASA 1RF1C 1JCCA 1OZHA 4NBED 1LWUB 4TT3H 1YIJP 3MIWA 2FFDC 3RL0C 4UB6E 2KUBA 1KYOI 1M56D 1H8AA 4A7PA 4GOFA 1MZ9A 4BRYA 3VCAA 2JJLA 1VQ5P 2ZYAA 4JQ0D 3MP7B 2JEEA 1RF0A 2LR2A 2WITA 5TISH 1SQPJ 4Y99C 3PTZA 4PV1D 2QJPB 4UB8H 1EQ7A 1ZV8A 1R8EA 2PAJA 1SQQD 3GKEA 4TLFA 5BVZA 1SQBK 1BGYG 4ASWA 3AE3C 2O01N 4M3LA 2W27A 1YITP 4D6TD 1OWAA 1GU5A 3TNUA 4NBBD 4NBAD 1K9MQ 5BOKA 3CX5E 3GB4A 2WWWA 3VMAA 1Q90D 1IJDB 1UIXA 4AAYB 3KYQA 3GOBA 1K04A 1AFOA 3TGUG 1VF5C 1N73C 1OVUA 3L75J 1DEEG 4HJGH 3S9OA 3FWLA 3FXDA 4R4MA 3IF4A 2WZ7A 4H44D 4ZKUA 1WRGA 3HUSB 5KLVD 3BVHA 2YKPA 4QDFA 1VQ9P 1JY2P 3B5NB 1NDOA 3P8CE 4W7YA 2WSSH 1GW4A 1EXIA 4RKUJ 1H0TA 2B87B 1VM9A 1GU4A 2Y0CA 1IFDA 1PP9E 3WUVA 2FYNB 2FYNC 1JO5A 2NZ2A 3V5BA 3L73J 3Q5SA 5AEWA 2P7JA 2AEJA 2R5BA 1KYOE 3M0AA 5KKZB 4PD4H 4QDFB 2OYIC 1IFJA 2HFED 2K88A 1NTZE 1SJGA 2OYHB 3TSIA 2OYIB 1P84D 3O8ZA 4PJ0H 3HTKB 4L74A 1E5WA 2O1KA 4L76A 5AW4B 1SQXG 2R3SA 5KKZC 1SQQK 2KSEA 3MHVA 3CCRP 3L72J 2RN0A 2KS1B 2Y9ZA 1OXZA 3H1JJ 1JCDA 1E79H 1KQLA 3TNUB 1X0TA 5AW8B 3H1KJ 5B5EE 5AVWB 1L0LK 3FXEA 3CPWO 1RE3C 1NH4A 3H1KG 2KB7P 1EZVG 2KNCB 3O6QA 3B71A 2R44A 3KDPB 1PGJA 3L70G 1VCKA 1HVVA 1OIPA 2IYOA 3KPEA 4QURA 1L0LG 3L72E 1YJ9P 1SQPE 5AW5B 3CXHH 4WY4C 1QX8A 1W5CE 3IFMA 2ZAEB 1SQBD 1AVYA 1KQGB 1KORA 3L74J 4DJGA 4WWIA 1FE6A 4N78D 3Q2YA 1YJNP 5KAIE 1N73A 3F5HA 4WY4A 3L73E 4N6JA 2V7QH 2ZYGA 3PJSK 4WY4B 1URQB 1LTBC 3U1AA 2W6BA 4H13C 1SFCA 5KJ7D 2ZJSE 3CI9A 3RK2B 1SFCC 4EIJA 1Y8AA 1YQ3C 2WMMA 1ZRTD 4AQRD 1KD1Q 4EOTA 1NTKE 1OMIA 2DW3A 1RF1B 3HD7B 4N78E 3RK2D 1GD2E 1ULIA 1SQPD 3G9RA 1EDKA 4PJ0E 1S2EA 2IX7C 3RBZA 3CL3D 5H2FH 2NPSC 3FOUA 1LT9B 3L4FA 3L73G 1ULJA 3M9QA 3N7NA 2IDBA 3GF3A 3V2RA 3EN1A 4QCKA 2NVFA 3L75G 2WSCH 3OA7A 1FDOA 2IYPA 5GTIH 4HKVA 3W68A 2D2CB 3GZXA 1FBMA 3H1JD 3HE4B 1SQXJ 2YIUB 1IFPA 1R5LA 1IZNB 3M0DC 2PFXA 3KZIE 3AEAC 1M90Q 4AYCA 4DOJA 2HMJA 1MFTA 1GL2C 3L70E 3Q1MA 1A02J 3CXHI 2E74B 3A2AA 1JEKA 1SQQJ 4Y28J 1M7LA 1IO4A 1LTGC 1SFCB 3CLQA 2FKWB 3II6A 1URQA 1KZUB 4NBDD 3GTSA 3L70J 2K9JB 5AW0B 1LT1A 1CI6B 3V4QA 3ITKA 1N7SC 3NFQA 4O9BA 3C1LA 2CK3H 3B8EB 2C0WA 2QSIA 1OVVA 1Q86Q 2YXQB 1JM0A 1R5SA 4B86A 1N73B 1PIXA 1RF1A 4HB1A 5KJ7C 4HKZH 1AQTA 5AW1B 3GF7A 1Q2NA 3NXSA 3V2NA 3A3YB 2BMQA 4JF7A 5B66E 3GHGA 1MUUA 1ZW0A 1EC5A 4YXWH 4HM3A 2FYUD 1FZBA 5AW3B 2KOGA 1LT9A 1RQVA 3WU2H 3I55P 1BSHA 3LIDA 1NYHA 1BCCE 1QL1A 3TF5A 1Y47A 1UIIA 1FDMA 1FZCC 2E5YA 1G1IA 2WPSA 1K73Q 1T8ZA 2KYVA 2BCCG 1RE4A 2QJYC 4GT1A 2A06G 4IFDK 4EYYQ 2XR8A 3AEGC 3CCMP 2FY8A 2QM8A 3MTUE 1HJ0A 1NJIQ 4KJMA 5H2FE 1NAYA 3HTKA 1K8AQ 5AVSB 4HM7A 1SQBE 2OYHA 3H6PA 1N7LA 4YTPC 3AEEC 2MJZA 1G8JB 1QEXA 3HE5A 3AE7C 5TISE 3R4YA 4I7ZB 1LTTC 4JBZA 2NPSA 2KP8A 5CXMA 3E1RA 2C9NY 2PGDA 3S4RA 3N0QA 2XRXA 2H43A 4I1LA 3DQYA 1L0LJ 1VPCA 3V6IA 4ASVA 1G8KB 4CPGA 1P84I 2AXTH 3GTEA 1IFNA 1FJPA 3VMGD 3RL0g 2E75B 3L75E 3M06A 1NOHA 1O7GA 5AW2B 1HTLC 2Q6QA 1NTZK 4H0LB 4W7ZA 2WSEH 3KHUA 3LW5J 4GODA 3VMHD 2W8ZA 2KK7A 3KXDA 5KAFH 1GL2A 3Q5RA 2OGUA 5KLIC 2GM4A 1U7MA 4XE5B 3TK1A 2I8DA 2O01J 1VF5B 3ZDMA 1P84E 1IFMA 2JWDA 2FBWC 2ZT9C 2XSHA 3D71A 1LGHB 1M1JA 3L71E 3G3ZA 3AE8C 5E79H 3T97A 1S3JA 2W90A 2O01H 3FX0A 2N9YB 2WT7B 2GBXA 1JMMA 2OYIA 2AXTE 2K3RA 3QWOC 3USSA 1L4AC 1N8RQ 1NTKJ 1NKZB 2V7QJ 2KLUA 3AZCA 3HD7C 1MFZA 1Q82Q 3M9BA 2IZ1A 2WQYC 3SFDC 1DIPA 4BRYB 1SQVJ 3JCUH 3N4XA 2J59M 1Q90C 2KZJA 3GLMA 3TGUD 3OAKA 1NU1D 4GDOA 1URQC 1AJYA 2HPCB 1BCCG 2FFDB 4U3FJ 5KLVE 1YJWP 2YVJB 1VQOP 2IZ0A 1S72P 1ZLLA 3VYIA 2OTLP 1SQVE 3CCEP 3H1LD 3L72G 1YBKA 2DE7D 1BGYD 1L4AB 2V4HA 1FOSE 1QVFO 1HGVA 2E76B 4KT0J 1X22A 1W2BO 5C39A 1NTMG 3NMDA 2FXOA 2Q9IA 3VMZA 2QRXA 2YFLA 2ZT9B 3BATA 2K1AA 1ZR4A 5APQA 2XDJA 4XA4A 3VMXA 3H1IE 1M1JB 3A0HH 1M57D 5AVVB 5EFWB 5CBNA 1QVGO 2FYUJ 3AE4C 4OGQC 1K05A 1RE3A 2WPVB 1VQMP 1NU1K 3H1KE 2YKQA 4U7JA 1HUCA 5AW6B 2YMYA 4WBAA 3Q3DA 3AE5C 1IK7A 4ZKPA 1VQ4P 5KLVK 1ZN5A 3TYYA 2ITAA 3PP5A 3H25A 2KZIA 3IAOA 2JP3A 1VQKP 1NTKK 2HMNA 2AEMA 2W6JH 1H88A 4EDFA 1RHZB 2H8PD 1VQ7P 1SQVD 1JTHA 1SQXK 1N86A 1JB0J 1S4XA 5APSA 4NBCD 1NWQA 5APWA 2HODA 4RESB 4U3FD 3T97B 2WSCJ 4W80A 2Q3WA 2Q5UA 3CMEP 1PV3A 3V2PA 2FYUK 4C46A 3WMM0 1LTAC 1GZLA 1SP4A 1X8YA 3O6QB 4GOEA 3EQ2A 4QDCA 5AVQB 3G71P 2A45H 4QUPA 3FWNA 3ABVC 3SSUA 3AE9C 3HUSA 1FZCB 1X79B 3CCJP 2OTJP 2N1TB 1U57A 1J1DC 3UIAA 3D6YA 1BGYJ 4QDDA 4R4LA 1HF9A 1OW7A 3L72D 1YQ4C 4DCKA 5TJHA 1NTKG 4OGQB 1YI2P 1AA0A
chains in the Genus database with same CATH topology
2QSIA 1KMIZ 3D70A 3IN6A 2QJPC 4NBED 4TT3H 1PIXA 3BCCE 1O7NA 3GF7A 1RQUA 3VCAA 3H1JE 2K9YA 1PPJE 2BMQA 4HM3A 2YMKA 2XSOA 4PV1D 3Q5PA 2DE5D 1RQVA 2FXPA 2IBZE 1R8EA 4OGQD 3GKEA 4H13D 4Z1MH 3FGAD 1L0NE 1NYHA 1BCCE 2QIWA 3C8VA 3D89A 5L8RJ 2E75D 3AE3C 1O7PA 1EZVE 4NBBD 4NBGD 4NBAD 5BOKA 3CX5E 3GB4A 2HMLA 1Y9BA 4AAYB 1Q90D 1UIXA 2QJYC 3GOBA 1K04A 2YFJA 2ZT9D 2XR8A 3AEGC 3AE6C 2NUMA 1VF5C 1HJ0A 4H0LD 1NTME 2HMKA 3S9OA 3AE1C 4HM0A 3D6ZA 2I7FA 4R4MA 1SQQE 2NVEA 1MKMA 4HM7A 4H44D 1SQBE 2NVGA 2BMRA 4YTPC 3RK3E 3AEEC 4QDFA 1G8JB 3AE2C 4HJLA 4QUQA 1KQFB 1NDOA 3AE7C 2CKFA 2D2CC 2E75C 3VCPA 3R4YA 4RKUJ 1EXIA 4I7ZB 4HM2A 5CXMA 1VM9A 2JO1A 4P1CH 1PP9E 3N0QA 2XRXA 2FYNC 2NZ2A 2E4PA 3DQYA 3Q5SA 3H1HE 5AEWA 2G8YA 1KYOE 1WMKA 1G8KB 3GTEA 4NB9D 2JO6A 4QDFB 4XFJA 3VMGD 3RL0g 5HL4A 2E75B 3L75E 1UUWA 1O7GA 5AEUA 3AEDC 1NTZE 1SJGA 4H0LB 1VF5D 4H0LC 3LW5J 1ZP0C 3VMHD 1NU1E 3AECC 4HM1A 2QPZA 2BMOA 1L0LE 3Q5RA 5KKZC 1KILE 1KB9E 1DD3A 3AEFC 5KLIC 2BEZF 2O01J 1VF5B 1P84E 2DE6D 2FBWC 2ZT9C 2P10A 2XSHA 3GCEA 3D71A 3GL0A 4H13B 3L71E 1RIEA 3AE8C 1DD4A 3GZYA 2WSEJ 1TU3F 2GBXA 3CWBE 3O6QA 3B71A 2V7QJ 3AZCA 2WQYC 1ZRTE 1VCKA 3SFDC 1EG9A 3L74E 4PV1C 1SQXE 1DIPA 4QURA 4EMJB 3L72E 1Q90C 3GLMA 1SQPE 1OW6A 3SFEC 4H44C 4H44B 1BE3E 4GDOA 1JM1A 1AJYA 1S1CX 1OW8A 5KLVE 2YVJB 2E76D 1EXJA 2WSFJ 1KQGB 2H88C 1SQVE 1KORA 4P1BH 2G3AA 1ZMEC 3Q2YA 4HM6A 1ZOYC 2DE7D 4IL6X 2D2CD 3L73E 3C0DA 2E76B 4KT0J 3AEBC 2GBWA 4AIVA 4H13C 2B24A 2YFLA 1WQLA 2ZT9B 2HMMA 3EWKA 4PV1B 4NBHD 3VMID 3H1IE 1YQ3C 2BEQD 1NTKE 1OMIA 3GL2A 3H1LE 1O7HA 3AE4C 4OGQC 1ULIA 1O7WA 1K05A 2NWFA 3TGUE 2WPVB 2A06E 3G9RA 3H1KE 2YIUC 4U7JA 5M1BA 1VL2A 3Q3DA 3AE5C 1IK7A 2HMOA 2J5UA 3FOUA 1ULJA 3H25A 3IAOA 2JP3A 1NGMB 2HMNA 4YXDC 2IDBA 4PD4E 3GF3A 3EN1A 2B1XA 4QCKA 2NVFA 1FDOA 1JB0J 2E74C 4I7ZC 2BCCE 4HKVA 1O7MA 2OQQA 4NBCD 3EQQA 1UUVA 2D2CB 3GZXA 4HM4A 2QJKC 3T97B 1PL5A 2WSCJ 2Q3WA 3CXHE 1PV3A 3AEAC 2HMJA 2JZAA 3L70E 3Q1MA 3GMAA 2NUKA 4HM5A 2E74B 4NB8D 4HM8A 4QDCA 4Y28J 4QUPA 2E4QA 1S5LX 1NYKA 3ABVC 2YFIA 1RFSA 4NBDD 3AE9C 4NBFD 1FQTA 2ZYLA 2E74D 3GTSA 1U57A 2E76C 4U3FE 3D6YA 1KTMA 2FYUE 2MKVA 4QDDA 4R4LA 1HF9A 1GMJA 1OW7A 1FDIA 1YQ4C 4OGQB 2H89C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUQ A;  2YIU C;  3AZC A;  2QSI A;  1NDO A;  2HMO A;  2CKF A;  1ZRT E;  2QJP C;  3FOU A;  4NBE D;  3VCP A;  1VCK A;  1EG9 A;  4RKU J;  1ULJ A;  4I7Z B;  4HM2 A;  3L74 E;  1SQX E;  2HMN A;  5CXM A;  3BCC E;  4QUR A;  1O7N A;  1VM9 A;  4P1C H;  4EMJ B;  3L72 E;  1Q90 C;  4PD4 E;  1SQP E;  1PP9 E;  3N0Q A;  3EN1 A;  2XRX A;  2FYN C;  4H44 B;  2B1X A;  4QCK A;  3VCA A;  3H1J E;  1BE3 E;  2NVF A;  2K9Y A;  2E4P A;  1PPJ E;  2BMQ A;  3DQY A;  3H1H E;  5AEW A;  1JM1 A;  1JB0 J;  1KYO E;  1G8K B;  4HM3 A;  5KLV E;  3GTE A;  2YVJ B;  2BCC E;  4NB9 D;  4HKV A;  2JO6 A;  2XSO A;  1O7M A;  4QDF B;  2E76 D;  4NBC D;  3VMG D;  3EQQ A;  4PV1 D;  2WSF J;  5HL4 A;  2E75 B;  1UUV A;  2D2C B;  1SQV E;  1UUW A;  2DE5 D;  3GZX A;  1O7G A;  3L75 E;  4HM4 A;  5AEU A;  4P1B H;  2IBZ E;  2QJK C;  1NTZ E;  4OGQ D;  1SJG A;  2WSC J;  4H0L B;  3GKE A;  1VF5 D;  4H13 D;  2Q3W A;  4HM6 A;  2DE7 D;  3LW5 J;  1L0N E;  3CXH E;  3VMH D;  1BCC E;  2QIW A;  1NU1 E;  4IL6 X;  3C8V A;  4HM1 A;  2D2C D;  3D89 A;  5L8R J;  2E75 D;  2BMO A;  2QPZ A;  3L73 E;  1L0L E;  2HMJ A;  3C0D A;  2JZA A;  1O7P A;  5KKZ C;  3L70 E;  2E76 B;  4KT0 J;  1EZV E;  2NUK A;  4NBB D;  4HM5 A;  2E74 B;  1KB9 E;  2GBW A;  4NB8 D;  4HM8 A;  4NBG D;  5KLI C;  4NBA D;  4QDC A;  5BOK A;  3CX5 E;  4AIV A;  4Y28 J;  3GB4 A;  2O01 J;  2B24 A;  1VF5 B;  2HML A;  2YFL A;  1Q90 D;  4AAY B;  1P84 E;  2DE6 D;  2QJY C;  3GOB A;  2E4Q A;  4QUP A;  1S5L X;  1WQL A;  2ZT9 B;  2HMM A;  2YFJ A;  2ZT9 D;  1NYK A;  2XSH A;  3GCE A;  2YFI A;  2XR8 A;  3GL0 A;  1RFS A;  4PV1 B;  2NUM A;  4NBH D;  3VMI D;  4H13 B;  4H0L D;  3L71 E;  3H1I E;  4NBD D;  1RIE A;  4NBF D;  1FQT A;  1NTM E;  2HMK A;  2ZYL A;  1NTK E;  3GZY A;  2E74 D;  3GTS A;  4HM0 A;  2WSE J;  4U3F E;  3GL2 A;  2I7F A;  2FYU E;  1SQQ E;  3H1L E;  1O7H A;  2NVE A;  4HM7 A;  4QDD A;  4H44 D;  1SQB E;  2GBX A;  1ULI A;  1O7W A;  2NVG A;  2NWF A;  2BMR A;  3TGU E;  2WPV B;  3CWB E;  4OGQ B;  4QDF A;  2A06 E;  1G8J B;  3H1K E;  4HJL A; 
#chains in the Genus database with same CATH topology
 1LWU A;  1EZV I;  1KIL A;  1SLQ A;  3D70 A;  1KV4 A;  2NPS D;  2VRS A;  2Z4E A;  3KZI H;  1NU1 G;  3BCC E;  4QMA A;  1RQU A;  2YKO A;  2QVA A;  1JNM A;  3P8C D;  2KS1 A;  1EDL A;  1S5L H;  3VOP A;  2RH0 A;  5DJU B;  1X9V A;  1BDC A;  1YTZ T;  4BXL A;  1Q7Y Q;  1KC8 Q;  4K35 A;  1USD A;  3FGA D;  1L0N E;  1OX3 A;  2QIW A;  1LTJ A;  3C8V A;  3D89 A;  2E75 D;  3P32 A;  1O7P A;  3OJA B;  1EZV E;  1J1D B;  2BCC J;  4C7N B;  4NBG D;  1T3J A;  2HML A;  1Y9B A;  4ZMD A;  1H89 A;  2P58 A;  3EFG A;  2ZT9 D;  2YFJ A;  5KAI H;  3RL0 B;  3AE6 C;  3H32 A;  3PLN A;  4H0L D;  1QL2 A;  4NPF X;  3RK3 C;  1NTM E;  2HMK A;  3H1H D;  1LWU C;  2XKM A;  4HM0 A;  3D6Z A;  1CI6 A;  3B4S A;  1SQQ E;  2HLO A;  2QE7 H;  3IR9 A;  2FYZ A;  3RK3 E;  3GHG B;  2KXP B;  3BCC D;  3AE2 C;  4HJL A;  2WPQ A;  2H7H A;  4I2L C;  2CKF A;  3A0B E;  2D2C C;  3VCP A;  1VQN P;  2PRR A;  1S9K E;  1VDF A;  1NHL A;  2JR8 A;  3HE4 A;  1PZQ A;  1LTS C;  1EDJ A;  1L0N D;  3HE5 B;  2E4P A;  3H1H E;  3L36 A;  5KLI B;  3HD7 A;  2G8Y A;  2Q3I A;  1CW5 A;  4NB9 D;  1UUW A;  5AEU A;  2QG4 A;  2WVR A;  1D7M A;  5B5E H;  1VF5 D;  2E5T A;  3L37 A;  3K5B A;  2QJK B;  4RO0 A;  1BE3 D;  3AEC C;  4HM1 A;  2QPZ A;  2GA1 A;  3EFF K;  1JTH B;  3AEF C;  3JSV C;  1NTM K;  2JWA A;  3S1K A;  1QGK B;  4LLH A;  2KIK A;  2WTY A;  2DE6 D;  4L75 A;  3PRJ A;  3GCE A;  3GL0 A;  3H1L G;  2XU6 A;  4H13 B;  2KI7 B;  5CJ4 A;  3RK3 D;  1LTJ B;  3GZY A;  3CXH D;  5CBO A;  1S9K D;  2WSE J;  2R32 A;  2R5D A;  1JY2 N;  2HYN A;  2FFD A;  2B88 A;  1HH0 A;  3E1I A;  2L91 A;  2XNX A;  3CWB E;  3BRT B;  4WVZ A;  1PFI A;  4MN4 C;  5AVR B;  1JY3 N;  2FYU G;  1ZRT E;  1N7S A;  3L74 E;  2ZXE B;  4PV1 C;  4JPZ B;  1P84 H;  2B87 A;  2QJY B;  1OW6 A;  1SQP G;  2A06 D;  1BE3 E;  5CCG C;  1DEB A;  1NTZ D;  4GIF A;  1KIL B;  3F89 A;  2N9B A;  2WT7 A;  2YO2 A;  4LGD E;  2W83 C;  2E76 D;  2OAR A;  3L71 J;  2H88 C;  3BCC J;  4P1B H;  3CWB D;  2G3A A;  1CSB A;  2SPZ A;  1ZME C;  1PGP A;  2I1J A;  5AVU B;  4N3Y B;  2D2C D;  2PP6 A;  3H1H J;  3G6E P;  2M0B A;  2UWJ E;  2IPP A;  3C0D A;  2GUS A;  2YNY A;  3M0D A;  4EI2 A;  5APT A;  1GTW A;  2N1T C;  2GBW A;  3OW2 O;  2Z5I A;  4AIV A;  3KQG A;  4GKG A;  1QLE D;  2B24 A;  1KN7 A;  3C9I A;  1BCC J;  3U59 A;  4ZNC A;  1WQL A;  2HMM A;  3V4W A;  1U7J A;  4NBH D;  3VMI D;  1Q81 Q;  5CJ0 A;  1SQB G;  2P67 A;  2FXM A;  3CCV P;  2BEQ D;  3MGN A;  1LJ2 A;  1S5L E;  1GL2 D;  1AQ5 A;  1O7W A;  3H1I D;  5E79 E;  2HPC A;  2A06 E;  1L0L D;  1NTM J;  2W6A A;  1KB9 I;  1FJK A;  3A5T A;  4YPC A;  2M5A A;  3MZW B;  3L75 D;  4D6T E;  2POH A;  1NGM B;  1M8O B;  2E43 A;  4IOI H;  5CCG A;  2Y9Y A;  4PD4 E;  1PP9 G;  1JY3 P;  1YYC A;  2B1X A;  2BAS A;  1KB9 D;  2HG5 D;  2AEF A;  3JCU E;  4DT0 A;  2IBZ I;  1AVO A;  4I7Z C;  1EDI A;  1GL2 B;  1LP1 A;  3CCU P;  5GTH H;  1KIL D;  1O7M A;  2LKM A;  3V2Q A;  2NRG A;  3B5N D;  3SWY A;  2M3B A;  1PL5 A;  3L71 D;  5KTB A;  5CMZ A;  1CZQ A;  1L4A A;  3HUS C;  2BCC D;  3L74 G;  4DZO A;  3L71 G;  1VQ8 P;  3H1J G;  2JZA A;  3CX5 I;  1SQX D;  3HRN A;  3CMA P;  4IFF A;  2HOD B;  4HH2 A;  1T2K C;  3CCL P;  2YO3 A;  2JKV A;  1KFN A;  5APU A;  2M8R A;  3A7O A;  2E4Q A;  1S5L X;  2LXC B;  4L73 A;  4NPE A;  1NYK A;  1XTG B;  1RFS A;  1PP9 D;  1FQT A;  1PPJ D;  2ZYL A;  3I56 P;  2E74 D;  3MUD C;  1J2J B;  5BU5 A;  1T3U A;  1T2K D;  1KTM A;  2FYU E;  3CX5 H;  1YTZ I;  2P2U A;  3PH0 A;  3GHG C;  1BGY E;  2LXB A;  1RH5 B;  5GTH E;  2IBZ D;  2WPR A;  3CWB G;  2J58 A;  1NTZ J;  2H89 C;  1SFC D;  3H1I J;  1KMI Z;  1VQL P;  5KJ7 A;  3IN6 A;  2QJP C;  2AXC A;  1OFC X;  3RK3 B;  1JMB A;  1NTZ G;  4PD4 I;  2Q3E A;  1KIL C;  3BCC G;  1O7N A;  3CCS P;  1GDT A;  2KSJ A;  5KAF E;  2YXR B;  1PP9 J;  1SS1 A;  2IBZ G;  3W67 A;  3H1J E;  1FZF A;  1NAF A;  1FC2 C;  2K9Y A;  1PPJ E;  2O1J A;  4WB4 A;  2YMK A;  1KFM A;  2XSO A;  1PPJ G;  3Q5P A;  2DE5 D;  1G2C B;  2FXP A;  2IBZ E;  2C9L Y;  4JYB A;  4OGQ D;  1RE4 C;  4H13 D;  4Z1M H;  5AVZ B;  2QA4 P;  1KB9 H;  2OYO A;  2Y0D A;  5CCH D;  5B66 H;  5L8R J;  4OVN F;  3G4S P;  3M9H A;  3HD7 D;  1AV1 A;  1XTC C;  2RKL A;  2IFM A;  1LTJ C;  1SQB J;  1MV8 A;  2R3C A;  5AW7 B;  4I6M C;  3L74 D;  5AVY B;  2NUM A;  2O3J A;  4IL6 E;  3TDK A;  4K3A A;  4OWF A;  1RF0 C;  4WY4 D;  3AE1 C;  3LW5 H;  5AVT B;  2I7F A;  2OTK E;  5CHX A;  4HYT B;  2NVE A;  1MKM A;  4NPD A;  1NKN A;  1FOS F;  3JC2 2;  2NVG A;  2BMR A;  1JY2 O;  1LNQ A;  3QH9 A;  3GG2 A;  4QUQ A;  1KQF B;  5BU8 B;  3MD0 A;  2E75 C;  3L73 D;  5APV A;  1URQ D;  5APY A;  2QM7 A;  1HWT C;  4HM2 A;  3CC7 P;  1RY3 A;  1IC2 A;  1WT6 A;  1L0N G;  2JO1 A;  4P1C H;  1NTK D;  2CPS A;  3H1I G;  3VMY A;  5CCG D;  4KHX A;  3MUD A;  2N1T A;  1WMK A;  3A0B H;  3E7K A;  4UB6 H;  2JO6 A;  1ZR2 A;  4XFJ A;  5HL4 A;  1FZE A;  1IFI A;  4C7R A;  3AED C;  2KNC A;  2M5A B;  4H0L C;  1KYO D;  1ZXG A;  2IFN A;  1ZP0 C;  5DJT B;  1NU1 E;  3M91 A;  2BMO A;  1L0L E;  2P1J A;  3RGU A;  5AW9 B;  1KIL E;  2JDI H;  3NTN A;  1KB9 E;  1DD3 A;  2BEZ F;  1FZG A;  3H1L J;  2ZYD A;  4D6T J;  1KYO H;  3B5N A;  5CCH C;  1HBW A;  3VN0 A;  2A45 G;  2P10 A;  4PD4 D;  3PHL A;  2E42 A;  1RIE A;  4D6T G;  1J1E C;  1DD4 A;  2QEX P;  4LC1 A;  3CD6 P;  3U1C A;  1G1J A;  1TU3 F;  1BDD A;  1L4A D;  1SQV G;  1T6A A;  1KQS O;  3P8M C;  3CWB J;  2ZVN B;  5KLV G;  2KLV A;  1GK6 A;  4OH8 B;  1W2E A;  1EG9 A;  2K9J A;  2I1K A;  3L70 D;  1DX7 A;  1SQX E;  2WSF H;  4EMJ B;  1BSN A;  3SFE C;  1FAV A;  4H44 C;  1IK9 A;  1HGZ A;  4H44 B;  1EZV D;  3H1K D;  1JM1 A;  1S1C X;  1NVO A;  3CX5 D;  1OW8 A;  1NO4 A;  2Q7C A;  1EXJ A;  2WSF J;  2Z5H A;  5GTI E;  4BWN A;  2HR3 A;  1GW3 A;  4HM6 A;  1ZOY C;  1VQP P;  1N7S B;  1SQV K;  2RMZ A;  3CCQ P;  4IL6 X;  1JOC A;  2ZFC A;  1NTM D;  4Y99 B;  1BE3 J;  3AEB C;  1J1E B;  2ZVO B;  2B89 A;  3H32 B;  1BE3 G;  1YHQ P;  4AUW A;  3EWK A;  3L35 A;  4PV1 B;  1L2P A;  3WUT A;  1BCC D;  2L5G B;  3GL2 A;  3H1L E;  1O7H A;  1HJB A;  1VQ6 P;  4UB8 E;  1G2C A;  1LP1 B;  1L0N J;  1PGO A;  2NWF A;  3TGU E;  3BRV B;  3RL0 D;  2M3E A;  2OYH C;  3TGU J;  1JUN A;  2YIU C;  3I5C A;  1DH3 A;  5M1B A;  1VL2 A;  2HMO A;  2J5U A;  1H0T B;  4RJT A;  2GUV A;  1N2D C;  2K37 A;  4YXD C;  2XZR A;  4IFM A;  3CC2 P;  3A0H E;  1LTI C;  3SWF A;  1FZA A;  1JY3 O;  1GK4 A;  2B9B A;  2E74 C;  2BCC E;  2OQQ A;  2XV5 A;  3EQQ A;  2ZXX A;  2NPS B;  3H1H G;  1UUV A;  4HM4 A;  1A02 F;  1N7S D;  3LIE A;  2QJK C;  1FU1 A;  3B5N C;  5CCH A;  4C7N A;  3CXH E;  1L0N K;  2XND H;  1M1K Q;  3WU2 E;  2Y0E A;  4U3F G;  3P7K A;  1OVR A;  3GMA A;  2NUK A;  4HM5 A;  2N1T D;  4JYC A;  3SWK A;  4NB8 D;  4HM8 A;  1Z56 A;  3GW6 A;  1M1J C;  3VP9 A;  1SVF A;  5K5G B;  3RK2 C;  1FS0 E;  2YFI A;  3VTP C;  1SQQ G;  2Q1K A;  1SQP K;  4IL6 H;  5APX A;  4NBF D;  2A45 I;  3CC4 P;  1PGQ A;  1LT9 C;  5KLV J;  2E76 C;  4U3F E;  2C0X A;  2MKV A;  5AVX B;  3VP8 A;  1FZC A;  3R2P A;  1NU1 J;  1GMJ A;  1FDI A;  1USE A;  2CPB A;  3RBX A;  3WUU A;  3BAS A;  1RF1 C;  1JCC A;  1OZH A;  4NBE D;  1LWU B;  4TT3 H;  1YIJ P;  3MIW A;  2FFD C;  3RL0 C;  4UB6 E;  2KUB A;  1KYO I;  1M56 D;  1H8A A;  4A7P A;  4GOF A;  1MZ9 A;  4BRY A;  3VCA A;  2JJL A;  1VQ5 P;  2ZYA A;  4JQ0 D;  3MP7 B;  2JEE A;  1RF0 A;  2LR2 A;  2WIT A;  5TIS H;  1SQP J;  4Y99 C;  3PTZ A;  4PV1 D;  2QJP B;  4UB8 H;  1EQ7 A;  1ZV8 A;  1R8E A;  2PAJ A;  1SQQ D;  3GKE A;  4TLF A;  5BVZ A;  1SQB K;  1BGY G;  4ASW A;  3AE3 C;  2O01 N;  4M3L A;  2W27 A;  1YIT P;  4D6T D;  1OWA A;  1GU5 A;  3TNU A;  4NBB D;  4NBA D;  1K9M Q;  5BOK A;  3CX5 E;  3GB4 A;  2WWW A;  3VMA A;  1Q90 D;  1IJD B;  1UIX A;  4AAY B;  3KYQ A;  3GOB A;  1K04 A;  1AFO A;  3TGU G;  1VF5 C;  1N73 C;  1OVU A;  3L75 J;  1DEE G;  4HJG H;  3S9O A;  3FWL A;  3FXD A;  4R4M A;  3IF4 A;  2WZ7 A;  4H44 D;  4ZKU A;  1WRG A;  3HUS B;  5KLV D;  3BVH A;  2YKP A;  4QDF A;  1VQ9 P;  1JY2 P;  3B5N B;  1NDO A;  3P8C E;  4W7Y A;  2WSS H;  1GW4 A;  1EXI A;  4RKU J;  1H0T A;  2B87 B;  1VM9 A;  1GU4 A;  2Y0C A;  1IFD A;  1PP9 E;  3WUV A;  2FYN B;  2FYN C;  1JO5 A;  2NZ2 A;  3V5B A;  3L73 J;  3Q5S A;  5AEW A;  2P7J A;  2AEJ A;  2R5B A;  1KYO E;  3M0A A;  5KKZ B;  4PD4 H;  4QDF B;  2OYI C;  1IFJ A;  2HFE D;  2K88 A;  1NTZ E;  1SJG A;  2OYH B;  3TSI A;  2OYI B;  1P84 D;  3O8Z A;  4PJ0 H;  3HTK B;  4L74 A;  1E5W A;  2O1K A;  4L76 A;  5AW4 B;  1SQX G;  2R3S A;  5KKZ C;  1SQQ K;  2KSE A;  3MHV A;  3CCR P;  3L72 J;  2RN0 A;  2KS1 B;  2Y9Z A;  1OXZ A;  3H1J J;  1JCD A;  1E79 H;  1KQL A;  3TNU B;  1X0T A;  5AW8 B;  3H1K J;  5B5E E;  5AVW B;  1L0L K;  3FXE A;  3CPW O;  1RE3 C;  1NH4 A;  3H1K G;  2KB7 P;  1EZV G;  2KNC B;  3O6Q A;  3B71 A;  2R44 A;  3KDP B;  1PGJ A;  3L70 G;  1VCK A;  1HVV A;  1OIP A;  2IYO A;  3KPE A;  4QUR A;  1L0L G;  3L72 E;  1YJ9 P;  1SQP E;  5AW5 B;  3CXH H;  4WY4 C;  1QX8 A;  1W5C E;  3IFM A;  2ZAE B;  1SQB D;  1AVY A;  1KQG B;  1KOR A;  3L74 J;  4DJG A;  4WWI A;  1FE6 A;  4N78 D;  3Q2Y A;  1YJN P;  5KAI E;  1N73 A;  3F5H A;  4WY4 A;  3L73 E;  4N6J A;  2V7Q H;  2ZYG A;  3PJS K;  4WY4 B;  1URQ B;  1LTB C;  3U1A A;  2W6B A;  4H13 C;  1SFC A;  5KJ7 D;  2ZJS E;  3CI9 A;  3RK2 B;  1SFC C;  4EIJ A;  1Y8A A;  1YQ3 C;  2WMM A;  1ZRT D;  4AQR D;  1KD1 Q;  4EOT A;  1NTK E;  1OMI A;  2DW3 A;  1RF1 B;  3HD7 B;  4N78 E;  3RK2 D;  1GD2 E;  1ULI A;  1SQP D;  3G9R A;  1EDK A;  4PJ0 E;  1S2E A;  2IX7 C;  3RBZ A;  3CL3 D;  5H2F H;  2NPS C;  3FOU A;  1LT9 B;  3L4F A;  3L73 G;  1ULJ A;  3M9Q A;  3N7N A;  2IDB A;  3GF3 A;  3V2R A;  3EN1 A;  4QCK A;  2NVF A;  3L75 G;  2WSC H;  3OA7 A;  1FDO A;  2IYP A;  5GTI H;  4HKV A;  3W68 A;  2D2C B;  3GZX A;  1FBM A;  3H1J D;  3HE4 B;  1SQX J;  2YIU B;  1IFP A;  1R5L A;  1IZN B;  3M0D C;  2PFX A;  3KZI E;  3AEA C;  1M90 Q;  4AYC A;  4DOJ A;  2HMJ A;  1MFT A;  1GL2 C;  3L70 E;  3Q1M A;  1A02 J;  3CXH I;  2E74 B;  3A2A A;  1JEK A;  1SQQ J;  4Y28 J;  1M7L A;  1IO4 A;  1LTG C;  1SFC B;  3CLQ A;  2FKW B;  3II6 A;  1URQ A;  1KZU B;  4NBD D;  3GTS A;  3L70 J;  2K9J B;  5AW0 B;  1LT1 A;  1CI6 B;  3V4Q A;  3ITK A;  1N7S C;  3NFQ A;  4O9B A;  3C1L A;  2CK3 H;  3B8E B;  2C0W A;  2QSI A;  1OVV A;  1Q86 Q;  2YXQ B;  1JM0 A;  1R5S A;  4B86 A;  1N73 B;  1PIX A;  1RF1 A;  4HB1 A;  5KJ7 C;  4HKZ H;  1AQT A;  5AW1 B;  3GF7 A;  1Q2N A;  3NXS A;  3V2N A;  3A3Y B;  2BMQ A;  4JF7 A;  5B66 E;  3GHG A;  1MUU A;  1ZW0 A;  1EC5 A;  4YXW H;  4HM3 A;  2FYU D;  1FZB A;  5AW3 B;  2KOG A;  1LT9 A;  1RQV A;  3WU2 H;  3I55 P;  1BSH A;  3LID A;  1NYH A;  1BCC E;  1QL1 A;  3TF5 A;  1Y47 A;  1UII A;  1FDM A;  1FZC C;  2E5Y A;  1G1I A;  2WPS A;  1K73 Q;  1T8Z A;  2KYV A;  2BCC G;  1RE4 A;  2QJY C;  4GT1 A;  2A06 G;  4IFD K;  4EYY Q;  2XR8 A;  3AEG C;  3CCM P;  2FY8 A;  2QM8 A;  3MTU E;  1HJ0 A;  1NJI Q;  4KJM A;  5H2F E;  1NAY A;  3HTK A;  1K8A Q;  5AVS B;  4HM7 A;  1SQB E;  2OYH A;  3H6P A;  1N7L A;  4YTP C;  3AEE C;  2MJZ A;  1G8J B;  1QEX A;  3HE5 A;  3AE7 C;  5TIS E;  3R4Y A;  4I7Z B;  1LTT C;  4JBZ A;  2NPS A;  2KP8 A;  5CXM A;  3E1R A;  2C9N Y;  2PGD A;  3S4R A;  3N0Q A;  2XRX A;  2H43 A;  4I1L A;  3DQY A;  1L0L J;  1VPC A;  3V6I A;  4ASV A;  1G8K B;  4CPG A;  1P84 I;  2AXT H;  3GTE A;  1IFN A;  1FJP A;  3VMG D;  3RL0 g;  2E75 B;  3L75 E;  3M06 A;  1NOH A;  1O7G A;  5AW2 B;  1HTL C;  2Q6Q A;  1NTZ K;  4H0L B;  4W7Z A;  2WSE H;  3KHU A;  3LW5 J;  4GOD A;  3VMH D;  2W8Z A;  2KK7 A;  3KXD A;  5KAF H;  1GL2 A;  3Q5R A;  2OGU A;  5KLI C;  2GM4 A;  1U7M A;  4XE5 B;  3TK1 A;  2I8D A;  2O01 J;  1VF5 B;  3ZDM A;  1P84 E;  1IFM A;  2JWD A;  2FBW C;  2ZT9 C;  2XSH A;  3D71 A;  1LGH B;  1M1J A;  3L71 E;  3G3Z A;  3AE8 C;  5E79 H;  3T97 A;  1S3J A;  2W90 A;  2O01 H;  3FX0 A;  2N9Y B;  2WT7 B;  2GBX A;  1JMM A;  2OYI A;  2AXT E;  2K3R A;  3QWO C;  3USS A;  1L4A C;  1N8R Q;  1NTK J;  1NKZ B;  2V7Q J;  2KLU A;  3AZC A;  3HD7 C;  1MFZ A;  1Q82 Q;  3M9B A;  2IZ1 A;  2WQY C;  3SFD C;  1DIP A;  4BRY B;  1SQV J;  3JCU H;  3N4X A;  2J59 M;  1Q90 C;  2KZJ A;  3GLM A;  3TGU D;  3OAK A;  1NU1 D;  4GDO A;  1URQ C;  1AJY A;  2HPC B;  1BCC G;  2FFD B;  4U3F J;  5KLV E;  1YJW P;  2YVJ B;  1VQO P;  2IZ0 A;  1S72 P;  1ZLL A;  3VYI A;  2OTL P;  1SQV E;  3CCE P;  3H1L D;  3L72 G;  1YBK A;  2DE7 D;  1BGY D;  1L4A B;  2V4H A;  1FOS E;  1QVF O;  1HGV A;  2E76 B;  4KT0 J;  1X22 A;  1W2B O;  5C39 A;  1NTM G;  3NMD A;  2FXO A;  2Q9I A;  3VMZ A;  2QRX A;  2YFL A;  2ZT9 B;  3BAT A;  2K1A A;  1ZR4 A;  5APQ A;  2XDJ A;  4XA4 A;  3VMX A;  3H1I E;  1M1J B;  3A0H H;  1M57 D;  5AVV B;  5EFW B;  5CBN A;  1QVG O;  2FYU J;  3AE4 C;  4OGQ C;  1K05 A;  1RE3 A;  2WPV B;  1VQM P;  1NU1 K;  3H1K E;  2YKQ A;  4U7J A;  1HUC A;  5AW6 B;  2YMY A;  4WBA A;  3Q3D A;  3AE5 C;  1IK7 A;  4ZKP A;  1VQ4 P;  5KLV K;  1ZN5 A;  3TYY A;  2ITA A;  3PP5 A;  3H25 A;  2KZI A;  3IAO A;  2JP3 A;  1VQK P;  1NTK K;  2HMN A;  2AEM A;  2W6J H;  1H88 A;  4EDF A;  1RHZ B;  2H8P D;  1VQ7 P;  1SQV D;  1JTH A;  1SQX K;  1N86 A;  1JB0 J;  1S4X A;  5APS A;  4NBC D;  1NWQ A;  5APW A;  2HOD A;  4RES B;  4U3F D;  3T97 B;  2WSC J;  4W80 A;  2Q3W A;  2Q5U A;  3CME P;  1PV3 A;  3V2P A;  2FYU K;  4C46 A;  3WMM 0;  1LTA C;  1GZL A;  1SP4 A;  1X8Y A;  3O6Q B;  4GOE A;  3EQ2 A;  4QDC A;  5AVQ B;  3G71 P;  2A45 H;  4QUP A;  3FWN A;  3ABV C;  3SSU A;  3AE9 C;  3HUS A;  1FZC B;  1X79 B;  3CCJ P;  2OTJ P;  2N1T B;  1U57 A;  1J1D C;  3UIA A;  3D6Y A;  1BGY J;  4QDD A;  4R4L A;  1HF9 A;  1OW7 A;  3L72 D;  1YQ4 C;  4DCK A;  5TJH A;  1NTK G;  4OGQ B;  1YI2 P;  1AA0 A; 
#chains in the Genus database with same CATH homology
 2QSI A;  1KMI Z;  3D70 A;  3IN6 A;  2QJP C;  4NBE D;  4TT3 H;  1PIX A;  3BCC E;  1O7N A;  3GF7 A;  1RQU A;  3VCA A;  3H1J E;  2K9Y A;  1PPJ E;  2BMQ A;  4HM3 A;  2YMK A;  2XSO A;  4PV1 D;  3Q5P A;  2DE5 D;  1RQV A;  2FXP A;  2IBZ E;  1R8E A;  4OGQ D;  3GKE A;  4H13 D;  4Z1M H;  3FGA D;  1L0N E;  1NYH A;  1BCC E;  2QIW A;  3C8V A;  3D89 A;  5L8R J;  2E75 D;  3AE3 C;  1O7P A;  1EZV E;  4NBB D;  4NBG D;  4NBA D;  5BOK A;  3CX5 E;  3GB4 A;  2HML A;  1Y9B A;  4AAY B;  1Q90 D;  1UIX A;  2QJY C;  3GOB A;  1K04 A;  2YFJ A;  2ZT9 D;  2XR8 A;  3AEG C;  3AE6 C;  2NUM A;  1VF5 C;  1HJ0 A;  4H0L D;  1NTM E;  2HMK A;  3S9O A;  3AE1 C;  4HM0 A;  3D6Z A;  2I7F A;  4R4M A;  1SQQ E;  2NVE A;  1MKM A;  4HM7 A;  4H44 D;  1SQB E;  2NVG A;  2BMR A;  4YTP C;  3RK3 E;  3AEE C;  4QDF A;  1G8J B;  3AE2 C;  4HJL A;  4QUQ A;  1KQF B;  1NDO A;  3AE7 C;  2CKF A;  2D2C C;  2E75 C;  3VCP A;  3R4Y A;  4RKU J;  1EXI A;  4I7Z B;  4HM2 A;  5CXM A;  1VM9 A;  2JO1 A;  4P1C H;  1PP9 E;  3N0Q A;  2XRX A;  2FYN C;  2NZ2 A;  2E4P A;  3DQY A;  3Q5S A;  3H1H E;  5AEW A;  2G8Y A;  1KYO E;  1WMK A;  1G8K B;  3GTE A;  4NB9 D;  2JO6 A;  4QDF B;  4XFJ A;  3VMG D;  3RL0 g;  5HL4 A;  2E75 B;  3L75 E;  1UUW A;  1O7G A;  5AEU A;  3AED C;  1NTZ E;  1SJG A;  4H0L B;  1VF5 D;  4H0L C;  3LW5 J;  1ZP0 C;  3VMH D;  1NU1 E;  3AEC C;  4HM1 A;  2QPZ A;  2BMO A;  1L0L E;  3Q5R A;  5KKZ C;  1KIL E;  1KB9 E;  1DD3 A;  3AEF C;  5KLI C;  2BEZ F;  2O01 J;  1VF5 B;  1P84 E;  2DE6 D;  2FBW C;  2ZT9 C;  2P10 A;  2XSH A;  3GCE A;  3D71 A;  3GL0 A;  4H13 B;  3L71 E;  1RIE A;  3AE8 C;  1DD4 A;  3GZY A;  2WSE J;  1TU3 F;  2GBX A;  3CWB E;  3O6Q A;  3B71 A;  2V7Q J;  3AZC A;  2WQY C;  1ZRT E;  1VCK A;  3SFD C;  1EG9 A;  3L74 E;  4PV1 C;  1SQX E;  1DIP A;  4QUR A;  4EMJ B;  3L72 E;  1Q90 C;  3GLM A;  1SQP E;  1OW6 A;  3SFE C;  4H44 C;  4H44 B;  1BE3 E;  4GDO A;  1JM1 A;  1AJY A;  1S1C X;  1OW8 A;  5KLV E;  2YVJ B;  2E76 D;  1EXJ A;  2WSF J;  1KQG B;  2H88 C;  1SQV E;  1KOR A;  4P1B H;  2G3A A;  1ZME C;  3Q2Y A;  4HM6 A;  1ZOY C;  2DE7 D;  4IL6 X;  2D2C D;  3L73 E;  3C0D A;  2E76 B;  4KT0 J;  3AEB C;  2GBW A;  4AIV A;  4H13 C;  2B24 A;  2YFL A;  1WQL A;  2ZT9 B;  2HMM A;  3EWK A;  4PV1 B;  4NBH D;  3VMI D;  3H1I E;  1YQ3 C;  2BEQ D;  1NTK E;  1OMI A;  3GL2 A;  3H1L E;  1O7H A;  3AE4 C;  4OGQ C;  1ULI A;  1O7W A;  1K05 A;  2NWF A;  3TGU E;  2WPV B;  2A06 E;  3G9R A;  3H1K E;  2YIU C;  4U7J A;  5M1B A;  1VL2 A;  3Q3D A;  3AE5 C;  1IK7 A;  2HMO A;  2J5U A;  3FOU A;  1ULJ A;  3H25 A;  3IAO A;  2JP3 A;  1NGM B;  2HMN A;  4YXD C;  2IDB A;  4PD4 E;  3GF3 A;  3EN1 A;  2B1X A;  4QCK A;  2NVF A;  1FDO A;  1JB0 J;  2E74 C;  4I7Z C;  2BCC E;  4HKV A;  1O7M A;  2OQQ A;  4NBC D;  3EQQ A;  1UUV A;  2D2C B;  3GZX A;  4HM4 A;  2QJK C;  3T97 B;  1PL5 A;  2WSC J;  2Q3W A;  3CXH E;  1PV3 A;  3AEA C;  2HMJ A;  2JZA A;  3L70 E;  3Q1M A;  3GMA A;  2NUK A;  4HM5 A;  2E74 B;  4NB8 D;  4HM8 A;  4QDC A;  4Y28 J;  4QUP A;  2E4Q A;  1S5L X;  1NYK A;  3ABV C;  2YFI A;  1RFS A;  4NBD D;  3AE9 C;  4NBF D;  1FQT A;  2ZYL A;  2E74 D;  3GTS A;  1U57 A;  2E76 C;  4U3F E;  3D6Y A;  1KTM A;  2FYU E;  2MKV A;  4QDD A;  4R4L A;  1HF9 A;  1GMJ A;  1OW7 A;  1FDI A;  1YQ4 C;  4OGQ B;  2H89 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...