1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
b'RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
2WPVB 1ULJA 1UUVA 4QUQA 2YIUC 2BMQA 2E75B 2D2CD 2E74D 2NVFA 4H44D 2WSFJ 4IL6X 1EG9A 1EZVE 2E4QA 3L71E 1PPJE 2NUKA 3H1KE 3DQYA 1SQXE 2B1XA 2IBZE 2O01J 2HMNA 3GL2A 5KLIC 4I7ZB 3FOUA 3H1JE 3GB4A 3L72E 4OGQD 4NBFD 4AAYB 3AZCA 4NBED 3L75E 2QPZA 4HM1A 4H13B 4HM7A 3EQQA 4QDFB 2ZYLA 2ZT9B 2QJPC 5L8RJ 4H0LB 1ULIA 1O7WA 1S5LX 4HM4A 1L0NE 1O7NA 5HL4A 1O7HA 1WQLA 3GZYA 2FYUE 4QDFA 5AEWA 4HKVA 4HM5A 1JB0J 4NBCD 2NVEA 1BE3E 1VF5B 3GL0A 4HM2A 1NTME 3C0DA 2DE7D 1SJGA 4NBDD 1Q90C 1VCKA 3GCEA 3VCPA 2CKFA 4QDDA 5KLVE 4PD4E 2HMJA 3C8VA 1G8JB 1NU1E 4P1BH 4KT0J 2E4PA 1P84E 2GBXA 2YFJA 5AEUA 1L0LE 2A06E 3GTEA 2B24A 3GKEA 4OGQB 1SQPE 5BOKA 2K9YA 1NYKA 4QDCA 2DE5D 2WSCJ 2E75D 1FQTA 1SQQE 2XSHA 4RKUJ 2E76D 3VMGD 2GBWA 1JM1A 3VCAA 2QIWA 1KB9E 1PP9E 4PV1D 1KYOE 4U3FE 2BMRA 3L74E 3LW5J 1SQVE 3CWBE 2HMMA 1Q90D 2HMOA 3H1HE 2HMKA 5CXMA 1O7MA 1ZRTE 1NDOA 2YFIA 2D2CB 2E74B 4H44B 4NBAD 4NBGD 4P1CH 3VMID 3CXHE 2BMOA 3H1LE 3L73E 4HM3A 4AIVA 2YFLA 4H0LD 4Y28J 4EMJB 2YVJB 2DE6D 2BCCE 3L70E 3GOBA 2WSEJ 3GTSA 2FYNC 2XR8A 3EN1A 3BCCE 2JO6A 4NB8D 3H1IE 2XSOA 4HJLA 1VM9A 2I7FA 2NWFA 2XRXA 3D89A 4QUPA 2E76B 1G8KB 3TGUE 1SQBE 4HM6A 4PV1B 1NTKE 2QJKC 3VMHD 3N0QA 1NTZE 2Q3WA 4H13D 2HMLA 4HM8A 4QCKA 2ZT9D 2NVGA 2NUMA 1BCCE 2QJYC 4NBBD 1O7PA 5KKZC 1RFSA 4QURA 2JZAA 4NB9D 4HM0A 3CX5E 1VF5D 1RIEA 3GZXA 4NBHD 1UUWA 2QSIA 1O7GA
chains in the Genus database with same CATH superfamily
1LTTC 4QUQA 1XTCC 2OYHB 2ZJSE 3HD7A 1LP1B 5AW5B 1KILB 3M0AA 1SQPG 3Q3DA 2OARA 4R4MA 1FAVA 4D6TE 4NBED 2BEQD 3FWLA 1W2BO 4EI2A 5CCGC 4H0LB 1O7WA 4HM4A 1S72P 2AEMA 4O9BA 1YIJP 2BASA 2YMYA 3H6PA 1BE3E 1USEA 3GL0A 1DIPA 1S4XA 1EDJA 3GCEA 5KLVE 1M90Q 4M3LA 3EFFK 4UB6E 5AEUA 1L0LE 1LP1A 3KXDA 2AXTH 1OMIA 2UWJE 3BCCG 1KD1Q 4QDCA 1KILA 1YBKA 4B86A 1H8AA 1JNMA 2FFDC 3AEEC 1Q90D 3GLMA 3T97B 3PTZA 3BASA 3L35A 2JP3A 5APYA 3D71A 2A06D 3VMYA 1IFNA 1BDDA 1OVVA 1P84H 1MFTA 4ZMDA 2LR2A 2D2CC 1OZHA 1KTMA 1RH5B 2MJZA 2O01N 1K04A 1NU1J 3AEFC 1K8AQ 2WPQA 2W8ZA 2PAJA 4C46A 1SQBK 3A2AA 1KORA 1N7LA 1Q81Q 1IJDB 3II6A 4QMAA 4U3FJ 1PGJA 3FOUA 2W83C 4OVNF 3NTNA 1LTJC 1NTZJ 4N3YB 2K9JA 1LTSC 3BVHA 5AVQB 4QDFB 3TNUA 1KC8Q 3L70J 1GL2D 5DJUB 1SQXK 3CX5D 2NVEA 1TU3F 2VRSA 3GG2A 3H1HG 3A0HH 1N7SB 1T6AA 5APTA 3H1KD 3L73G 1NU1E 2GBXA 2H7HA 2H88C 1BCCJ 3H1IG 1NTMK 1W5CE 4IOIH 4HB1A 3UIAA 1JUNA 1A02J 3O6QB 4PV1D 4U3FE 3LW5J 3CMAP 1RF0A 3USSA 3WU2E 4P1CH 3A7OA 2ZXEB 1NAYA 1NO4A 3L70E 3GOBA 5KJ7C 2XR8A 3SFDC 2IFNA 1SQQD 2I7FA 2KXPB 4QUPA 5E79H 1PP9D 2E74C 2JJLA 3Q5SA 3CWBD 1N73C 3RK3D 3AE3C 2JO1A 4H13D 2JWAA 2ZT9D 2NUMA 1BCCE 3OAKA 1Y47A 4QURA 1RE3C 1VF5D 4WY4B 4DCKA 3SFEC 4PV1C 5EFWB 1EG9A 2E5TA 1OXZA 2HMNA 1JTHB 2OYIB 1Z56A 4WB4A 4IL6H 2QJPC 2Y9YA 1ULIA 3CMEP 1SFCD 5HL4A 3KZIE 5AVXB 1YYCA 2GM4A 3AE1C 1NTKG 4WBAA 3C0DA 1J1EC 4WY4A 2FYZA 1LTIC 4PD4E 1FU1A 1JY2N 4H13C 2HODA 2HR3A 2ZT9C 4Y99B 1PGQA 3HD7D 2O3JA 5BU8B 2DE5D 3AE8C 1HUCA 2E76D 3VN0A 2GBWA 2FYUD 4NPEA 1SQBG 2OTKE 3B5NC 4JF7A 2YIUB 3ZDMA 1NDOA 3PP5A 3CX5H 2I1KA 1KQSO 2KLUA 4HM3A 3H1JJ 2K88A 2W6JH 1SQPD 2FYNC 1LT1A 1SQVK 2V7QH 4A7PA 4HJLA 5CBOA 2FKWB 2NPSA 1VQMP 2P1JA 1SQXG 1KYOD 4H44C 1KILD 1LWUC 1N86A 1NTKE 1MUUA 1EDKA 2C9NY 1DEBA 3CXHD 2Z5HA 1BGYE 1QEXA 1FBMA 3A0BH 3OJAB 2YMKA 3BCCD 5B66E 2YO2A 1OW8A 3U1CA 1NTMG 2WPVB 2P10A 2JDIH 1OX3A 2IBZE 3HE5B 1FOSF 1JY3O 3JSVC 4JBZA 3H1JE 1IFPA 1YTZI 2R3CA 4AAYB 2XV5A 1AVOA 3VMZA 1G1IA 2ZYLA 3U1AA 3AEAC 2WPSA 2OYHC 5KAIH 1ZN5A 2WT7B 1FC2C 1ZOYC 3MGNA 3A5TA 3G9RA 3R2PA 1QVFO 3SWKA 5CCHA 2GUVA 1FS0E 3EFGA 2B24A 4H0LC 2KIKA 1NYKA 4BWNA 1IK7A 1Y9BA 1ZR2A 5KLVK 1NYHA 1PL5A 1L0LK 5AW8B 2HMMA 1E5WA 1Q2NA 5C39A 1Q7YQ 2QM8A 2C0XA 2QJYB 1Q82Q 4UB6H 1NJIQ 3L71G 1PFIA 1GL2B 1JOCA 2K37A 1GW3A 3JC22 3L74J 2E43A 3H1HD 3FGAD 4BXLA 3PHLA 3L75G 5KLIB 4HM8A 1Y8AA 3L73D 2IX7C 1AQ5A 2JZAA 1KV4A 3CCUP 4RO0A 2PRRA 4YXWH 2Q1KA 3H1ID 1N7SD 5DJTB 1JO5A 1LJ2A 1S9KD 4ZKUA 5AVRB 1RE4C 1H88A 2POHA 2E42A 2IDBA 4N78E 2BCCJ 3BRTB 2ZVNB 5APVA 1GU4A 4TT3H 1SQVG 4GOEA 1YJWP 5KAFE 3TGUJ 2XDJA 1FZCA 2E5YA 4KT0J 4L74A 4JYCA 3GF3A 3RK3B 2R3SA 3IN6A 3CL3D 3MUDA 5TJHA 1N7SC 2YXQB 1VQLP 1X8YA 1NU1K 3M0DC 3AE2C 2BMOA 3PLNA 1P84D 3L72J 2MKVA 3HRNA 2BCCE 4WY4D 1EDLA 1L0NJ 2FXPA 3TGUE 2N1TB 4ASVA 4DT0A 5AVUB 1IFDA 2KB7P 4D6TG 4R4LA 2Q3WA 1FZEA 4HH2A 1J1DB 1NVOA 4ASWA 3WU2H 3HD7B 4HJGH 2XU6A 1BE3G 2BMQA 1UIXA 1HTLC 1PPJE 2RKLA 1SQBD 3AE7C 2M0BA 3HTKA 1L0LG 3L72E 4K3AA 2WSFH 2N1TA 1URQC 1ZXGA 3VYIA 4HM7A 2YO3A 3MHVA 1YJ9P 1S5LX 1L0NE 3V2RA 3W67A 1IFIA 2AEFA 2OYIC 1SQXD 1R8EA 2QJKB 2IPPA 2HYNA 2V4HA 3LW5H 3TK1A 3KHUA 2OTJP 4PJ0H 4GDOA 2IBZI 1HJBA 2SPZA 1Q86Q 3VCAA 1KB9E 2QIWA 4KJMA 2LXCB 3AEDC 1NTMD 2WSCH 5AVVB 3M06A 1RF1A 4NBAD 3KZIH 4Y99C 1NKZB 3I55P 3P8CE 2KYVA 5GTIE 3P32A 4PD4H 2JO6A 2FY8A 1CI6A 3CCSP 1ZMEC 5CCHD 1LT9A 3A3YB 1GK6A 3VMHD 3HUSB 3SSUA 1NHLA 4YPCA 3L36A 1NAFA 1RFSA 1HWTC 1NTKK 1UUWA 1DX7A 2O01J 1NU1G 2K9JB 4I7ZB 1HVVA 5GTHE 3TNUB 4EOTA 3SWFA 2K3RA 3HUSA 4HM1A 1LNQA 1OIPA 1AJYA 1VQ7P 4U3FG 1YI2P 3L71D 1Q90C 1M8OB 5B66H 3C8VA 3Q5PA 1YQ4C 4L73A 1M1JB 1T2KD 3L70G 3GTEA 3L75D 5AVTB 1BCCG 3FX0A 4EMJB 2DE6D 3AECC 1WT6A 1DH3A 2WVRA 1M1JA 1VDFA 2XSOA 3GMAA 3WUUA 2GUSA 3Q2YA 1L4AA 4C7RA 1SQVD 3MZWB 1ZRTD 1GTWA 1QL1A 3WUTA 2KNCA 1NTZE 2R5BA 3MIWA 2QJYC 3GW6A 3RK2D 3E7KA 1LTAC 2W90A 3GF7A 4NB9D 1WMKA 4AQRD 4JQ0D 4EDFA 5AW3B 2IZ0A 1S5LE 1GL2C 2WMMA 5AW0B 1FDMA 1JMMA 1YITP 1M57D 1S2EA 3DQYA 5BU5A 5KLIC 3CC7P 4L76A 4IFMA 3KDPB 4UB8E 2XZRA 3GHGB 2NRGA 4XFJA 1UIIA 3RL0B 2B88A 3E1IA 5K5GB 3G71P 2HODB 4NBDD 2CKFA 4TLFA 1VQ5P 3LIEA 2QVAA 1NGMB 4OGQB 4D6TD 1VQKP 1KZUB 1MZ9A 2E75D 1FQTA 2ZAEB 2WQYC 1E79H 4BRYB 2B9BA 2N1TD 3GHGA 1BE3D 2HFED 3OW2O 3Q5RA 4NPDA 1KFNA 4NBGD 2WZ7A 5KLVD 3RK3C 1BGYG 1L0LD 4LC1A 3CLQA 2ZYAA 2NPSB 5KAFH 2R5DA 4NB8D 5AVWB 4LLHA 1VF5C 1KQGB 2IBZG 4YXDC 1T3JA 3H1JG 4BRYA 1USDA 1KB9I 2NVGA 3PJSK 1CZQA 1RIEA 1SFCC 2W6BA 1ULJA 2M8RA 1JEKA 3H32A 2NVFA 1EZVE 1R5SA 5CCGA 3VP9A 2BEZF 3E1RA 1OW6A 3C1LA 3NFQA 3TDKA 3H1LJ 4XA4A 1RQVA 4DJGA 3HD7C 1NOHA 1DEEG 2ITAA 4L75A 1PZQA 4RJTA 3M9HA 2E76C 2DW3A 2RN0A 2Q5UA 1VQ9P 4YTPC 1VCKA 1SQXJ 3VCPA 1NWQA 1IO4A 2FFDA 2XNDH 3D6ZA 2RH0A 2O1JA 1S1CX 4GOFA 2H89C 4EYYQ 4DOJA 2PP6A 1NTMJ 2HMKA 2YFIA 1KILC 3K5BA 1ZLLA 1NU1D 3H1LE 2YVJB 3GTSA 1VQ4P 3EN1A 2Y9ZA 5KKZB 3FWNA 3S4RA 2QA4P 1VM9A 2XNXA 3D89A 2ZFCA 4IFFA 3KPEA 4U3FD 3MP7B 1YHQP 3AE9C 1SVFA 1AA0A 2YXRB 1KB9H 2YKPA 3L70D 4C7NB 3I56P 2IYPA 3L74G 1IZNB 1LTJA 1JY2P 2R44A 1FDOA 3FXDA 2NUKA 5GTIH 2B1XA 2KP8A 3GB4A 1AVYA 1WRGA 2AEJA 1BCCD 3IF4A 1MFZA 1U7MA 1LGHB 1O7NA 1EQ7A 2WITA 4HKVA 2Q9IA 4C7NA 3CCJP 1FZCB 1JY2O 2A45I 1VQ8P 4I7ZC 1JCDA 3VOPA 4QDDA 1A02F 2HMJA 4XE5B 2E4PA 1KFMA 2BCCG 2A06E 3L75J 1GU5A 5GTHH 3RK2B 3CCEP 2Y0EA 1JM1A 3TGUG 3U59A 2W27A 2BMRA 3L74E 5KJ7A 2KK7A 2FXOA 5CXMA 3H1KJ 2JWDA 2NZ2A 4PD4D 2V7QJ 3WUVA 2H43A 3MD0A 1N73A 1S3JA 2QM7A 4LGDE 1RF0C 1AQTA 1HF9A 1VL2A 4JPZB 1PPJG 4MN4C 1BSHA 1RE3A 3RBXA 1SQVJ 3L72G 1M1KQ 1XTGB 1FZFA 1BDCA 2WSSH 2O01H 2HLOA 3NXSA 1X79B 1L0NG 1H89A 3CX5E 3RL0D 2J5UA 3R4YA 1SQQJ 1CSBA 3HTKB 2E75B 1G2CB 1NTZK 2E4QA 3AE5C 1PP9J 3H1KE 3QWOC 4IFDK 4ZKPA 2Q7CA 1NTKD 1QLED 3CWBJ 2QE7H 4OGQD 3QH9A 5B5EE 1BGYD 1W2EA 2OYOA 1ZV8A 2FYNB 3S9OA 5M1BA 4HM2A 2KI7B 1JCCA 1EXJA 3A0BE 1AV1A 2IBZD 1X22A 1G2CA 3C9IA 3H1JD 2NPSD 3B5NA 5CCGD 1EZVI 1PGOA 4WY4C 2M3BA 1SQQE 2P58A 2XSHA 3CCVP 1RF1B 1P84I 1PP9E 2B87B 3CWBE 1PGPA 3AEBC 4I1LA 5KLVJ 1MKMA 3HE4B 1CI6B 1LWUA 2WSEJ 1LT9B 3L37A 2P2UA 3RGUA 3M9BA 2Q6QA 2KZIA 3M9QA 2FYUJ 2Q3IA 1L2PA 2NPSC 2B87A 2FBWC 4W80A 3VTPC 1LTGC 1SQPJ 5AW6B 3D70A 3HE4A 2HPCB 1KQFB 1ZR4A 3BRVB 1O7GA 2WPRA 2YIUC 2D2CD 5TISE 3F89A 2YKQA 2Q3EA 2YKOA 2OYHA 4EIJA 1YQ3C 3AZCA 2QPZA 1AFOA 5APUA 5CJ4A 3CD6P 1O7HA 2FYUE 3BCCJ 5AEWA 1HH0A 4K35A 2JKVA 1OW7A 2HPCA 1VQ6P 3KQGA 3EWKA 2KZJA 1HGVA 1FZBA 4GT1A 2KLVA 3FXEA 3F5HA 1IK9A 1M7LA 4RESB 1NKNA 2YFJA 5CMZA 5CJ0A 1SQPE 3CCMP 1LTBC 2IYOA 4N78D 4DZOA 2N9BA 4WVZA 3VMGD 3CC4P 5CCHC 2ZXXA 1KYOE 3L74D 1KILE 2WTYA 1O7MA 1NTZG 2AXCA 3CXHE 2A45G 2L5GB 1SP4A 3T97A 3V4QA 1D7MA 2J59M 3BCCE 1L4AB 3Q1MA 3TF5A 1FOSE 1MV8A 4NPFX 3WMM0 4CPGA 5AW2B 1FJPA 1U7JA 3P8MC 1R5LA 1IC2A 2KNCB 2RMZA 1OFCX 1HJ0A 3JCUE 3KYQA 4QCKA 3AE4C 5KJ7D 5KKZC 2BCCD 1RE4A 3G4SP 3GZXA 2E74D 2WSFJ 3N7NA 3TGUD 3IFMA 1KQLA 5APSA 3H1HJ 4NBFD 3I5CA 1T2KC 3L73J 1NH4A 1JY3N 1WQLA 5APWA 4QDFA 3H1IJ 1VPCA 2CPBA 1EDIA 2DE7D 1PPJD 3AEGC 2B89A 3B8EB 3CX5I 1N7SA 3L72D 3W68A 2WSCJ 3M0DA 4RKUJ 1L0ND 1FZCC 5H2FE 3G6EP 2PGDA 3SWYA 3ABVC 3H1HE 3O6QA 1RY3A 3VMID 3MUDC 3PRJA 3L73E 4HKZH 3B4SA 1GW4A 1VQPP 1URQB 2H8PD 1GMJA 3RK2C 3H1IE 2JR8A 2Y0DA 1EZVG 1S9KE 3B5ND 2XRXA 1KB9D 1KMIZ 4PJ0E 2J58A 3N0QA 5AVSB 1DD4A 2KS1B 4WWIA 1IFMA 1HGZA 1K9MQ 2K1AA 3P8CD 2Z4EA 1FDIA 3H32B 1FZGA 3VMAA 2CK3H 3V4WA 4NBHD 1OVUA 1YTZT 3H25A 1EXIA 1URQA 2KSEA 4H44D 3RL0g 4IL6X 2N9YB 1SS1A 2FXMA 4W7ZA 2AXTE 3CCRP 1NTKJ 1VQNP 1EC5A 3N4XA 1JTHA 1BGYJ 2OYIA 1CW5A 5L8RJ 3S1KA 3CC2P 2KS1A 2E75C 4I6MC 2WWWA 3MTUE 1QL2A 1JB0J 2M3EA 2FFDB 2N1TC 1SJGA 2OGUA 4OWFA 1SQBJ 2O1KA 5AW9B 3H1LG 2ZVOB 1G8JB 1P84E 3GKEA 1J1DC 3CCQP 1YJNP 3NMDA 2C9LY 3B71A 5B5EH 5AW4B 4I2LC 2KUBA 1JY3P 2D2CB 4AYCA 1SQQK 4AIVA 4H0LD 1L0NK 1OVRA 3G3ZA 3D6YA 1DD3A 1PIXA 1ZP0C 3O8ZA 5CBNA 1RQUA 1RF1C 5CHXA 1BSNA 4KHXA 5APXA 3RBZA 1SQBE 5KTBA 4HM6A 2LXBA 2QJKC 1K73Q 3IAOA 1JMBA 2QEXP 2PFXA 1LT9C 1SLQA 1KYOI 1O7PA 3A0HE 1LTJB 2KOGA 4HM0A 3TYYA 2CPSA 3CXHI 2G8YA 4U7JA 3V2QA 1SQXE 1J2JB 2A06G 1HBWA 1NTZD 3HE5A 1M56D 3EQQA 1ZW0A 4GKGA 3GZYA 2G3AA 1GK4A 4HM5A 4NBCD 1IFJA 1KN7A 1NTME 1GD2E 3HUSC 1T3UA 3ITKA 2WT7A 4JYBA 1RHZB 1PV3A 1FJKA 5AVZB 5TISH 2FYUK 5E79E 1L4AD 5BOKA 2K9YA 2LKMA 3IR9A 3VP8A 2XKMA 4OH8B 2WSEH 2I1JA 2HMOA 4N6JA 3L71J 1SQPK 2E74B 1N73B 1N2DC 2W6AA 1VQOP 5APQA 2HG5D 5AW7B 4GODA 1X0TA 3M91A 2L91A 5AW1B 4HYTB 3TSIA 3H1KG 2YNYA 3CPWO 4PV1B 3CI9A 4IL6E 3EQ2A 1T8ZA 2KSJA 1M1JC 1GL2A 4Z1MH 2HMLA 1KYOH 1L4AC 3BATA 4GIFA 1QGKB 2Y0CA 3OA7A 1QX8A 1X9VA 2QJPB 3CXHH 2ZYDA 2QSIA 1UUVA 3LIDA 4AUWA 3P7KA 3L71E 3V5BA 2P67A 5BVZA 5AVYB 1J1EB 3GL2A 3V6IA 2P7JA 3L75E 4H13B 1SQQG 2ZT9B 1H0TB 3JCUH 1PP9G 4W7YA 2M5AB 2ZYGA 3CWBG 1VF5B 3L4FA 1EZVD 3B5NB 4P1BH 1URQD 4PD4I 2C0WA 1N8RQ 1FZAA 1SFCB 3V2PA 1U57A 4ZNCA 2A45H 1H0TA 1SQVE 2M5AA 2QRXA 1ZRTE 1G1JA 4H44B 1GDTA 1LWUB 2OQQA 1S5LH 2IZ1A 2OTLP 2YFLA 4Y28J 3GHGC 1QVGO 2JEEA 1GZLA 1FE6A 2QG4A 4D6TJ 2GA1A 3PH0A 3RL0C 2NWFA 1JM0A 2I8DA 2E76B 2Z5IA 1G8KB 5KLVG 4UB8H 1BE3J 1OWAA 3AE6C 3CCLP 1SFCA 2IFMA 3RK3E 5H2FH 2R32A 3VMXA 5KAIE 4OGQC 1K05A 3H1LD 4NBBD 1L0LJ 2FYUG 3V2NA
chains in the Genus database with same CATH topology
1ULJA 4QUQA 2E74D 2NVFA 2WSFJ 1EZVE 2BEZF 4NBFD 1OW6A 3Q3DA 4R4MA 4NBED 2IDBA 2BEQD 1RQVA 4H0LB 1O7WA 4HM4A 1WQLA 2E76C 4QDFA 4TT3H 1BE3E 3GL0A 1DIPA 2DE7D 4YTPC 3AEGC 1VCKA 3GCEA 3VCPA 5KLVE 4KT0J 5AEUA 1L0LE 3D6ZA 3GF3A 1OMIA 3IN6A 4QDCA 2WSCJ 4RKUJ 1S1CX 3AEEC 2H89C 3ABVC 1Q90D 3H1HE 2HMKA 3GLMA 2YFIA 3T97B 3O6QA 3VMID 3AE2C 2JP3A 2BMOA 3H1LE 3L73E 2YVJB 2MKVA 3D71A 2BCCE 1GMJA 3GTSA 3EN1A 3H1IE 1VM9A 2XRXA 3D89A 1KMIZ 2FXPA 2D2CC 3TGUE 1KTMA 3AE9C 3N0QA 1DD4A 4R4LA 2Q3WA 1K04A 3AEFC 1FDIA 4NBHD 1KORA 3H25A 1EXIA 2BMQA 3RL0g 4H44D 1UIXA 4IL6X 1FDOA 1PPJE 2NUKA 2B1XA 3AE7C 3FOUA 3L72E 3GB4A 4QDFB 4HM7A 5L8RJ 1S5LX 1L0NE 1O7NA 2E75C 4HKVA 1JB0J 2NVEA 1TU3F 4I7ZC 1SJGA 1R8EA 4QDDA 2HMJA 1G8JB 1NU1E 2E4PA 1P84E 2GBXA 2A06E 3GKEA 4GDOA 2H88C 3B71A 1JM1A 3VCAA 2QIWA 1KB9E 4PV1D 4U3FE 2BMRA 3L74E 3AEDC 3LW5J 5CXMA 2D2CB 4NBAD 4P1CH 2NZ2A 2V7QJ 4AIVA 4H0LD 3D6YA 1DD3A 1PIXA 3L70E 3GOBA 1ZP0C 2XR8A 1RQUA 3SFDC 2JO6A 1ZMEC 1HF9A 1VL2A 2I7FA 4QUPA 1SQBE 2E74C 3Q5SA 4HM6A 2QJKC 3VMHD 3IAOA 3AE3C 2JO1A 4H13D 2ZT9D 2NUMA 1BCCE 1O7PA 1RFSA 4QURA 4HM0A 3CX5E 2J5UA 1VF5D 1UUWA 3R4YA 3SFEC 2G8YA 2E75B 4PV1C 4U7JA 2E4QA 1EG9A 3AE5C 3H1KE 1SQXE 2O01J 2HMNA 4I7ZB 4OGQD 4HM1A 3EQQA 1AJYA 2QJPC 1ULIA 3S9OA 5HL4A 5M1BA 3GZYA 2G3AA 3AE1C 4HM5A 4NBCD 4HM2A 1NTME 3C0DA 1EXJA 1Q90C 4PD4E 3C8VA 3Q5PA 1YQ4C 1PV3A 4H13C 2ZT9C 3GTEA 5BOKA 2K9YA 2DE5D 3AE8C 1SQQE 2XSHA 2E76D 2GBWA 1PP9E 3CWBE 3AEBC 2HMOA 1NDOA 2E74B 1MKMA 4HM3A 4EMJB 2DE6D 3AECC 2WSEJ 2FYNC 2XSOA 4HJLA 3GMAA 3Q2YA 4H44C 4PV1B 1NTKE 1NTZE 4Z1MH 2HMLA 2FBWC 2QJYC 3GF7A 4NB9D 3D70A 2YMKA 1WMKA 1KQFB 2QSIA 1OW8A 1O7GA 2WPVB 1UUVA 2YIUC 2D2CD 3L71E 2P10A 3DQYA 2IBZE 3GL2A 5KLIC 3H1JE 1YQ3C 4AAYB 3AZCA 3L75E 2QPZA 4H13B 2ZYLA 2ZT9B 3AEAC 1O7HA 4XFJA 2FYUE 5AEWA 1OW7A 1VF5B 1ZOYC 3EWKA 4NBDD 2CKFA 3G9RA 4P1BH 2YFJA 1NGMB 2B24A 4H0LC 4OGQB 1SQPE 1NYKA 2E75D 1FQTA 2WQYC 3VMGD 1IK7A 1Y9BA 1NYHA 1PL5A 1U57A 1KYOE 1KILE 1SQVE 2HMMA 1O7MA 3Q5RA 1ZRTE 4H44B 4NBGD 2OQQA 3CXHE 2YFLA 4Y28J 3BCCE 3Q1MA 4NB8D 1VF5C 2NWFA 2E76B 1KQGB 1G8KB 4YXDC 3AE6C 1HJ0A 3FGAD 3RK3E 4HM8A 4QCKA 4OGQC 1K05A 2NVGA 3AE4C 4NBBD 5KKZC 2JZAA 1RIEA 3GZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV B;  1ULJ A;  1UUV A;  4QUQ A;  2YIU C;  2BMQ A;  2E75 B;  2D2C D;  2E74 D;  2NVF A;  4H44 D;  2WSF J;  4IL6 X;  1EG9 A;  1EZV E;  2E4Q A;  3L71 E;  1PPJ E;  2NUK A;  3H1K E;  3DQY A;  1SQX E;  2B1X A;  2IBZ E;  2O01 J;  2HMN A;  3GL2 A;  5KLI C;  4I7Z B;  3FOU A;  3H1J E;  3GB4 A;  3L72 E;  4OGQ D;  4NBF D;  4AAY B;  3AZC A;  4NBE D;  3L75 E;  2QPZ A;  4HM1 A;  4H13 B;  4HM7 A;  3EQQ A;  4QDF B;  2ZYL A;  2ZT9 B;  2QJP C;  5L8R J;  4H0L B;  1ULI A;  1O7W A;  1S5L X;  4HM4 A;  1L0N E;  1O7N A;  5HL4 A;  1O7H A;  1WQL A;  3GZY A;  2FYU E;  4QDF A;  5AEW A;  4HKV A;  4HM5 A;  1JB0 J;  4NBC D;  2NVE A;  1BE3 E;  1VF5 B;  3GL0 A;  4HM2 A;  1NTM E;  3C0D A;  2DE7 D;  1SJG A;  4NBD D;  1Q90 C;  1VCK A;  3GCE A;  3VCP A;  2CKF A;  4QDD A;  5KLV E;  4PD4 E;  2HMJ A;  3C8V A;  1G8J B;  1NU1 E;  4P1B H;  4KT0 J;  2E4P A;  1P84 E;  2GBX A;  2YFJ A;  5AEU A;  1L0L E;  2A06 E;  3GTE A;  2B24 A;  3GKE A;  4OGQ B;  1SQP E;  5BOK A;  2K9Y A;  1NYK A;  4QDC A;  2DE5 D;  2WSC J;  2E75 D;  1FQT A;  1SQQ E;  2XSH A;  4RKU J;  2E76 D;  3VMG D;  2GBW A;  1JM1 A;  3VCA A;  2QIW A;  1KB9 E;  1PP9 E;  4PV1 D;  1KYO E;  4U3F E;  2BMR A;  3L74 E;  3LW5 J;  1SQV E;  3CWB E;  2HMM A;  1Q90 D;  2HMO A;  3H1H E;  2HMK A;  5CXM A;  1O7M A;  1ZRT E;  1NDO A;  2YFI A;  2D2C B;  2E74 B;  4H44 B;  4NBA D;  4NBG D;  4P1C H;  3VMI D;  3CXH E;  2BMO A;  3H1L E;  3L73 E;  4HM3 A;  4AIV A;  2YFL A;  4H0L D;  4Y28 J;  4EMJ B;  2YVJ B;  2DE6 D;  2BCC E;  3L70 E;  3GOB A;  2WSE J;  3GTS A;  2FYN C;  2XR8 A;  3EN1 A;  3BCC E;  2JO6 A;  4NB8 D;  3H1I E;  2XSO A;  4HJL A;  1VM9 A;  2I7F A;  2NWF A;  2XRX A;  3D89 A;  4QUP A;  2E76 B;  1G8K B;  3TGU E;  1SQB E;  4HM6 A;  4PV1 B;  1NTK E;  2QJK C;  3VMH D;  3N0Q A;  1NTZ E;  2Q3W A;  4H13 D;  2HML A;  4HM8 A;  4QCK A;  2ZT9 D;  2NVG A;  2NUM A;  1BCC E;  2QJY C;  4NBB D;  1O7P A;  5KKZ C;  1RFS A;  4QUR A;  2JZA A;  4NB9 D;  4HM0 A;  3CX5 E;  1VF5 D;  1RIE A;  3GZX A;  4NBH D;  1UUW A;  2QSI A;  1O7G A; 
#chains in the Genus database with same CATH topology
 1LTT C;  4QUQ A;  1XTC C;  2OYH B;  2ZJS E;  3HD7 A;  1LP1 B;  5AW5 B;  1KIL B;  3M0A A;  1SQP G;  3Q3D A;  2OAR A;  4R4M A;  1FAV A;  4D6T E;  4NBE D;  2BEQ D;  3FWL A;  1W2B O;  4EI2 A;  5CCG C;  4H0L B;  1O7W A;  4HM4 A;  1S72 P;  2AEM A;  4O9B A;  1YIJ P;  2BAS A;  2YMY A;  3H6P A;  1BE3 E;  1USE A;  3GL0 A;  1DIP A;  1S4X A;  1EDJ A;  3GCE A;  5KLV E;  1M90 Q;  4M3L A;  3EFF K;  4UB6 E;  5AEU A;  1L0L E;  1LP1 A;  3KXD A;  2AXT H;  1OMI A;  2UWJ E;  3BCC G;  1KD1 Q;  4QDC A;  1KIL A;  1YBK A;  4B86 A;  1H8A A;  1JNM A;  2FFD C;  3AEE C;  1Q90 D;  3GLM A;  3T97 B;  3PTZ A;  3BAS A;  3L35 A;  2JP3 A;  5APY A;  3D71 A;  2A06 D;  3VMY A;  1IFN A;  1BDD A;  1OVV A;  1P84 H;  1MFT A;  4ZMD A;  2LR2 A;  2D2C C;  1OZH A;  1KTM A;  1RH5 B;  2MJZ A;  2O01 N;  1K04 A;  1NU1 J;  3AEF C;  1K8A Q;  2WPQ A;  2W8Z A;  2PAJ A;  4C46 A;  1SQB K;  3A2A A;  1KOR A;  1N7L A;  1Q81 Q;  1IJD B;  3II6 A;  4QMA A;  4U3F J;  1PGJ A;  3FOU A;  2W83 C;  4OVN F;  3NTN A;  1LTJ C;  1NTZ J;  4N3Y B;  2K9J A;  1LTS C;  3BVH A;  5AVQ B;  4QDF B;  3TNU A;  1KC8 Q;  3L70 J;  1GL2 D;  5DJU B;  1SQX K;  3CX5 D;  2NVE A;  1TU3 F;  2VRS A;  3GG2 A;  3H1H G;  3A0H H;  1N7S B;  1T6A A;  5APT A;  3H1K D;  3L73 G;  1NU1 E;  2GBX A;  2H7H A;  2H88 C;  1BCC J;  3H1I G;  1NTM K;  1W5C E;  4IOI H;  4HB1 A;  3UIA A;  1JUN A;  1A02 J;  3O6Q B;  4PV1 D;  4U3F E;  3LW5 J;  3CMA P;  1RF0 A;  3USS A;  3WU2 E;  4P1C H;  3A7O A;  2ZXE B;  1NAY A;  1NO4 A;  3L70 E;  3GOB A;  5KJ7 C;  2XR8 A;  3SFD C;  2IFN A;  1SQQ D;  2I7F A;  2KXP B;  4QUP A;  5E79 H;  1PP9 D;  2E74 C;  2JJL A;  3Q5S A;  3CWB D;  1N73 C;  3RK3 D;  3AE3 C;  2JO1 A;  4H13 D;  2JWA A;  2ZT9 D;  2NUM A;  1BCC E;  3OAK A;  1Y47 A;  4QUR A;  1RE3 C;  1VF5 D;  4WY4 B;  4DCK A;  3SFE C;  4PV1 C;  5EFW B;  1EG9 A;  2E5T A;  1OXZ A;  2HMN A;  1JTH B;  2OYI B;  1Z56 A;  4WB4 A;  4IL6 H;  2QJP C;  2Y9Y A;  1ULI A;  3CME P;  1SFC D;  5HL4 A;  3KZI E;  5AVX B;  1YYC A;  2GM4 A;  3AE1 C;  1NTK G;  4WBA A;  3C0D A;  1J1E C;  4WY4 A;  2FYZ A;  1LTI C;  4PD4 E;  1FU1 A;  1JY2 N;  4H13 C;  2HOD A;  2HR3 A;  2ZT9 C;  4Y99 B;  1PGQ A;  3HD7 D;  2O3J A;  5BU8 B;  2DE5 D;  3AE8 C;  1HUC A;  2E76 D;  3VN0 A;  2GBW A;  2FYU D;  4NPE A;  1SQB G;  2OTK E;  3B5N C;  4JF7 A;  2YIU B;  3ZDM A;  1NDO A;  3PP5 A;  3CX5 H;  2I1K A;  1KQS O;  2KLU A;  4HM3 A;  3H1J J;  2K88 A;  2W6J H;  1SQP D;  2FYN C;  1LT1 A;  1SQV K;  2V7Q H;  4A7P A;  4HJL A;  5CBO A;  2FKW B;  2NPS A;  1VQM P;  2P1J A;  1SQX G;  1KYO D;  4H44 C;  1KIL D;  1LWU C;  1N86 A;  1NTK E;  1MUU A;  1EDK A;  2C9N Y;  1DEB A;  3CXH D;  2Z5H A;  1BGY E;  1QEX A;  1FBM A;  3A0B H;  3OJA B;  2YMK A;  3BCC D;  5B66 E;  2YO2 A;  1OW8 A;  3U1C A;  1NTM G;  2WPV B;  2P10 A;  2JDI H;  1OX3 A;  2IBZ E;  3HE5 B;  1FOS F;  1JY3 O;  3JSV C;  4JBZ A;  3H1J E;  1IFP A;  1YTZ I;  2R3C A;  4AAY B;  2XV5 A;  1AVO A;  3VMZ A;  1G1I A;  2ZYL A;  3U1A A;  3AEA C;  2WPS A;  2OYH C;  5KAI H;  1ZN5 A;  2WT7 B;  1FC2 C;  1ZOY C;  3MGN A;  3A5T A;  3G9R A;  3R2P A;  1QVF O;  3SWK A;  5CCH A;  2GUV A;  1FS0 E;  3EFG A;  2B24 A;  4H0L C;  2KIK A;  1NYK A;  4BWN A;  1IK7 A;  1Y9B A;  1ZR2 A;  5KLV K;  1NYH A;  1PL5 A;  1L0L K;  5AW8 B;  2HMM A;  1E5W A;  1Q2N A;  5C39 A;  1Q7Y Q;  2QM8 A;  2C0X A;  2QJY B;  1Q82 Q;  4UB6 H;  1NJI Q;  3L71 G;  1PFI A;  1GL2 B;  1JOC A;  2K37 A;  1GW3 A;  3JC2 2;  3L74 J;  2E43 A;  3H1H D;  3FGA D;  4BXL A;  3PHL A;  3L75 G;  5KLI B;  4HM8 A;  1Y8A A;  3L73 D;  2IX7 C;  1AQ5 A;  2JZA A;  1KV4 A;  3CCU P;  4RO0 A;  2PRR A;  4YXW H;  2Q1K A;  3H1I D;  1N7S D;  5DJT B;  1JO5 A;  1LJ2 A;  1S9K D;  4ZKU A;  5AVR B;  1RE4 C;  1H88 A;  2POH A;  2E42 A;  2IDB A;  4N78 E;  2BCC J;  3BRT B;  2ZVN B;  5APV A;  1GU4 A;  4TT3 H;  1SQV G;  4GOE A;  1YJW P;  5KAF E;  3TGU J;  2XDJ A;  1FZC A;  2E5Y A;  4KT0 J;  4L74 A;  4JYC A;  3GF3 A;  3RK3 B;  2R3S A;  3IN6 A;  3CL3 D;  3MUD A;  5TJH A;  1N7S C;  2YXQ B;  1VQL P;  1X8Y A;  1NU1 K;  3M0D C;  3AE2 C;  2BMO A;  3PLN A;  1P84 D;  3L72 J;  2MKV A;  3HRN A;  2BCC E;  4WY4 D;  1EDL A;  1L0N J;  2FXP A;  3TGU E;  2N1T B;  4ASV A;  4DT0 A;  5AVU B;  1IFD A;  2KB7 P;  4D6T G;  4R4L A;  2Q3W A;  1FZE A;  4HH2 A;  1J1D B;  1NVO A;  4ASW A;  3WU2 H;  3HD7 B;  4HJG H;  2XU6 A;  1BE3 G;  2BMQ A;  1UIX A;  1HTL C;  1PPJ E;  2RKL A;  1SQB D;  3AE7 C;  2M0B A;  3HTK A;  1L0L G;  3L72 E;  4K3A A;  2WSF H;  2N1T A;  1URQ C;  1ZXG A;  3VYI A;  4HM7 A;  2YO3 A;  3MHV A;  1YJ9 P;  1S5L X;  1L0N E;  3V2R A;  3W67 A;  1IFI A;  2AEF A;  2OYI C;  1SQX D;  1R8E A;  2QJK B;  2IPP A;  2HYN A;  2V4H A;  3LW5 H;  3TK1 A;  3KHU A;  2OTJ P;  4PJ0 H;  4GDO A;  2IBZ I;  1HJB A;  2SPZ A;  1Q86 Q;  3VCA A;  1KB9 E;  2QIW A;  4KJM A;  2LXC B;  3AED C;  1NTM D;  2WSC H;  5AVV B;  3M06 A;  1RF1 A;  4NBA D;  3KZI H;  4Y99 C;  1NKZ B;  3I55 P;  3P8C E;  2KYV A;  5GTI E;  3P32 A;  4PD4 H;  2JO6 A;  2FY8 A;  1CI6 A;  3CCS P;  1ZME C;  5CCH D;  1LT9 A;  3A3Y B;  1GK6 A;  3VMH D;  3HUS B;  3SSU A;  1NHL A;  4YPC A;  3L36 A;  1NAF A;  1RFS A;  1HWT C;  1NTK K;  1UUW A;  1DX7 A;  2O01 J;  1NU1 G;  2K9J B;  4I7Z B;  1HVV A;  5GTH E;  3TNU B;  4EOT A;  3SWF A;  2K3R A;  3HUS A;  4HM1 A;  1LNQ A;  1OIP A;  1AJY A;  1VQ7 P;  4U3F G;  1YI2 P;  3L71 D;  1Q90 C;  1M8O B;  5B66 H;  3C8V A;  3Q5P A;  1YQ4 C;  4L73 A;  1M1J B;  1T2K D;  3L70 G;  3GTE A;  3L75 D;  5AVT B;  1BCC G;  3FX0 A;  4EMJ B;  2DE6 D;  3AEC C;  1WT6 A;  1DH3 A;  2WVR A;  1M1J A;  1VDF A;  2XSO A;  3GMA A;  3WUU A;  2GUS A;  3Q2Y A;  1L4A A;  4C7R A;  1SQV D;  3MZW B;  1ZRT D;  1GTW A;  1QL1 A;  3WUT A;  2KNC A;  1NTZ E;  2R5B A;  3MIW A;  2QJY C;  3GW6 A;  3RK2 D;  3E7K A;  1LTA C;  2W90 A;  3GF7 A;  4NB9 D;  1WMK A;  4AQR D;  4JQ0 D;  4EDF A;  5AW3 B;  2IZ0 A;  1S5L E;  1GL2 C;  2WMM A;  5AW0 B;  1FDM A;  1JMM A;  1YIT P;  1M57 D;  1S2E A;  3DQY A;  5BU5 A;  5KLI C;  3CC7 P;  4L76 A;  4IFM A;  3KDP B;  4UB8 E;  2XZR A;  3GHG B;  2NRG A;  4XFJ A;  1UII A;  3RL0 B;  2B88 A;  3E1I A;  5K5G B;  3G71 P;  2HOD B;  4NBD D;  2CKF A;  4TLF A;  1VQ5 P;  3LIE A;  2QVA A;  1NGM B;  4OGQ B;  4D6T D;  1VQK P;  1KZU B;  1MZ9 A;  2E75 D;  1FQT A;  2ZAE B;  2WQY C;  1E79 H;  4BRY B;  2B9B A;  2N1T D;  3GHG A;  1BE3 D;  2HFE D;  3OW2 O;  3Q5R A;  4NPD A;  1KFN A;  4NBG D;  2WZ7 A;  5KLV D;  3RK3 C;  1BGY G;  1L0L D;  4LC1 A;  3CLQ A;  2ZYA A;  2NPS B;  5KAF H;  2R5D A;  4NB8 D;  5AVW B;  4LLH A;  1VF5 C;  1KQG B;  2IBZ G;  4YXD C;  1T3J A;  3H1J G;  4BRY A;  1USD A;  1KB9 I;  2NVG A;  3PJS K;  1CZQ A;  1RIE A;  1SFC C;  2W6B A;  1ULJ A;  2M8R A;  1JEK A;  3H32 A;  2NVF A;  1EZV E;  1R5S A;  5CCG A;  3VP9 A;  2BEZ F;  3E1R A;  1OW6 A;  3C1L A;  3NFQ A;  3TDK A;  3H1L J;  4XA4 A;  1RQV A;  4DJG A;  3HD7 C;  1NOH A;  1DEE G;  2ITA A;  4L75 A;  1PZQ A;  4RJT A;  3M9H A;  2E76 C;  2DW3 A;  2RN0 A;  2Q5U A;  1VQ9 P;  4YTP C;  1VCK A;  1SQX J;  3VCP A;  1NWQ A;  1IO4 A;  2FFD A;  2XND H;  3D6Z A;  2RH0 A;  2O1J A;  1S1C X;  4GOF A;  2H89 C;  4EYY Q;  4DOJ A;  2PP6 A;  1NTM J;  2HMK A;  2YFI A;  1KIL C;  3K5B A;  1ZLL A;  1NU1 D;  3H1L E;  2YVJ B;  3GTS A;  1VQ4 P;  3EN1 A;  2Y9Z A;  5KKZ B;  3FWN A;  3S4R A;  2QA4 P;  1VM9 A;  2XNX A;  3D89 A;  2ZFC A;  4IFF A;  3KPE A;  4U3F D;  3MP7 B;  1YHQ P;  3AE9 C;  1SVF A;  1AA0 A;  2YXR B;  1KB9 H;  2YKP A;  3L70 D;  4C7N B;  3I56 P;  2IYP A;  3L74 G;  1IZN B;  1LTJ A;  1JY2 P;  2R44 A;  1FDO A;  3FXD A;  2NUK A;  5GTI H;  2B1X A;  2KP8 A;  3GB4 A;  1AVY A;  1WRG A;  2AEJ A;  1BCC D;  3IF4 A;  1MFZ A;  1U7M A;  1LGH B;  1O7N A;  1EQ7 A;  2WIT A;  4HKV A;  2Q9I A;  4C7N A;  3CCJ P;  1FZC B;  1JY2 O;  2A45 I;  1VQ8 P;  4I7Z C;  1JCD A;  3VOP A;  4QDD A;  1A02 F;  2HMJ A;  4XE5 B;  2E4P A;  1KFM A;  2BCC G;  2A06 E;  3L75 J;  1GU5 A;  5GTH H;  3RK2 B;  3CCE P;  2Y0E A;  1JM1 A;  3TGU G;  3U59 A;  2W27 A;  2BMR A;  3L74 E;  5KJ7 A;  2KK7 A;  2FXO A;  5CXM A;  3H1K J;  2JWD A;  2NZ2 A;  4PD4 D;  2V7Q J;  3WUV A;  2H43 A;  3MD0 A;  1N73 A;  1S3J A;  2QM7 A;  4LGD E;  1RF0 C;  1AQT A;  1HF9 A;  1VL2 A;  4JPZ B;  1PPJ G;  4MN4 C;  1BSH A;  1RE3 A;  3RBX A;  1SQV J;  3L72 G;  1M1K Q;  1XTG B;  1FZF A;  1BDC A;  2WSS H;  2O01 H;  2HLO A;  3NXS A;  1X79 B;  1L0N G;  1H89 A;  3CX5 E;  3RL0 D;  2J5U A;  3R4Y A;  1SQQ J;  1CSB A;  3HTK B;  2E75 B;  1G2C B;  1NTZ K;  2E4Q A;  3AE5 C;  1PP9 J;  3H1K E;  3QWO C;  4IFD K;  4ZKP A;  2Q7C A;  1NTK D;  1QLE D;  3CWB J;  2QE7 H;  4OGQ D;  3QH9 A;  5B5E E;  1BGY D;  1W2E A;  2OYO A;  1ZV8 A;  2FYN B;  3S9O A;  5M1B A;  4HM2 A;  2KI7 B;  1JCC A;  1EXJ A;  3A0B E;  1AV1 A;  2IBZ D;  1X22 A;  1G2C A;  3C9I A;  3H1J D;  2NPS D;  3B5N A;  5CCG D;  1EZV I;  1PGO A;  4WY4 C;  2M3B A;  1SQQ E;  2P58 A;  2XSH A;  3CCV P;  1RF1 B;  1P84 I;  1PP9 E;  2B87 B;  3CWB E;  1PGP A;  3AEB C;  4I1L A;  5KLV J;  1MKM A;  3HE4 B;  1CI6 B;  1LWU A;  2WSE J;  1LT9 B;  3L37 A;  2P2U A;  3RGU A;  3M9B A;  2Q6Q A;  2KZI A;  3M9Q A;  2FYU J;  2Q3I A;  1L2P A;  2NPS C;  2B87 A;  2FBW C;  4W80 A;  3VTP C;  1LTG C;  1SQP J;  5AW6 B;  3D70 A;  3HE4 A;  2HPC B;  1KQF B;  1ZR4 A;  3BRV B;  1O7G A;  2WPR A;  2YIU C;  2D2C D;  5TIS E;  3F89 A;  2YKQ A;  2Q3E A;  2YKO A;  2OYH A;  4EIJ A;  1YQ3 C;  3AZC A;  2QPZ A;  1AFO A;  5APU A;  5CJ4 A;  3CD6 P;  1O7H A;  2FYU E;  3BCC J;  5AEW A;  1HH0 A;  4K35 A;  2JKV A;  1OW7 A;  2HPC A;  1VQ6 P;  3KQG A;  3EWK A;  2KZJ A;  1HGV A;  1FZB A;  4GT1 A;  2KLV A;  3FXE A;  3F5H A;  1IK9 A;  1M7L A;  4RES B;  1NKN A;  2YFJ A;  5CMZ A;  5CJ0 A;  1SQP E;  3CCM P;  1LTB C;  2IYO A;  4N78 D;  4DZO A;  2N9B A;  4WVZ A;  3VMG D;  3CC4 P;  5CCH C;  2ZXX A;  1KYO E;  3L74 D;  1KIL E;  2WTY A;  1O7M A;  1NTZ G;  2AXC A;  3CXH E;  2A45 G;  2L5G B;  1SP4 A;  3T97 A;  3V4Q A;  1D7M A;  2J59 M;  3BCC E;  1L4A B;  3Q1M A;  3TF5 A;  1FOS E;  1MV8 A;  4NPF X;  3WMM 0;  4CPG A;  5AW2 B;  1FJP A;  1U7J A;  3P8M C;  1R5L A;  1IC2 A;  2KNC B;  2RMZ A;  1OFC X;  1HJ0 A;  3JCU E;  3KYQ A;  4QCK A;  3AE4 C;  5KJ7 D;  5KKZ C;  2BCC D;  1RE4 A;  3G4S P;  3GZX A;  2E74 D;  2WSF J;  3N7N A;  3TGU D;  3IFM A;  1KQL A;  5APS A;  3H1H J;  4NBF D;  3I5C A;  1T2K C;  3L73 J;  1NH4 A;  1JY3 N;  1WQL A;  5APW A;  4QDF A;  3H1I J;  1VPC A;  2CPB A;  1EDI A;  2DE7 D;  1PPJ D;  3AEG C;  2B89 A;  3B8E B;  3CX5 I;  1N7S A;  3L72 D;  3W68 A;  2WSC J;  3M0D A;  4RKU J;  1L0N D;  1FZC C;  5H2F E;  3G6E P;  2PGD A;  3SWY A;  3ABV C;  3H1H E;  3O6Q A;  1RY3 A;  3VMI D;  3MUD C;  3PRJ A;  3L73 E;  4HKZ H;  3B4S A;  1GW4 A;  1VQP P;  1URQ B;  2H8P D;  1GMJ A;  3RK2 C;  3H1I E;  2JR8 A;  2Y0D A;  1EZV G;  1S9K E;  3B5N D;  2XRX A;  1KB9 D;  1KMI Z;  4PJ0 E;  2J58 A;  3N0Q A;  5AVS B;  1DD4 A;  2KS1 B;  4WWI A;  1IFM A;  1HGZ A;  1K9M Q;  2K1A A;  3P8C D;  2Z4E A;  1FDI A;  3H32 B;  1FZG A;  3VMA A;  2CK3 H;  3V4W A;  4NBH D;  1OVU A;  1YTZ T;  3H25 A;  1EXI A;  1URQ A;  2KSE A;  4H44 D;  3RL0 g;  4IL6 X;  2N9Y B;  1SS1 A;  2FXM A;  4W7Z A;  2AXT E;  3CCR P;  1NTK J;  1VQN P;  1EC5 A;  3N4X A;  1JTH A;  1BGY J;  2OYI A;  1CW5 A;  5L8R J;  3S1K A;  3CC2 P;  2KS1 A;  2E75 C;  4I6M C;  2WWW A;  3MTU E;  1QL2 A;  1JB0 J;  2M3E A;  2FFD B;  2N1T C;  1SJG A;  2OGU A;  4OWF A;  1SQB J;  2O1K A;  5AW9 B;  3H1L G;  2ZVO B;  1G8J B;  1P84 E;  3GKE A;  1J1D C;  3CCQ P;  1YJN P;  3NMD A;  2C9L Y;  3B71 A;  5B5E H;  5AW4 B;  4I2L C;  2KUB A;  1JY3 P;  2D2C B;  4AYC A;  1SQQ K;  4AIV A;  4H0L D;  1L0N K;  1OVR A;  3G3Z A;  3D6Y A;  1DD3 A;  1PIX A;  1ZP0 C;  3O8Z A;  5CBN A;  1RQU A;  1RF1 C;  5CHX A;  1BSN A;  4KHX A;  5APX A;  3RBZ A;  1SQB E;  5KTB A;  4HM6 A;  2LXB A;  2QJK C;  1K73 Q;  3IAO A;  1JMB A;  2QEX P;  2PFX A;  1LT9 C;  1SLQ A;  1KYO I;  1O7P A;  3A0H E;  1LTJ B;  2KOG A;  4HM0 A;  3TYY A;  2CPS A;  3CXH I;  2G8Y A;  4U7J A;  3V2Q A;  1SQX E;  1J2J B;  2A06 G;  1HBW A;  1NTZ D;  3HE5 A;  1M56 D;  3EQQ A;  1ZW0 A;  4GKG A;  3GZY A;  2G3A A;  1GK4 A;  4HM5 A;  4NBC D;  1IFJ A;  1KN7 A;  1NTM E;  1GD2 E;  3HUS C;  1T3U A;  3ITK A;  2WT7 A;  4JYB A;  1RHZ B;  1PV3 A;  1FJK A;  5AVZ B;  5TIS H;  2FYU K;  5E79 E;  1L4A D;  5BOK A;  2K9Y A;  2LKM A;  3IR9 A;  3VP8 A;  2XKM A;  4OH8 B;  2WSE H;  2I1J A;  2HMO A;  4N6J A;  3L71 J;  1SQP K;  2E74 B;  1N73 B;  1N2D C;  2W6A A;  1VQO P;  5APQ A;  2HG5 D;  5AW7 B;  4GOD A;  1X0T A;  3M91 A;  2L91 A;  5AW1 B;  4HYT B;  3TSI A;  3H1K G;  2YNY A;  3CPW O;  4PV1 B;  3CI9 A;  4IL6 E;  3EQ2 A;  1T8Z A;  2KSJ A;  1M1J C;  1GL2 A;  4Z1M H;  2HML A;  1KYO H;  1L4A C;  3BAT A;  4GIF A;  1QGK B;  2Y0C A;  3OA7 A;  1QX8 A;  1X9V A;  2QJP B;  3CXH H;  2ZYD A;  2QSI A;  1UUV A;  3LID A;  4AUW A;  3P7K A;  3L71 E;  3V5B A;  2P67 A;  5BVZ A;  5AVY B;  1J1E B;  3GL2 A;  3V6I A;  2P7J A;  3L75 E;  4H13 B;  1SQQ G;  2ZT9 B;  1H0T B;  3JCU H;  1PP9 G;  4W7Y A;  2M5A B;  2ZYG A;  3CWB G;  1VF5 B;  3L4F A;  1EZV D;  3B5N B;  4P1B H;  1URQ D;  4PD4 I;  2C0W A;  1N8R Q;  1FZA A;  1SFC B;  3V2P A;  1U57 A;  4ZNC A;  2A45 H;  1H0T A;  1SQV E;  2M5A A;  2QRX A;  1ZRT E;  1G1J A;  4H44 B;  1GDT A;  1LWU B;  2OQQ A;  1S5L H;  2IZ1 A;  2OTL P;  2YFL A;  4Y28 J;  3GHG C;  1QVG O;  2JEE A;  1GZL A;  1FE6 A;  2QG4 A;  4D6T J;  2GA1 A;  3PH0 A;  3RL0 C;  2NWF A;  1JM0 A;  2I8D A;  2E76 B;  2Z5I A;  1G8K B;  5KLV G;  4UB8 H;  1BE3 J;  1OWA A;  3AE6 C;  3CCL P;  1SFC A;  2IFM A;  3RK3 E;  5H2F H;  2R32 A;  3VMX A;  5KAI E;  4OGQ C;  1K05 A;  3H1L D;  4NBB D;  1L0L J;  2FYU G;  3V2N A; 
#chains in the Genus database with same CATH homology
 1ULJ A;  4QUQ A;  2E74 D;  2NVF A;  2WSF J;  1EZV E;  2BEZ F;  4NBF D;  1OW6 A;  3Q3D A;  4R4M A;  4NBE D;  2IDB A;  2BEQ D;  1RQV A;  4H0L B;  1O7W A;  4HM4 A;  1WQL A;  2E76 C;  4QDF A;  4TT3 H;  1BE3 E;  3GL0 A;  1DIP A;  2DE7 D;  4YTP C;  3AEG C;  1VCK A;  3GCE A;  3VCP A;  5KLV E;  4KT0 J;  5AEU A;  1L0L E;  3D6Z A;  3GF3 A;  1OMI A;  3IN6 A;  4QDC A;  2WSC J;  4RKU J;  1S1C X;  3AEE C;  2H89 C;  3ABV C;  1Q90 D;  3H1H E;  2HMK A;  3GLM A;  2YFI A;  3T97 B;  3O6Q A;  3VMI D;  3AE2 C;  2JP3 A;  2BMO A;  3H1L E;  3L73 E;  2YVJ B;  2MKV A;  3D71 A;  2BCC E;  1GMJ A;  3GTS A;  3EN1 A;  3H1I E;  1VM9 A;  2XRX A;  3D89 A;  1KMI Z;  2FXP A;  2D2C C;  3TGU E;  1KTM A;  3AE9 C;  3N0Q A;  1DD4 A;  4R4L A;  2Q3W A;  1K04 A;  3AEF C;  1FDI A;  4NBH D;  1KOR A;  3H25 A;  1EXI A;  2BMQ A;  3RL0 g;  4H44 D;  1UIX A;  4IL6 X;  1FDO A;  1PPJ E;  2NUK A;  2B1X A;  3AE7 C;  3FOU A;  3L72 E;  3GB4 A;  4QDF B;  4HM7 A;  5L8R J;  1S5L X;  1L0N E;  1O7N A;  2E75 C;  4HKV A;  1JB0 J;  2NVE A;  1TU3 F;  4I7Z C;  1SJG A;  1R8E A;  4QDD A;  2HMJ A;  1G8J B;  1NU1 E;  2E4P A;  1P84 E;  2GBX A;  2A06 E;  3GKE A;  4GDO A;  2H88 C;  3B71 A;  1JM1 A;  3VCA A;  2QIW A;  1KB9 E;  4PV1 D;  4U3F E;  2BMR A;  3L74 E;  3AED C;  3LW5 J;  5CXM A;  2D2C B;  4NBA D;  4P1C H;  2NZ2 A;  2V7Q J;  4AIV A;  4H0L D;  3D6Y A;  1DD3 A;  1PIX A;  3L70 E;  3GOB A;  1ZP0 C;  2XR8 A;  1RQU A;  3SFD C;  2JO6 A;  1ZME C;  1HF9 A;  1VL2 A;  2I7F A;  4QUP A;  1SQB E;  2E74 C;  3Q5S A;  4HM6 A;  2QJK C;  3VMH D;  3IAO A;  3AE3 C;  2JO1 A;  4H13 D;  2ZT9 D;  2NUM A;  1BCC E;  1O7P A;  1RFS A;  4QUR A;  4HM0 A;  3CX5 E;  2J5U A;  1VF5 D;  1UUW A;  3R4Y A;  3SFE C;  2G8Y A;  2E75 B;  4PV1 C;  4U7J A;  2E4Q A;  1EG9 A;  3AE5 C;  3H1K E;  1SQX E;  2O01 J;  2HMN A;  4I7Z B;  4OGQ D;  4HM1 A;  3EQQ A;  1AJY A;  2QJP C;  1ULI A;  3S9O A;  5HL4 A;  5M1B A;  3GZY A;  2G3A A;  3AE1 C;  4HM5 A;  4NBC D;  4HM2 A;  1NTM E;  3C0D A;  1EXJ A;  1Q90 C;  4PD4 E;  3C8V A;  3Q5P A;  1YQ4 C;  1PV3 A;  4H13 C;  2ZT9 C;  3GTE A;  5BOK A;  2K9Y A;  2DE5 D;  3AE8 C;  1SQQ E;  2XSH A;  2E76 D;  2GBW A;  1PP9 E;  3CWB E;  3AEB C;  2HMO A;  1NDO A;  2E74 B;  1MKM A;  4HM3 A;  4EMJ B;  2DE6 D;  3AEC C;  2WSE J;  2FYN C;  2XSO A;  4HJL A;  3GMA A;  3Q2Y A;  4H44 C;  4PV1 B;  1NTK E;  1NTZ E;  4Z1M H;  2HML A;  2FBW C;  2QJY C;  3GF7 A;  4NB9 D;  3D70 A;  2YMK A;  1WMK A;  1KQF B;  2QSI A;  1OW8 A;  1O7G A;  2WPV B;  1UUV A;  2YIU C;  2D2C D;  3L71 E;  2P10 A;  3DQY A;  2IBZ E;  3GL2 A;  5KLI C;  3H1J E;  1YQ3 C;  4AAY B;  3AZC A;  3L75 E;  2QPZ A;  4H13 B;  2ZYL A;  2ZT9 B;  3AEA C;  1O7H A;  4XFJ A;  2FYU E;  5AEW A;  1OW7 A;  1VF5 B;  1ZOY C;  3EWK A;  4NBD D;  2CKF A;  3G9R A;  4P1B H;  2YFJ A;  1NGM B;  2B24 A;  4H0L C;  4OGQ B;  1SQP E;  1NYK A;  2E75 D;  1FQT A;  2WQY C;  3VMG D;  1IK7 A;  1Y9B A;  1NYH A;  1PL5 A;  1U57 A;  1KYO E;  1KIL E;  1SQV E;  2HMM A;  1O7M A;  3Q5R A;  1ZRT E;  4H44 B;  4NBG D;  2OQQ A;  3CXH E;  2YFL A;  4Y28 J;  3BCC E;  3Q1M A;  4NB8 D;  1VF5 C;  2NWF A;  2E76 B;  1KQG B;  1G8K B;  4YXD C;  3AE6 C;  1HJ0 A;  3FGA D;  3RK3 E;  4HM8 A;  4QCK A;  4OGQ C;  1K05 A;  2NVG A;  3AE4 C;  4NBB D;  5KKZ C;  2JZA A;  1RIE A;  3GZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...