1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
molecule keywords Cytochrome b
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
2B24A 3H1LE 3H1HE 3L70E 4HKVA 1RIEA 3VCPA 2ZT9D 3GOBA 2NUKA 4U3FE 4HM0A 2XR8A 3C0DA 4PD4E 2NVFA 3GKEA 3AZCA 1PPJE 4P1BH 1ULJA 1S5LX 4Y28J 3LW5J 2E75B 1EZVE 2HMOA 3VMHD 2GBXA 2NWFA 4PV1B 3L72E 4HM3A 4QUPA 2DE5D 1VF5B 1L0LE 2JO6A 4H13B 4H13D 1NDOA 2BMOA 2E74D 1NU1E 1RFSA 4HM5A 3L75E 2DE6D 4NBCD 2QSIA 2HMNA 3CXHE 5AEWA 4HJLA 2YVJB 1O7WA 3GTEA 4RKUJ 2NUMA 2WSEJ 2ZT9B 2B1XA 2E76B 4NBFD 4NBAD 2YIUC 4NBBD 4KT0J 2O01J 1BCCE 1JM1A 2E4PA 2HMLA 1VM9A 3GCEA 3N0QA 2QPZA 5L8RJ 4OGQD 4EMJB 4OGQB 1L0NE 3GB4A 2QJYC 3CWBE 1NTME 2I7FA 1P84E 2BMRA 2QIWA 2E76D 4HM2A 1Q90C 5BOKA 2YFIA 3GL0A 1VF5D 2BCCE 4HM6A 1KB9E 4QDDA 2QJKC 1WQLA 5KLIC 1Q90D 3VMGD 1UUVA 5CXMA 2D2CB 1G8JB 2YFLA 3L71E 4QCKA 1SQVE 4H0LB 3DQYA 3GL2A 2GBWA 3EN1A 5HL4A 4IL6X 2XSOA 5AEUA 2IBZE 2DE7D 4QURA 4AIVA 2WSCJ 1O7HA 1VCKA 4NBDD 1O7NA 2D2CD 3EQQA 2WPVB 4NBGD 1SQBE 2QJPC 3FOUA 5KKZC 2A06E 2E4QA 4NBHD 1SQXE 4I7ZB 4NB8D 3GTSA 1JB0J 1NYKA 3D89A 3H1IE 2CKFA 1SQPE 3CX5E 4NB9D 2WSFJ 3VCAA 4H44B 2NVEA 1SQQE 2FYNC 2NVGA 3GZYA 4QUQA 3C8VA 4HM1A 1ZRTE 3H1JE 2HMKA 2E74B 3H1KE 4P1CH 5KLVE 1NTKE 3L74E 2Q3WA 3TGUE 4AAYB 2K9YA 4NBED 1KYOE 2JZAA 4QDCA 1ULIA 2BMQA 1O7PA 4HM7A 4HM8A 2FYUE 3VMID 1G8KB 4QDFB 3L73E 2HMMA 1FQTA 1O7MA 2XRXA 4H44D 1NTZE 2HMJA 4H0LD 1UUWA 1BE3E 3BCCE 1O7GA 2YFJA 1SJGA 2E75D 2XSHA 4HM4A 4PV1D 4QDFA 3GZXA 1PP9E 2ZYLA 1EG9A
chains in the Genus database with same CATH superfamily
2JR8A 1RF1A 2BCCJ 3GOBA 1E5WA 5CBNA 4AUWA 2XR8A 1DEEG 5AW4B 4NPEA 2QM7A 3CCRP 1SQQJ 2E75B 5KAIH 3RGUA 2N9YB 3H1LJ 1LTIC 1SQPJ 4XA4A 2QA4P 1BCCJ 1AVYA 3N4XA 3TGUJ 2YXRB 1W2BO 4H13C 1FZCA 4NBCD 3TGUG 4HJLA 1LNQA 2XNXA 2IFMA 2KOGA 2V7QH 3H1LG 2BCCD 2A06G 3A0BH 4M3LA 3I55P 2Y9ZA 3FXDA 1IFMA 1Z56A 3GL0A 3H1KG 3D6YA 2GUVA 1NTZG 3H1HJ 1JY2O 2YMYA 4A7PA 2FYUG 3SFEC 1SQVE 3Q1MA 1L2PA 3EN1A 1NTZJ 1GW4A 3Q5PA 1EZVD 3W67A 3EQQA 3PH0A 3HUSA 4OVNF 1SQXE 3KZIE 5M1BA 4IFMA 1W2EA 2KZJA 2J5UA 2MKVA 4P1CH 1NKZB 4BRYA 1RE3C 1JNMA 1QVGO 1BGYG 4HM8A 2CPBA 4HKZH 1PFIA 1EDKA 4H44D 3FXEA 1NO4A 4QDFA 3B4SA 2YNYA 3H1LE 3L75G 3L70E 2IBZI 3TNUA 1HH0A 3PHLA 5CCGD 4PD4E 3H32A 1OW8A 2WITA 3U1AA 1EZVE 4C7NA 4H13B 2WPRA 1SQVD 2AXTH 1SQXG 3OAKA 1HGZA 3NMDA 1OFCX 1PGPA 2W83C 1N7SC 1SQBD 1FZAA 1HF9A 3S9OA 1KYOH 2L5GB 2OTJP 3CCVP 4HB1A 1NH4A 1QX8A 1N73B 1KORA 5KJ7D 1RF1C 2ZYAA 3CCMP 3KDPB 3H1HD 2JWAA 4L75A 1VF5D 3SWKA 1KTMA 2ZXEB 4YPCA 3RK3B 1M1JB 2D2CD 1GZLA 3M9BA 1J1DC 3B5ND 1A02F 3O6QB 1KB9H 1SQVK 1JUNA 1N7SD 2KS1B 4C7RA 1L0NJ 2G8YA 2YO2A 2BCCG 1KYOE 3VMID 3L73E 2K1AA 1O7MA 1MZ9A 3RK3D 3MHVA 5AW1B 5KLVD 1Q86Q 1LTAC 1MUUA 1P84I 1G1JA 3L71D 2P1JA 1L0ND 2NVFA 3CCEP 3AZCA 3M91A 3LW5J 2WWWA 1GD2E 2GBXA 2C9LY 3H1JD 5B5EE 1ZP0C 1VQ4P 4IL6E 2YVJB 3HE5B 2WT7B 2YIUC 2HG5D 3GCEA 1NU1G 2R3CA 2AXCA 2QPZA 5AW7B 2QJYC 4K35A 1DX7A 1URQB 3L70G 3CXHI 3BASA 1HBWA 5KLVK 3VMGD 1QVFO 1OZHA 4ZMDA 1X22A 5KKZB 1NTMJ 1PGJA 1PL5A 1FU1A 2DE7D 2O1KA 1S1CX 1JY2N 1AA0A 3WUTA 1VQKP 3FWNA 2E4QA 3A3YB 2D2CC 3AEEC 3VP9A 2FXMA 1YTZI 3GHGC 4JYCA 5TISE 1RQUA 3RL0B 3TF5A 4RO0A 1HVVA 2JZAA 1X79B 2NZ2A 1QL2A 2P2UA 1ZMEC 3V2PA 2KP8A 2E5TA 1CZQA 3VMXA 2ZJSE 3AE9C 1RF1B 5BU5A 3CX5D 3KQGA 1FBMA 1IC2A 3H32B 3B5NB 1M57D 2OYIA 4ASVA 1JO5A 1YQ3C 2G3AA 1EZVG 2FXOA 3E1RA 2PAJA 3FGAD 3P32A 4DOJA 2DE6D 2V4HA 3A2AA 1JMMA 1T8ZA 1KQGB 4KT0J 3F89A 3AE7C 1VM9A 4OGQD 2I7FA 5APWA 4RJTA 2M5AB 3GF3A 3CCLP 1Q90C 1IFDA 2I1JA 5AW9B 5CBOA 1ZR4A 1BGYE 3JCUE 1URQA 3QH9A 2K88A 4XFJA 1S5LH 1L4AD 2WSCH 5AEUA 5AVTB 1NYHA 2KZIA 4WB4A 3E1IA 2A06E 5APTA 3O6QA 3E7KA 3V2QA 2POHA 3A0HE 4H44B 5AVWB 2FYUK 1H0TA 2H88C 1W5CE 4BXLA 3RK2C 2Q3WA 2Y0EA 1X9VA 5GTIH 3L75J 2E76C 3H1KJ 2JJLA 2PGDA 2JO1A 3EQ2A 4I6MC 2Q9IA 1GMJA 2O01N 4PV1D 2FFDB 5CCGC 1VF5C 3H1JG 1KILE 1GTWA 3H1JJ 4IOIH 3PTZA 3SFDC 2BEQD 3BCCG 3NTNA 1ZW0A 4MN4C 3M9QA 1JY2P 2KLVA 1NTKJ 4W7ZA 2HMOA 3P8CE 3MTUE 1L0LK 2I1KA 1G2CA 3A7OA 2H8PD 2C0WA 2Q3IA 5KAIE 3CLQA 2NUMA 2E76B 3C9IA 2FYUJ 5GTIE 5L8RJ 4KJMA 3H1HG 2SPZA 2KYVA 3Q2YA 1CW5A 2C9NY 3EFFK 2VRSA 4ZKPA 3A0BE 4PJ0H 1OW7A 4I7ZC 2YFLA 3M0DC 3CL3D 5APQA 2Z5IA 1VQMP 3IN6A 1FZFA 4QURA 2GA1A 4DCKA 3ABVC 4NB9D 5APUA 3M0AA 5CCHC 1SFCC 2E43A 1PPJG 2QJPB 1GL2B 3AEAC 1R5LA 1YHQP 5B66E 2A45G 4HM7A 4N3YB 2HMJA 4IFDK 1VQ8P 1SJGA 1JY3O 2HR3A 2B24A 2QVAA 2OYIB 1NWQA 2J59M 2Z4EA 3BRVB 4R4LA 2AEFA 3FWLA 1NTMK 3B5NA 2PFXA 4P1BH 3VMZA 4Y28J 4JPZB 1RE4C 2NWFA 2OYHB 3I5CA 3KPEA 1PZQA 4WY4D 2H43A 3MUDA 2QSIA 5B66H 5BVZA 1FDMA 3V6IA 3HE4A 3RBXA 2KLUA 3HD7C 2BMRA 3HRNA 2WZ7A 3VMYA 3BATA 3L74G 4N78D 2YXQB 4QCKA 2NRGA 1MFZA 2FBWC 2GBWA 1CI6A 1KFNA 2YKPA 1KQSO 4BWNA 2QEXP 3M9HA 4I7ZB 4WY4C 1H8AA 3JC22 1FOSE 3CD6P 4JQ0D 1LT9C 3H1JE 2JP3A 4U3FD 2E74B 1GL2D 1JOCA 4AAYB 1ZLLA 1L4AB 4QDCA 3G4SP 1O7PA 4ZNCA 2KSJA 2ZYGA 1NTKK 2HPCB 2K9JB 1OXZA 1NAYA 4UB8E 3HUSC 2XU6A 4JF7A 1SQPD 2NUKA 1XTGB 2KUBA 3BCCD 5CCHA 3IAOA 3VYIA 2DE5D 2W6AA 1NDOA 2PRRA 1M1JA 4L74A 2L91A 3V4QA 3B8EB 1S2EA 4KHXA 4RESB 3G71P 1LP1B 1M90Q 2OTLP 4EMJB 3N0QA 3AE1C 1K8AQ 3GB4A 1SQPK 2C0XA 3N7NA 5APVA 1Q2NA 1ZN5A 5APXA 1T3JA 2WVRA 3G3ZA 3M0DA 3AECC 2M5AA 1PP9G 1KILB 1S9KD 2K37A 3MIWA 4AQRD 1SQXD 4UB6H 5AW8B 4AIVA 4L73A 3K5BA 1VCKA 1RQVA 1SQBE 5AVQB 1RH5B 3RL0D 5BU8B 1S5LE 1HUCA 2B9BA 2FY8A 2BASA 2NVEA 4Y99C 4D6TJ 3CX5I 1RE4A 2B87A 1T6AA 2GM4A 3TGUE 5TISH 4NBED 1K04A 2BMQA 4EIJA 2V7QJ 2HMMA 1WMKA 2XRXA 1KMIZ 1MV8A 3P7KA 5E79E 1UIXA 2ZYLA 2YMKA 1KB9D 2M0BA 3PP5A 2ZVOB 1VDFA 1ZV8A 1PP9D 2ZT9D 4U3FE 3S1KA 4YXWH 1BCCG 4WVZA 1ULJA 1SQPG 3HUSB 4QUPA 1VQ6P 5KAFE 1DIPA 4GIFA 3R2PA 4HM5A 4W7YA 2Z5HA 4HJGH 3CXHE 2RKLA 4DJGA 1NTZD 1QGKB 3D71A 4C46A 1LT9B 3WMM0 5KLIB 4H44C 2QJKC 3IF4A 1G8JB 3T97A 4H0LB 3DQYA 1LTJA 2HODA 5HL4A 1CI6B 2IBZE 1BE3G 1UIIA 2MJZA 3VTPC 4U7JA 1T2KC 2KXPB 3WU2E 1LP1A 2CPSA 3BVHA 3L35A 4QUQA 2IX7C 3U59A 2YIUB 1M8OB 2RN0A 5KLVG 2QE7H 3L70J 4QDFB 5AVVB 1NJIQ 1NTMG 1FDIA 2R5BA 2JEEA 2A45H 2P10A 3V2RA 2ZT9C 3MD0A 3LIEA 3G6EP 3CMAP 2OYIC 1S9KE 1YJWP 3IFMA 2JO6A 1OVRA 1LWUB 1S4XA 1FZCB 1LTGC 3SWFA 2N1TC 4OWFA 2WPQA 2KB7P 2KK7A 1KD1Q 2IFNA 4NBBD 1GL2C 1HTLC 3RL0g 2WSSH 3VOPA 1AV1A 3AEGC 4HM2A 3KZIH 2KI7B 3GHGB 5CXMA 2FFDA 1GK6A 1YI2P 3AEDC 1J1DB 3PJSK 1PGQA 3MGNA 2DW3A 1SQVG 4NBDD 3QWOC 1OVUA 4NBHD 2UWJE 2FYUD 4WWIA 1FZCC 1FZGA 1LWUC 2NVGA 2LXBA 1SVFA 4HYTB 3LIDA 3L74E 4WBAA 2QJYB 4OGQC 1KILD 3OW2O 4PD4H 1LT1A 3PRJA 1N7SB 2IZ0A 1N7SA 3KYQA 3L72J 1G1IA 2XNDH 1RHZB 3KXDA 4EDFA 5KJ7C 4O9BA 4HM4A 3KHUA 2GUSA 1JTHB 4R4MA 4EOTA 4Z1MH 3CCUP 1PIXA 3GKEA 3H1KD 2LXCB 1MKMA 2N1TB 3CPWO 4QMAA 1VF5B 1L0LE 1N2DC 1NTKG 1OIPA 1SLQA 3CXHD 4LGDE 2A06D 2BEZF 1SFCD 3I56P 1FZBA 1NU1E 1J2JB 2IYPA 3SSUA 4C7NB 3PLNA 2HMNA 1O7WA 4RKUJ 4NBFD 2N1TD 1JMBA 2NPSA 1EDIA 5EFWB 3RK2B 1NTME 1LJ2A 2P58A 5APYA 1BSNA 2XDJA 2QIWA 3R4YA 1J1EC 2BCCE 1Q82Q 1KB9E 2AEJA 2QJKB 5KLIC 5AVZB 1OW6A 3L71E 1YYCA 5CHXA 3GL2A 2XKMA 2M3EA 1O7HA 1DD3A 3HTKA 4CPGA 1GW3A 1S3JA 3AE6C 3L73D 1JB0J 2E42A 1NYKA 3D89A 1JCDA 4XE5B 3VCAA 4D6TE 1VQPP 1K05A 1N7LA 3TK1A 1DD4A 3SWYA 1H0TB 1VQ9P 1N73C 1JY3N 1EXIA 4D6TD 5AW0B 1YJNP 2FKWB 3GF7A 5B5EH 3EWKA 1O7GA 1JEKA 4NPFX 1BE3D 4IL6H 3GZXA 4N6JA 1GK4A 1AQ5A 1KILA 1FS0E 1FAVA 2KSEA 3H1IG 3B5NC 3ITKA 3CMEP 2R32A 1BDCA 1LWUA 3H1ID 1PPJE 2Q5UA 1VQNP 3WUUA 4H13D 5CMZA 2O1JA 1VQ7P 1YIJP 1BE3J 4D6TG 2IYOA 5KJ7A 1Q81Q 2OTKE 1L0NK 2E4PA 2HMLA 1SQXK 1NOHA 1SQQG 1U57A 1XTCC 1FOSF 5BOKA 1BCCD 3HD7D 1OX3A 1J1EB 2D2CB 2Q3EA 3JSVC 2HFED 2W8ZA 2XSOA 2IPPA 1O7NA 5AVRB 1FZEA 1ZOYC 5KKZC 1QEXA 1H88A 5K5GB 1EDLA 3B71A 4NB8D 4UB6E 2LR2A 2FYNC 4EYYQ 5AW6B 1LTTC 2IBZD 3GZYA 3C8VA 4GODA 2HYNA 3D6ZA 1HJ0A 2J58A 5H2FE 2K3RA 2K9YA 2NPSB 1FDOA 2WSFH 3V4WA 2P7JA 5C39A 1P84H 4H0LD 1BE3E 3EFGA 1NAFA 1NU1J 2Q6QA 1NTKD 1VPCA 1RIEA 3T97B 3OJAB 1KZUB 2W27A 2LKMA 1KN7A 1AJYA 1NTZK 1SQBK 1L4AC 1USDA 2Q1KA 3L71G 1USEA 5AW2B 2E74C 3MZWB 1RF0C 4GDOA 3A5TA 1RFSA 1NKNA 1BDDA 1FJPA 2ZYDA 1A02J 1P84D 3JCUH 1D7MA 5CCHD 3Q5RA 5KAFH 1PP9J 3CCJP 3L72D 4I1LA 3CXHH 2B89A 1P84E 5AVUB 5CCGA 2YFIA 3A0HH 1RY3A 2H89C 2AEMA 1NU1K 3L73G 3TGUD 4EI2A 4IFFA 3HD7B 1M1JC 1ZR2A 4NBGD 4DT0A 2QG4A 1PGOA 1Q7YQ 4YXDC 1SQPE 2HLOA 1L0NG 1Y8AA 3H1KE 5AVYB 4JBZA 4BRYB 2Q7CA 4GOEA 3AE2C 1R5SA 1N8RQ 5AVXB 1E79H 2W90A 2PP6A 1N86A 2R3SA 2ZAEB 3L37A 1PP9E 3H1HE 2HPCA 1R8EA 1EDJA 1LTJB 2R44A 1KQLA 3C0DA 3L74D 2WTYA 3H25A 3WUVA 1WRGA 5CJ4A 1DH3A 2E74D 4PJ0E 1SQVJ 5AEWA 3GTEA 3P8CD 2ZT9B 2B1XA 1EZVI 1RE3A 2WPSA 2NPSD 3VMAA 4U3FG 2KNCB 3W68A 1T3UA 3GLMA 1LGHB 1OVVA 1WQLA 1Q90D 1UUVA 2IDBA 3IR9A 2JDIH 3AEFC 3L73J 3L75D 1NHLA 5APSA 3HTKB 2WPVB 1U7JA 1SFCB 1BGYJ 2P67A 1SQQE 1JY3P 4HM1A 1ZRTE 3RK3E 4JYBA 1KQFB 3MUDC 3CWBG 2K9JA 1SQBG 4H0LC 3BRTB 1GL2A 3L71J 2ZFCA 1CSBA 3BCCE 4NPDA 3HD7A 2FFDC 3CC2P 2M8RA 1QLED 1BGYD 1U7MA 2CK3H 2A45I 3ZDMA 1EG9A 5KLVJ 1FC2C 2E75C 5TJHA 4PV1C 4PD4D 2E5YA 1YITP 2IBZG 4HM0A 1Y9BA 1NGMB 1FE6A 3L70D 1VQOP 2H7HA 3VMHD 2QM8A 2OYHA 3L72E 3LW5H 2R5DA 3MP7B 2BMOA 4W80A 1FJKA 3L75E 1OWAA 2KS1A 2WT7A 1SS1A 1JM0A 3G9RA 1JM1A 2O01J 2B87B 2XV5A 2KIKA 1NU1D 4HM6A 2FYNB 1ZXGA 3TDKA 3GG2A 3CWBJ 3NFQA 1IK9A 1IO4A 4HH2A 2WMMA 3NXSA 2IZ1A 1YQ4C 1SQQK 3FOUA 4GOFA 5AW5B 2N1TA 1SQBJ 3AE3C 1AQTA 4Y99B 2HODB 4GKGA 2CKFA 2O01H 1T2KD 2JKVA 3OA7A 1SFCA 1PV3A 4PD4I 1K73Q 2HMKA 3BCCJ 3H1IJ 1K9MQ 4DZOA 1NTMD 1ULIA 1G8KB 1KILC 3D70A 1KYOI 1M7LA 3TNUB 3RBZA 2YFJA 2XZRA 2WSEH 3C1LA 1X8YA 1IFJA 4HKVA 2FYZA 3V2NA 3VCPA 3AE5C 2Y0DA 2AXTE 4U3FJ 1G2CB 1KFMA 2YKQA 4N78E 4PV1B 3GW6A 1AFOA 1KC8Q 3RL0C 3CX5H 4TLFA 1M56D 4UB8H 4WY4A 4WY4B 2RMZA 1N73A 2O3JA 1HWTC 1KB9I 3L36A 3P8MC 2OQQA 4TT3H 1LT9A 2ZVNB 2WSEJ 5CJ0A 3M06A 1JCCA 3CCSP 1TU3F 1QL1A 4AYCA 3II6A 1L0NE 4OH8B 3VN0A 2W6BA 1BSHA 1PPJD 5AW3B 2E76D 4ASWA 3L72G 3AEBC 3TSIA 1IFPA 3S4RA 4QDDA 4LC1A 1URQC 2W6JH 1YTZT 1MFTA 1AVOA 2WSCJ 2QRXA 1SP4A 1KYOD 2OARA 1KV4A 2I8DA 3FX0A 3VP8A 1L0LJ 3CX5E 4YTPC 5E79H 1IFNA 3CWBD 2JWDA 1HGVA 1L0LD 2OYHC 3HE4B 1L0LG 1NTKE 1ZRTD 1SQQD 3GMAA 5DJTB 1IZNB 3GHGA 2OGUA 3HE5A 1FQTA 1WT6A 2RH0A 2ITAA 5H2FH 1X0TA 1UUWA 3V5BA 1L4AA 1GDTA 2WQYC 1URQD 1IK7A 4I2LC 3TYYA 3O8ZA 5DJUB 3CCQP 2B88A 4ZKUA 2Y0CA 1LTBC 1LTJC 1S5LX 2YO3A 1JTHA 1Y47A 4B86A 4HM3A 1VQ5P 1VL2A 3AE4C 1OMIA 3CI9A 1M1KQ 3AE8C 3H6PA 2OYOA 5AVSB 1YJ9P 5GTHE 2NPSC 4NBAD 2Y9YA 1BCCE 1GU4A 4L76A 3RK2D 3RK3C 4OGQB 3CWBE 3L74J 2KNCA 3L4FA 3UIAA 1NVOA 3U1CA 3F5HA 3H1LD 1LTSC 1VQLP 1EXJA 2N9BA 1EQ7A 4LLHA 3CC4P 1HJBA 4IL6X 3Q3DA 1IJDB 3CC7P 2QJPC 4K3AA 1DEBA 1GU5A 2M3BA 3GTSA 1YBKA 3H1IE 1EC5A 2WSFJ 3Q5SA 2FXPA 5KLVE 2YKOA 5GTHH 1SQXJ 2FYUE 5KTBA 4GT1A 1S72P 1IFIA 1NTZE 2ZXXA 3WU2H 1H89A 2E75D 2XSHA 3USSA 1RF0A
chains in the Genus database with same CATH topology
3H1HE 1KILE 3SFDC 2P10A 3GOBA 1R8EA 2BEQD 2XR8A 3C0DA 2ZT9C 3H25A 2E75B 2HMOA 2JO6A 2E74D 4H13C 4NBCD 5AEWA 4HJLA 3GTEA 2NUMA 2ZT9B 2B1XA 2E76B 4NBBD 5L8RJ 3RL0g 3AEGC 4HM2A 3Q2YA 3GL0A 3D6YA 3GLMA 1WQLA 1Q90D 1UUVA 2IDBA 1OW7A 4I7ZC 2YFLA 5CXMA 3AEFC 3AEDC 3SFEC 1SQVE 3Q1MA 3EN1A 3Q5PA 3IN6A 4QURA 4NBDD 3EQQA 2WPVB 4NBHD 1SQXE 3ABVC 4NB9D 5M1BA 1SQQE 2NVGA 4HM1A 1ZRTE 2J5UA 3RK3E 2MKVA 4P1CH 1KQFB 3L74E 3AEAC 4OGQC 4HM7A 4HM8A 4H0LC 4H44D 2HMJA 3BCCE 1SJGA 4HM4A 4QDFA 1EG9A 2B24A 3H1LE 3L70E 2E75C 4PV1C 4R4MA 4R4LA 4Z1MH 4HM0A 4PD4E 1PIXA 1Y9BA 3GKEA 1NGMB 4P1BH 1OW8A 4Y28J 3VMHD 1MKMA 1EZVE 2NWFA 3L72E 1VF5B 1L0LE 4H13B 2BEZF 2BMOA 1NU1E 3L75E 2QSIA 2HMNA 1O7WA 4RKUJ 4NBFD 1HF9A 3S9OA 3G9RA 1JM1A 2O01J 1KORA 1NTME 2BMRA 2QIWA 3R4YA 1VF5D 2BCCE 4HM6A 1KTMA 1KB9E 5KLIC 1OW6A 3L71E 4QCKA 3GL2A 2FBWC 2GBWA 1YQ4C 1O7HA 1DD3A 2D2CD 3FOUA 3AE3C 3AE6C 4I7ZB 1JB0J 1NYKA 3D89A 2CKFA 3VCAA 1PV3A 1K05A 2JP3A 3H1JE 1DD4A 2HMKA 2E74B 2G8YA 4AAYB 1KYOE 4QDCA 1ULIA 1O7PA 3VMID 1EXIA 1G8KB 3L73E 3D70A 1O7MA 3GF7A 3EWKA 1O7GA 2YFJA 3GZXA 4HKVA 3VCPA 3AE5C 2NUKA 2NVFA 3AZCA 1PPJE 3IAOA 3LW5J 2GBXA 4PV1B 2DE5D 1ZP0C 4H13D 1NDOA 2YVJB 2OQQA 4TT3H 2WSEJ 2YIUC 1TU3F 2E4PA 2HMLA 3GCEA 4EMJB 3N0QA 3AE1C 2QPZA 1L0NE 3GB4A 2QJYC 1U57A 2E76D 5BOKA 3AEBC 4QDDA 3VMGD 2D2CB 3AECC 1PL5A 2XSOA 2DE7D 4AIVA 2WSCJ 1VCKA 1O7NA 1S1CX 1RQVA 1SQBE 1ZOYC 5KKZC 2E4QA 2D2CC 3AEEC 3B71A 4NB8D 3CX5E 4YTPC 1RQUA 2NVEA 2FYNC 3GZYA 3C8VA 3D6ZA 1HJ0A 1NTKE 3TGUE 2K9YA 3GMAA 4NBED 1K04A 2JZAA 1FDOA 2BMQA 2V7QJ 2HMMA 1WMKA 2NZ2A 1FQTA 2XRXA 4H0LD 1UUWA 1BE3E 1KMIZ 1ZMEC 2WQYC 1UIXA 2ZYLA 2YMKA 1IK7A 3AE9C 1RIEA 3T97B 2ZT9D 4U3FE 1AJYA 1ULJA 1S5LX 4HM3A 4QUPA 2E74C 1YQ3C 2G3AA 4GDOA 1VL2A 3AE4C 3FGAD 1RFSA 1DIPA 1OMIA 4HM5A 2DE6D 3AE8C 3CXHE 1KQGB 3Q5RA 4NBAD 4KT0J 1BCCE 3AE7C 1VM9A 4OGQD 4OGQB 3D71A 3CWBE 2I7FA 1P84E 3GF3A 1Q90C 2YFIA 4H44C 2QJKC 1EXJA 2H89C 1G8JB 4XFJA 4H0LB 3DQYA 5HL4A 4IL6X 3Q3DA 5AEUA 2IBZE 4NBGD 1NYHA 2QJPC 2A06E 4YXDC 3O6QA 4U7JA 3GTSA 3H1IE 1SQPE 2WSFJ 3Q5SA 2FXPA 4H44B 4QUQA 3H1KE 2H88C 5KLVE 2Q3WA 3AE2C 2FYUE 2E76C 4QDFB 2JO1A 1NTZE 1GMJA 2E75D 2XSHA 4PV1D 1FDIA 1PP9E 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B24 A;  3H1L E;  3H1H E;  3L70 E;  4HKV A;  1RIE A;  3VCP A;  2ZT9 D;  3GOB A;  2NUK A;  4U3F E;  4HM0 A;  2XR8 A;  3C0D A;  4PD4 E;  2NVF A;  3GKE A;  3AZC A;  1PPJ E;  4P1B H;  1ULJ A;  1S5L X;  4Y28 J;  3LW5 J;  2E75 B;  1EZV E;  2HMO A;  3VMH D;  2GBX A;  2NWF A;  4PV1 B;  3L72 E;  4HM3 A;  4QUP A;  2DE5 D;  1VF5 B;  1L0L E;  2JO6 A;  4H13 B;  4H13 D;  1NDO A;  2BMO A;  2E74 D;  1NU1 E;  1RFS A;  4HM5 A;  3L75 E;  2DE6 D;  4NBC D;  2QSI A;  2HMN A;  3CXH E;  5AEW A;  4HJL A;  2YVJ B;  1O7W A;  3GTE A;  4RKU J;  2NUM A;  2WSE J;  2ZT9 B;  2B1X A;  2E76 B;  4NBF D;  4NBA D;  2YIU C;  4NBB D;  4KT0 J;  2O01 J;  1BCC E;  1JM1 A;  2E4P A;  2HML A;  1VM9 A;  3GCE A;  3N0Q A;  2QPZ A;  5L8R J;  4OGQ D;  4EMJ B;  4OGQ B;  1L0N E;  3GB4 A;  2QJY C;  3CWB E;  1NTM E;  2I7F A;  1P84 E;  2BMR A;  2QIW A;  2E76 D;  4HM2 A;  1Q90 C;  5BOK A;  2YFI A;  3GL0 A;  1VF5 D;  2BCC E;  4HM6 A;  1KB9 E;  4QDD A;  2QJK C;  1WQL A;  5KLI C;  1Q90 D;  3VMG D;  1UUV A;  5CXM A;  2D2C B;  1G8J B;  2YFL A;  3L71 E;  4QCK A;  1SQV E;  4H0L B;  3DQY A;  3GL2 A;  2GBW A;  3EN1 A;  5HL4 A;  4IL6 X;  2XSO A;  5AEU A;  2IBZ E;  2DE7 D;  4QUR A;  4AIV A;  2WSC J;  1O7H A;  1VCK A;  4NBD D;  1O7N A;  2D2C D;  3EQQ A;  2WPV B;  4NBG D;  1SQB E;  2QJP C;  3FOU A;  5KKZ C;  2A06 E;  2E4Q A;  4NBH D;  1SQX E;  4I7Z B;  4NB8 D;  3GTS A;  1JB0 J;  1NYK A;  3D89 A;  3H1I E;  2CKF A;  1SQP E;  3CX5 E;  4NB9 D;  2WSF J;  3VCA A;  4H44 B;  2NVE A;  1SQQ E;  2FYN C;  2NVG A;  3GZY A;  4QUQ A;  3C8V A;  4HM1 A;  1ZRT E;  3H1J E;  2HMK A;  2E74 B;  3H1K E;  4P1C H;  5KLV E;  1NTK E;  3L74 E;  2Q3W A;  3TGU E;  4AAY B;  2K9Y A;  4NBE D;  1KYO E;  2JZA A;  4QDC A;  1ULI A;  2BMQ A;  1O7P A;  4HM7 A;  4HM8 A;  2FYU E;  3VMI D;  1G8K B;  4QDF B;  3L73 E;  2HMM A;  1FQT A;  1O7M A;  2XRX A;  4H44 D;  1NTZ E;  2HMJ A;  4H0L D;  1UUW A;  1BE3 E;  3BCC E;  1O7G A;  2YFJ A;  1SJG A;  2E75 D;  2XSH A;  4HM4 A;  4PV1 D;  4QDF A;  3GZX A;  1PP9 E;  2ZYL A;  1EG9 A; 
#chains in the Genus database with same CATH topology
 2JR8 A;  1RF1 A;  2BCC J;  3GOB A;  1E5W A;  5CBN A;  4AUW A;  2XR8 A;  1DEE G;  5AW4 B;  4NPE A;  2QM7 A;  3CCR P;  1SQQ J;  2E75 B;  5KAI H;  3RGU A;  2N9Y B;  3H1L J;  1LTI C;  1SQP J;  4XA4 A;  2QA4 P;  1BCC J;  1AVY A;  3N4X A;  3TGU J;  2YXR B;  1W2B O;  4H13 C;  1FZC A;  4NBC D;  3TGU G;  4HJL A;  1LNQ A;  2XNX A;  2IFM A;  2KOG A;  2V7Q H;  3H1L G;  2BCC D;  2A06 G;  3A0B H;  4M3L A;  3I55 P;  2Y9Z A;  3FXD A;  1IFM A;  1Z56 A;  3GL0 A;  3H1K G;  3D6Y A;  2GUV A;  1NTZ G;  3H1H J;  1JY2 O;  2YMY A;  4A7P A;  2FYU G;  3SFE C;  1SQV E;  3Q1M A;  1L2P A;  3EN1 A;  1NTZ J;  1GW4 A;  3Q5P A;  1EZV D;  3W67 A;  3EQQ A;  3PH0 A;  3HUS A;  4OVN F;  1SQX E;  3KZI E;  5M1B A;  4IFM A;  1W2E A;  2KZJ A;  2J5U A;  2MKV A;  4P1C H;  1NKZ B;  4BRY A;  1RE3 C;  1JNM A;  1QVG O;  1BGY G;  4HM8 A;  2CPB A;  4HKZ H;  1PFI A;  1EDK A;  4H44 D;  3FXE A;  1NO4 A;  4QDF A;  3B4S A;  2YNY A;  3H1L E;  3L75 G;  3L70 E;  2IBZ I;  3TNU A;  1HH0 A;  3PHL A;  5CCG D;  4PD4 E;  3H32 A;  1OW8 A;  2WIT A;  3U1A A;  1EZV E;  4C7N A;  4H13 B;  2WPR A;  1SQV D;  2AXT H;  1SQX G;  3OAK A;  1HGZ A;  3NMD A;  1OFC X;  1PGP A;  2W83 C;  1N7S C;  1SQB D;  1FZA A;  1HF9 A;  3S9O A;  1KYO H;  2L5G B;  2OTJ P;  3CCV P;  4HB1 A;  1NH4 A;  1QX8 A;  1N73 B;  1KOR A;  5KJ7 D;  1RF1 C;  2ZYA A;  3CCM P;  3KDP B;  3H1H D;  2JWA A;  4L75 A;  1VF5 D;  3SWK A;  1KTM A;  2ZXE B;  4YPC A;  3RK3 B;  1M1J B;  2D2C D;  1GZL A;  3M9B A;  1J1D C;  3B5N D;  1A02 F;  3O6Q B;  1KB9 H;  1SQV K;  1JUN A;  1N7S D;  2KS1 B;  4C7R A;  1L0N J;  2G8Y A;  2YO2 A;  2BCC G;  1KYO E;  3VMI D;  3L73 E;  2K1A A;  1O7M A;  1MZ9 A;  3RK3 D;  3MHV A;  5AW1 B;  5KLV D;  1Q86 Q;  1LTA C;  1MUU A;  1P84 I;  1G1J A;  3L71 D;  2P1J A;  1L0N D;  2NVF A;  3CCE P;  3AZC A;  3M91 A;  3LW5 J;  2WWW A;  1GD2 E;  2GBX A;  2C9L Y;  3H1J D;  5B5E E;  1ZP0 C;  1VQ4 P;  4IL6 E;  2YVJ B;  3HE5 B;  2WT7 B;  2YIU C;  2HG5 D;  3GCE A;  1NU1 G;  2R3C A;  2AXC A;  2QPZ A;  5AW7 B;  2QJY C;  4K35 A;  1DX7 A;  1URQ B;  3L70 G;  3CXH I;  3BAS A;  1HBW A;  5KLV K;  3VMG D;  1QVF O;  1OZH A;  4ZMD A;  1X22 A;  5KKZ B;  1NTM J;  1PGJ A;  1PL5 A;  1FU1 A;  2DE7 D;  2O1K A;  1S1C X;  1JY2 N;  1AA0 A;  3WUT A;  1VQK P;  3FWN A;  2E4Q A;  3A3Y B;  2D2C C;  3AEE C;  3VP9 A;  2FXM A;  1YTZ I;  3GHG C;  4JYC A;  5TIS E;  1RQU A;  3RL0 B;  3TF5 A;  4RO0 A;  1HVV A;  2JZA A;  1X79 B;  2NZ2 A;  1QL2 A;  2P2U A;  1ZME C;  3V2P A;  2KP8 A;  2E5T A;  1CZQ A;  3VMX A;  2ZJS E;  3AE9 C;  1RF1 B;  5BU5 A;  3CX5 D;  3KQG A;  1FBM A;  1IC2 A;  3H32 B;  3B5N B;  1M57 D;  2OYI A;  4ASV A;  1JO5 A;  1YQ3 C;  2G3A A;  1EZV G;  2FXO A;  3E1R A;  2PAJ A;  3FGA D;  3P32 A;  4DOJ A;  2DE6 D;  2V4H A;  3A2A A;  1JMM A;  1T8Z A;  1KQG B;  4KT0 J;  3F89 A;  3AE7 C;  1VM9 A;  4OGQ D;  2I7F A;  5APW A;  4RJT A;  2M5A B;  3GF3 A;  3CCL P;  1Q90 C;  1IFD A;  2I1J A;  5AW9 B;  5CBO A;  1ZR4 A;  1BGY E;  3JCU E;  1URQ A;  3QH9 A;  2K88 A;  4XFJ A;  1S5L H;  1L4A D;  2WSC H;  5AEU A;  5AVT B;  1NYH A;  2KZI A;  4WB4 A;  3E1I A;  2A06 E;  5APT A;  3O6Q A;  3E7K A;  3V2Q A;  2POH A;  3A0H E;  4H44 B;  5AVW B;  2FYU K;  1H0T A;  2H88 C;  1W5C E;  4BXL A;  3RK2 C;  2Q3W A;  2Y0E A;  1X9V A;  5GTI H;  3L75 J;  2E76 C;  3H1K J;  2JJL A;  2PGD A;  2JO1 A;  3EQ2 A;  4I6M C;  2Q9I A;  1GMJ A;  2O01 N;  4PV1 D;  2FFD B;  5CCG C;  1VF5 C;  3H1J G;  1KIL E;  1GTW A;  3H1J J;  4IOI H;  3PTZ A;  3SFD C;  2BEQ D;  3BCC G;  3NTN A;  1ZW0 A;  4MN4 C;  3M9Q A;  1JY2 P;  2KLV A;  1NTK J;  4W7Z A;  2HMO A;  3P8C E;  3MTU E;  1L0L K;  2I1K A;  1G2C A;  3A7O A;  2H8P D;  2C0W A;  2Q3I A;  5KAI E;  3CLQ A;  2NUM A;  2E76 B;  3C9I A;  2FYU J;  5GTI E;  5L8R J;  4KJM A;  3H1H G;  2SPZ A;  2KYV A;  3Q2Y A;  1CW5 A;  2C9N Y;  3EFF K;  2VRS A;  4ZKP A;  3A0B E;  4PJ0 H;  1OW7 A;  4I7Z C;  2YFL A;  3M0D C;  3CL3 D;  5APQ A;  2Z5I A;  1VQM P;  3IN6 A;  1FZF A;  4QUR A;  2GA1 A;  4DCK A;  3ABV C;  4NB9 D;  5APU A;  3M0A A;  5CCH C;  1SFC C;  2E43 A;  1PPJ G;  2QJP B;  1GL2 B;  3AEA C;  1R5L A;  1YHQ P;  5B66 E;  2A45 G;  4HM7 A;  4N3Y B;  2HMJ A;  4IFD K;  1VQ8 P;  1SJG A;  1JY3 O;  2HR3 A;  2B24 A;  2QVA A;  2OYI B;  1NWQ A;  2J59 M;  2Z4E A;  3BRV B;  4R4L A;  2AEF A;  3FWL A;  1NTM K;  3B5N A;  2PFX A;  4P1B H;  3VMZ A;  4Y28 J;  4JPZ B;  1RE4 C;  2NWF A;  2OYH B;  3I5C A;  3KPE A;  1PZQ A;  4WY4 D;  2H43 A;  3MUD A;  2QSI A;  5B66 H;  5BVZ A;  1FDM A;  3V6I A;  3HE4 A;  3RBX A;  2KLU A;  3HD7 C;  2BMR A;  3HRN A;  2WZ7 A;  3VMY A;  3BAT A;  3L74 G;  4N78 D;  2YXQ B;  4QCK A;  2NRG A;  1MFZ A;  2FBW C;  2GBW A;  1CI6 A;  1KFN A;  2YKP A;  1KQS O;  4BWN A;  2QEX P;  3M9H A;  4I7Z B;  4WY4 C;  1H8A A;  3JC2 2;  1FOS E;  3CD6 P;  4JQ0 D;  1LT9 C;  3H1J E;  2JP3 A;  4U3F D;  2E74 B;  1GL2 D;  1JOC A;  4AAY B;  1ZLL A;  1L4A B;  4QDC A;  3G4S P;  1O7P A;  4ZNC A;  2KSJ A;  2ZYG A;  1NTK K;  2HPC B;  2K9J B;  1OXZ A;  1NAY A;  4UB8 E;  3HUS C;  2XU6 A;  4JF7 A;  1SQP D;  2NUK A;  1XTG B;  2KUB A;  3BCC D;  5CCH A;  3IAO A;  3VYI A;  2DE5 D;  2W6A A;  1NDO A;  2PRR A;  1M1J A;  4L74 A;  2L91 A;  3V4Q A;  3B8E B;  1S2E A;  4KHX A;  4RES B;  3G71 P;  1LP1 B;  1M90 Q;  2OTL P;  4EMJ B;  3N0Q A;  3AE1 C;  1K8A Q;  3GB4 A;  1SQP K;  2C0X A;  3N7N A;  5APV A;  1Q2N A;  1ZN5 A;  5APX A;  1T3J A;  2WVR A;  3G3Z A;  3M0D A;  3AEC C;  2M5A A;  1PP9 G;  1KIL B;  1S9K D;  2K37 A;  3MIW A;  4AQR D;  1SQX D;  4UB6 H;  5AW8 B;  4AIV A;  4L73 A;  3K5B A;  1VCK A;  1RQV A;  1SQB E;  5AVQ B;  1RH5 B;  3RL0 D;  5BU8 B;  1S5L E;  1HUC A;  2B9B A;  2FY8 A;  2BAS A;  2NVE A;  4Y99 C;  4D6T J;  3CX5 I;  1RE4 A;  2B87 A;  1T6A A;  2GM4 A;  3TGU E;  5TIS H;  4NBE D;  1K04 A;  2BMQ A;  4EIJ A;  2V7Q J;  2HMM A;  1WMK A;  2XRX A;  1KMI Z;  1MV8 A;  3P7K A;  5E79 E;  1UIX A;  2ZYL A;  2YMK A;  1KB9 D;  2M0B A;  3PP5 A;  2ZVO B;  1VDF A;  1ZV8 A;  1PP9 D;  2ZT9 D;  4U3F E;  3S1K A;  4YXW H;  1BCC G;  4WVZ A;  1ULJ A;  1SQP G;  3HUS B;  4QUP A;  1VQ6 P;  5KAF E;  1DIP A;  4GIF A;  3R2P A;  4HM5 A;  4W7Y A;  2Z5H A;  4HJG H;  3CXH E;  2RKL A;  4DJG A;  1NTZ D;  1QGK B;  3D71 A;  4C46 A;  1LT9 B;  3WMM 0;  5KLI B;  4H44 C;  2QJK C;  3IF4 A;  1G8J B;  3T97 A;  4H0L B;  3DQY A;  1LTJ A;  2HOD A;  5HL4 A;  1CI6 B;  2IBZ E;  1BE3 G;  1UII A;  2MJZ A;  3VTP C;  4U7J A;  1T2K C;  2KXP B;  3WU2 E;  1LP1 A;  2CPS A;  3BVH A;  3L35 A;  4QUQ A;  2IX7 C;  3U59 A;  2YIU B;  1M8O B;  2RN0 A;  5KLV G;  2QE7 H;  3L70 J;  4QDF B;  5AVV B;  1NJI Q;  1NTM G;  1FDI A;  2R5B A;  2JEE A;  2A45 H;  2P10 A;  3V2R A;  2ZT9 C;  3MD0 A;  3LIE A;  3G6E P;  3CMA P;  2OYI C;  1S9K E;  1YJW P;  3IFM A;  2JO6 A;  1OVR A;  1LWU B;  1S4X A;  1FZC B;  1LTG C;  3SWF A;  2N1T C;  4OWF A;  2WPQ A;  2KB7 P;  2KK7 A;  1KD1 Q;  2IFN A;  4NBB D;  1GL2 C;  1HTL C;  3RL0 g;  2WSS H;  3VOP A;  1AV1 A;  3AEG C;  4HM2 A;  3KZI H;  2KI7 B;  3GHG B;  5CXM A;  2FFD A;  1GK6 A;  1YI2 P;  3AED C;  1J1D B;  3PJS K;  1PGQ A;  3MGN A;  2DW3 A;  1SQV G;  4NBD D;  3QWO C;  1OVU A;  4NBH D;  2UWJ E;  2FYU D;  4WWI A;  1FZC C;  1FZG A;  1LWU C;  2NVG A;  2LXB A;  1SVF A;  4HYT B;  3LID A;  3L74 E;  4WBA A;  2QJY B;  4OGQ C;  1KIL D;  3OW2 O;  4PD4 H;  1LT1 A;  3PRJ A;  1N7S B;  2IZ0 A;  1N7S A;  3KYQ A;  3L72 J;  1G1I A;  2XND H;  1RHZ B;  3KXD A;  4EDF A;  5KJ7 C;  4O9B A;  4HM4 A;  3KHU A;  2GUS A;  1JTH B;  4R4M A;  4EOT A;  4Z1M H;  3CCU P;  1PIX A;  3GKE A;  3H1K D;  2LXC B;  1MKM A;  2N1T B;  3CPW O;  4QMA A;  1VF5 B;  1L0L E;  1N2D C;  1NTK G;  1OIP A;  1SLQ A;  3CXH D;  4LGD E;  2A06 D;  2BEZ F;  1SFC D;  3I56 P;  1FZB A;  1NU1 E;  1J2J B;  2IYP A;  3SSU A;  4C7N B;  3PLN A;  2HMN A;  1O7W A;  4RKU J;  4NBF D;  2N1T D;  1JMB A;  2NPS A;  1EDI A;  5EFW B;  3RK2 B;  1NTM E;  1LJ2 A;  2P58 A;  5APY A;  1BSN A;  2XDJ A;  2QIW A;  3R4Y A;  1J1E C;  2BCC E;  1Q82 Q;  1KB9 E;  2AEJ A;  2QJK B;  5KLI C;  5AVZ B;  1OW6 A;  3L71 E;  1YYC A;  5CHX A;  3GL2 A;  2XKM A;  2M3E A;  1O7H A;  1DD3 A;  3HTK A;  4CPG A;  1GW3 A;  1S3J A;  3AE6 C;  3L73 D;  1JB0 J;  2E42 A;  1NYK A;  3D89 A;  1JCD A;  4XE5 B;  3VCA A;  4D6T E;  1VQP P;  1K05 A;  1N7L A;  3TK1 A;  1DD4 A;  3SWY A;  1H0T B;  1VQ9 P;  1N73 C;  1JY3 N;  1EXI A;  4D6T D;  5AW0 B;  1YJN P;  2FKW B;  3GF7 A;  5B5E H;  3EWK A;  1O7G A;  1JEK A;  4NPF X;  1BE3 D;  4IL6 H;  3GZX A;  4N6J A;  1GK4 A;  1AQ5 A;  1KIL A;  1FS0 E;  1FAV A;  2KSE A;  3H1I G;  3B5N C;  3ITK A;  3CME P;  2R32 A;  1BDC A;  1LWU A;  3H1I D;  1PPJ E;  2Q5U A;  1VQN P;  3WUU A;  4H13 D;  5CMZ A;  2O1J A;  1VQ7 P;  1YIJ P;  1BE3 J;  4D6T G;  2IYO A;  5KJ7 A;  1Q81 Q;  2OTK E;  1L0N K;  2E4P A;  2HML A;  1SQX K;  1NOH A;  1SQQ G;  1U57 A;  1XTC C;  1FOS F;  5BOK A;  1BCC D;  3HD7 D;  1OX3 A;  1J1E B;  2D2C B;  2Q3E A;  3JSV C;  2HFE D;  2W8Z A;  2XSO A;  2IPP A;  1O7N A;  5AVR B;  1FZE A;  1ZOY C;  5KKZ C;  1QEX A;  1H88 A;  5K5G B;  1EDL A;  3B71 A;  4NB8 D;  4UB6 E;  2LR2 A;  2FYN C;  4EYY Q;  5AW6 B;  1LTT C;  2IBZ D;  3GZY A;  3C8V A;  4GOD A;  2HYN A;  3D6Z A;  1HJ0 A;  2J58 A;  5H2F E;  2K3R A;  2K9Y A;  2NPS B;  1FDO A;  2WSF H;  3V4W A;  2P7J A;  5C39 A;  1P84 H;  4H0L D;  1BE3 E;  3EFG A;  1NAF A;  1NU1 J;  2Q6Q A;  1NTK D;  1VPC A;  1RIE A;  3T97 B;  3OJA B;  1KZU B;  2W27 A;  2LKM A;  1KN7 A;  1AJY A;  1NTZ K;  1SQB K;  1L4A C;  1USD A;  2Q1K A;  3L71 G;  1USE A;  5AW2 B;  2E74 C;  3MZW B;  1RF0 C;  4GDO A;  3A5T A;  1RFS A;  1NKN A;  1BDD A;  1FJP A;  2ZYD A;  1A02 J;  1P84 D;  3JCU H;  1D7M A;  5CCH D;  3Q5R A;  5KAF H;  1PP9 J;  3CCJ P;  3L72 D;  4I1L A;  3CXH H;  2B89 A;  1P84 E;  5AVU B;  5CCG A;  2YFI A;  3A0H H;  1RY3 A;  2H89 C;  2AEM A;  1NU1 K;  3L73 G;  3TGU D;  4EI2 A;  4IFF A;  3HD7 B;  1M1J C;  1ZR2 A;  4NBG D;  4DT0 A;  2QG4 A;  1PGO A;  1Q7Y Q;  4YXD C;  1SQP E;  2HLO A;  1L0N G;  1Y8A A;  3H1K E;  5AVY B;  4JBZ A;  4BRY B;  2Q7C A;  4GOE A;  3AE2 C;  1R5S A;  1N8R Q;  5AVX B;  1E79 H;  2W90 A;  2PP6 A;  1N86 A;  2R3S A;  2ZAE B;  3L37 A;  1PP9 E;  3H1H E;  2HPC A;  1R8E A;  1EDJ A;  1LTJ B;  2R44 A;  1KQL A;  3C0D A;  3L74 D;  2WTY A;  3H25 A;  3WUV A;  1WRG A;  5CJ4 A;  1DH3 A;  2E74 D;  4PJ0 E;  1SQV J;  5AEW A;  3GTE A;  3P8C D;  2ZT9 B;  2B1X A;  1EZV I;  1RE3 A;  2WPS A;  2NPS D;  3VMA A;  4U3F G;  2KNC B;  3W68 A;  1T3U A;  3GLM A;  1LGH B;  1OVV A;  1WQL A;  1Q90 D;  1UUV A;  2IDB A;  3IR9 A;  2JDI H;  3AEF C;  3L73 J;  3L75 D;  1NHL A;  5APS A;  3HTK B;  2WPV B;  1U7J A;  1SFC B;  1BGY J;  2P67 A;  1SQQ E;  1JY3 P;  4HM1 A;  1ZRT E;  3RK3 E;  4JYB A;  1KQF B;  3MUD C;  3CWB G;  2K9J A;  1SQB G;  4H0L C;  3BRT B;  1GL2 A;  3L71 J;  2ZFC A;  1CSB A;  3BCC E;  4NPD A;  3HD7 A;  2FFD C;  3CC2 P;  2M8R A;  1QLE D;  1BGY D;  1U7M A;  2CK3 H;  2A45 I;  3ZDM A;  1EG9 A;  5KLV J;  1FC2 C;  2E75 C;  5TJH A;  4PV1 C;  4PD4 D;  2E5Y A;  1YIT P;  2IBZ G;  4HM0 A;  1Y9B A;  1NGM B;  1FE6 A;  3L70 D;  1VQO P;  2H7H A;  3VMH D;  2QM8 A;  2OYH A;  3L72 E;  3LW5 H;  2R5D A;  3MP7 B;  2BMO A;  4W80 A;  1FJK A;  3L75 E;  1OWA A;  2KS1 A;  2WT7 A;  1SS1 A;  1JM0 A;  3G9R A;  1JM1 A;  2O01 J;  2B87 B;  2XV5 A;  2KIK A;  1NU1 D;  4HM6 A;  2FYN B;  1ZXG A;  3TDK A;  3GG2 A;  3CWB J;  3NFQ A;  1IK9 A;  1IO4 A;  4HH2 A;  2WMM A;  3NXS A;  2IZ1 A;  1YQ4 C;  1SQQ K;  3FOU A;  4GOF A;  5AW5 B;  2N1T A;  1SQB J;  3AE3 C;  1AQT A;  4Y99 B;  2HOD B;  4GKG A;  2CKF A;  2O01 H;  1T2K D;  2JKV A;  3OA7 A;  1SFC A;  1PV3 A;  4PD4 I;  1K73 Q;  2HMK A;  3BCC J;  3H1I J;  1K9M Q;  4DZO A;  1NTM D;  1ULI A;  1G8K B;  1KIL C;  3D70 A;  1KYO I;  1M7L A;  3TNU B;  3RBZ A;  2YFJ A;  2XZR A;  2WSE H;  3C1L A;  1X8Y A;  1IFJ A;  4HKV A;  2FYZ A;  3V2N A;  3VCP A;  3AE5 C;  2Y0D A;  2AXT E;  4U3F J;  1G2C B;  1KFM A;  2YKQ A;  4N78 E;  4PV1 B;  3GW6 A;  1AFO A;  1KC8 Q;  3RL0 C;  3CX5 H;  4TLF A;  1M56 D;  4UB8 H;  4WY4 A;  4WY4 B;  2RMZ A;  1N73 A;  2O3J A;  1HWT C;  1KB9 I;  3L36 A;  3P8M C;  2OQQ A;  4TT3 H;  1LT9 A;  2ZVN B;  2WSE J;  5CJ0 A;  3M06 A;  1JCC A;  3CCS P;  1TU3 F;  1QL1 A;  4AYC A;  3II6 A;  1L0N E;  4OH8 B;  3VN0 A;  2W6B A;  1BSH A;  1PPJ D;  5AW3 B;  2E76 D;  4ASW A;  3L72 G;  3AEB C;  3TSI A;  1IFP A;  3S4R A;  4QDD A;  4LC1 A;  1URQ C;  2W6J H;  1YTZ T;  1MFT A;  1AVO A;  2WSC J;  2QRX A;  1SP4 A;  1KYO D;  2OAR A;  1KV4 A;  2I8D A;  3FX0 A;  3VP8 A;  1L0L J;  3CX5 E;  4YTP C;  5E79 H;  1IFN A;  3CWB D;  2JWD A;  1HGV A;  1L0L D;  2OYH C;  3HE4 B;  1L0L G;  1NTK E;  1ZRT D;  1SQQ D;  3GMA A;  5DJT B;  1IZN B;  3GHG A;  2OGU A;  3HE5 A;  1FQT A;  1WT6 A;  2RH0 A;  2ITA A;  5H2F H;  1X0T A;  1UUW A;  3V5B A;  1L4A A;  1GDT A;  2WQY C;  1URQ D;  1IK7 A;  4I2L C;  3TYY A;  3O8Z A;  5DJU B;  3CCQ P;  2B88 A;  4ZKU A;  2Y0C A;  1LTB C;  1LTJ C;  1S5L X;  2YO3 A;  1JTH A;  1Y47 A;  4B86 A;  4HM3 A;  1VQ5 P;  1VL2 A;  3AE4 C;  1OMI A;  3CI9 A;  1M1K Q;  3AE8 C;  3H6P A;  2OYO A;  5AVS B;  1YJ9 P;  5GTH E;  2NPS C;  4NBA D;  2Y9Y A;  1BCC E;  1GU4 A;  4L76 A;  3RK2 D;  3RK3 C;  4OGQ B;  3CWB E;  3L74 J;  2KNC A;  3L4F A;  3UIA A;  1NVO A;  3U1C A;  3F5H A;  3H1L D;  1LTS C;  1VQL P;  1EXJ A;  2N9B A;  1EQ7 A;  4LLH A;  3CC4 P;  1HJB A;  4IL6 X;  3Q3D A;  1IJD B;  3CC7 P;  2QJP C;  4K3A A;  1DEB A;  1GU5 A;  2M3B A;  3GTS A;  1YBK A;  3H1I E;  1EC5 A;  2WSF J;  3Q5S A;  2FXP A;  5KLV E;  2YKO A;  5GTH H;  1SQX J;  2FYU E;  5KTB A;  4GT1 A;  1S72 P;  1IFI A;  1NTZ E;  2ZXX A;  3WU2 H;  1H89 A;  2E75 D;  2XSH A;  3USS A;  1RF0 A; 
#chains in the Genus database with same CATH homology
 3H1H E;  1KIL E;  3SFD C;  2P10 A;  3GOB A;  1R8E A;  2BEQ D;  2XR8 A;  3C0D A;  2ZT9 C;  3H25 A;  2E75 B;  2HMO A;  2JO6 A;  2E74 D;  4H13 C;  4NBC D;  5AEW A;  4HJL A;  3GTE A;  2NUM A;  2ZT9 B;  2B1X A;  2E76 B;  4NBB D;  5L8R J;  3RL0 g;  3AEG C;  4HM2 A;  3Q2Y A;  3GL0 A;  3D6Y A;  3GLM A;  1WQL A;  1Q90 D;  1UUV A;  2IDB A;  1OW7 A;  4I7Z C;  2YFL A;  5CXM A;  3AEF C;  3AED C;  3SFE C;  1SQV E;  3Q1M A;  3EN1 A;  3Q5P A;  3IN6 A;  4QUR A;  4NBD D;  3EQQ A;  2WPV B;  4NBH D;  1SQX E;  3ABV C;  4NB9 D;  5M1B A;  1SQQ E;  2NVG A;  4HM1 A;  1ZRT E;  2J5U A;  3RK3 E;  2MKV A;  4P1C H;  1KQF B;  3L74 E;  3AEA C;  4OGQ C;  4HM7 A;  4HM8 A;  4H0L C;  4H44 D;  2HMJ A;  3BCC E;  1SJG A;  4HM4 A;  4QDF A;  1EG9 A;  2B24 A;  3H1L E;  3L70 E;  2E75 C;  4PV1 C;  4R4M A;  4R4L A;  4Z1M H;  4HM0 A;  4PD4 E;  1PIX A;  1Y9B A;  3GKE A;  1NGM B;  4P1B H;  1OW8 A;  4Y28 J;  3VMH D;  1MKM A;  1EZV E;  2NWF A;  3L72 E;  1VF5 B;  1L0L E;  4H13 B;  2BEZ F;  2BMO A;  1NU1 E;  3L75 E;  2QSI A;  2HMN A;  1O7W A;  4RKU J;  4NBF D;  1HF9 A;  3S9O A;  3G9R A;  1JM1 A;  2O01 J;  1KOR A;  1NTM E;  2BMR A;  2QIW A;  3R4Y A;  1VF5 D;  2BCC E;  4HM6 A;  1KTM A;  1KB9 E;  5KLI C;  1OW6 A;  3L71 E;  4QCK A;  3GL2 A;  2FBW C;  2GBW A;  1YQ4 C;  1O7H A;  1DD3 A;  2D2C D;  3FOU A;  3AE3 C;  3AE6 C;  4I7Z B;  1JB0 J;  1NYK A;  3D89 A;  2CKF A;  3VCA A;  1PV3 A;  1K05 A;  2JP3 A;  3H1J E;  1DD4 A;  2HMK A;  2E74 B;  2G8Y A;  4AAY B;  1KYO E;  4QDC A;  1ULI A;  1O7P A;  3VMI D;  1EXI A;  1G8K B;  3L73 E;  3D70 A;  1O7M A;  3GF7 A;  3EWK A;  1O7G A;  2YFJ A;  3GZX A;  4HKV A;  3VCP A;  3AE5 C;  2NUK A;  2NVF A;  3AZC A;  1PPJ E;  3IAO A;  3LW5 J;  2GBX A;  4PV1 B;  2DE5 D;  1ZP0 C;  4H13 D;  1NDO A;  2YVJ B;  2OQQ A;  4TT3 H;  2WSE J;  2YIU C;  1TU3 F;  2E4P A;  2HML A;  3GCE A;  4EMJ B;  3N0Q A;  3AE1 C;  2QPZ A;  1L0N E;  3GB4 A;  2QJY C;  1U57 A;  2E76 D;  5BOK A;  3AEB C;  4QDD A;  3VMG D;  2D2C B;  3AEC C;  1PL5 A;  2XSO A;  2DE7 D;  4AIV A;  2WSC J;  1VCK A;  1O7N A;  1S1C X;  1RQV A;  1SQB E;  1ZOY C;  5KKZ C;  2E4Q A;  2D2C C;  3AEE C;  3B71 A;  4NB8 D;  3CX5 E;  4YTP C;  1RQU A;  2NVE A;  2FYN C;  3GZY A;  3C8V A;  3D6Z A;  1HJ0 A;  1NTK E;  3TGU E;  2K9Y A;  3GMA A;  4NBE D;  1K04 A;  2JZA A;  1FDO A;  2BMQ A;  2V7Q J;  2HMM A;  1WMK A;  2NZ2 A;  1FQT A;  2XRX A;  4H0L D;  1UUW A;  1BE3 E;  1KMI Z;  1ZME C;  2WQY C;  1UIX A;  2ZYL A;  2YMK A;  1IK7 A;  3AE9 C;  1RIE A;  3T97 B;  2ZT9 D;  4U3F E;  1AJY A;  1ULJ A;  1S5L X;  4HM3 A;  4QUP A;  2E74 C;  1YQ3 C;  2G3A A;  4GDO A;  1VL2 A;  3AE4 C;  3FGA D;  1RFS A;  1DIP A;  1OMI A;  4HM5 A;  2DE6 D;  3AE8 C;  3CXH E;  1KQG B;  3Q5R A;  4NBA D;  4KT0 J;  1BCC E;  3AE7 C;  1VM9 A;  4OGQ D;  4OGQ B;  3D71 A;  3CWB E;  2I7F A;  1P84 E;  3GF3 A;  1Q90 C;  2YFI A;  4H44 C;  2QJK C;  1EXJ A;  2H89 C;  1G8J B;  4XFJ A;  4H0L B;  3DQY A;  5HL4 A;  4IL6 X;  3Q3D A;  5AEU A;  2IBZ E;  4NBG D;  1NYH A;  2QJP C;  2A06 E;  4YXD C;  3O6Q A;  4U7J A;  3GTS A;  3H1I E;  1SQP E;  2WSF J;  3Q5S A;  2FXP A;  4H44 B;  4QUQ A;  3H1K E;  2H88 C;  5KLV E;  2Q3W A;  3AE2 C;  2FYU E;  2E76 C;  4QDF B;  2JO1 A;  1NTZ E;  1GMJ A;  2E75 D;  2XSH A;  4PV1 D;  1FDI A;  1PP9 E;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...