1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase/metal transport
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
4OGQB 1KB9E 3GB4A 3LW5J 1WQLA 5CXMA 2YIUC 2ZT9D 4P1BH 4PV1B 2E74B 1O7GA 1O7NA 2E75B 1G8KB 2E76B 4H0LB 1KYOE 3GZXA 4KT0J 1EG9A 3DQYA 3CX5E 4H44B 3CWBE 4NBED 1O7HA 4PD4E 2JO6A 1ZRTE 2YVJB 3C0DA 2BMRA 3H1HE 2QJYC 2QIWA 2WSFJ 5KLIC 3H1KE 1VF5D 2FYUE 2Q3WA 1O7WA 4QURA 2E4PA 5HL4A 2GBWA 5KLVE 4NBGD 3TGUE 4HM5A 2D2CD 1VM9A 4OGQD 3D89A 4QUPA 4AAYB 4IL6X 3GKEA 3GOBA 4PV1D 5AEUA 1NTKE 3H1LE 1SQPE 2NVFA 2E75D 2XSHA 2E76D 2K9YA 2XSOA 4H0LD 4P1CH 4QUQA 4AIVA 1NYKA 3GL0A 4H44D 1NDOA 3GCEA 3GL2A 5AEWA 2DE6D 1ULIA 1UUVA 2HMKA 3GTEA 4HKVA 2DE5D 4EMJB 4HM4A 4I7ZB 5BOKA 3L72E 2HMJA 3L70E 4QDFA 2YFJA 1NU1E 3GZYA 2ZYLA 1SQQE 2B24A 2B1XA 3EN1A 4NBAD 4H13B 1ULJA 4NBFD 4NBHD 3VMGD 3H1JE 4QDDA 2BMQA 4HM3A 2NVGA 2A06E 2HMLA 3VCAA 3EQQA 2E74D 1FQTA 2YFLA 4RKUJ 1SQXE 4HM1A 4QDCA 2NVEA 4HM7A 3VMHD 1Q90D 2XR8A 1O7MA 2GBXA 2HMOA 4NBDD 1L0NE 2O01J 2DE7D 2E4QA 1G8JB 4HJLA 3N0QA 2NUKA 2IBZE 1JM1A 3C8VA 2JZAA 1PP9E 1Q90C 3VCPA 1NTZE 2NWFA 1L0LE 4HM8A 3GTSA 1O7PA 3L74E 2WSCJ 1RFSA 3FOUA 4Y28J 1S5LX 5KKZC 2WSEJ 1JB0J 1SQVE 1SQBE 3L71E 1PPJE 4NB8D 2ZT9B 1BE3E 2FYNC 4QDFB 4H13D 4NBCD 1RIEA 1VCKA 2HMMA 1NTME 3BCCE 2QJKC 2QJPC 3CXHE 2QPZA 2HMNA 4U3FE 2BMOA 2XRXA 3AZCA 3L73E 4HM2A 4NBBD 3H1IE 2YFIA 4NB9D 5L8RJ 1UUWA 4HM0A 1VF5B 2NUMA 1EZVE 2BCCE 4QCKA 1BCCE 1SJGA 4HM6A 3VMID 1P84E 2I7FA 2D2CB 2WPVB 3L75E 2CKFA 2QSIA
chains in the Genus database with same CATH superfamily
3EWKA 2W6JH 2JKVA 1VQOP 1N7LA 5CMZA 3TNUA 2C0WA 3HE4B 1LGHB 5BU5A 5CJ4A 2XKMA 1OIPA 4BWNA 3CX5D 1HUCA 2RN0A 2IFMA 1SQBD 4ASVA 1HGZA 2B87B 3TSIA 2GBWA 1QVFO 1VQNP 4N78D 1OVUA 3KPEA 5APTA 2Z5HA 3D6YA 3IAOA 1NTKE 4OWFA 1LWUC 1EDLA 1NYKA 2E74C 1QVGO 2O1JA 1NU1G 1SQPK 1W2EA 4K3AA 3L72E 2ZYLA 1G2CB 4D6TD 1LT9A 1BGYJ 2P2UA 2HMLA 2V4HA 1Q90D 2KYVA 4L76A 1PGPA 1J2JB 1VQLP 3GTSA 1NH4A 1L0NK 1S5LX 5KKZC 1SQBE 1AQ5A 1NWQA 1RE4A 3GHGB 2KLUA 3H32B 3V4WA 1Q81Q 1LTIC 2M8RA 1VCKA 2J5UA 4N78E 1AA0A 2M3BA 1QGKB 1A02J 2KS1B 4C7RA 4I6MC 1R5SA 1UUWA 2ZYDA 1U57A 1SQQD 1BE3D 3WMM0 3VOPA 2AXCA 2YNYA 2LXCB 1ZLLA 2WT7A 1OMIA 3GB4A 3A0BH 2JR8A 2O1KA 3HD7B 4D6TE 2Z5IA 2R5BA 3L70G 3USSA 2FYUE 1JO5A 2ZVNB 2ZAEB 4C46A 4HB1A 3IR9A 5H2FE 1DEBA 1LTGC 1MKMA 3PLNA 2DE6D 1BCCJ 4HKVA 3L71J 1ZMEC 2WVRA 1YYCA 1SQQE 1X0TA 5AVZB 1YTZT 4HM3A 2A45G 1GL2B 3VCAA 2Y9ZA 3AEEC 1BSNA 1EZVG 3H1KJ 1KB9I 5APXA 4UB6H 1WT6A 3GW6A 2JWDA 3N4XA 1PPJG 1BDCA 4HM8A 2WSEJ 5GTIH 1JY3O 3PP5A 3CWBG 4KJMA 2OYIB 2QJYB 4O9BA 3NXSA 1RF1A 1SFCD 1KN7A 4NB9D 5AW4B 4LC1A 2JJLA 3K5BA 1RH5B 4OGQB 3B8EB 4Z1MH 2R44A 2V7QH 1AVOA 3V2NA 3ABVC 1ZR4A 1YITP 3AEGC 1KFMA 3DQYA 2LXBA 1N73A 4PD4E 3AE9C 1PFIA 1NTZJ 1LT9C 2FXOA 1VF5D 2ITAA 2V7QJ 2Q3WA 3AE3C 3T97B 1O7WA 3RL0D 1GU4A 2M5AA 3BCCJ 3JCUH 1IC2A 4IL6X 4YTPC 1LTAC 5KLVK 1HVVA 4AIVA 2C9NY 3HE5B 3Q2YA 2ZFCA 1KILA 2E75C 1JY2P 1T2KC 3M0DA 1FE6A 1KB9D 5BOKA 1RE4C 2P10A 3MP7B 4QDFA 5KAIE 3H1JG 2WTYA 2B24A 1ULJA 1NKNA 3GG2A 3EFGA 3HUSA 2IZ1A 2IBZG 4NBDD 2O01N 2HFED 3C8VA 4I2LC 3TGUJ 2BEZF 3VCPA 1O7PA 3IF4A 1SQVE 3G4SP 2FYNC 4YXWH 1LJ2A 2N1TA 1KILE 3H1HG 2QJPC 5KLIB 1T3UA 1PP9D 3HTKA 2BCCG 1LTBC 3VP8A 3FXDA 3SWYA 1J1DB 5KLVJ 3F5HA 3VMYA 2WPVB 3L75E 1SQPG 1PL5A 3QWOC 1KB9E 1SQXD 2AXTE 4H0LB 2QM8A 2IPPA 1FZAA 2YVJB 2MKVA 1L0LJ 3C1LA 1AVYA 2QE7H 1RF0A 2HPCA 4EOTA 1NTMD 4QUPA 4RESB 2H88C 4QMAA 3L73J 2QM7A 3H1IJ 3SWFA 4PV1C 3GL0A 2HMKA 2KK7A 3S9OA 3L70E 1T8ZA 1RF1C 3Q5SA 3VMGD 1KC8Q 1S9KD 2W83C 1GMJA 1SQXE 3VMHD 3RK2C 2GBXA 2PFXA 2I1KA 3N0QA 4A7PA 1NJIQ 1SQBG 5APYA 3VMZA 4GIFA 3G6EP 1RE3A 1LP1A 2XDJA 1YJ9P 3A3YB 3JSVC 3W67A 1N73C 1USDA 2P67A 2NPSB 3P8MC 2RMZA 1NTME 5AVRB 4H13C 4R4MA 4OVNF 1SLQA 2HLOA 4HM0A 1KV4A 1NU1J 1EZVE 1K9MQ 2E5TA 4QCKA 2QRXA 3L37A 4DOJA 5GTHH 5CBNA 3E7KA 3H1LJ 4D6TG 1KILC 5AW1B 1G8KB 3M0DC 1SVFA 2P1JA 2ZT9C 5KAFE 4H44B 3CWBE 2B88A 3VTPC 1S9KE 1O7HA 2K9JA 1NYHA 3AE6C 2HODB 1IFIA 1URQB 3RBXA 3OA7A 3HUSC 3CMAP 4HM5A 2OARA 1BGYD 5AW9B 2WPSA 1JY3N 1H88A 1GK6A 2ZYAA 1VQ4P 2XSHA 5CBOA 1N86A 4P1CH 3HD7D 1NO4A 5E79H 3I56P 1Z56A 5AEWA 1T6AA 1SQQG 1BE3G 2N1TC 2O01H 2KB7P 2KUBA 3I5CA 3EQQA 4I1LA 1KQSO 4HM7A 3D70A 3NFQA 1YTZI 2O01J 1MZ9A 2YMKA 2MJZA 1H89A 1FDIA 2YIUB 5AW3B 1HH0A 2FXPA 3A7OA 4I7ZC 1N7SA 1YHQP 1YIJP 1GL2D 1RF0C 2QPZA 5BU8B 2KNCA 3G71P 2A45H 4HYTB 5B5EH 3CCRP 4BRYB 3CL3D 2H89C 1FS0E 2UWJE 4LGDE 3CPWO 1VPCA 1GL2A 3B71A 4GOEA 4IFMA 4DJGA 4C7NB 1L0ND 5B66H 5CCHD 1DD3A 3AECC 3ITKA 4WY4B 1R8EA 3ZDMA 1UIIA 3L71D 2Q9IA 3H1HE 3CXHI 5HL4A 1GW4A 5CCGD 4OGQD 1JMBA 4WVZA 5KJ7A 2IZ0A 5AEUA 1SQPE 1PGQA 2YO2A 3H1KD 1M57D 1RE3C 3NTNA 3GCEA 3PHLA 1NAYA 2XNXA 3SFEC 2M3EA 3WU2E 1FC2C 2Y9YA 1RQUA 3D6ZA 3EN1A 4W80A 1S5LE 1LTTC 1K8AQ 3CCJP 2OYOA 3FXEA 2JO1A 1L0NE 5K5GB 2DE7D 2WMMA 3O6QB 2OQQA 4EI2A 1SQVG 4RO0A 3KZIH 2KOGA 4YPCA 3LIDA 2XNDH 3P7KA 2HR3A 1FJPA 5AVVB 3AZCA 1GD2E 1FZFA 2YFIA 1VQ5P 3L75G 2WSSH 1SJGA 3O8ZA 3H1JJ 3CX5E 3BCCD 3CXHD 1LWUB 2E74B 2KI7B 3PJSK 1FAVA 1EG9A 3CD6P 4NBED 3II6A 3L74D 2KZJA 2O3JA 3PTZA 5AW8B 2FKWB 5DJUB 4U3FJ 2ZXXA 2D2CC 3B5ND 1KQLA 2YKOA 2YXQB 4H0LD 1PP9G 3CLQA 3TF5A 2L5GB 2BCCJ 3TGUD 5KKZB 2R5DA 1N7SC 1J1EC 3B5NA 1H8AA 2AEJA 1MFTA 1CI6A 1QEXA 3TDKA 1ZN5A 4QDDA 1SQXG 3CCLP 1OW6A 3CC4P 4W7ZA 3H25A 2XV5A 1GL2C 1G8JB 5KLVD 3H6PA 3A2AA 5AW6B 1KYOI 1LTJA 3L74E 4M3LA 1RFSA 1JB0J 1NTKJ 1NTMG 1BE3E 1JCCA 1NTZK 2YKPA 1LNQA 1HWTC 1VDFA 2JDIH 4EIJA 3L72J 2J59M 3S1KA 1BSHA 2NUMA 5KJ7C 2I7FA 2QSIA 1WQLA 3P32A 1O7GA 2NPSD 1O7NA 4IL6E 3OW2O 2FBWC 1IJDB 3M9QA 5AVSB 5KLVE 4GKGA 1VM9A 3D89A 1JTHB 4JF7A 1SFCA 1S3JA 4GOFA 1P84I 1G1JA 4H44D 3TNUB 3M9HA 1UUVA 1OW8A 2HMJA 1URQD 2YFJA 1PV3A 1T3JA 1KYOD 1KD1Q 1JY3P 1EC5A 4D6TJ 1ZRTD 5H2FH 1URQA 2FYUJ 2R3CA 3E1RA 3CI9A 2Q1KA 1Q90C 1E79H 1R5LA 1GU5A 2WZ7A 3H1LD 1FZCA 2L91A 3WUUA 2OYHA 4N3YB 1BGYG 1N2DC 4DZOA 2HMMA 1L0LK 1HJBA 1LT9B 4HJGH 1FJKA 3D71A 1AV1A 4OH8B 3V5BA 1S2EA 1PGOA 2SPZA 2JP3A 5L8RJ 3AE4C 1QX8A 1M1JB 2H7HA 4Y99C 1SQQJ 3QH9A 1NVOA 4XE5B 1HBWA 5M1BA 3AEBC 1L4AB 1J1DC 4RJTA 1VQ9P 1W2BO 1FDOA 2E75B 1KYOE 3GZXA 3B5NC 1PGJA 1ZRTE 1P84D 4H0LC 3U59A 2FXMA 1EQ7A 3Q1MA 3VYIA 4CPGA 1JEKA 2W6AA 2P7JA 5C39A 4IFDK 3H1LE 2WT7B 4L73A 2KXPB 2FFDA 2YKQA 3PH0A 2K37A 1U7JA 4WY4D 1LTJC 3GF3A 4PD4H 1FZEA 5AVWB 2W8ZA 2FYNB 2BASA 1KMIZ 4NPFX 2GUVA 2QJPB 4WY4A 5TISE 1M56D 3A0HE 1YJNP 3KXDA 1L0NG 1OZHA 2ZVOB 3GLMA 3E1IA 1NU1K 2WITA 2R3SA 5APUA 2E4QA 1IFPA 3HRNA 2NUKA 1CSBA 1PP9E 1YQ4C 2K88A 3FWLA 2CPBA 2A06D 5KAIH 1M1KQ 3HE4A 1GTWA 3JC22 3EFFK 2QJKC 5APVA 2M0BA 3CCQP 2BMOA 2C0XA 4HM2A 2B87A 1E5WA 2GM4A 1SFCC 1RHZB 2Q3EA 1DD4A 2ZYGA 1DIPA 1GW3A 2JWAA 4PV1B 1YI2P 5BVZA 1KTMA 1XTGB 1JM0A 1H0TB 2CK3H 2IX7C 1G2CA 3AE2C 3C9IA 4H44C 1RF1B 2XU6A 1SQVJ 3FGAD 3TYYA 4TT3H 1VF5C 1URQC 1KB9H 1RQVA 3RK2B 4UB8E 1IK9A 3RL0C 2AXTH 1VQ7P 2RH0A 2K9YA 3F89A 1FZCC 3RK3B 2OYHC 1OW7A 3L75J 1N73B 2B89A 3GHGA 3H32A 4N6JA 3BCCG 4H13B 3N7NA 2KS1A 2IFNA 3TK1A 4GODA 2M5AB 3A0HH 3LW5H 3WUTA 2WPQA 4PJ0E 3L74G 1JM1A 4AQRD 5AW7B 1KILB 2WWWA 3HD7A 2ZT9B 4QDFB 1QL1A 1EDKA 2OGUA 1QL2A 3V6IA 2HMNA 2FYZA 2W6BA 4GDOA 3HUSB 3L70J 2BEQD 3RGUA 2GUSA 2FFDC 4U3FD 1DX7A 1S1CX 1M8OB 5AVUB 1IO4A 2JEEA 1K05A 2E76B 1BGYE 3VN0A 2N1TB 1PIXA 2BMRA 4WY4C 3V2QA 5KLVG 1LT1A 3M06A 3HTKB 4QURA 3U1AA 2AEFA 1KFNA 3A5TA 3FX0A 1NTMJ 1XTCC 1K73Q 1NOHA 2G3AA 2FY8A 4GT1A 5KAFH 1BCCD 4AYCA 1ULIA 1KQFB 1ZW0A 4I7ZB 4ZKPA 3RBZA 1NTKD 3GZYA 5CCHA 3KQGA 3VMAA 2OYIA 1A02F 2G8YA 4TLFA 2R32A 2HPCB 3M9BA 2WSCH 3CWBJ 2YFLA 5AVQB 2OTLP 5AW2B 2QA4P 3L72D 2XR8A 2Y0EA 5CCGA 2IDBA 2CPSA 2WSCJ 4Y28J 1EDIA 3V2PA 5DJTB 3A0BE 1DH3A 3EQ2A 2XRXA 2KLVA 4JYBA 3T97A 1GDTA 1JUNA 3AE7C 1BCCE 3VMID 3L71E 1KORA 2WSFH 1SS1A 1NHLA 3HE5A 4WWIA 4EYYQ 1LP1B 3VMXA 1IZNB 1YQ3C 3GHGC 4DCKA 1NTZD 2VRSA 1ZV8A 2WSFJ 3KDPB 1AJYA 1ZXGA 3H1KE 1IFNA 2NRGA 1VQ6P 4NBGD 3W68A 1MV8A 1OVVA 3H1LG 1L4AD 3GOBA 2E75D 3L4FA 1M1JA 2FYUD 1T2KD 4UB6E 3GL2A 4MN4C 1KQGB 1L4AA 2DE5D 1NTKK 2Y0CA 3HD7C 3AE1C 2K9JB 3GF7A 5GTIE 4PD4I 2B1XA 2XZRA 1Q86Q 3M91A 3H1HJ 2NZ2A 4L75A 1JCDA 1IFMA 3R2PA 1KZUB 1NTZE 2NWFA 2PRRA 3WU2H 1SQPJ 4NB8D 1DEEG 1QLED 1S5LH 3BASA 3BCCE 1X8YA 3CXHE 4WBAA 1SQBK 4NBBD 2HG5D 3CCMP 3UIAA 3MZWB 1EXJA 1IFDA 2D2CB 3CCUP 2CKFA 3JCUE 5CXMA 4IOIH 1HJ0A 3AEFC 1L0NJ 2Y0DA 1N7SB 1W5CE 1J1EB 1LTSC 5CCHC 4EDFA 1L0LD 1NKZB 2OYIC 2QJYC 4HKZH 3CCSP 1OFCX 2KNCB 3TGUE 2A06G 1Q82Q 3CX5H 4AAYB 3L73D 4PD4D 2FYUK 4PV1D 2WSEH 3H1ID 2QEXP 5CCGC 4OGQC 2E5YA 1X9VA 1VL2A 4ZKUA 1WRGA 4R4LA 1SQBJ 2NPSA 4AUWA 3R4YA 3GMAA 4NBAD 1ZP0C 3PRJA 1H0TA 4NBHD 1MFZA 3RK2D 1EXIA 1FQTA 1G1IA 3M0AA 1JMMA 4HM1A 1SQQK 4QDCA 2I1JA 1YJWP 1HGVA 1K04A 4HJLA 3RL0g 1JY2O 3RK3D 2POHA 2JZAA 1FU1A 1L0LE 5EFWB 1IFJA 4XA4A 2W27A 4H13D 1Q2NA 2HODA 3CXHH 3L73E 3H1IE 3NMDA 1RY3A 1NU1D 1SQVD 3SFDC 1SP4A 5APWA 1KILD 1M1JC 1OXZA 2ZT9D 1Q7YQ 1OVRA 1GZLA 1L4AC 1FZGA 3WUVA 4NPDA 3C0DA 3L75D 2QIWA 4U7JA 1YBKA 5KLIC 3L74J 3G9RA 4JPZB 3MUDA 1X22A 2Q7CA 2W90A 1BE3J 3LIEA 2A45I 3RK3E 2H43A 1FZBA 2IYOA 4K35A 3BATA 5CJ0A 1EZVI 2NVFA 2PGDA 2E76D 4IL6H 4QUQA 3S4RA 1Y8AA 2N1TD 2N9BA 2KSEA 2RKLA 4HM4A 3MGNA 4B86A 3CCEP 1NU1E 4U3FG 4NBFD 4L74A 2NVGA 1EDJA 3KHUA 1USEA 4BRYA 4ZNCA 4RKUJ 3V4QA 4Y99B 4JBZA 3L70D 1BDDA 2HMOA 1CW5A 1HTLC 2IYPA 1D7MA 1S4XA 5AVXB 3AE5C 2QG4A 1Y47A 4C7NA 5GTHE 4JQ0D 3FOUA 4HH2A 4NBCD 3B5NB 1VQMP 3Q5RA 1CI6B 1SQVK 5APSA 1UIXA 4KHXA 1BCCG 1VQPP 3G3ZA 3L71G 3U1CA 1N8RQ 5AVYB 4HM6A 1P84E 3SSUA 1NTKG 3AE8C 1FDMA 3Q5PA 5KTBA 4JYCA 1LTJB 4P1BH 1ZOYC 4W7YA 5E79E 1EZVD 3MTUE 3H1KG 2K1AA 3L72G 2NPSC 2GA1A 4LLHA 1PPJD 4YXDC 2E4PA 2WQYC 3CWBD 2IBZI 3L35A 1FOSE 2Q6QA 1X79B 2K3RA 5TJHA 5CHXA 3O6QA 1KYOH 1WMKA 1FOSF 3GTEA 3L36A 4WB4A 3RK3C 3Q3DA 2QJKB 4ZMDA 3SWKA 2BMQA 1ZR2A 2Q5UA 2QVAA 2A06E 2E74D 1JOCA 2E42A 1SFCB 3BRTB 5B5EE 3V2RA 1NTZG 2B9BA 2YXRB 3B4SA 1LWUA 1SQXK 1U7MA 2Z4EA 2ZJSE 3IFMA 1MUUA 3P8CD 3CC7P 1PPJE 3MIWA 3OAKA 5B66E 3BRVB 2ZXEB 1JNMA 5TISH 3MUDC 4NPEA 2Q3IA 2FYUG 1NAFA 1VF5B 2N9YB 1S72P 1NTMK 3H1JD 3RL0B 4IFFA 3CCVP 1P84H 3I55P 1NGMB 3LW5J 1Y9BA 2YIUC 4BXLA 1FZCB 2PP6A 3MHVA 2IBZD 2KSJA 2OYHB 3CMEP 4KT0J 4XFJA 1M90Q 1PP9J 2JO6A 2OTKE 1VQ8P 2E76C 2C9LY 3FWNA 1JY2N 3TGUG 1TU3F 5AW0B 2D2CD 3BVHA 2E43A 2KZIA 3GKEA 2KIKA 1L2PA 1PZQA 2PAJA 1SQXJ 3H1HD 3P8CE 1M7LA 2J58A 3CX5I 2XSOA 2BCCD 1N7SD 1NDOA 1VQKP 3MD0A 2P58A 4EMJB 3KZIE 4DT0A 2I8DA 2H8PD 5APQA 1SQPD 1AQTA 1FBMA 3H1JE 4ASWA 2AEMA 4UB8H 2NVEA 1AFOA 3CC2P 1O7MA 1IK7A 3AEDC 2LKMA 2YMYA 2IBZE 1L0LG 2FFDB 3KYQA 1OWAA 2KP8A 2LR2A 2WPRA 1RIEA 3L73G 3AEAC 5AVTB 2YO3A 3OJAB 3H1IG 2HYNA 4U3FE 1OX3A 3IN6A 5KJ7D 1HF9A 4PJ0H 2BCCE 2DW3A 1JTHA 5AW5B 1GK4A 3VP9A 1CZQA 2OTJP
chains in the Genus database with same CATH topology
3EWKA 5CXMA 1FDOA 1HJ0A 2E75B 3AEFC 1G8KB 1KYOE 3GZXA 2ZT9C 4H44B 3CWBE 1O7HA 1ZRTE 1NYHA 4H0LC 2QJYC 3AE6C 3Q1MA 2GBWA 3TGUE 4HM5A 4AAYB 3D6YA 3IAOA 4PV1D 1NTKE 3H1LE 2XSHA 4OGQC 4P1CH 1NYKA 2E74C 5AEWA 3GF3A 1VL2A 3L72E 4R4LA 1KMIZ 2ZYLA 3R4YA 3GMAA 4NBAD 1ZP0C 4NBHD 1EXIA 2HMLA 3EQQA 1FQTA 3GLMA 4HM1A 4QDCA 4HM7A 1Q90D 3D70A 1K04A 2O01J 2E4QA 3RL0g 4HJLA 2NUKA 2YMKA 2JZAA 1PP9E 1FDIA 1YQ4C 1L0LE 3GTSA 1S5LX 2FXPA 5KKZC 1SQBE 4I7ZC 4H13D 1VCKA 2J5UA 2QJKC 2QPZA 2BMOA 4HM2A 3L73E 3H1IE 1UUWA 1U57A 3SFDC 2H89C 3B71A 1OMIA 1DD4A 1DIPA 3GB4A 2ZT9D 4PV1B 1KTMA 1DD3A 3AECC 1R8EA 3C0DA 3H1HE 2QIWA 4U7JA 3AE2C 5KLIC 3G9RA 4H44C 2FYUE 3FGAD 5HL4A 3RK3E 4TT3H 1VF5C 4OGQD 1RQVA 5AEUA 1SQPE 2NVFA 2E76D 2K9YA 4QUQA 1MKMA 3GCEA 2DE6D 4HKVA 4HM4A 1OW7A 1ZMEC 3SFEC 1NU1E 1RQUA 1SQQE 3D6ZA 3EN1A 4H13B 4NBFD 4HM3A 2NVGA 3VCAA 4RKUJ 3AEEC 2JO1A 2HMOA 1L0NE 2DE7D 1JM1A 2OQQA 3AE5C 4HM8A 3FOUA 2WSEJ 2ZT9B 4QDFB 4NBCD 3Q5RA 2HMNA 3AZCA 1UIXA 4GDOA 2YFIA 4NB9D 1SJGA 4HM6A 2BEQD 1P84E 3CX5E 3AE8C 4OGQB 3Q5PA 4Z1MH 1S1CX 4P1BH 3ABVC 2E74B 1K05A 1ZOYC 3AEGC 2E76B 1EG9A 3DQYA 4NBED 1PIXA 4PD4E 3AE9C 2BMRA 1VF5D 4YXDC 2V7QJ 2Q3WA 3AE3C 3T97B 1O7WA 4QURA 2E4PA 2WQYC 4IL6X 4YTPC 2D2CC 2G3AA 4H0LD 4AIVA 3O6QA 1WMKA 3Q2YA 2E75C 1ULIA 3GTEA 1KQFB 4I7ZB 5BOKA 2P10A 4QDFA 3GZYA 2B24A 3Q3DA 2G8YA 1ULJA 4QDDA 2BMQA 1OW6A 2A06E 2E74D 3H25A 2YFLA 2XR8A 4NBDD 1G8JB 3C8VA 2IDBA 2BEZF 3VCPA 1O7PA 3L74E 2WSCJ 1RFSA 4Y28J 1JB0J 1SQVE 1PPJE 1BE3E 2FYNC 1KILE 2QJPC 2XRXA 1VF5B 2NUMA 3AE7C 1BCCE 3VMID 2I7FA 3L71E 2WPVB 3L75E 1KORA 2QSIA 1PL5A 1KB9E 1NGMB 3LW5J 1Y9BA 1WQLA 2YIUC 1O7GA 1O7NA 4H0LB 4KT0J 1YQ3C 4XFJA 2JO6A 2YVJB 2FBWC 2E76C 2MKVA 2WSFJ 1AJYA 3H1KE 1TU3F 5KLVE 4NBGD 2D2CD 1VM9A 4QUPA 3D89A 2H88C 3GKEA 3GOBA 2E75D 2XSOA 4PV1C 4H44D 3GL0A 1NDOA 3GL2A 1UUVA 2HMKA 1KQGB 2DE5D 4EMJB 3AE1C 3S9OA 1OW8A 2HMJA 3L70E 3GF7A 1PV3A 2YFJA 2B1XA 3Q5SA 3VMGD 3H1JE 1GMJA 1SQXE 2NVEA 3VMHD 2NZ2A 1O7MA 2GBXA 1IK7A 3AEDC 3N0QA 2IBZE 1Q90C 1NTZE 2NWFA 4NB8D 1RIEA 3AEAC 2HMMA 1NTME 3BCCE 3CXHE 4U3FE 4H13C 3D71A 4NBBD 3IN6A 4R4MA 2JP3A 5L8RJ 3AE4C 4HM0A 1HF9A 1EZVE 2BCCE 1EXJA 4QCKA 5M1BA 2D2CB 3AEBC 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ B;  1KB9 E;  3GB4 A;  3LW5 J;  1WQL A;  5CXM A;  2YIU C;  2ZT9 D;  4P1B H;  4PV1 B;  2E74 B;  1O7G A;  1O7N A;  2E75 B;  1G8K B;  2E76 B;  4H0L B;  1KYO E;  3GZX A;  4KT0 J;  1EG9 A;  3DQY A;  3CX5 E;  4H44 B;  3CWB E;  4NBE D;  1O7H A;  4PD4 E;  2JO6 A;  1ZRT E;  2YVJ B;  3C0D A;  2BMR A;  3H1H E;  2QJY C;  2QIW A;  2WSF J;  5KLI C;  3H1K E;  1VF5 D;  2FYU E;  2Q3W A;  1O7W A;  4QUR A;  2E4P A;  5HL4 A;  2GBW A;  5KLV E;  4NBG D;  3TGU E;  4HM5 A;  2D2C D;  1VM9 A;  4OGQ D;  3D89 A;  4QUP A;  4AAY B;  4IL6 X;  3GKE A;  3GOB A;  4PV1 D;  5AEU A;  1NTK E;  3H1L E;  1SQP E;  2NVF A;  2E75 D;  2XSH A;  2E76 D;  2K9Y A;  2XSO A;  4H0L D;  4P1C H;  4QUQ A;  4AIV A;  1NYK A;  3GL0 A;  4H44 D;  1NDO A;  3GCE A;  3GL2 A;  5AEW A;  2DE6 D;  1ULI A;  1UUV A;  2HMK A;  3GTE A;  4HKV A;  2DE5 D;  4EMJ B;  4HM4 A;  4I7Z B;  5BOK A;  3L72 E;  2HMJ A;  3L70 E;  4QDF A;  2YFJ A;  1NU1 E;  3GZY A;  2ZYL A;  1SQQ E;  2B24 A;  2B1X A;  3EN1 A;  4NBA D;  4H13 B;  1ULJ A;  4NBF D;  4NBH D;  3VMG D;  3H1J E;  4QDD A;  2BMQ A;  4HM3 A;  2NVG A;  2A06 E;  2HML A;  3VCA A;  3EQQ A;  2E74 D;  1FQT A;  2YFL A;  4RKU J;  1SQX E;  4HM1 A;  4QDC A;  2NVE A;  4HM7 A;  3VMH D;  1Q90 D;  2XR8 A;  1O7M A;  2GBX A;  2HMO A;  4NBD D;  1L0N E;  2O01 J;  2DE7 D;  2E4Q A;  1G8J B;  4HJL A;  3N0Q A;  2NUK A;  2IBZ E;  1JM1 A;  3C8V A;  2JZA A;  1PP9 E;  1Q90 C;  3VCP A;  1NTZ E;  2NWF A;  1L0L E;  4HM8 A;  3GTS A;  1O7P A;  3L74 E;  2WSC J;  1RFS A;  3FOU A;  4Y28 J;  1S5L X;  5KKZ C;  2WSE J;  1JB0 J;  1SQV E;  1SQB E;  3L71 E;  1PPJ E;  4NB8 D;  2ZT9 B;  1BE3 E;  2FYN C;  4QDF B;  4H13 D;  4NBC D;  1RIE A;  1VCK A;  2HMM A;  1NTM E;  3BCC E;  2QJK C;  2QJP C;  3CXH E;  2QPZ A;  2HMN A;  4U3F E;  2BMO A;  2XRX A;  3AZC A;  3L73 E;  4HM2 A;  4NBB D;  3H1I E;  2YFI A;  4NB9 D;  5L8R J;  1UUW A;  4HM0 A;  1VF5 B;  2NUM A;  1EZV E;  2BCC E;  4QCK A;  1BCC E;  1SJG A;  4HM6 A;  3VMI D;  1P84 E;  2I7F A;  2D2C B;  2WPV B;  3L75 E;  2CKF A;  2QSI A; 
#chains in the Genus database with same CATH topology
 3EWK A;  2W6J H;  2JKV A;  1VQO P;  1N7L A;  5CMZ A;  3TNU A;  2C0W A;  3HE4 B;  1LGH B;  5BU5 A;  5CJ4 A;  2XKM A;  1OIP A;  4BWN A;  3CX5 D;  1HUC A;  2RN0 A;  2IFM A;  1SQB D;  4ASV A;  1HGZ A;  2B87 B;  3TSI A;  2GBW A;  1QVF O;  1VQN P;  4N78 D;  1OVU A;  3KPE A;  5APT A;  2Z5H A;  3D6Y A;  3IAO A;  1NTK E;  4OWF A;  1LWU C;  1EDL A;  1NYK A;  2E74 C;  1QVG O;  2O1J A;  1NU1 G;  1SQP K;  1W2E A;  4K3A A;  3L72 E;  2ZYL A;  1G2C B;  4D6T D;  1LT9 A;  1BGY J;  2P2U A;  2HML A;  2V4H A;  1Q90 D;  2KYV A;  4L76 A;  1PGP A;  1J2J B;  1VQL P;  3GTS A;  1NH4 A;  1L0N K;  1S5L X;  5KKZ C;  1SQB E;  1AQ5 A;  1NWQ A;  1RE4 A;  3GHG B;  2KLU A;  3H32 B;  3V4W A;  1Q81 Q;  1LTI C;  2M8R A;  1VCK A;  2J5U A;  4N78 E;  1AA0 A;  2M3B A;  1QGK B;  1A02 J;  2KS1 B;  4C7R A;  4I6M C;  1R5S A;  1UUW A;  2ZYD A;  1U57 A;  1SQQ D;  1BE3 D;  3WMM 0;  3VOP A;  2AXC A;  2YNY A;  2LXC B;  1ZLL A;  2WT7 A;  1OMI A;  3GB4 A;  3A0B H;  2JR8 A;  2O1K A;  3HD7 B;  4D6T E;  2Z5I A;  2R5B A;  3L70 G;  3USS A;  2FYU E;  1JO5 A;  2ZVN B;  2ZAE B;  4C46 A;  4HB1 A;  3IR9 A;  5H2F E;  1DEB A;  1LTG C;  1MKM A;  3PLN A;  2DE6 D;  1BCC J;  4HKV A;  3L71 J;  1ZME C;  2WVR A;  1YYC A;  1SQQ E;  1X0T A;  5AVZ B;  1YTZ T;  4HM3 A;  2A45 G;  1GL2 B;  3VCA A;  2Y9Z A;  3AEE C;  1BSN A;  1EZV G;  3H1K J;  1KB9 I;  5APX A;  4UB6 H;  1WT6 A;  3GW6 A;  2JWD A;  3N4X A;  1PPJ G;  1BDC A;  4HM8 A;  2WSE J;  5GTI H;  1JY3 O;  3PP5 A;  3CWB G;  4KJM A;  2OYI B;  2QJY B;  4O9B A;  3NXS A;  1RF1 A;  1SFC D;  1KN7 A;  4NB9 D;  5AW4 B;  4LC1 A;  2JJL A;  3K5B A;  1RH5 B;  4OGQ B;  3B8E B;  4Z1M H;  2R44 A;  2V7Q H;  1AVO A;  3V2N A;  3ABV C;  1ZR4 A;  1YIT P;  3AEG C;  1KFM A;  3DQY A;  2LXB A;  1N73 A;  4PD4 E;  3AE9 C;  1PFI A;  1NTZ J;  1LT9 C;  2FXO A;  1VF5 D;  2ITA A;  2V7Q J;  2Q3W A;  3AE3 C;  3T97 B;  1O7W A;  3RL0 D;  1GU4 A;  2M5A A;  3BCC J;  3JCU H;  1IC2 A;  4IL6 X;  4YTP C;  1LTA C;  5KLV K;  1HVV A;  4AIV A;  2C9N Y;  3HE5 B;  3Q2Y A;  2ZFC A;  1KIL A;  2E75 C;  1JY2 P;  1T2K C;  3M0D A;  1FE6 A;  1KB9 D;  5BOK A;  1RE4 C;  2P10 A;  3MP7 B;  4QDF A;  5KAI E;  3H1J G;  2WTY A;  2B24 A;  1ULJ A;  1NKN A;  3GG2 A;  3EFG A;  3HUS A;  2IZ1 A;  2IBZ G;  4NBD D;  2O01 N;  2HFE D;  3C8V A;  4I2L C;  3TGU J;  2BEZ F;  3VCP A;  1O7P A;  3IF4 A;  1SQV E;  3G4S P;  2FYN C;  4YXW H;  1LJ2 A;  2N1T A;  1KIL E;  3H1H G;  2QJP C;  5KLI B;  1T3U A;  1PP9 D;  3HTK A;  2BCC G;  1LTB C;  3VP8 A;  3FXD A;  3SWY A;  1J1D B;  5KLV J;  3F5H A;  3VMY A;  2WPV B;  3L75 E;  1SQP G;  1PL5 A;  3QWO C;  1KB9 E;  1SQX D;  2AXT E;  4H0L B;  2QM8 A;  2IPP A;  1FZA A;  2YVJ B;  2MKV A;  1L0L J;  3C1L A;  1AVY A;  2QE7 H;  1RF0 A;  2HPC A;  4EOT A;  1NTM D;  4QUP A;  4RES B;  2H88 C;  4QMA A;  3L73 J;  2QM7 A;  3H1I J;  3SWF A;  4PV1 C;  3GL0 A;  2HMK A;  2KK7 A;  3S9O A;  3L70 E;  1T8Z A;  1RF1 C;  3Q5S A;  3VMG D;  1KC8 Q;  1S9K D;  2W83 C;  1GMJ A;  1SQX E;  3VMH D;  3RK2 C;  2GBX A;  2PFX A;  2I1K A;  3N0Q A;  4A7P A;  1NJI Q;  1SQB G;  5APY A;  3VMZ A;  4GIF A;  3G6E P;  1RE3 A;  1LP1 A;  2XDJ A;  1YJ9 P;  3A3Y B;  3JSV C;  3W67 A;  1N73 C;  1USD A;  2P67 A;  2NPS B;  3P8M C;  2RMZ A;  1NTM E;  5AVR B;  4H13 C;  4R4M A;  4OVN F;  1SLQ A;  2HLO A;  4HM0 A;  1KV4 A;  1NU1 J;  1EZV E;  1K9M Q;  2E5T A;  4QCK A;  2QRX A;  3L37 A;  4DOJ A;  5GTH H;  5CBN A;  3E7K A;  3H1L J;  4D6T G;  1KIL C;  5AW1 B;  1G8K B;  3M0D C;  1SVF A;  2P1J A;  2ZT9 C;  5KAF E;  4H44 B;  3CWB E;  2B88 A;  3VTP C;  1S9K E;  1O7H A;  2K9J A;  1NYH A;  3AE6 C;  2HOD B;  1IFI A;  1URQ B;  3RBX A;  3OA7 A;  3HUS C;  3CMA P;  4HM5 A;  2OAR A;  1BGY D;  5AW9 B;  2WPS A;  1JY3 N;  1H88 A;  1GK6 A;  2ZYA A;  1VQ4 P;  2XSH A;  5CBO A;  1N86 A;  4P1C H;  3HD7 D;  1NO4 A;  5E79 H;  3I56 P;  1Z56 A;  5AEW A;  1T6A A;  1SQQ G;  1BE3 G;  2N1T C;  2O01 H;  2KB7 P;  2KUB A;  3I5C A;  3EQQ A;  4I1L A;  1KQS O;  4HM7 A;  3D70 A;  3NFQ A;  1YTZ I;  2O01 J;  1MZ9 A;  2YMK A;  2MJZ A;  1H89 A;  1FDI A;  2YIU B;  5AW3 B;  1HH0 A;  2FXP A;  3A7O A;  4I7Z C;  1N7S A;  1YHQ P;  1YIJ P;  1GL2 D;  1RF0 C;  2QPZ A;  5BU8 B;  2KNC A;  3G71 P;  2A45 H;  4HYT B;  5B5E H;  3CCR P;  4BRY B;  3CL3 D;  2H89 C;  1FS0 E;  2UWJ E;  4LGD E;  3CPW O;  1VPC A;  1GL2 A;  3B71 A;  4GOE A;  4IFM A;  4DJG A;  4C7N B;  1L0N D;  5B66 H;  5CCH D;  1DD3 A;  3AEC C;  3ITK A;  4WY4 B;  1R8E A;  3ZDM A;  1UII A;  3L71 D;  2Q9I A;  3H1H E;  3CXH I;  5HL4 A;  1GW4 A;  5CCG D;  4OGQ D;  1JMB A;  4WVZ A;  5KJ7 A;  2IZ0 A;  5AEU A;  1SQP E;  1PGQ A;  2YO2 A;  3H1K D;  1M57 D;  1RE3 C;  3NTN A;  3GCE A;  3PHL A;  1NAY A;  2XNX A;  3SFE C;  2M3E A;  3WU2 E;  1FC2 C;  2Y9Y A;  1RQU A;  3D6Z A;  3EN1 A;  4W80 A;  1S5L E;  1LTT C;  1K8A Q;  3CCJ P;  2OYO A;  3FXE A;  2JO1 A;  1L0N E;  5K5G B;  2DE7 D;  2WMM A;  3O6Q B;  2OQQ A;  4EI2 A;  1SQV G;  4RO0 A;  3KZI H;  2KOG A;  4YPC A;  3LID A;  2XND H;  3P7K A;  2HR3 A;  1FJP A;  5AVV B;  3AZC A;  1GD2 E;  1FZF A;  2YFI A;  1VQ5 P;  3L75 G;  2WSS H;  1SJG A;  3O8Z A;  3H1J J;  3CX5 E;  3BCC D;  3CXH D;  1LWU B;  2E74 B;  2KI7 B;  3PJS K;  1FAV A;  1EG9 A;  3CD6 P;  4NBE D;  3II6 A;  3L74 D;  2KZJ A;  2O3J A;  3PTZ A;  5AW8 B;  2FKW B;  5DJU B;  4U3F J;  2ZXX A;  2D2C C;  3B5N D;  1KQL A;  2YKO A;  2YXQ B;  4H0L D;  1PP9 G;  3CLQ A;  3TF5 A;  2L5G B;  2BCC J;  3TGU D;  5KKZ B;  2R5D A;  1N7S C;  1J1E C;  3B5N A;  1H8A A;  2AEJ A;  1MFT A;  1CI6 A;  1QEX A;  3TDK A;  1ZN5 A;  4QDD A;  1SQX G;  3CCL P;  1OW6 A;  3CC4 P;  4W7Z A;  3H25 A;  2XV5 A;  1GL2 C;  1G8J B;  5KLV D;  3H6P A;  3A2A A;  5AW6 B;  1KYO I;  1LTJ A;  3L74 E;  4M3L A;  1RFS A;  1JB0 J;  1NTK J;  1NTM G;  1BE3 E;  1JCC A;  1NTZ K;  2YKP A;  1LNQ A;  1HWT C;  1VDF A;  2JDI H;  4EIJ A;  3L72 J;  2J59 M;  3S1K A;  1BSH A;  2NUM A;  5KJ7 C;  2I7F A;  2QSI A;  1WQL A;  3P32 A;  1O7G A;  2NPS D;  1O7N A;  4IL6 E;  3OW2 O;  2FBW C;  1IJD B;  3M9Q A;  5AVS B;  5KLV E;  4GKG A;  1VM9 A;  3D89 A;  1JTH B;  4JF7 A;  1SFC A;  1S3J A;  4GOF A;  1P84 I;  1G1J A;  4H44 D;  3TNU B;  3M9H A;  1UUV A;  1OW8 A;  2HMJ A;  1URQ D;  2YFJ A;  1PV3 A;  1T3J A;  1KYO D;  1KD1 Q;  1JY3 P;  1EC5 A;  4D6T J;  1ZRT D;  5H2F H;  1URQ A;  2FYU J;  2R3C A;  3E1R A;  3CI9 A;  2Q1K A;  1Q90 C;  1E79 H;  1R5L A;  1GU5 A;  2WZ7 A;  3H1L D;  1FZC A;  2L91 A;  3WUU A;  2OYH A;  4N3Y B;  1BGY G;  1N2D C;  4DZO A;  2HMM A;  1L0L K;  1HJB A;  1LT9 B;  4HJG H;  1FJK A;  3D71 A;  1AV1 A;  4OH8 B;  3V5B A;  1S2E A;  1PGO A;  2SPZ A;  2JP3 A;  5L8R J;  3AE4 C;  1QX8 A;  1M1J B;  2H7H A;  4Y99 C;  1SQQ J;  3QH9 A;  1NVO A;  4XE5 B;  1HBW A;  5M1B A;  3AEB C;  1L4A B;  1J1D C;  4RJT A;  1VQ9 P;  1W2B O;  1FDO A;  2E75 B;  1KYO E;  3GZX A;  3B5N C;  1PGJ A;  1ZRT E;  1P84 D;  4H0L C;  3U59 A;  2FXM A;  1EQ7 A;  3Q1M A;  3VYI A;  4CPG A;  1JEK A;  2W6A A;  2P7J A;  5C39 A;  4IFD K;  3H1L E;  2WT7 B;  4L73 A;  2KXP B;  2FFD A;  2YKQ A;  3PH0 A;  2K37 A;  1U7J A;  4WY4 D;  1LTJ C;  3GF3 A;  4PD4 H;  1FZE A;  5AVW B;  2W8Z A;  2FYN B;  2BAS A;  1KMI Z;  4NPF X;  2GUV A;  2QJP B;  4WY4 A;  5TIS E;  1M56 D;  3A0H E;  1YJN P;  3KXD A;  1L0N G;  1OZH A;  2ZVO B;  3GLM A;  3E1I A;  1NU1 K;  2WIT A;  2R3S A;  5APU A;  2E4Q A;  1IFP A;  3HRN A;  2NUK A;  1CSB A;  1PP9 E;  1YQ4 C;  2K88 A;  3FWL A;  2CPB A;  2A06 D;  5KAI H;  1M1K Q;  3HE4 A;  1GTW A;  3JC2 2;  3EFF K;  2QJK C;  5APV A;  2M0B A;  3CCQ P;  2BMO A;  2C0X A;  4HM2 A;  2B87 A;  1E5W A;  2GM4 A;  1SFC C;  1RHZ B;  2Q3E A;  1DD4 A;  2ZYG A;  1DIP A;  1GW3 A;  2JWA A;  4PV1 B;  1YI2 P;  5BVZ A;  1KTM A;  1XTG B;  1JM0 A;  1H0T B;  2CK3 H;  2IX7 C;  1G2C A;  3AE2 C;  3C9I A;  4H44 C;  1RF1 B;  2XU6 A;  1SQV J;  3FGA D;  3TYY A;  4TT3 H;  1VF5 C;  1URQ C;  1KB9 H;  1RQV A;  3RK2 B;  4UB8 E;  1IK9 A;  3RL0 C;  2AXT H;  1VQ7 P;  2RH0 A;  2K9Y A;  3F89 A;  1FZC C;  3RK3 B;  2OYH C;  1OW7 A;  3L75 J;  1N73 B;  2B89 A;  3GHG A;  3H32 A;  4N6J A;  3BCC G;  4H13 B;  3N7N A;  2KS1 A;  2IFN A;  3TK1 A;  4GOD A;  2M5A B;  3A0H H;  3LW5 H;  3WUT A;  2WPQ A;  4PJ0 E;  3L74 G;  1JM1 A;  4AQR D;  5AW7 B;  1KIL B;  2WWW A;  3HD7 A;  2ZT9 B;  4QDF B;  1QL1 A;  1EDK A;  2OGU A;  1QL2 A;  3V6I A;  2HMN A;  2FYZ A;  2W6B A;  4GDO A;  3HUS B;  3L70 J;  2BEQ D;  3RGU A;  2GUS A;  2FFD C;  4U3F D;  1DX7 A;  1S1C X;  1M8O B;  5AVU B;  1IO4 A;  2JEE A;  1K05 A;  2E76 B;  1BGY E;  3VN0 A;  2N1T B;  1PIX A;  2BMR A;  4WY4 C;  3V2Q A;  5KLV G;  1LT1 A;  3M06 A;  3HTK B;  4QUR A;  3U1A A;  2AEF A;  1KFN A;  3A5T A;  3FX0 A;  1NTM J;  1XTC C;  1K73 Q;  1NOH A;  2G3A A;  2FY8 A;  4GT1 A;  5KAF H;  1BCC D;  4AYC A;  1ULI A;  1KQF B;  1ZW0 A;  4I7Z B;  4ZKP A;  3RBZ A;  1NTK D;  3GZY A;  5CCH A;  3KQG A;  3VMA A;  2OYI A;  1A02 F;  2G8Y A;  4TLF A;  2R32 A;  2HPC B;  3M9B A;  2WSC H;  3CWB J;  2YFL A;  5AVQ B;  2OTL P;  5AW2 B;  2QA4 P;  3L72 D;  2XR8 A;  2Y0E A;  5CCG A;  2IDB A;  2CPS A;  2WSC J;  4Y28 J;  1EDI A;  3V2P A;  5DJT B;  3A0B E;  1DH3 A;  3EQ2 A;  2XRX A;  2KLV A;  4JYB A;  3T97 A;  1GDT A;  1JUN A;  3AE7 C;  1BCC E;  3VMI D;  3L71 E;  1KOR A;  2WSF H;  1SS1 A;  1NHL A;  3HE5 A;  4WWI A;  4EYY Q;  1LP1 B;  3VMX A;  1IZN B;  1YQ3 C;  3GHG C;  4DCK A;  1NTZ D;  2VRS A;  1ZV8 A;  2WSF J;  3KDP B;  1AJY A;  1ZXG A;  3H1K E;  1IFN A;  2NRG A;  1VQ6 P;  4NBG D;  3W68 A;  1MV8 A;  1OVV A;  3H1L G;  1L4A D;  3GOB A;  2E75 D;  3L4F A;  1M1J A;  2FYU D;  1T2K D;  4UB6 E;  3GL2 A;  4MN4 C;  1KQG B;  1L4A A;  2DE5 D;  1NTK K;  2Y0C A;  3HD7 C;  3AE1 C;  2K9J B;  3GF7 A;  5GTI E;  4PD4 I;  2B1X A;  2XZR A;  1Q86 Q;  3M91 A;  3H1H J;  2NZ2 A;  4L75 A;  1JCD A;  1IFM A;  3R2P A;  1KZU B;  1NTZ E;  2NWF A;  2PRR A;  3WU2 H;  1SQP J;  4NB8 D;  1DEE G;  1QLE D;  1S5L H;  3BAS A;  3BCC E;  1X8Y A;  3CXH E;  4WBA A;  1SQB K;  4NBB D;  2HG5 D;  3CCM P;  3UIA A;  3MZW B;  1EXJ A;  1IFD A;  2D2C B;  3CCU P;  2CKF A;  3JCU E;  5CXM A;  4IOI H;  1HJ0 A;  3AEF C;  1L0N J;  2Y0D A;  1N7S B;  1W5C E;  1J1E B;  1LTS C;  5CCH C;  4EDF A;  1L0L D;  1NKZ B;  2OYI C;  2QJY C;  4HKZ H;  3CCS P;  1OFC X;  2KNC B;  3TGU E;  2A06 G;  1Q82 Q;  3CX5 H;  4AAY B;  3L73 D;  4PD4 D;  2FYU K;  4PV1 D;  2WSE H;  3H1I D;  2QEX P;  5CCG C;  4OGQ C;  2E5Y A;  1X9V A;  1VL2 A;  4ZKU A;  1WRG A;  4R4L A;  1SQB J;  2NPS A;  4AUW A;  3R4Y A;  3GMA A;  4NBA D;  1ZP0 C;  3PRJ A;  1H0T A;  4NBH D;  1MFZ A;  3RK2 D;  1EXI A;  1FQT A;  1G1I A;  3M0A A;  1JMM A;  4HM1 A;  1SQQ K;  4QDC A;  2I1J A;  1YJW P;  1HGV A;  1K04 A;  4HJL A;  3RL0 g;  1JY2 O;  3RK3 D;  2POH A;  2JZA A;  1FU1 A;  1L0L E;  5EFW B;  1IFJ A;  4XA4 A;  2W27 A;  4H13 D;  1Q2N A;  2HOD A;  3CXH H;  3L73 E;  3H1I E;  3NMD A;  1RY3 A;  1NU1 D;  1SQV D;  3SFD C;  1SP4 A;  5APW A;  1KIL D;  1M1J C;  1OXZ A;  2ZT9 D;  1Q7Y Q;  1OVR A;  1GZL A;  1L4A C;  1FZG A;  3WUV A;  4NPD A;  3C0D A;  3L75 D;  2QIW A;  4U7J A;  1YBK A;  5KLI C;  3L74 J;  3G9R A;  4JPZ B;  3MUD A;  1X22 A;  2Q7C A;  2W90 A;  1BE3 J;  3LIE A;  2A45 I;  3RK3 E;  2H43 A;  1FZB A;  2IYO A;  4K35 A;  3BAT A;  5CJ0 A;  1EZV I;  2NVF A;  2PGD A;  2E76 D;  4IL6 H;  4QUQ A;  3S4R A;  1Y8A A;  2N1T D;  2N9B A;  2KSE A;  2RKL A;  4HM4 A;  3MGN A;  4B86 A;  3CCE P;  1NU1 E;  4U3F G;  4NBF D;  4L74 A;  2NVG A;  1EDJ A;  3KHU A;  1USE A;  4BRY A;  4ZNC A;  4RKU J;  3V4Q A;  4Y99 B;  4JBZ A;  3L70 D;  1BDD A;  2HMO A;  1CW5 A;  1HTL C;  2IYP A;  1D7M A;  1S4X A;  5AVX B;  3AE5 C;  2QG4 A;  1Y47 A;  4C7N A;  5GTH E;  4JQ0 D;  3FOU A;  4HH2 A;  4NBC D;  3B5N B;  1VQM P;  3Q5R A;  1CI6 B;  1SQV K;  5APS A;  1UIX A;  4KHX A;  1BCC G;  1VQP P;  3G3Z A;  3L71 G;  3U1C A;  1N8R Q;  5AVY B;  4HM6 A;  1P84 E;  3SSU A;  1NTK G;  3AE8 C;  1FDM A;  3Q5P A;  5KTB A;  4JYC A;  1LTJ B;  4P1B H;  1ZOY C;  4W7Y A;  5E79 E;  1EZV D;  3MTU E;  3H1K G;  2K1A A;  3L72 G;  2NPS C;  2GA1 A;  4LLH A;  1PPJ D;  4YXD C;  2E4P A;  2WQY C;  3CWB D;  2IBZ I;  3L35 A;  1FOS E;  2Q6Q A;  1X79 B;  2K3R A;  5TJH A;  5CHX A;  3O6Q A;  1KYO H;  1WMK A;  1FOS F;  3GTE A;  3L36 A;  4WB4 A;  3RK3 C;  3Q3D A;  2QJK B;  4ZMD A;  3SWK A;  2BMQ A;  1ZR2 A;  2Q5U A;  2QVA A;  2A06 E;  2E74 D;  1JOC A;  2E42 A;  1SFC B;  3BRT B;  5B5E E;  3V2R A;  1NTZ G;  2B9B A;  2YXR B;  3B4S A;  1LWU A;  1SQX K;  1U7M A;  2Z4E A;  2ZJS E;  3IFM A;  1MUU A;  3P8C D;  3CC7 P;  1PPJ E;  3MIW A;  3OAK A;  5B66 E;  3BRV B;  2ZXE B;  1JNM A;  5TIS H;  3MUD C;  4NPE A;  2Q3I A;  2FYU G;  1NAF A;  1VF5 B;  2N9Y B;  1S72 P;  1NTM K;  3H1J D;  3RL0 B;  4IFF A;  3CCV P;  1P84 H;  3I55 P;  1NGM B;  3LW5 J;  1Y9B A;  2YIU C;  4BXL A;  1FZC B;  2PP6 A;  3MHV A;  2IBZ D;  2KSJ A;  2OYH B;  3CME P;  4KT0 J;  4XFJ A;  1M90 Q;  1PP9 J;  2JO6 A;  2OTK E;  1VQ8 P;  2E76 C;  2C9L Y;  3FWN A;  1JY2 N;  3TGU G;  1TU3 F;  5AW0 B;  2D2C D;  3BVH A;  2E43 A;  2KZI A;  3GKE A;  2KIK A;  1L2P A;  1PZQ A;  2PAJ A;  1SQX J;  3H1H D;  3P8C E;  1M7L A;  2J58 A;  3CX5 I;  2XSO A;  2BCC D;  1N7S D;  1NDO A;  1VQK P;  3MD0 A;  2P58 A;  4EMJ B;  3KZI E;  4DT0 A;  2I8D A;  2H8P D;  5APQ A;  1SQP D;  1AQT A;  1FBM A;  3H1J E;  4ASW A;  2AEM A;  4UB8 H;  2NVE A;  1AFO A;  3CC2 P;  1O7M A;  1IK7 A;  3AED C;  2LKM A;  2YMY A;  2IBZ E;  1L0L G;  2FFD B;  3KYQ A;  1OWA A;  2KP8 A;  2LR2 A;  2WPR A;  1RIE A;  3L73 G;  3AEA C;  5AVT B;  2YO3 A;  3OJA B;  3H1I G;  2HYN A;  4U3F E;  1OX3 A;  3IN6 A;  5KJ7 D;  1HF9 A;  4PJ0 H;  2BCC E;  2DW3 A;  1JTH A;  5AW5 B;  1GK4 A;  3VP9 A;  1CZQ A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 3EWK A;  5CXM A;  1FDO A;  1HJ0 A;  2E75 B;  3AEF C;  1G8K B;  1KYO E;  3GZX A;  2ZT9 C;  4H44 B;  3CWB E;  1O7H A;  1ZRT E;  1NYH A;  4H0L C;  2QJY C;  3AE6 C;  3Q1M A;  2GBW A;  3TGU E;  4HM5 A;  4AAY B;  3D6Y A;  3IAO A;  4PV1 D;  1NTK E;  3H1L E;  2XSH A;  4OGQ C;  4P1C H;  1NYK A;  2E74 C;  5AEW A;  3GF3 A;  1VL2 A;  3L72 E;  4R4L A;  1KMI Z;  2ZYL A;  3R4Y A;  3GMA A;  4NBA D;  1ZP0 C;  4NBH D;  1EXI A;  2HML A;  3EQQ A;  1FQT A;  3GLM A;  4HM1 A;  4QDC A;  4HM7 A;  1Q90 D;  3D70 A;  1K04 A;  2O01 J;  2E4Q A;  3RL0 g;  4HJL A;  2NUK A;  2YMK A;  2JZA A;  1PP9 E;  1FDI A;  1YQ4 C;  1L0L E;  3GTS A;  1S5L X;  2FXP A;  5KKZ C;  1SQB E;  4I7Z C;  4H13 D;  1VCK A;  2J5U A;  2QJK C;  2QPZ A;  2BMO A;  4HM2 A;  3L73 E;  3H1I E;  1UUW A;  1U57 A;  3SFD C;  2H89 C;  3B71 A;  1OMI A;  1DD4 A;  1DIP A;  3GB4 A;  2ZT9 D;  4PV1 B;  1KTM A;  1DD3 A;  3AEC C;  1R8E A;  3C0D A;  3H1H E;  2QIW A;  4U7J A;  3AE2 C;  5KLI C;  3G9R A;  4H44 C;  2FYU E;  3FGA D;  5HL4 A;  3RK3 E;  4TT3 H;  1VF5 C;  4OGQ D;  1RQV A;  5AEU A;  1SQP E;  2NVF A;  2E76 D;  2K9Y A;  4QUQ A;  1MKM A;  3GCE A;  2DE6 D;  4HKV A;  4HM4 A;  1OW7 A;  1ZME C;  3SFE C;  1NU1 E;  1RQU A;  1SQQ E;  3D6Z A;  3EN1 A;  4H13 B;  4NBF D;  4HM3 A;  2NVG A;  3VCA A;  4RKU J;  3AEE C;  2JO1 A;  2HMO A;  1L0N E;  2DE7 D;  1JM1 A;  2OQQ A;  3AE5 C;  4HM8 A;  3FOU A;  2WSE J;  2ZT9 B;  4QDF B;  4NBC D;  3Q5R A;  2HMN A;  3AZC A;  1UIX A;  4GDO A;  2YFI A;  4NB9 D;  1SJG A;  4HM6 A;  2BEQ D;  1P84 E;  3CX5 E;  3AE8 C;  4OGQ B;  3Q5P A;  4Z1M H;  1S1C X;  4P1B H;  3ABV C;  2E74 B;  1K05 A;  1ZOY C;  3AEG C;  2E76 B;  1EG9 A;  3DQY A;  4NBE D;  1PIX A;  4PD4 E;  3AE9 C;  2BMR A;  1VF5 D;  4YXD C;  2V7Q J;  2Q3W A;  3AE3 C;  3T97 B;  1O7W A;  4QUR A;  2E4P A;  2WQY C;  4IL6 X;  4YTP C;  2D2C C;  2G3A A;  4H0L D;  4AIV A;  3O6Q A;  1WMK A;  3Q2Y A;  2E75 C;  1ULI A;  3GTE A;  1KQF B;  4I7Z B;  5BOK A;  2P10 A;  4QDF A;  3GZY A;  2B24 A;  3Q3D A;  2G8Y A;  1ULJ A;  4QDD A;  2BMQ A;  1OW6 A;  2A06 E;  2E74 D;  3H25 A;  2YFL A;  2XR8 A;  4NBD D;  1G8J B;  3C8V A;  2IDB A;  2BEZ F;  3VCP A;  1O7P A;  3L74 E;  2WSC J;  1RFS A;  4Y28 J;  1JB0 J;  1SQV E;  1PPJ E;  1BE3 E;  2FYN C;  1KIL E;  2QJP C;  2XRX A;  1VF5 B;  2NUM A;  3AE7 C;  1BCC E;  3VMI D;  2I7F A;  3L71 E;  2WPV B;  3L75 E;  1KOR A;  2QSI A;  1PL5 A;  1KB9 E;  1NGM B;  3LW5 J;  1Y9B A;  1WQL A;  2YIU C;  1O7G A;  1O7N A;  4H0L B;  4KT0 J;  1YQ3 C;  4XFJ A;  2JO6 A;  2YVJ B;  2FBW C;  2E76 C;  2MKV A;  2WSF J;  1AJY A;  3H1K E;  1TU3 F;  5KLV E;  4NBG D;  2D2C D;  1VM9 A;  4QUP A;  3D89 A;  2H88 C;  3GKE A;  3GOB A;  2E75 D;  2XSO A;  4PV1 C;  4H44 D;  3GL0 A;  1NDO A;  3GL2 A;  1UUV A;  2HMK A;  1KQG B;  2DE5 D;  4EMJ B;  3AE1 C;  3S9O A;  1OW8 A;  2HMJ A;  3L70 E;  3GF7 A;  1PV3 A;  2YFJ A;  2B1X A;  3Q5S A;  3VMG D;  3H1J E;  1GMJ A;  1SQX E;  2NVE A;  3VMH D;  2NZ2 A;  1O7M A;  2GBX A;  1IK7 A;  3AED C;  3N0Q A;  2IBZ E;  1Q90 C;  1NTZ E;  2NWF A;  4NB8 D;  1RIE A;  3AEA C;  2HMM A;  1NTM E;  3BCC E;  3CXH E;  4U3F E;  4H13 C;  3D71 A;  4NBB D;  3IN6 A;  4R4M A;  2JP3 A;  5L8R J;  3AE4 C;  4HM0 A;  1HF9 A;  1EZV E;  2BCC E;  1EXJ A;  4QCK A;  5M1B A;  2D2C B;  3AEB C;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...