1ZRTE

Rhodobacter capsulatus cytochrome bc1 complex with stigmatellin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
RRDFLYHATAATGVVVTGAAVWPLINQMNASADVKAMASIFVDVSAVEVGTQLTVKWRGKPVFIRRRDEKDIELARSVPLGALRDTSAENANKPGAEATDENRTLPAFDGTNTGEWLVMLGVCTHLGCVPMGDKSGDFGGWFCPCHGSHYDSAGRIRKGPAPRNLDIPVAAFVDETTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/metal transport
molecule keywords Cytochrome b
publication title X-Ray Structure of Rhodobacter Capsulatus Cytochrome bc (1): Comparison with its Mitochondrial and Chloroplast Counterparts.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 33
structure length 181
sequence length 181
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1zrtE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1zrtE02
1PPJE 4I7ZB 4H0LB 2BMOA 2E74D 3DQYA 3N0QA 2HMNA 3L74E 4QCKA 4NBGD 1O7PA 4OGQB 2E74B 1BE3E 2HMOA 4HM6A 2BCCE 1JM1A 2E4QA 1BCCE 1UUVA 4AIVA 3L73E 1O7MA 2ZT9D 1NTME 4RKUJ 3GZXA 4HM1A 3BCCE 1KB9E 2HMMA 2BMRA 4HM7A 1JB0J 4H13D 4HJLA 1UUWA 2E4PA 2QPZA 4PD4E 1VF5D 4NB8D 2QSIA 2QJKC 2JZAA 4AAYB 4EMJB 5AEUA 1SQXE 3AZCA 2YFLA 2GBWA 2ZYLA 4NBCD 2NVGA 4QDCA 3FOUA 4H13B 4P1BH 1ULJA 2HMKA 2NWFA 2XRXA 1SQBE 2QJYC 1L0NE 3VMID 2DE7D 2A06E 3H1HE 4U3FE 4NBDD 5HL4A 2QJPC 5KKZC 1NDOA 3L75E 3EQQA 1RFSA 1KYOE 3C0DA 1NU1E 3GL2A 2YIUC 1SQQE 1NTZE 1VM9A 5CXMA 2E76D 3GTEA 1ULIA 3L71E 3VMGD 2I7FA 1S5LX 4NBAD 4NBBD 2DE5D 2ZT9B 1G8KB 4KT0J 4QURA 1O7WA 2D2CD 2JO6A 1ZRTE 2XR8A 4P1CH 2B1XA 3L70E 2WSEJ 4H44D 3GOBA 4HM5A 1P84E 4NBHD 4HM8A 4IL6X 2NUKA 3GCEA 1PP9E 4NB9D 2DE6D 1VF5B 2D2CB 2GBXA 1NYKA 3C8VA 4PV1D 4QUQA 4HM0A 5KLIC 3D89A 3GB4A 2QIWA 1O7HA 3GZYA 3LW5J 4QDDA 4NBFD 3H1KE 4PV1B 4HKVA 2IBZE 3GTSA 4NBED 2CKFA 3GKEA 2Q3WA 2NVFA 4H0LD 3VCAA 1EZVE 2HMJA 2NVEA 3H1IE 3TGUE 5L8RJ 2HMLA 1NTKE 5BOKA 1SQPE 1SQVE 4HM3A 2YVJB 3CX5E 4QDFB 1Q90D 2FYUE 4OGQD 2E76B 1RIEA 3L72E 3CXHE 4QDFA 4Y28J 2WPVB 2B24A 2XSOA 1SJGA 2FYNC 2XSHA 1EG9A 2YFIA 2NUMA 4H44B 2WSCJ 1L0LE 2E75D 3EN1A 4HM2A 2BMQA 1O7GA 1WQLA 5KLVE 2WSFJ 4QUPA 3GL0A 3H1LE 2E75B 2O01J 4HM4A 1VCKA 3CWBE 5AEWA 3VMHD 2YFJA 1FQTA 2K9YA 3H1JE 3VCPA 1G8JB 1Q90C 1O7NA
chains in the Genus database with same CATH superfamily
2Z5IA 4I7ZB 5AW9B 1W2EA 3TSIA 3GHGB 3JCUE 2L91A 2C9LY 3L37A 5AW7B 2N9BA 3PLNA 2RKLA 3M06A 1RF1C 1H89A 2ZYAA 1SQBG 1NTZK 1FJPA 2ZFCA 4D6TD 2C9NY 2K88A 1SQXE 3GMAA 5CBOA 1USDA 4IOIH 4H13B 3I56P 3L73G 3CCMP 5DJUB 1KN7A 3AEBC 3OW2O 1L4AC 2WSEH 2PRRA 3CCEP 5TISE 2BASA 1GL2D 2E76D 1L0NG 3KHUA 5KLVD 2W8ZA 2DE5D 4KT0J 2XR8A 2IBZG 4P1CH 2IFMA 1NAYA 4QUQA 3WU2H 5AVUB 1JY3N 1NYHA 1O7HA 3VP9A 3LW5J 2E43A 2FYNB 3RK2D 3Q1MA 3BATA 1L2PA 5L8RJ 1NTZD 3MD0A 3FX0A 1RIEA 1HH0A 4GDOA 4K3AA 3B8EB 2WT7A 3E7KA 3KZIE 4WY4C 3V5BA 4M3LA 5B66H 1NTMK 1IC2A 1HF9A 1X79B 1FOSF 1P84H 4I2LC 4PJ0E 1SFCD 5E79H 4OGQB 5AW6B 4JYBA 3G9RA 1KTMA 3S1KA 4JBZA 1J1EC 1AV1A 3CCJP 4PD4E 2KS1B 1JY3P 3RK3D 3GG2A 2YFLA 3H1JD 3AE3C 1PGOA 5APQA 5CCHD 5GTHE 1NTKJ 3L74D 1CI6A 2NPSD 2HLOA 5KKZC 2JJLA 2LR2A 3V4WA 3L72J 4LGDE 3C0DA 1YJ9P 2G3AA 1NU1E 2GM4A 1NTMD 2P67A 3HUSB 3SWYA 4IFMA 4WVZA 2HPCB 3HD7C 2XNDH 2PP6A 2V7QJ 2D2CB 2HR3A 1YJWP 3L36A 1L0LK 4PV1B 4W7ZA 3VOPA 2K9JA 2K3RA 1LTJA 2R5DA 3RBZA 2HMLA 4H44C 5AVSB 2P10A 1SJGA 2C0XA 1N7SC 1LTAC 3VN0A 3U59A 5AVTB 1USEA 2M0BA 5GTIH 3AE8C 1NWQA 2IYOA 1OVVA 1ZOYC 2KYVA 2OQQA 3HE5B 3AEAC 3CMAP 3N0QA 1QLED 3OAKA 2FYUD 1X0TA 1RF0C 2BEQD 2KK7A 1UUVA 4DZOA 1L0LD 1IZNB 3A7OA 1FJKA 1CSBA 4HM7A 1OW8A 2QJKC 4C7NB 2WSSH 2E74C 1BCCG 3MP7B 1RF1A 1SQPD 1AVOA 4ZKPA 1OVUA 1JEKA 1NH4A 3CLQA 2XV5A 1EDIA 5BVZA 1FDIA 3D6YA 2OTLP 1PIXA 3H1HG 4U3FG 4EDFA 4AUWA 4N3YB 3QH9A 2WSEJ 2YNYA 2FXPA 2O1KA 1LT9A 1OZHA 1SQXD 2N1TD 3CWBJ 1VF5B 1Y8AA 1ZP0C 4GOFA 3KPEA 5AVZB 2JP3A 1A02J 2J5UA 3BRVB 2H7HA 1PP9G 3Q5PA 2GUSA 2B88A 3CX5E 1HTLC 1KB9D 2QM7A 1IJDB 2IYPA 4D6TG 2WPVB 4HKZH 3BCCJ 2YKPA 4OH8B 2OYIA 3H32A 1WQLA 2JWAA 3CC7P 2WSFJ 2PAJA 2E75B 1BGYJ 2O01J 1R8EA 2M5AB 2M8RA 3O6QB 3GW6A 3M9BA 4OGQC 2ZXXA 1EXIA 5KLVG 1VL2A 4WY4A 3L71J 2QA4P 2E4QA 5AW5B 2B87A 1NU1K 1MV8A 2QJPB 3AE7C 2IFNA 2JO1A 3CCSP 3AEGC 5AW8B 3H1KJ 4NBCD 4DCKA 1KD1Q 1NTZG 4JYCA 3CD6P 1SVFA 2CPBA 3BRTB 5KJ7D 1RQUA 3VMYA 1GL2B 1O7WA 3A0BH 5KAIE 4N78E 4PD4D 2VRSA 3SFEC 3C8VA 2HODA 3T97A 3B5ND 1K05A 1PGQA 5CCGA 1KB9I 1BDDA 3A3YB 2M3BA 1KFMA 1NU1D 2O1JA 1VQKP 1NTKE 1GU5A 1IK7A 4CPGA 1H8AA 3L73J 5K5GB 3L72E 1BSHA 4YPCA 1SP4A 3H1JG 4HJGH 1JTHA 1NAFA 1SQVG 1LGHB 3RGUA 3FXEA 5AVWB 3EWKA 1MZ9A 3VMHD 1N7SA 2OYHB 1KILD 1YTZI 4K35A 1URQA 1ZR2A 1GTWA 1JCDA 4YXDC 2HMOA 2AEMA 3GHGA 2YKOA 2O01N 1VQ7P 2Q3IA 2WTYA 4WB4A 2OTJP 2KLVA 3GZXA 1HJBA 1ZN5A 2BMRA 1S2EA 1G1IA 4ZNCA 2QSIA 1DD3A 1JY2O 1W2BO 2NVGA 1FZGA 4ASVA 2FFDB 2H88C 1FDOA 2XZRA 1VQ4P 1ZW0A 2NPSB 3M91A 1RQVA 1ULIA 1GZLA 3PH0A 1VF5C 2ZYDA 4EIJA 4JQ0D 1LTGC 4N6JA 1YITP 2FYUG 4HKVA 2W83C 1NOHA 1BE3D 1AJYA 2KB7P 3UIAA 5AW3B 2QVAA 3TGUE 1L0LG 2BCCJ 2FBWC 1E5WA 4DJGA 2Q1KA 1LTJC 1T8ZA 3S4RA 3AE6C 1SQPG 1GW3A 3I55P 1T6AA 3MTUE 3CWBE 1FQTA 1AQTA 5APWA 4H0LB 1U57A 2HMNA 2WITA 2AEFA 4ZKUA 4GODA 4I6MC 3CC4P 1SQXG 1YHQP 1OMIA 3L70J 3C9IA 3M0AA 1Y47A 2P7JA 3BCCE 5AEUA 4AAYB 1E79H 2KS1A 2WPRA 2GA1A 1BGYE 1N86A 2JWDA 1T3JA 4L76A 1FZCB 3GTEA 3L71E 2A06G 3FWNA 1NTKK 2R3SA 1ZRTE 1FOSE 3IAOA 5APYA 5CMZA 3HUSA 1P84E 1SQQG 2HPCA 3CCLP 3D89A 1VDFA 3H1KE 1T2KD 2KOGA 1LT9C 1N7LA 1NO4A 1EZVE 4IL6E 2AXTH 1RHZB 2ZVOB 1KMIZ 3G6EP 1BCCJ 2Z5HA 4L74A 4C46A 5BU5A 4N78D 1N2DC 3USSA 3EN1A 2KXPB 2OYHC 3GLMA 1LWUB 1Q86Q 1HGZA 3H1HJ 4U3FJ 3HE4B 2WPQA 2OYIC 4EI2A 4MN4C 1OWAA 1NTKD 3C1LA 1IFMA 3HE5A 2Q9IA 3B71A 1M8OB 1L4AD 5EFWB 3L73E 1T3UA 1PP9J 1QX8A 2JKVA 4HM1A 1EQ7A 2A45I 1M1JB 3Q2YA 4O9BA 3A0HH 3H1ID 4C7NA 1NU1G 1PZQA 4LLHA 1J1DB 1L0NE 2QE7H 3PP5A 3B4SA 2KUBA 5H2FH 5GTIE 2WSCH 1HGVA 4NBBD 1AVYA 2ZVNB 1IFPA 5KLVJ 3H1LJ 4IL6X 2NUKA 1NKZB 3A5TA 1W5CE 2FKWB 3O8ZA 1RE3C 2CKFA 3GKEA 3F5HA 2DW3A 1KB9H 2V4HA 4WY4D 1MUUA 2XDJA 3B5NB 1R5SA 3VYIA 2WQYC 5B5EH 1S1CX 4XFJA 3WUUA 3CXHE 5CCGC 4Y28J 2XSOA 1FS0E 4HM2A 1JO5A 3VMXA 2RN0A 4H0LC 1KYOD 2CPSA 2M5AA 1UIIA 3K5BA 2K37A 3O6QA 1NGMB 1KILB 4WWIA 2R3CA 2YMYA 3CC2P 1O7PA 3V6IA 2NRGA 1H0TB 3KZIH 1LTBC 2BCCE 2Q5UA 3R4YA 4UB8E 2KZJA 1URQC 4NPDA 4I7ZC 1BE3G 1G1JA 3GHGC 4QDCA 3HD7D 3FOUA 1ULJA 2NWFA 2FXOA 4C7RA 3VMID 2QEXP 1SQVJ 3KXDA 4NBDD 1LP1B 4GT1A 3EQQA 4YXWH 4A7PA 2FY8A 1R5LA 2HFED 3SSUA 3NTNA 5C39A 4H13C 2ITAA 1LT1A 2ZT9B 3BCCD 1FZAA 2YIUB 4XA4A 3L75G 3L70E 3AEFC 3LIDA 4H44D 2B1XA 1VQMP 1GL2A 5GTHH 4RJTA 1VQPP 2E42A 1KZUB 1N7SD 4U7JA 4HM0A 3TGUJ 1BGYD 3IF4A 4BRYB 1DX7A 3EFGA 1DEEG 3JC22 2Q3WA 3V2RA 4UB6E 3VMAA 3SWFA 5BOKA 1QEXA 4QDFB 4RO0A 5CHXA 1K73Q 3L71D 4BXLA 1FBMA 1P84D 4OWFA 2FYNC 3M0DA 1DIPA 2XSHA 2A45G 2BMQA 2KLUA 1KYOI 2FXMA 3AEDC 1EDLA 3VTPC 2E5YA 1WRGA 3H1KD 1AA0A 5APXA 3U1AA 3PTZA 2OYHA 3MGNA 2E74D 2OARA 3DQYA 1X8YA 2H43A 1L0NK 1IK9A 4HYTB 1S3JA 2QJYB 3HRNA 1BCCE 5APUA 1FDMA 4AIVA 4RKUJ 2KI7B 2XKMA 1OVRA 2E4PA 2J58A 4IFFA 2Q7CA 4P1BH 3L4FA 3OJAB 5DJTB 3RL0B 1KQLA 2HYNA 3H1HE 4U3FE 3S9OA 1SQPJ 3Q5RA 1Q7YQ 4R4MA 2FFDA 2CK3H 3FGAD 3GL2A 4R4LA 1VQOP 5CCHA 2NPSA 4HM5A 1JY2N 1PP9E 2DE6D 3LIEA 1KQSO 4DOJA 3W68A 5CJ0A 3GZYA 2R5BA 1S5LE 1Z56A 3HUSC 2OTKE 3R2PA 3VCAA 3GF7A 1YI2P 2D2CC 4OGQD 5AVQB 2E76B 1RE3A 3TK1A 2I1JA 2B24A 3D70A 5AVXB 4PV1C 3NXSA 1Q82Q 3H1IG 2NUMA 2H89C 5KLVE 4QMAA 1SQBJ 3H1LE 1YIJP 4HM4A 1ZV8A 1KQFB 1ZXGA 3HTKB 3RK2B 3ZDMA 3E1RA 3G3ZA 1SQQJ 2B89A 3CXHD 1YQ4C 1HBWA 1PL5A 2N9YB 1M56D 1KORA 3KYQA 3L74G 1L4AB 1L0NJ 2HMMA 2A45H 3LW5H 1N73B 5AW1B 1JNMA 2KSJA 1IO4A 3AZCA 3CI9A 1NTMG 3CCUP 2DE7D 2K1AA 4LC1A 1OW7A 1SFCB 3AE5C 2W90A 1NDOA 1FC2C 2ZT9C 2BCCD 2YIUC 1FE6A 2UWJE 1NVOA 4TT3H 1OFCX 1FZCA 1S5LX 1CW5A 1JMBA 4HB1A 3RK3B 1NYKA 4IFDK 3GTSA 5KLIB 1PV3A 1FAVA 1S4XA 2I1KA 4RESB 2HMJA 4PD4I 1WMKA 5KAFE 1SQVE 4W7YA 3AEEC 1LTSC 3F89A 3L70D 1QL1A 1JUNA 1KFNA 1G2CB 1GU4A 1O7GA 4ZMDA 3OA7A 3V2NA 1Q81Q 3WUTA 4QUPA 1GDTA 1LWUA 1DEBA 1Q90C 2QG4A 1J1EB 1OXZA 1O7NA 3HE4A 1MKMA 1ZR4A 3V2PA 2QM8A 2E75C 4HM6A 2V7QH 5KKZB 2I8DA 1VF5D 3RL0C 2YMKA 1M1JA 3JSVC 4L75A 2BEZF 2YXRB 1YJNP 3CX5D 1VQ8P 3TYYA 3HD7B 1MFZA 2QJPC 1HVVA 2IX7C 3WU2E 3G4SP 1S9KE 2IDBA 5APVA 3KDPB 1BCCD 2HG5D 1G8KB 1Y9BA 3H1KG 4GOEA 3GCEA 3WUVA 5KJ7A 2QIWA 5AW4B 1H88A 4NBFD 1X22A 3H1HD 4U3FD 5KLVK 2Y0EA 1GL2C 1FZEA 4AYCA 2NVFA 2E76C 1BE3J 5B66E 1SQPE 3IR9A 3B5NA 3TF5A 2YKQA 3A0HE 2YO3A 1GMJA 5E79E 2YFIA 1PP9D 1LTIC 1YYCA 4OVNF 1KYOH 2N1TB 3RK2C 5CBNA 1CZQA 5AEWA 1RE4C 5H2FE 2K9YA 3M0DC 3L75J 3TDKA 1PPJE 1KC8Q 2KSEA 2JDIH 2QJKB 2AXCA 2E74B 1KILA 3TNUB 5BU8B 1RY3A 1N73C 1BDCA 1H0TA 2MKVA 2Q6QA 1KB9E 2JR8A 3H1LD 3CX5I 4NB8D 2ZYGA 1VQ9P 1OIPA 1A02F 2ZYLA 1SFCC 5B5EE 2XRXA 1SQBE 2Y9ZA 2KNCB 2A06E 3L72D 3SWKA 2P58A 2ZJSE 1RFSA 2W6JH 1LP1A 1SQQE 4L73A 3EQ2A 4NBAD 3RK3C 2FFDC 1SQVK 2WSFH 5TJHA 2O01H 4D6TJ 4NBHD 1Q2NA 2KZIA 5CJ4A 3JCUH 4NB9D 2YO2A 5KLIC 5CCHC 2NPSC 3IFMA 2IBZE 2RMZA 3BASA 2R32A 3V4QA 2Y9YA 4BRYA 3FXDA 3NMDA 3P8CE 2OYOA 1EDJA 4QDFA 1VQ6P 1X9VA 1YBKA 4ASWA 3D71A 2W6AA 1QGKB 5TISH 1VQ5P 2Y0DA 4IL6H 3GL0A 1DH3A 3A2AA 2YFJA 2RH0A 4NPEA 2BCCG 3V2QA 1SQVD 5KTBA 1NTZJ 3P8MC 4QCKA 4I1LA 1DD4A 4YTPC 2W27A 3ABVC 1UUWA 2FYUK 2GBWA 3TGUD 1JY3O 3H1IJ 2LXBA 4DT0A 3KQGA 3VP8A 3AE1C 3P7KA 3L70G 1VQNP 1JOCA 1VPCA 2G8YA 1KILE 1UIXA 5CXMA 3VMGD 3PJSK 4PJ0H 2M3EA 1SQPK 2XU6A 3CWBD 4QURA 1U7MA 2JO6A 1KQGB 1PFIA 5CCGD 1FZCC 1YQ3C 3H1JJ 3GB4A 2PGDA 4QDDA 4NBED 3L74J 4Y99B 1QL2A 1S9KD 1N8RQ 3P32A 4H0LD 4PD4H 1EC5A 2JEEA 2Y0CA 1SQXK 2IPPA 1IFJA 3NFQA 4JPZB 1NTMJ 2N1TC 2WT7B 2Q3EA 4AQRD 2QRXA 1OW6A 1M57D 1HWTC 1URQD 2LXCB 2H8PD 1G8JB 3CXHH 3N4XA 2BMOA 3HTKA 3AE2C 3H25A 1S72P 1K9MQ 1SQBK 1K8AQ 4NBGD 1EDKA 1ZRTD 1RE4A 2Z4EA 1LWUC 1GD2E 1BE3E 1IFIA 1RH5B 3BVHA 1JM1A 3CCVP 1LTTC 1SQQK 2WPSA 4H13D 3M9QA 3PHLA 1L4AA 1EZVD 1N73A 1OX3A 3QWOC 3MHVA 5AVVB 2IZ0A 3A0BE 1JCCA 5APSA 1CI6B 4EOTA 1PPJD 3CPWO 4UB8H 1EXJA 3AE9C 2FYUJ 3L75E 1SFCA 1M90Q 1M1JC 3MUDC 5AVYB 1K04A 1VM9A 1L0LJ 1J1DC 3H6PA 4HM8A 3MZWB 2GBXA 4TLFA 1SQBD 1M7LA 2K9JB 4GIFA 1FZBA 1QVGO 3IN6A 1LTJB 2A06D 3AECC 5KJ7C 3L73D 1SQQD 3GF3A 3CCQP 1PGJA 2P2UA 2WZ7A 3H1LG 3M9HA 1GW4A 1EG9A 4HH2A 2WSCJ 1SQXJ 1NTKG 1L0ND 2E5TA 3EFFK 2ZXEB 3B5NC 1G2CA 2L5GB 3D6ZA 4UB6H 4D6TE 3L72G 2IBZD 1VCKA 1HJ0A 3VCPA 2LKMA 3SFDC 2R44A 1P84I 3P8CD 2KP8A 5AVRB 2YXQB 3G71P 2AEJA 1EZVI 1JB0J 2NZ2A 3CX5H 4HJLA 2QPZA 1KILC 2JZAA 1RF1B 3MIWA 2GUVA 3VMZA 1D7MA 3PRJA 4NPFX 1ZLLA 5AW0B 2WWWA 3W67A 5HL4A 1FZFA 4JF7A 3HD7A 2IZ1A 1NKNA 1AQ5A 3II6A 1NTZE 3CL3D 2OGUA 1TU3F 1JY2P 2SPZA 2I7FA 1LT9B 2D2CD 2J59M 3ITKA 1ZMEC 3WMM0 4XE5B 4PV1D 4Y99C 2POHA 3I5CA 1FU1A 3H1IE 2NVEA 3FWLA 3L35A 3RBXA 3N7NA 2KIKA 2P1JA 2O3JA 2OYIB 3H32B 1S5LH 3TGUG 2IBZI 1GK4A 1PGPA 3CCRP 2WVRA 2N1TA 3RK3E 1RF0A 3H1JE 5KAIH 4WY4B 1VQLP 2B9BA 1NU1J 4B86A 3L74E 3CMEP 3CWBG 2B87B 1JM0A 2MJZA 5M1BA 1LNQA 2ZT9D 1O7MA 3TNUA 1NTME 1SLQA 1GK6A 4GKGA 4EMJB 2PFXA 4WBAA 3CXHI 2FYZA 2HMKA 2C0WA 2QJYC 1WT6A 1M1KQ 1MFTA 3BCCG 1LJ2A 1XTCC 4EYYQ 1IFDA 3AE4C 2KNCA 2ZAEB 1KYOE 1IFNA 1BGYG 2W6BA 1J2JB 4KHXA 5APTA 2AXTE 2WMMA 3GOBA 1BSNA 2HODB 3Q3DA 3MUDA 3T97B 3RL0g 2XNXA 3E1IA 3L71G 1YTZT 1NHLA 3L75D 4W80A 1JMMA 1XTGB 1QVFO 4HM3A 1U7JA 2YVJB 1Q90D 2FYUE 1JTHB 1EZVG 1HUCA 4H44B 4Z1MH 1L0LE 2E75D 3U1CA 1SS1A 1T2KC 1PPJG 4KJMA 1N7SB 5KAFH 3Q5SA 5AW2B 3RL0D 4BWNA 1NJIQ 1KV4A 1URQB 1AFOA
chains in the Genus database with same CATH topology
4I7ZB 2E74D 3DQYA 4QCKA 4YXDC 2HMOA 1BCCE 1DD4A 4YTPC 4AIVA 4RKUJ 3GZXA 2BMRA 3ABVC 1UUWA 2E4PA 2QSIA 1DD3A 1SQXE 3GMAA 2GBWA 2NVGA 4H13B 4P1BH 2H88C 3AEBC 1FDOA 3S9OA 3Q5RA 3H1HE 4U3FE 4R4MA 3AE1C 3FGAD 2G8YA 3GL2A 1KILE 1UIXA 4R4LA 5CXMA 1RQVA 2E76D 1ULIA 3VMGD 1VF5C 2DE5D 4KT0J 4QURA 2JO6A 2XR8A 4P1CH 1KQGB 4HM5A 1PP9E 2DE6D 4QUQA 1YQ3C 3GB4A 1NYHA 1O7HA 3GZYA 3LW5J 4QDDA 4NBED 4HKVA 3Q1MA 1AJYA 4H0LD 3VCAA 3GF7A 3TGUE 5L8RJ 2FBWC 2D2CC 4OGQD 2E76B 1RIEA 2B24A 4GDOA 3D70A 4PV1C 2NUMA 3AE6C 2H89C 1OW6A 5KLVE 3H1LE 4HM4A 3CWBE 1HF9A 1FQTA 1KQFB 1G8JB 4H0LB 1U57A 2BMOA 2HMNA 3AE2C 3H25A 4NBGD 4OGQB 1BE3E 1YQ4C 1JM1A 3G9RA 1PL5A 1OMIA 1KORA 1KTMA 3BCCE 2HMMA 4H13D 4PD4E 5AEUA 4AAYB 3AZCA 2YFLA 3AE3C 2DE7D 1OW7A 1EXJA 3AE9C 3AE5C 5KKZC 1NDOA 3L75E 3C0DA 2G3AA 2ZT9C 1NU1E 1K04A 2YIUC 1VM9A 4TT3H 3GTEA 3L71E 1S5LX 1ZRTE 3IAOA 1P84E 4HM8A 2V7QJ 2D2CB 2GBXA 1NYKA 3D89A 3IN6A 4PV1B 3H1KE 3GTSA 1PV3A 3AECC 1EZVE 2HMJA 1WMKA 2HMLA 1KMIZ 1SQVE 3GF3A 3AEEC 4H44C 2P10A 1SJGA 1EG9A 2WSCJ 3EN1A 1O7GA 3D6ZA 3GLMA 3AE8C 4QUPA 1VCKA 1HJ0A 3VCPA 1ZOYC 3SFDC 1Q90C 2OQQA 1O7NA 3AEAC 3N0QA 1MKMA 2BEQD 2E75C 3B71A 4HM6A 1UUVA 3L73E 4HM1A 4HM7A 1JB0J 2NZ2A 4HJLA 2QPZA 3Q2YA 1VF5D 1OW8A 2QJKC 2JZAA 2E74C 2YMKA 2BEZF 1L0NE 5HL4A 2QJPC 2IDBA 1FDIA 1NTZE 1TU3F 3D6YA 2I7FA 4NBBD 1PIXA 1G8KB 2D2CD 1Y9BA 2WSEJ 2FXPA 1ZMEC 4IL6X 2NUKA 3GCEA 1VF5B 4PV1D 1ZP0C 2QIWA 4NBFD 2JP3A 2CKFA 3GKEA 2J5UA 2NVFA 2E76C 3Q5PA 2NVEA 3H1IE 1SQPE 3CX5E 2WQYC 1S1CX 4XFJA 3CXHE 4Y28J 2WPVB 2XSOA 1GMJA 2YFIA 4HM2A 1WQLA 2WSFJ 2E75B 2O01J 1R8EA 5AEWA 4H0LC 3RK3E 2K9YA 3H1JE 4OGQC 1EXIA 1PPJE 3O6QA 1VL2A 1NGMB 3L74E 1O7PA 2E74B 3R4YA 2BCCE 2E4QA 5M1BA 2MKVA 2ZT9D 1O7MA 1NTME 3AE7C 1KB9E 4I7ZC 2JO1A 4NB8D 3AEGC 4EMJB 4NBCD 2ZYLA 4QDCA 3FOUA 1ULJA 2HMKA 2NWFA 2XRXA 1SQBE 2QJYC 3VMID 2A06E 4NBDD 3AE4C 3EQQA 1RFSA 1KYOE 1SQQE 1RQUA 4H13C 4NBAD 2ZT9B 1O7WA 2B1XA 3L70E 3AEFC 4H44D 3GOBA 4NBHD 3Q3DA 3SFEC 3T97B 4NB9D 3RL0g 3C8VA 4U7JA 4HM0A 5KLIC 2IBZE 1K05A 2Q3WA 1NTKE 5BOKA 4HM3A 1IK7A 4QDFB 2YVJB 1Q90D 2FYUE 3L72E 4QDFA 3D71A 2FYNC 1DIPA 2XSHA 4H44B 4Z1MH 2E75D 1L0LE 2BMQA 3AEDC 3GL0A 3Q5SA 3EWKA 3VMHD 2YFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ E;  4I7Z B;  4H0L B;  2BMO A;  2E74 D;  3DQY A;  3N0Q A;  2HMN A;  3L74 E;  4QCK A;  4NBG D;  1O7P A;  4OGQ B;  2E74 B;  1BE3 E;  2HMO A;  4HM6 A;  2BCC E;  1JM1 A;  2E4Q A;  1BCC E;  1UUV A;  4AIV A;  3L73 E;  1O7M A;  2ZT9 D;  1NTM E;  4RKU J;  3GZX A;  4HM1 A;  3BCC E;  1KB9 E;  2HMM A;  2BMR A;  4HM7 A;  1JB0 J;  4H13 D;  4HJL A;  1UUW A;  2E4P A;  2QPZ A;  4PD4 E;  1VF5 D;  4NB8 D;  2QSI A;  2QJK C;  2JZA A;  4AAY B;  4EMJ B;  5AEU A;  1SQX E;  3AZC A;  2YFL A;  2GBW A;  2ZYL A;  4NBC D;  2NVG A;  4QDC A;  3FOU A;  4H13 B;  4P1B H;  1ULJ A;  2HMK A;  2NWF A;  2XRX A;  1SQB E;  2QJY C;  1L0N E;  3VMI D;  2DE7 D;  2A06 E;  3H1H E;  4U3F E;  4NBD D;  5HL4 A;  2QJP C;  5KKZ C;  1NDO A;  3L75 E;  3EQQ A;  1RFS A;  1KYO E;  3C0D A;  1NU1 E;  3GL2 A;  2YIU C;  1SQQ E;  1NTZ E;  1VM9 A;  5CXM A;  2E76 D;  3GTE A;  1ULI A;  3L71 E;  3VMG D;  2I7F A;  1S5L X;  4NBA D;  4NBB D;  2DE5 D;  2ZT9 B;  1G8K B;  4KT0 J;  4QUR A;  1O7W A;  2D2C D;  2JO6 A;  1ZRT E;  2XR8 A;  4P1C H;  2B1X A;  3L70 E;  2WSE J;  4H44 D;  3GOB A;  4HM5 A;  1P84 E;  4NBH D;  4HM8 A;  4IL6 X;  2NUK A;  3GCE A;  1PP9 E;  4NB9 D;  2DE6 D;  1VF5 B;  2D2C B;  2GBX A;  1NYK A;  3C8V A;  4PV1 D;  4QUQ A;  4HM0 A;  5KLI C;  3D89 A;  3GB4 A;  2QIW A;  1O7H A;  3GZY A;  3LW5 J;  4QDD A;  4NBF D;  3H1K E;  4PV1 B;  4HKV A;  2IBZ E;  3GTS A;  4NBE D;  2CKF A;  3GKE A;  2Q3W A;  2NVF A;  4H0L D;  3VCA A;  1EZV E;  2HMJ A;  2NVE A;  3H1I E;  3TGU E;  5L8R J;  2HML A;  1NTK E;  5BOK A;  1SQP E;  1SQV E;  4HM3 A;  2YVJ B;  3CX5 E;  4QDF B;  1Q90 D;  2FYU E;  4OGQ D;  2E76 B;  1RIE A;  3L72 E;  3CXH E;  4QDF A;  4Y28 J;  2WPV B;  2B24 A;  2XSO A;  1SJG A;  2FYN C;  2XSH A;  1EG9 A;  2YFI A;  2NUM A;  4H44 B;  2WSC J;  1L0L E;  2E75 D;  3EN1 A;  4HM2 A;  2BMQ A;  1O7G A;  1WQL A;  5KLV E;  2WSF J;  4QUP A;  3GL0 A;  3H1L E;  2E75 B;  2O01 J;  4HM4 A;  1VCK A;  3CWB E;  5AEW A;  3VMH D;  2YFJ A;  1FQT A;  2K9Y A;  3H1J E;  3VCP A;  1G8J B;  1Q90 C;  1O7N A; 
#chains in the Genus database with same CATH topology
 2Z5I A;  4I7Z B;  5AW9 B;  1W2E A;  3TSI A;  3GHG B;  3JCU E;  2L91 A;  2C9L Y;  3L37 A;  5AW7 B;  2N9B A;  3PLN A;  2RKL A;  3M06 A;  1RF1 C;  1H89 A;  2ZYA A;  1SQB G;  1NTZ K;  1FJP A;  2ZFC A;  4D6T D;  2C9N Y;  2K88 A;  1SQX E;  3GMA A;  5CBO A;  1USD A;  4IOI H;  4H13 B;  3I56 P;  3L73 G;  3CCM P;  5DJU B;  1KN7 A;  3AEB C;  3OW2 O;  1L4A C;  2WSE H;  2PRR A;  3CCE P;  5TIS E;  2BAS A;  1GL2 D;  2E76 D;  1L0N G;  3KHU A;  5KLV D;  2W8Z A;  2DE5 D;  4KT0 J;  2XR8 A;  2IBZ G;  4P1C H;  2IFM A;  1NAY A;  4QUQ A;  3WU2 H;  5AVU B;  1JY3 N;  1NYH A;  1O7H A;  3VP9 A;  3LW5 J;  2E43 A;  2FYN B;  3RK2 D;  3Q1M A;  3BAT A;  1L2P A;  5L8R J;  1NTZ D;  3MD0 A;  3FX0 A;  1RIE A;  1HH0 A;  4GDO A;  4K3A A;  3B8E B;  2WT7 A;  3E7K A;  3KZI E;  4WY4 C;  3V5B A;  4M3L A;  5B66 H;  1NTM K;  1IC2 A;  1HF9 A;  1X79 B;  1FOS F;  1P84 H;  4I2L C;  4PJ0 E;  1SFC D;  5E79 H;  4OGQ B;  5AW6 B;  4JYB A;  3G9R A;  1KTM A;  3S1K A;  4JBZ A;  1J1E C;  1AV1 A;  3CCJ P;  4PD4 E;  2KS1 B;  1JY3 P;  3RK3 D;  3GG2 A;  2YFL A;  3H1J D;  3AE3 C;  1PGO A;  5APQ A;  5CCH D;  5GTH E;  1NTK J;  3L74 D;  1CI6 A;  2NPS D;  2HLO A;  5KKZ C;  2JJL A;  2LR2 A;  3V4W A;  3L72 J;  4LGD E;  3C0D A;  1YJ9 P;  2G3A A;  1NU1 E;  2GM4 A;  1NTM D;  2P67 A;  3HUS B;  3SWY A;  4IFM A;  4WVZ A;  2HPC B;  3HD7 C;  2XND H;  2PP6 A;  2V7Q J;  2D2C B;  2HR3 A;  1YJW P;  3L36 A;  1L0L K;  4PV1 B;  4W7Z A;  3VOP A;  2K9J A;  2K3R A;  1LTJ A;  2R5D A;  3RBZ A;  2HML A;  4H44 C;  5AVS B;  2P10 A;  1SJG A;  2C0X A;  1N7S C;  1LTA C;  3VN0 A;  3U59 A;  5AVT B;  1USE A;  2M0B A;  5GTI H;  3AE8 C;  1NWQ A;  2IYO A;  1OVV A;  1ZOY C;  2KYV A;  2OQQ A;  3HE5 B;  3AEA C;  3CMA P;  3N0Q A;  1QLE D;  3OAK A;  2FYU D;  1X0T A;  1RF0 C;  2BEQ D;  2KK7 A;  1UUV A;  4DZO A;  1L0L D;  1IZN B;  3A7O A;  1FJK A;  1CSB A;  4HM7 A;  1OW8 A;  2QJK C;  4C7N B;  2WSS H;  2E74 C;  1BCC G;  3MP7 B;  1RF1 A;  1SQP D;  1AVO A;  4ZKP A;  1OVU A;  1JEK A;  1NH4 A;  3CLQ A;  2XV5 A;  1EDI A;  5BVZ A;  1FDI A;  3D6Y A;  2OTL P;  1PIX A;  3H1H G;  4U3F G;  4EDF A;  4AUW A;  4N3Y B;  3QH9 A;  2WSE J;  2YNY A;  2FXP A;  2O1K A;  1LT9 A;  1OZH A;  1SQX D;  2N1T D;  3CWB J;  1VF5 B;  1Y8A A;  1ZP0 C;  4GOF A;  3KPE A;  5AVZ B;  2JP3 A;  1A02 J;  2J5U A;  3BRV B;  2H7H A;  1PP9 G;  3Q5P A;  2GUS A;  2B88 A;  3CX5 E;  1HTL C;  1KB9 D;  2QM7 A;  1IJD B;  2IYP A;  4D6T G;  2WPV B;  4HKZ H;  3BCC J;  2YKP A;  4OH8 B;  2OYI A;  3H32 A;  1WQL A;  2JWA A;  3CC7 P;  2WSF J;  2PAJ A;  2E75 B;  1BGY J;  2O01 J;  1R8E A;  2M5A B;  2M8R A;  3O6Q B;  3GW6 A;  3M9B A;  4OGQ C;  2ZXX A;  1EXI A;  5KLV G;  1VL2 A;  4WY4 A;  3L71 J;  2QA4 P;  2E4Q A;  5AW5 B;  2B87 A;  1NU1 K;  1MV8 A;  2QJP B;  3AE7 C;  2IFN A;  2JO1 A;  3CCS P;  3AEG C;  5AW8 B;  3H1K J;  4NBC D;  4DCK A;  1KD1 Q;  1NTZ G;  4JYC A;  3CD6 P;  1SVF A;  2CPB A;  3BRT B;  5KJ7 D;  1RQU A;  3VMY A;  1GL2 B;  1O7W A;  3A0B H;  5KAI E;  4N78 E;  4PD4 D;  2VRS A;  3SFE C;  3C8V A;  2HOD A;  3T97 A;  3B5N D;  1K05 A;  1PGQ A;  5CCG A;  1KB9 I;  1BDD A;  3A3Y B;  2M3B A;  1KFM A;  1NU1 D;  2O1J A;  1VQK P;  1NTK E;  1GU5 A;  1IK7 A;  4CPG A;  1H8A A;  3L73 J;  5K5G B;  3L72 E;  1BSH A;  4YPC A;  1SP4 A;  3H1J G;  4HJG H;  1JTH A;  1NAF A;  1SQV G;  1LGH B;  3RGU A;  3FXE A;  5AVW B;  3EWK A;  1MZ9 A;  3VMH D;  1N7S A;  2OYH B;  1KIL D;  1YTZ I;  4K35 A;  1URQ A;  1ZR2 A;  1GTW A;  1JCD A;  4YXD C;  2HMO A;  2AEM A;  3GHG A;  2YKO A;  2O01 N;  1VQ7 P;  2Q3I A;  2WTY A;  4WB4 A;  2OTJ P;  2KLV A;  3GZX A;  1HJB A;  1ZN5 A;  2BMR A;  1S2E A;  1G1I A;  4ZNC A;  2QSI A;  1DD3 A;  1JY2 O;  1W2B O;  2NVG A;  1FZG A;  4ASV A;  2FFD B;  2H88 C;  1FDO A;  2XZR A;  1VQ4 P;  1ZW0 A;  2NPS B;  3M91 A;  1RQV A;  1ULI A;  1GZL A;  3PH0 A;  1VF5 C;  2ZYD A;  4EIJ A;  4JQ0 D;  1LTG C;  4N6J A;  1YIT P;  2FYU G;  4HKV A;  2W83 C;  1NOH A;  1BE3 D;  1AJY A;  2KB7 P;  3UIA A;  5AW3 B;  2QVA A;  3TGU E;  1L0L G;  2BCC J;  2FBW C;  1E5W A;  4DJG A;  2Q1K A;  1LTJ C;  1T8Z A;  3S4R A;  3AE6 C;  1SQP G;  1GW3 A;  3I55 P;  1T6A A;  3MTU E;  3CWB E;  1FQT A;  1AQT A;  5APW A;  4H0L B;  1U57 A;  2HMN A;  2WIT A;  2AEF A;  4ZKU A;  4GOD A;  4I6M C;  3CC4 P;  1SQX G;  1YHQ P;  1OMI A;  3L70 J;  3C9I A;  3M0A A;  1Y47 A;  2P7J A;  3BCC E;  5AEU A;  4AAY B;  1E79 H;  2KS1 A;  2WPR A;  2GA1 A;  1BGY E;  1N86 A;  2JWD A;  1T3J A;  4L76 A;  1FZC B;  3GTE A;  3L71 E;  2A06 G;  3FWN A;  1NTK K;  2R3S A;  1ZRT E;  1FOS E;  3IAO A;  5APY A;  5CMZ A;  3HUS A;  1P84 E;  1SQQ G;  2HPC A;  3CCL P;  3D89 A;  1VDF A;  3H1K E;  1T2K D;  2KOG A;  1LT9 C;  1N7L A;  1NO4 A;  1EZV E;  4IL6 E;  2AXT H;  1RHZ B;  2ZVO B;  1KMI Z;  3G6E P;  1BCC J;  2Z5H A;  4L74 A;  4C46 A;  5BU5 A;  4N78 D;  1N2D C;  3USS A;  3EN1 A;  2KXP B;  2OYH C;  3GLM A;  1LWU B;  1Q86 Q;  1HGZ A;  3H1H J;  4U3F J;  3HE4 B;  2WPQ A;  2OYI C;  4EI2 A;  4MN4 C;  1OWA A;  1NTK D;  3C1L A;  1IFM A;  3HE5 A;  2Q9I A;  3B71 A;  1M8O B;  1L4A D;  5EFW B;  3L73 E;  1T3U A;  1PP9 J;  1QX8 A;  2JKV A;  4HM1 A;  1EQ7 A;  2A45 I;  1M1J B;  3Q2Y A;  4O9B A;  3A0H H;  3H1I D;  4C7N A;  1NU1 G;  1PZQ A;  4LLH A;  1J1D B;  1L0N E;  2QE7 H;  3PP5 A;  3B4S A;  2KUB A;  5H2F H;  5GTI E;  2WSC H;  1HGV A;  4NBB D;  1AVY A;  2ZVN B;  1IFP A;  5KLV J;  3H1L J;  4IL6 X;  2NUK A;  1NKZ B;  3A5T A;  1W5C E;  2FKW B;  3O8Z A;  1RE3 C;  2CKF A;  3GKE A;  3F5H A;  2DW3 A;  1KB9 H;  2V4H A;  4WY4 D;  1MUU A;  2XDJ A;  3B5N B;  1R5S A;  3VYI A;  2WQY C;  5B5E H;  1S1C X;  4XFJ A;  3WUU A;  3CXH E;  5CCG C;  4Y28 J;  2XSO A;  1FS0 E;  4HM2 A;  1JO5 A;  3VMX A;  2RN0 A;  4H0L C;  1KYO D;  2CPS A;  2M5A A;  1UII A;  3K5B A;  2K37 A;  3O6Q A;  1NGM B;  1KIL B;  4WWI A;  2R3C A;  2YMY A;  3CC2 P;  1O7P A;  3V6I A;  2NRG A;  1H0T B;  3KZI H;  1LTB C;  2BCC E;  2Q5U A;  3R4Y A;  4UB8 E;  2KZJ A;  1URQ C;  4NPD A;  4I7Z C;  1BE3 G;  1G1J A;  3GHG C;  4QDC A;  3HD7 D;  3FOU A;  1ULJ A;  2NWF A;  2FXO A;  4C7R A;  3VMI D;  2QEX P;  1SQV J;  3KXD A;  4NBD D;  1LP1 B;  4GT1 A;  3EQQ A;  4YXW H;  4A7P A;  2FY8 A;  1R5L A;  2HFE D;  3SSU A;  3NTN A;  5C39 A;  4H13 C;  2ITA A;  1LT1 A;  2ZT9 B;  3BCC D;  1FZA A;  2YIU B;  4XA4 A;  3L75 G;  3L70 E;  3AEF C;  3LID A;  4H44 D;  2B1X A;  1VQM P;  1GL2 A;  5GTH H;  4RJT A;  1VQP P;  2E42 A;  1KZU B;  1N7S D;  4U7J A;  4HM0 A;  3TGU J;  1BGY D;  3IF4 A;  4BRY B;  1DX7 A;  3EFG A;  1DEE G;  3JC2 2;  2Q3W A;  3V2R A;  4UB6 E;  3VMA A;  3SWF A;  5BOK A;  1QEX A;  4QDF B;  4RO0 A;  5CHX A;  1K73 Q;  3L71 D;  4BXL A;  1FBM A;  1P84 D;  4OWF A;  2FYN C;  3M0D A;  1DIP A;  2XSH A;  2A45 G;  2BMQ A;  2KLU A;  1KYO I;  2FXM A;  3AED C;  1EDL A;  3VTP C;  2E5Y A;  1WRG A;  3H1K D;  1AA0 A;  5APX A;  3U1A A;  3PTZ A;  2OYH A;  3MGN A;  2E74 D;  2OAR A;  3DQY A;  1X8Y A;  2H43 A;  1L0N K;  1IK9 A;  4HYT B;  1S3J A;  2QJY B;  3HRN A;  1BCC E;  5APU A;  1FDM A;  4AIV A;  4RKU J;  2KI7 B;  2XKM A;  1OVR A;  2E4P A;  2J58 A;  4IFF A;  2Q7C A;  4P1B H;  3L4F A;  3OJA B;  5DJT B;  3RL0 B;  1KQL A;  2HYN A;  3H1H E;  4U3F E;  3S9O A;  1SQP J;  3Q5R A;  1Q7Y Q;  4R4M A;  2FFD A;  2CK3 H;  3FGA D;  3GL2 A;  4R4L A;  1VQO P;  5CCH A;  2NPS A;  4HM5 A;  1JY2 N;  1PP9 E;  2DE6 D;  3LIE A;  1KQS O;  4DOJ A;  3W68 A;  5CJ0 A;  3GZY A;  2R5B A;  1S5L E;  1Z56 A;  3HUS C;  2OTK E;  3R2P A;  3VCA A;  3GF7 A;  1YI2 P;  2D2C C;  4OGQ D;  5AVQ B;  2E76 B;  1RE3 A;  3TK1 A;  2I1J A;  2B24 A;  3D70 A;  5AVX B;  4PV1 C;  3NXS A;  1Q82 Q;  3H1I G;  2NUM A;  2H89 C;  5KLV E;  4QMA A;  1SQB J;  3H1L E;  1YIJ P;  4HM4 A;  1ZV8 A;  1KQF B;  1ZXG A;  3HTK B;  3RK2 B;  3ZDM A;  3E1R A;  3G3Z A;  1SQQ J;  2B89 A;  3CXH D;  1YQ4 C;  1HBW A;  1PL5 A;  2N9Y B;  1M56 D;  1KOR A;  3KYQ A;  3L74 G;  1L4A B;  1L0N J;  2HMM A;  2A45 H;  3LW5 H;  1N73 B;  5AW1 B;  1JNM A;  2KSJ A;  1IO4 A;  3AZC A;  3CI9 A;  1NTM G;  3CCU P;  2DE7 D;  2K1A A;  4LC1 A;  1OW7 A;  1SFC B;  3AE5 C;  2W90 A;  1NDO A;  1FC2 C;  2ZT9 C;  2BCC D;  2YIU C;  1FE6 A;  2UWJ E;  1NVO A;  4TT3 H;  1OFC X;  1FZC A;  1S5L X;  1CW5 A;  1JMB A;  4HB1 A;  3RK3 B;  1NYK A;  4IFD K;  3GTS A;  5KLI B;  1PV3 A;  1FAV A;  1S4X A;  2I1K A;  4RES B;  2HMJ A;  4PD4 I;  1WMK A;  5KAF E;  1SQV E;  4W7Y A;  3AEE C;  1LTS C;  3F89 A;  3L70 D;  1QL1 A;  1JUN A;  1KFN A;  1G2C B;  1GU4 A;  1O7G A;  4ZMD A;  3OA7 A;  3V2N A;  1Q81 Q;  3WUT A;  4QUP A;  1GDT A;  1LWU A;  1DEB A;  1Q90 C;  2QG4 A;  1J1E B;  1OXZ A;  1O7N A;  3HE4 A;  1MKM A;  1ZR4 A;  3V2P A;  2QM8 A;  2E75 C;  4HM6 A;  2V7Q H;  5KKZ B;  2I8D A;  1VF5 D;  3RL0 C;  2YMK A;  1M1J A;  3JSV C;  4L75 A;  2BEZ F;  2YXR B;  1YJN P;  3CX5 D;  1VQ8 P;  3TYY A;  3HD7 B;  1MFZ A;  2QJP C;  1HVV A;  2IX7 C;  3WU2 E;  3G4S P;  1S9K E;  2IDB A;  5APV A;  3KDP B;  1BCC D;  2HG5 D;  1G8K B;  1Y9B A;  3H1K G;  4GOE A;  3GCE A;  3WUV A;  5KJ7 A;  2QIW A;  5AW4 B;  1H88 A;  4NBF D;  1X22 A;  3H1H D;  4U3F D;  5KLV K;  2Y0E A;  1GL2 C;  1FZE A;  4AYC A;  2NVF A;  2E76 C;  1BE3 J;  5B66 E;  1SQP E;  3IR9 A;  3B5N A;  3TF5 A;  2YKQ A;  3A0H E;  2YO3 A;  1GMJ A;  5E79 E;  2YFI A;  1PP9 D;  1LTI C;  1YYC A;  4OVN F;  1KYO H;  2N1T B;  3RK2 C;  5CBN A;  1CZQ A;  5AEW A;  1RE4 C;  5H2F E;  2K9Y A;  3M0D C;  3L75 J;  3TDK A;  1PPJ E;  1KC8 Q;  2KSE A;  2JDI H;  2QJK B;  2AXC A;  2E74 B;  1KIL A;  3TNU B;  5BU8 B;  1RY3 A;  1N73 C;  1BDC A;  1H0T A;  2MKV A;  2Q6Q A;  1KB9 E;  2JR8 A;  3H1L D;  3CX5 I;  4NB8 D;  2ZYG A;  1VQ9 P;  1OIP A;  1A02 F;  2ZYL A;  1SFC C;  5B5E E;  2XRX A;  1SQB E;  2Y9Z A;  2KNC B;  2A06 E;  3L72 D;  3SWK A;  2P58 A;  2ZJS E;  1RFS A;  2W6J H;  1LP1 A;  1SQQ E;  4L73 A;  3EQ2 A;  4NBA D;  3RK3 C;  2FFD C;  1SQV K;  2WSF H;  5TJH A;  2O01 H;  4D6T J;  4NBH D;  1Q2N A;  2KZI A;  5CJ4 A;  3JCU H;  4NB9 D;  2YO2 A;  5KLI C;  5CCH C;  2NPS C;  3IFM A;  2IBZ E;  2RMZ A;  3BAS A;  2R32 A;  3V4Q A;  2Y9Y A;  4BRY A;  3FXD A;  3NMD A;  3P8C E;  2OYO A;  1EDJ A;  4QDF A;  1VQ6 P;  1X9V A;  1YBK A;  4ASW A;  3D71 A;  2W6A A;  1QGK B;  5TIS H;  1VQ5 P;  2Y0D A;  4IL6 H;  3GL0 A;  1DH3 A;  3A2A A;  2YFJ A;  2RH0 A;  4NPE A;  2BCC G;  3V2Q A;  1SQV D;  5KTB A;  1NTZ J;  3P8M C;  4QCK A;  4I1L A;  1DD4 A;  4YTP C;  2W27 A;  3ABV C;  1UUW A;  2FYU K;  2GBW A;  3TGU D;  1JY3 O;  3H1I J;  2LXB A;  4DT0 A;  3KQG A;  3VP8 A;  3AE1 C;  3P7K A;  3L70 G;  1VQN P;  1JOC A;  1VPC A;  2G8Y A;  1KIL E;  1UIX A;  5CXM A;  3VMG D;  3PJS K;  4PJ0 H;  2M3E A;  1SQP K;  2XU6 A;  3CWB D;  4QUR A;  1U7M A;  2JO6 A;  1KQG B;  1PFI A;  5CCG D;  1FZC C;  1YQ3 C;  3H1J J;  3GB4 A;  2PGD A;  4QDD A;  4NBE D;  3L74 J;  4Y99 B;  1QL2 A;  1S9K D;  1N8R Q;  3P32 A;  4H0L D;  4PD4 H;  1EC5 A;  2JEE A;  2Y0C A;  1SQX K;  2IPP A;  1IFJ A;  3NFQ A;  4JPZ B;  1NTM J;  2N1T C;  2WT7 B;  2Q3E A;  4AQR D;  2QRX A;  1OW6 A;  1M57 D;  1HWT C;  1URQ D;  2LXC B;  2H8P D;  1G8J B;  3CXH H;  3N4X A;  2BMO A;  3HTK A;  3AE2 C;  3H25 A;  1S72 P;  1K9M Q;  1SQB K;  1K8A Q;  4NBG D;  1EDK A;  1ZRT D;  1RE4 A;  2Z4E A;  1LWU C;  1GD2 E;  1BE3 E;  1IFI A;  1RH5 B;  3BVH A;  1JM1 A;  3CCV P;  1LTT C;  1SQQ K;  2WPS A;  4H13 D;  3M9Q A;  3PHL A;  1L4A A;  1EZV D;  1N73 A;  1OX3 A;  3QWO C;  3MHV A;  5AVV B;  2IZ0 A;  3A0B E;  1JCC A;  5APS A;  1CI6 B;  4EOT A;  1PPJ D;  3CPW O;  4UB8 H;  1EXJ A;  3AE9 C;  2FYU J;  3L75 E;  1SFC A;  1M90 Q;  1M1J C;  3MUD C;  5AVY B;  1K04 A;  1VM9 A;  1L0L J;  1J1D C;  3H6P A;  4HM8 A;  3MZW B;  2GBX A;  4TLF A;  1SQB D;  1M7L A;  2K9J B;  4GIF A;  1FZB A;  1QVG O;  3IN6 A;  1LTJ B;  2A06 D;  3AEC C;  5KJ7 C;  3L73 D;  1SQQ D;  3GF3 A;  3CCQ P;  1PGJ A;  2P2U A;  2WZ7 A;  3H1L G;  3M9H A;  1GW4 A;  1EG9 A;  4HH2 A;  2WSC J;  1SQX J;  1NTK G;  1L0N D;  2E5T A;  3EFF K;  2ZXE B;  3B5N C;  1G2C A;  2L5G B;  3D6Z A;  4UB6 H;  4D6T E;  3L72 G;  2IBZ D;  1VCK A;  1HJ0 A;  3VCP A;  2LKM A;  3SFD C;  2R44 A;  1P84 I;  3P8C D;  2KP8 A;  5AVR B;  2YXQ B;  3G71 P;  2AEJ A;  1EZV I;  1JB0 J;  2NZ2 A;  3CX5 H;  4HJL A;  2QPZ A;  1KIL C;  2JZA A;  1RF1 B;  3MIW A;  2GUV A;  3VMZ A;  1D7M A;  3PRJ A;  4NPF X;  1ZLL A;  5AW0 B;  2WWW A;  3W67 A;  5HL4 A;  1FZF A;  4JF7 A;  3HD7 A;  2IZ1 A;  1NKN A;  1AQ5 A;  3II6 A;  1NTZ E;  3CL3 D;  2OGU A;  1TU3 F;  1JY2 P;  2SPZ A;  2I7F A;  1LT9 B;  2D2C D;  2J59 M;  3ITK A;  1ZME C;  3WMM 0;  4XE5 B;  4PV1 D;  4Y99 C;  2POH A;  3I5C A;  1FU1 A;  3H1I E;  2NVE A;  3FWL A;  3L35 A;  3RBX A;  3N7N A;  2KIK A;  2P1J A;  2O3J A;  2OYI B;  3H32 B;  1S5L H;  3TGU G;  2IBZ I;  1GK4 A;  1PGP A;  3CCR P;  2WVR A;  2N1T A;  3RK3 E;  1RF0 A;  3H1J E;  5KAI H;  4WY4 B;  1VQL P;  2B9B A;  1NU1 J;  4B86 A;  3L74 E;  3CME P;  3CWB G;  2B87 B;  1JM0 A;  2MJZ A;  5M1B A;  1LNQ A;  2ZT9 D;  1O7M A;  3TNU A;  1NTM E;  1SLQ A;  1GK6 A;  4GKG A;  4EMJ B;  2PFX A;  4WBA A;  3CXH I;  2FYZ A;  2HMK A;  2C0W A;  2QJY C;  1WT6 A;  1M1K Q;  1MFT A;  3BCC G;  1LJ2 A;  1XTC C;  4EYY Q;  1IFD A;  3AE4 C;  2KNC A;  2ZAE B;  1KYO E;  1IFN A;  1BGY G;  2W6B A;  1J2J B;  4KHX A;  5APT A;  2AXT E;  2WMM A;  3GOB A;  1BSN A;  2HOD B;  3Q3D A;  3MUD A;  3T97 B;  3RL0 g;  2XNX A;  3E1I A;  3L71 G;  1YTZ T;  1NHL A;  3L75 D;  4W80 A;  1JMM A;  1XTG B;  1QVF O;  4HM3 A;  1U7J A;  2YVJ B;  1Q90 D;  2FYU E;  1JTH B;  1EZV G;  1HUC A;  4H44 B;  4Z1M H;  1L0L E;  2E75 D;  3U1C A;  1SS1 A;  1T2K C;  1PPJ G;  4KJM A;  1N7S B;  5KAF H;  3Q5S A;  5AW2 B;  3RL0 D;  4BWN A;  1NJI Q;  1KV4 A;  1URQ B;  1AFO A; 
#chains in the Genus database with same CATH homology
 4I7Z B;  2E74 D;  3DQY A;  4QCK A;  4YXD C;  2HMO A;  1BCC E;  1DD4 A;  4YTP C;  4AIV A;  4RKU J;  3GZX A;  2BMR A;  3ABV C;  1UUW A;  2E4P A;  2QSI A;  1DD3 A;  1SQX E;  3GMA A;  2GBW A;  2NVG A;  4H13 B;  4P1B H;  2H88 C;  3AEB C;  1FDO A;  3S9O A;  3Q5R A;  3H1H E;  4U3F E;  4R4M A;  3AE1 C;  3FGA D;  2G8Y A;  3GL2 A;  1KIL E;  1UIX A;  4R4L A;  5CXM A;  1RQV A;  2E76 D;  1ULI A;  3VMG D;  1VF5 C;  2DE5 D;  4KT0 J;  4QUR A;  2JO6 A;  2XR8 A;  4P1C H;  1KQG B;  4HM5 A;  1PP9 E;  2DE6 D;  4QUQ A;  1YQ3 C;  3GB4 A;  1NYH A;  1O7H A;  3GZY A;  3LW5 J;  4QDD A;  4NBE D;  4HKV A;  3Q1M A;  1AJY A;  4H0L D;  3VCA A;  3GF7 A;  3TGU E;  5L8R J;  2FBW C;  2D2C C;  4OGQ D;  2E76 B;  1RIE A;  2B24 A;  4GDO A;  3D70 A;  4PV1 C;  2NUM A;  3AE6 C;  2H89 C;  1OW6 A;  5KLV E;  3H1L E;  4HM4 A;  3CWB E;  1HF9 A;  1FQT A;  1KQF B;  1G8J B;  4H0L B;  1U57 A;  2BMO A;  2HMN A;  3AE2 C;  3H25 A;  4NBG D;  4OGQ B;  1BE3 E;  1YQ4 C;  1JM1 A;  3G9R A;  1PL5 A;  1OMI A;  1KOR A;  1KTM A;  3BCC E;  2HMM A;  4H13 D;  4PD4 E;  5AEU A;  4AAY B;  3AZC A;  2YFL A;  3AE3 C;  2DE7 D;  1OW7 A;  1EXJ A;  3AE9 C;  3AE5 C;  5KKZ C;  1NDO A;  3L75 E;  3C0D A;  2G3A A;  2ZT9 C;  1NU1 E;  1K04 A;  2YIU C;  1VM9 A;  4TT3 H;  3GTE A;  3L71 E;  1S5L X;  1ZRT E;  3IAO A;  1P84 E;  4HM8 A;  2V7Q J;  2D2C B;  2GBX A;  1NYK A;  3D89 A;  3IN6 A;  4PV1 B;  3H1K E;  3GTS A;  1PV3 A;  3AEC C;  1EZV E;  2HMJ A;  1WMK A;  2HML A;  1KMI Z;  1SQV E;  3GF3 A;  3AEE C;  4H44 C;  2P10 A;  1SJG A;  1EG9 A;  2WSC J;  3EN1 A;  1O7G A;  3D6Z A;  3GLM A;  3AE8 C;  4QUP A;  1VCK A;  1HJ0 A;  3VCP A;  1ZOY C;  3SFD C;  1Q90 C;  2OQQ A;  1O7N A;  3AEA C;  3N0Q A;  1MKM A;  2BEQ D;  2E75 C;  3B71 A;  4HM6 A;  1UUV A;  3L73 E;  4HM1 A;  4HM7 A;  1JB0 J;  2NZ2 A;  4HJL A;  2QPZ A;  3Q2Y A;  1VF5 D;  1OW8 A;  2QJK C;  2JZA A;  2E74 C;  2YMK A;  2BEZ F;  1L0N E;  5HL4 A;  2QJP C;  2IDB A;  1FDI A;  1NTZ E;  1TU3 F;  3D6Y A;  2I7F A;  4NBB D;  1PIX A;  1G8K B;  2D2C D;  1Y9B A;  2WSE J;  2FXP A;  1ZME C;  4IL6 X;  2NUK A;  3GCE A;  1VF5 B;  4PV1 D;  1ZP0 C;  2QIW A;  4NBF D;  2JP3 A;  2CKF A;  3GKE A;  2J5U A;  2NVF A;  2E76 C;  3Q5P A;  2NVE A;  3H1I E;  1SQP E;  3CX5 E;  2WQY C;  1S1C X;  4XFJ A;  3CXH E;  4Y28 J;  2WPV B;  2XSO A;  1GMJ A;  2YFI A;  4HM2 A;  1WQL A;  2WSF J;  2E75 B;  2O01 J;  1R8E A;  5AEW A;  4H0L C;  3RK3 E;  2K9Y A;  3H1J E;  4OGQ C;  1EXI A;  1PPJ E;  3O6Q A;  1VL2 A;  1NGM B;  3L74 E;  1O7P A;  2E74 B;  3R4Y A;  2BCC E;  2E4Q A;  5M1B A;  2MKV A;  2ZT9 D;  1O7M A;  1NTM E;  3AE7 C;  1KB9 E;  4I7Z C;  2JO1 A;  4NB8 D;  3AEG C;  4EMJ B;  4NBC D;  2ZYL A;  4QDC A;  3FOU A;  1ULJ A;  2HMK A;  2NWF A;  2XRX A;  1SQB E;  2QJY C;  3VMI D;  2A06 E;  4NBD D;  3AE4 C;  3EQQ A;  1RFS A;  1KYO E;  1SQQ E;  1RQU A;  4H13 C;  4NBA D;  2ZT9 B;  1O7W A;  2B1X A;  3L70 E;  3AEF C;  4H44 D;  3GOB A;  4NBH D;  3Q3D A;  3SFE C;  3T97 B;  4NB9 D;  3RL0 g;  3C8V A;  4U7J A;  4HM0 A;  5KLI C;  2IBZ E;  1K05 A;  2Q3W A;  1NTK E;  5BOK A;  4HM3 A;  1IK7 A;  4QDF B;  2YVJ B;  1Q90 D;  2FYU E;  3L72 E;  4QDF A;  3D71 A;  2FYN C;  1DIP A;  2XSH A;  4H44 B;  4Z1M H;  2E75 D;  1L0L E;  2BMQ A;  3AED C;  3GL0 A;  3Q5S A;  3EWK A;  3VMH D;  2YFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...