3FOUA

Low ph structure of the rieske protein from thermus thermophilus at 2.1 a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
b'TPEKEPLKPGDILVYAQGGGEPKPIRLEELKPGDPFVLAYPMDPKTKVVKSGEAKNTLLVARFDPEELAPEVAQHAAEGVVAYSAVCTHLGCIVSQWVADEEAALCPCHGGVYDLRHGAQVIAGPPPRPVPQLPVRVEDGVLVAAGEFLGPVGVQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
publication title Effects of pH on the Rieske Protein from Thermus thermophilus: A Spectroscopic and Structural Analysis
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 35
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3fouA00
2BMQA 2CKFA 3GOBA 1ZRTE 2XSOA 1O7WA 2NVGA 4U3FE 5AEWA 2E74D 3EQQA 2IBZE 2HMOA 1NYKA 2XRXA 4OGQD 4AAYB 2YFLA 1ULIA 2NWFA 1ULJA 2HMNA 3H1JE 1L0NE 1PPJE 1NTME 2Q3WA 3H1LE 3VCPA 1PP9E 3GKEA 1EG9A 2E4PA 4AIVA 1KB9E 1JM1A 1SQPE 4HM5A 4PD4E 1WQLA 4QDFA 3DQYA 2QJKC 3GL2A 4HM2A 3VMHD 3EN1A 4QDDA 1O7MA 3L72E 1SQBE 4H13D 4HM7A 4HM4A 3GTEA 3VMID 4EMJB 1G8JB 1NU1E 4HJLA 1VCKA 4QDCA 3H1HE 5CXMA 4HM3A 4H44D 1UUVA 2NUKA 5KLIC 1BE3E 1VM9A 2BCCE 2E4QA 2GBWA 3H1KE 2B24A 1O7PA 2ZT9D 4NBBD 1SQVE 2DE6D 3N0QA 1Q90C 1NDOA 2DE7D 1KYOE 1O7NA 1O7HA 3D89A 1O7GA 2E75D 3AZCA 2JO6A 3GTSA 3TGUE 2YFIA 3VCAA 3GZYA 3L74E 4NBED 4QUQA 1RIEA 1SJGA 5HL4A 3L73E 4NBDD 4NBFD 4NBGD 3GCEA 3L71E 1RFSA 4QURA 1SQQE 2GBXA 1L0LE 1VF5D 2DE5D 1BCCE 1FQTA 2HMMA 3CWBE 4PV1D 3H1IE 2XSHA 5KKZC 3L75E 2E76D 2QJPC 2HMJA 1NTZE 3GZXA 2FYNC 4QUPA 1EZVE 2XR8A 4QDFB 4NBHD 4P1BH 4HM8A 3GB4A 1P84E 2D2CD 2YFJA 3CX5E 4HM1A 2NUMA 2YVJB 3CXHE 3VMGD 4QCKA 2BMRA 2QJYC 2HMLA 2QPZA 5KLVE 2NVFA 3C0DA 1G8KB 4HM6A 2ZYLA 2NVEA 1SQXE 4NB8D 2FYUE 4P1CH 5AEUA 2B1XA 4HKVA 2I7FA 4NBAD 3GL0A 4H0LD 1UUWA 2A06E 3BCCE 2YIUC 2BMOA 3L70E 5BOKA 4NB9D 2JZAA 1NTKE 4HM0A 3FOUA 4NBCD 2HMKA
chains in the Genus database with same CATH superfamily
2BMQA 2CKFA 3GOBA 1ZRTE 2XSOA 1O7WA 2NVGA 4U3FE 5AEWA 2E74D 3EQQA 2IBZE 2HMOA 1NYKA 2XRXA 4OGQD 4AAYB 2YFLA 1ULIA 2NWFA 1ULJA 2HMNA 3H1JE 1L0NE 1PPJE 1NTME 2Q3WA 3H1LE 3VCPA 1PP9E 3GKEA 1EG9A 2E4PA 4AIVA 1KB9E 1JM1A 1SQPE 4HM5A 4PD4E 1WQLA 4QDFA 3DQYA 2QJKC 3GL2A 4HM2A 3VMHD 3EN1A 4QDDA 1O7MA 3L72E 1SQBE 4H13D 4HM7A 4HM4A 3GTEA 3VMID 4EMJB 1G8JB 1NU1E 4HJLA 1VCKA 4QDCA 3H1HE 5CXMA 4HM3A 4H44D 1UUVA 2NUKA 5KLIC 1BE3E 1VM9A 2BCCE 2E4QA 2GBWA 3H1KE 2B24A 1O7PA 2ZT9D 4NBBD 1SQVE 2DE6D 3N0QA 1Q90C 1NDOA 2DE7D 1KYOE 1O7NA 1O7HA 3D89A 1O7GA 2E75D 3AZCA 2JO6A 3GTSA 3TGUE 2YFIA 3VCAA 3GZYA 3L74E 4NBED 4QUQA 1RIEA 1SJGA 5HL4A 3L73E 4NBDD 4NBFD 4NBGD 3GCEA 3L71E 1RFSA 4QURA 1SQQE 2GBXA 1L0LE 1VF5D 2DE5D 1BCCE 1FQTA 2HMMA 3CWBE 4PV1D 3H1IE 2XSHA 5KKZC 3L75E 2E76D 2QJPC 2HMJA 1NTZE 3GZXA 2FYNC 4QUPA 1EZVE 2XR8A 4QDFB 4NBHD 4P1BH 4HM8A 3GB4A 1P84E 2D2CD 2YFJA 3CX5E 4HM1A 2NUMA 2YVJB 3CXHE 3VMGD 4QCKA 2BMRA 2QJYC 2HMLA 2QPZA 5KLVE 2NVFA 3C0DA 1G8KB 4HM6A 2ZYLA 2NVEA 1SQXE 4NB8D 2FYUE 4P1CH 5AEUA 2B1XA 4HKVA 2I7FA 4NBAD 3GL0A 4H0LD 1UUWA 2A06E 3BCCE 2YIUC 2BMOA 3L70E 5BOKA 4NB9D 2JZAA 1NTKE 4HM0A 3FOUA 4NBCD 2HMKA
chains in the Genus database with same CATH topology
2BMQA 2CKFA 3GOBA 1ZRTE 2XSOA 1O7WA 2NVGA 4U3FE 5AEWA 2E74D 3EQQA 2IBZE 2HMOA 1NYKA 2XRXA 4OGQD 4AAYB 2YFLA 1ULIA 2NWFA 1ULJA 2HMNA 3H1JE 1L0NE 1PPJE 1NTME 2Q3WA 3H1LE 3VCPA 1PP9E 3GKEA 1EG9A 2E4PA 4AIVA 1KB9E 1JM1A 1SQPE 4HM5A 4PD4E 1WQLA 4QDFA 3DQYA 2QJKC 3GL2A 4HM2A 3VMHD 3EN1A 4QDDA 1O7MA 3L72E 1SQBE 4H13D 4HM7A 4HM4A 3GTEA 3VMID 4EMJB 1G8JB 1NU1E 4HJLA 1VCKA 4QDCA 3H1HE 5CXMA 4HM3A 4H44D 1UUVA 2NUKA 5KLIC 1BE3E 1VM9A 2BCCE 2E4QA 2GBWA 3H1KE 2B24A 1O7PA 2ZT9D 4NBBD 1SQVE 2DE6D 3N0QA 1Q90C 1NDOA 2DE7D 1KYOE 1O7NA 1O7HA 3D89A 1O7GA 2E75D 3AZCA 2JO6A 3GTSA 3TGUE 2YFIA 3VCAA 3GZYA 3L74E 4NBED 4QUQA 1RIEA 1SJGA 5HL4A 3L73E 4NBDD 4NBFD 4NBGD 3GCEA 3L71E 1RFSA 4QURA 1SQQE 2GBXA 1L0LE 1VF5D 2DE5D 1BCCE 1FQTA 2HMMA 3CWBE 4PV1D 3H1IE 2XSHA 5KKZC 3L75E 2E76D 2QJPC 2HMJA 1NTZE 3GZXA 2FYNC 4QUPA 1EZVE 2XR8A 4QDFB 4NBHD 4P1BH 4HM8A 3GB4A 1P84E 2D2CD 2YFJA 3CX5E 4HM1A 2NUMA 2YVJB 3CXHE 3VMGD 4QCKA 2BMRA 2QJYC 2HMLA 2QPZA 5KLVE 2NVFA 3C0DA 1G8KB 4HM6A 2ZYLA 2NVEA 1SQXE 4NB8D 2FYUE 4P1CH 5AEUA 2B1XA 4HKVA 2I7FA 4NBAD 3GL0A 4H0LD 1UUWA 2A06E 3BCCE 2YIUC 2BMOA 3L70E 5BOKA 4NB9D 2JZAA 1NTKE 4HM0A 3FOUA 4NBCD 2HMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMQ A;  2CKF A;  3GOB A;  1ZRT E;  2XSO A;  1O7W A;  2NVG A;  4U3F E;  5AEW A;  2E74 D;  3EQQ A;  2IBZ E;  2HMO A;  1NYK A;  2XRX A;  4OGQ D;  4AAY B;  2YFL A;  1ULI A;  2NWF A;  1ULJ A;  2HMN A;  3H1J E;  1L0N E;  1PPJ E;  1NTM E;  2Q3W A;  3H1L E;  3VCP A;  1PP9 E;  3GKE A;  1EG9 A;  2E4P A;  4AIV A;  1KB9 E;  1JM1 A;  1SQP E;  4HM5 A;  4PD4 E;  1WQL A;  4QDF A;  3DQY A;  2QJK C;  3GL2 A;  4HM2 A;  3VMH D;  3EN1 A;  4QDD A;  1O7M A;  3L72 E;  1SQB E;  4H13 D;  4HM7 A;  4HM4 A;  3GTE A;  3VMI D;  4EMJ B;  1G8J B;  1NU1 E;  4HJL A;  1VCK A;  4QDC A;  3H1H E;  5CXM A;  4HM3 A;  4H44 D;  1UUV A;  2NUK A;  5KLI C;  1BE3 E;  1VM9 A;  2BCC E;  2E4Q A;  2GBW A;  3H1K E;  2B24 A;  1O7P A;  2ZT9 D;  4NBB D;  1SQV E;  2DE6 D;  3N0Q A;  1Q90 C;  1NDO A;  2DE7 D;  1KYO E;  1O7N A;  1O7H A;  3D89 A;  1O7G A;  2E75 D;  3AZC A;  2JO6 A;  3GTS A;  3TGU E;  2YFI A;  3VCA A;  3GZY A;  3L74 E;  4NBE D;  4QUQ A;  1RIE A;  1SJG A;  5HL4 A;  3L73 E;  4NBD D;  4NBF D;  4NBG D;  3GCE A;  3L71 E;  1RFS A;  4QUR A;  1SQQ E;  2GBX A;  1L0L E;  1VF5 D;  2DE5 D;  1BCC E;  1FQT A;  2HMM A;  3CWB E;  4PV1 D;  3H1I E;  2XSH A;  5KKZ C;  3L75 E;  2E76 D;  2QJP C;  2HMJ A;  1NTZ E;  3GZX A;  2FYN C;  4QUP A;  1EZV E;  2XR8 A;  4QDF B;  4NBH D;  4P1B H;  4HM8 A;  3GB4 A;  1P84 E;  2D2C D;  2YFJ A;  3CX5 E;  4HM1 A;  2NUM A;  2YVJ B;  3CXH E;  3VMG D;  4QCK A;  2BMR A;  2QJY C;  2HML A;  2QPZ A;  5KLV E;  2NVF A;  3C0D A;  1G8K B;  4HM6 A;  2ZYL A;  2NVE A;  1SQX E;  4NB8 D;  2FYU E;  4P1C H;  5AEU A;  2B1X A;  4HKV A;  2I7F A;  4NBA D;  3GL0 A;  4H0L D;  1UUW A;  2A06 E;  3BCC E;  2YIU C;  2BMO A;  3L70 E;  5BOK A;  4NB9 D;  2JZA A;  1NTK E;  4HM0 A;  3FOU A;  4NBC D;  2HMK A; 
#chains in the Genus database with same CATH topology
 2BMQ A;  2CKF A;  3GOB A;  1ZRT E;  2XSO A;  1O7W A;  2NVG A;  4U3F E;  5AEW A;  2E74 D;  3EQQ A;  2IBZ E;  2HMO A;  1NYK A;  2XRX A;  4OGQ D;  4AAY B;  2YFL A;  1ULI A;  2NWF A;  1ULJ A;  2HMN A;  3H1J E;  1L0N E;  1PPJ E;  1NTM E;  2Q3W A;  3H1L E;  3VCP A;  1PP9 E;  3GKE A;  1EG9 A;  2E4P A;  4AIV A;  1KB9 E;  1JM1 A;  1SQP E;  4HM5 A;  4PD4 E;  1WQL A;  4QDF A;  3DQY A;  2QJK C;  3GL2 A;  4HM2 A;  3VMH D;  3EN1 A;  4QDD A;  1O7M A;  3L72 E;  1SQB E;  4H13 D;  4HM7 A;  4HM4 A;  3GTE A;  3VMI D;  4EMJ B;  1G8J B;  1NU1 E;  4HJL A;  1VCK A;  4QDC A;  3H1H E;  5CXM A;  4HM3 A;  4H44 D;  1UUV A;  2NUK A;  5KLI C;  1BE3 E;  1VM9 A;  2BCC E;  2E4Q A;  2GBW A;  3H1K E;  2B24 A;  1O7P A;  2ZT9 D;  4NBB D;  1SQV E;  2DE6 D;  3N0Q A;  1Q90 C;  1NDO A;  2DE7 D;  1KYO E;  1O7N A;  1O7H A;  3D89 A;  1O7G A;  2E75 D;  3AZC A;  2JO6 A;  3GTS A;  3TGU E;  2YFI A;  3VCA A;  3GZY A;  3L74 E;  4NBE D;  4QUQ A;  1RIE A;  1SJG A;  5HL4 A;  3L73 E;  4NBD D;  4NBF D;  4NBG D;  3GCE A;  3L71 E;  1RFS A;  4QUR A;  1SQQ E;  2GBX A;  1L0L E;  1VF5 D;  2DE5 D;  1BCC E;  1FQT A;  2HMM A;  3CWB E;  4PV1 D;  3H1I E;  2XSH A;  5KKZ C;  3L75 E;  2E76 D;  2QJP C;  2HMJ A;  1NTZ E;  3GZX A;  2FYN C;  4QUP A;  1EZV E;  2XR8 A;  4QDF B;  4NBH D;  4P1B H;  4HM8 A;  3GB4 A;  1P84 E;  2D2C D;  2YFJ A;  3CX5 E;  4HM1 A;  2NUM A;  2YVJ B;  3CXH E;  3VMG D;  4QCK A;  2BMR A;  2QJY C;  2HML A;  2QPZ A;  5KLV E;  2NVF A;  3C0D A;  1G8K B;  4HM6 A;  2ZYL A;  2NVE A;  1SQX E;  4NB8 D;  2FYU E;  4P1C H;  5AEU A;  2B1X A;  4HKV A;  2I7F A;  4NBA D;  3GL0 A;  4H0L D;  1UUW A;  2A06 E;  3BCC E;  2YIU C;  2BMO A;  3L70 E;  5BOK A;  4NB9 D;  2JZA A;  1NTK E;  4HM0 A;  3FOU A;  4NBC D;  2HMK A; 
#chains in the Genus database with same CATH homology
 2BMQ A;  2CKF A;  3GOB A;  1ZRT E;  2XSO A;  1O7W A;  2NVG A;  4U3F E;  5AEW A;  2E74 D;  3EQQ A;  2IBZ E;  2HMO A;  1NYK A;  2XRX A;  4OGQ D;  4AAY B;  2YFL A;  1ULI A;  2NWF A;  1ULJ A;  2HMN A;  3H1J E;  1L0N E;  1PPJ E;  1NTM E;  2Q3W A;  3H1L E;  3VCP A;  1PP9 E;  3GKE A;  1EG9 A;  2E4P A;  4AIV A;  1KB9 E;  1JM1 A;  1SQP E;  4HM5 A;  4PD4 E;  1WQL A;  4QDF A;  3DQY A;  2QJK C;  3GL2 A;  4HM2 A;  3VMH D;  3EN1 A;  4QDD A;  1O7M A;  3L72 E;  1SQB E;  4H13 D;  4HM7 A;  4HM4 A;  3GTE A;  3VMI D;  4EMJ B;  1G8J B;  1NU1 E;  4HJL A;  1VCK A;  4QDC A;  3H1H E;  5CXM A;  4HM3 A;  4H44 D;  1UUV A;  2NUK A;  5KLI C;  1BE3 E;  1VM9 A;  2BCC E;  2E4Q A;  2GBW A;  3H1K E;  2B24 A;  1O7P A;  2ZT9 D;  4NBB D;  1SQV E;  2DE6 D;  3N0Q A;  1Q90 C;  1NDO A;  2DE7 D;  1KYO E;  1O7N A;  1O7H A;  3D89 A;  1O7G A;  2E75 D;  3AZC A;  2JO6 A;  3GTS A;  3TGU E;  2YFI A;  3VCA A;  3GZY A;  3L74 E;  4NBE D;  4QUQ A;  1RIE A;  1SJG A;  5HL4 A;  3L73 E;  4NBD D;  4NBF D;  4NBG D;  3GCE A;  3L71 E;  1RFS A;  4QUR A;  1SQQ E;  2GBX A;  1L0L E;  1VF5 D;  2DE5 D;  1BCC E;  1FQT A;  2HMM A;  3CWB E;  4PV1 D;  3H1I E;  2XSH A;  5KKZ C;  3L75 E;  2E76 D;  2QJP C;  2HMJ A;  1NTZ E;  3GZX A;  2FYN C;  4QUP A;  1EZV E;  2XR8 A;  4QDF B;  4NBH D;  4P1B H;  4HM8 A;  3GB4 A;  1P84 E;  2D2C D;  2YFJ A;  3CX5 E;  4HM1 A;  2NUM A;  2YVJ B;  3CXH E;  3VMG D;  4QCK A;  2BMR A;  2QJY C;  2HML A;  2QPZ A;  5KLV E;  2NVF A;  3C0D A;  1G8K B;  4HM6 A;  2ZYL A;  2NVE A;  1SQX E;  4NB8 D;  2FYU E;  4P1C H;  5AEU A;  2B1X A;  4HKV A;  2I7F A;  4NBA D;  3GL0 A;  4H0L D;  1UUW A;  2A06 E;  3BCC E;  2YIU C;  2BMO A;  3L70 E;  5BOK A;  4NB9 D;  2JZA A;  1NTK E;  4HM0 A;  3FOU A;  4NBC D;  2HMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...