3FOUA

Low ph structure of the rieske protein from thermus thermophilus at 2.1 a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
TPEKEPLKPGDILVYAQGGGEPKPIRLEELKPGDPFVLAYPMDPKTKVVKSGEAKNTLLVARFDPEELAPEVAQHAAEGVVAYSAVCTHLGCIVSQWVADEEAALCPCHGGVYDLRHGAQVIAGPPPRPVPQLPVRVEDGVLVAAGEFLGPVGVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
publication title Effects of pH on the Rieske Protein from Thermus thermophilus: A Spectroscopic and Structural Analysis
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
total genus 35
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3fouA00
4HM1A 2XSHA 1VF5D 4HJLA 2E4QA 4AAYB 3CWBE 4NBBD 1PP9E 5AEWA 1BCCE 2GBXA 4AIVA 4QCKA 2FYUE 2B24A 2NWFA 3N0QA 1EZVE 2DE5D 2YVJB 3L73E 2DE6D 2QJYC 2BMQA 2QJPC 1L0LE 1SQPE 4QUQA 1ULJA 4NBED 2XSOA 2XR8A 2ZT9D 1ZRTE 4HM2A 3VCPA 3EN1A 1WQLA 2HMOA 5CXMA 1SQVE 5KLIC 4HKVA 1O7WA 1RFSA 4HM7A 3GTEA 4NBFD 1L0NE 2JZAA 2JO6A 3H1KE 4P1CH 1UUWA 3GB4A 2I7FA 1G8KB 3GZYA 1SQQE 2D2CD 1ULIA 2YFLA 3H1HE 1VM9A 3DQYA 5BOKA 1SQBE 1KB9E 2YFIA 2A06E 4H44D 1O7NA 4HM3A 1BE3E 4NBAD 1G8JB 1Q90C 3L74E 4QDDA 2BMOA 3GOBA 3VMID 3GL0A 1NDOA 3EQQA 4NBGD 4HM4A 1NU1E 1O7GA 1O7MA 4U3FE 2YIUC 3CX5E 3FOUA 4NB9D 4NBCD 2HMMA 1P84E 4HM6A 2HMJA 4HM0A 1RIEA 3GL2A 2HMNA 1SJGA 3VMGD 4EMJB 3GKEA 4PD4E 1EG9A 3H1IE 1UUVA 3L70E 2XRXA 4QDFB 1O7PA 3TGUE 5HL4A 2B1XA 2FYNC 2E75D 1FQTA 5AEUA 2CKFA 2QJKC 2IBZE 4P1BH 3BCCE 3GTSA 3AZCA 2GBWA 2NVEA 1NTKE 4QDCA 3CXHE 3C0DA 1KYOE 4QUPA 1VCKA 4QDFA 2HMKA 3L75E 5KLVE 2QPZA 4HM8A 3VCAA 1NTZE 2NUKA 4OGQD 4PV1D 2Q3WA 2HMLA 2NVGA 1O7HA 3VMHD 2DE7D 4QURA 4NBHD 2BMRA 5KKZC 4H13D 4NBDD 3L71E 3L72E 2YFJA 2E4PA 2NUMA 1JM1A 1NTME 1PPJE 3H1JE 2E74D 1SQXE 4NB8D 2BCCE 3GCEA 1NYKA 3D89A 2E76D 2ZYLA 3GZXA 4HM5A 3H1LE 2NVFA 4H0LD
chains in the Genus database with same CATH superfamily
4HM1A 2XSHA 1VF5D 4HJLA 2E4QA 4AAYB 3CWBE 4NBBD 1PP9E 5AEWA 1BCCE 2GBXA 4AIVA 4QCKA 2FYUE 2B24A 2NWFA 3N0QA 1EZVE 2DE5D 2YVJB 3L73E 2DE6D 2QJYC 2BMQA 2QJPC 1L0LE 1SQPE 4QUQA 1ULJA 4NBED 2XSOA 2XR8A 2ZT9D 1ZRTE 4HM2A 3VCPA 3EN1A 1WQLA 2HMOA 5CXMA 1SQVE 5KLIC 4HKVA 1O7WA 1RFSA 4HM7A 3GTEA 4NBFD 1L0NE 2JZAA 2JO6A 3H1KE 4P1CH 1UUWA 3GB4A 2I7FA 1G8KB 3GZYA 1SQQE 2D2CD 1ULIA 2YFLA 3H1HE 1VM9A 3DQYA 5BOKA 1SQBE 1KB9E 2YFIA 2A06E 4H44D 1O7NA 4HM3A 1BE3E 4NBAD 1G8JB 1Q90C 3L74E 4QDDA 2BMOA 3GOBA 3VMID 3GL0A 1NDOA 3EQQA 4NBGD 4HM4A 1NU1E 1O7GA 1O7MA 4U3FE 2YIUC 3CX5E 3FOUA 4NB9D 4NBCD 2HMMA 1P84E 4HM6A 2HMJA 4HM0A 1RIEA 3GL2A 2HMNA 1SJGA 3VMGD 4EMJB 3GKEA 4PD4E 1EG9A 3H1IE 1UUVA 3L70E 2XRXA 4QDFB 1O7PA 3TGUE 5HL4A 2B1XA 2FYNC 2E75D 1FQTA 5AEUA 2CKFA 2QJKC 2IBZE 4P1BH 3BCCE 3GTSA 3AZCA 2GBWA 2NVEA 1NTKE 4QDCA 3CXHE 3C0DA 1KYOE 4QUPA 1VCKA 4QDFA 2HMKA 3L75E 5KLVE 2QPZA 4HM8A 3VCAA 1NTZE 2NUKA 4OGQD 4PV1D 2Q3WA 2HMLA 2NVGA 1O7HA 3VMHD 2DE7D 4QURA 4NBHD 2BMRA 5KKZC 4H13D 4NBDD 3L71E 3L72E 2YFJA 2E4PA 2NUMA 1JM1A 1NTME 1PPJE 3H1JE 2E74D 1SQXE 4NB8D 2BCCE 3GCEA 1NYKA 3D89A 2E76D 2ZYLA 3GZXA 4HM5A 3H1LE 2NVFA 4H0LD
chains in the Genus database with same CATH topology
4HM1A 2XSHA 1VF5D 4HJLA 2E4QA 4AAYB 3CWBE 4NBBD 1PP9E 5AEWA 1BCCE 2GBXA 4AIVA 4QCKA 2FYUE 2B24A 2NWFA 3N0QA 1EZVE 2DE5D 2YVJB 3L73E 2DE6D 2QJYC 2BMQA 2QJPC 1L0LE 1SQPE 4QUQA 1ULJA 4NBED 2XSOA 2XR8A 2ZT9D 1ZRTE 4HM2A 3VCPA 3EN1A 1WQLA 2HMOA 5CXMA 1SQVE 5KLIC 4HKVA 1O7WA 1RFSA 4HM7A 3GTEA 4NBFD 1L0NE 2JZAA 2JO6A 3H1KE 4P1CH 1UUWA 3GB4A 2I7FA 1G8KB 3GZYA 1SQQE 2D2CD 1ULIA 2YFLA 3H1HE 1VM9A 3DQYA 5BOKA 1SQBE 1KB9E 2YFIA 2A06E 4H44D 1O7NA 4HM3A 1BE3E 4NBAD 1G8JB 1Q90C 3L74E 4QDDA 2BMOA 3GOBA 3VMID 3GL0A 1NDOA 3EQQA 4NBGD 4HM4A 1NU1E 1O7GA 1O7MA 4U3FE 2YIUC 3CX5E 3FOUA 4NB9D 4NBCD 2HMMA 1P84E 4HM6A 2HMJA 4HM0A 1RIEA 3GL2A 2HMNA 1SJGA 3VMGD 4EMJB 3GKEA 4PD4E 1EG9A 3H1IE 1UUVA 3L70E 2XRXA 4QDFB 1O7PA 3TGUE 5HL4A 2B1XA 2FYNC 2E75D 1FQTA 5AEUA 2CKFA 2QJKC 2IBZE 4P1BH 3BCCE 3GTSA 3AZCA 2GBWA 2NVEA 1NTKE 4QDCA 3CXHE 3C0DA 1KYOE 4QUPA 1VCKA 4QDFA 2HMKA 3L75E 5KLVE 2QPZA 4HM8A 3VCAA 1NTZE 2NUKA 4OGQD 4PV1D 2Q3WA 2HMLA 2NVGA 1O7HA 3VMHD 2DE7D 4QURA 4NBHD 2BMRA 5KKZC 4H13D 4NBDD 3L71E 3L72E 2YFJA 2E4PA 2NUMA 1JM1A 1NTME 1PPJE 3H1JE 2E74D 1SQXE 4NB8D 2BCCE 3GCEA 1NYKA 3D89A 2E76D 2ZYLA 3GZXA 4HM5A 3H1LE 2NVFA 4H0LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM1 A;  2XSH A;  1VF5 D;  4HJL A;  2E4Q A;  4AAY B;  3CWB E;  4NBB D;  1PP9 E;  5AEW A;  1BCC E;  2GBX A;  4AIV A;  4QCK A;  2FYU E;  2B24 A;  2NWF A;  3N0Q A;  1EZV E;  2DE5 D;  2YVJ B;  3L73 E;  2DE6 D;  2QJY C;  2BMQ A;  2QJP C;  1L0L E;  1SQP E;  4QUQ A;  1ULJ A;  4NBE D;  2XSO A;  2XR8 A;  2ZT9 D;  1ZRT E;  4HM2 A;  3VCP A;  3EN1 A;  1WQL A;  2HMO A;  5CXM A;  1SQV E;  5KLI C;  4HKV A;  1O7W A;  1RFS A;  4HM7 A;  3GTE A;  4NBF D;  1L0N E;  2JZA A;  2JO6 A;  3H1K E;  4P1C H;  1UUW A;  3GB4 A;  2I7F A;  1G8K B;  3GZY A;  1SQQ E;  2D2C D;  1ULI A;  2YFL A;  3H1H E;  1VM9 A;  3DQY A;  5BOK A;  1SQB E;  1KB9 E;  2YFI A;  2A06 E;  4H44 D;  1O7N A;  4HM3 A;  1BE3 E;  4NBA D;  1G8J B;  1Q90 C;  3L74 E;  4QDD A;  2BMO A;  3GOB A;  3VMI D;  3GL0 A;  1NDO A;  3EQQ A;  4NBG D;  4HM4 A;  1NU1 E;  1O7G A;  1O7M A;  4U3F E;  2YIU C;  3CX5 E;  3FOU A;  4NB9 D;  4NBC D;  2HMM A;  1P84 E;  4HM6 A;  2HMJ A;  4HM0 A;  1RIE A;  3GL2 A;  2HMN A;  1SJG A;  3VMG D;  4EMJ B;  3GKE A;  4PD4 E;  1EG9 A;  3H1I E;  1UUV A;  3L70 E;  2XRX A;  4QDF B;  1O7P A;  3TGU E;  5HL4 A;  2B1X A;  2FYN C;  2E75 D;  1FQT A;  5AEU A;  2CKF A;  2QJK C;  2IBZ E;  4P1B H;  3BCC E;  3GTS A;  3AZC A;  2GBW A;  2NVE A;  1NTK E;  4QDC A;  3CXH E;  3C0D A;  1KYO E;  4QUP A;  1VCK A;  4QDF A;  2HMK A;  3L75 E;  5KLV E;  2QPZ A;  4HM8 A;  3VCA A;  1NTZ E;  2NUK A;  4OGQ D;  4PV1 D;  2Q3W A;  2HML A;  2NVG A;  1O7H A;  3VMH D;  2DE7 D;  4QUR A;  4NBH D;  2BMR A;  5KKZ C;  4H13 D;  4NBD D;  3L71 E;  3L72 E;  2YFJ A;  2E4P A;  2NUM A;  1JM1 A;  1NTM E;  1PPJ E;  3H1J E;  2E74 D;  1SQX E;  4NB8 D;  2BCC E;  3GCE A;  1NYK A;  3D89 A;  2E76 D;  2ZYL A;  3GZX A;  4HM5 A;  3H1L E;  2NVF A;  4H0L D; 
#chains in the Genus database with same CATH topology
 4HM1 A;  2XSH A;  1VF5 D;  4HJL A;  2E4Q A;  4AAY B;  3CWB E;  4NBB D;  1PP9 E;  5AEW A;  1BCC E;  2GBX A;  4AIV A;  4QCK A;  2FYU E;  2B24 A;  2NWF A;  3N0Q A;  1EZV E;  2DE5 D;  2YVJ B;  3L73 E;  2DE6 D;  2QJY C;  2BMQ A;  2QJP C;  1L0L E;  1SQP E;  4QUQ A;  1ULJ A;  4NBE D;  2XSO A;  2XR8 A;  2ZT9 D;  1ZRT E;  4HM2 A;  3VCP A;  3EN1 A;  1WQL A;  2HMO A;  5CXM A;  1SQV E;  5KLI C;  4HKV A;  1O7W A;  1RFS A;  4HM7 A;  3GTE A;  4NBF D;  1L0N E;  2JZA A;  2JO6 A;  3H1K E;  4P1C H;  1UUW A;  3GB4 A;  2I7F A;  1G8K B;  3GZY A;  1SQQ E;  2D2C D;  1ULI A;  2YFL A;  3H1H E;  1VM9 A;  3DQY A;  5BOK A;  1SQB E;  1KB9 E;  2YFI A;  2A06 E;  4H44 D;  1O7N A;  4HM3 A;  1BE3 E;  4NBA D;  1G8J B;  1Q90 C;  3L74 E;  4QDD A;  2BMO A;  3GOB A;  3VMI D;  3GL0 A;  1NDO A;  3EQQ A;  4NBG D;  4HM4 A;  1NU1 E;  1O7G A;  1O7M A;  4U3F E;  2YIU C;  3CX5 E;  3FOU A;  4NB9 D;  4NBC D;  2HMM A;  1P84 E;  4HM6 A;  2HMJ A;  4HM0 A;  1RIE A;  3GL2 A;  2HMN A;  1SJG A;  3VMG D;  4EMJ B;  3GKE A;  4PD4 E;  1EG9 A;  3H1I E;  1UUV A;  3L70 E;  2XRX A;  4QDF B;  1O7P A;  3TGU E;  5HL4 A;  2B1X A;  2FYN C;  2E75 D;  1FQT A;  5AEU A;  2CKF A;  2QJK C;  2IBZ E;  4P1B H;  3BCC E;  3GTS A;  3AZC A;  2GBW A;  2NVE A;  1NTK E;  4QDC A;  3CXH E;  3C0D A;  1KYO E;  4QUP A;  1VCK A;  4QDF A;  2HMK A;  3L75 E;  5KLV E;  2QPZ A;  4HM8 A;  3VCA A;  1NTZ E;  2NUK A;  4OGQ D;  4PV1 D;  2Q3W A;  2HML A;  2NVG A;  1O7H A;  3VMH D;  2DE7 D;  4QUR A;  4NBH D;  2BMR A;  5KKZ C;  4H13 D;  4NBD D;  3L71 E;  3L72 E;  2YFJ A;  2E4P A;  2NUM A;  1JM1 A;  1NTM E;  1PPJ E;  3H1J E;  2E74 D;  1SQX E;  4NB8 D;  2BCC E;  3GCE A;  1NYK A;  3D89 A;  2E76 D;  2ZYL A;  3GZX A;  4HM5 A;  3H1L E;  2NVF A;  4H0L D; 
#chains in the Genus database with same CATH homology
 4HM1 A;  2XSH A;  1VF5 D;  4HJL A;  2E4Q A;  4AAY B;  3CWB E;  4NBB D;  1PP9 E;  5AEW A;  1BCC E;  2GBX A;  4AIV A;  4QCK A;  2FYU E;  2B24 A;  2NWF A;  3N0Q A;  1EZV E;  2DE5 D;  2YVJ B;  3L73 E;  2DE6 D;  2QJY C;  2BMQ A;  2QJP C;  1L0L E;  1SQP E;  4QUQ A;  1ULJ A;  4NBE D;  2XSO A;  2XR8 A;  2ZT9 D;  1ZRT E;  4HM2 A;  3VCP A;  3EN1 A;  1WQL A;  2HMO A;  5CXM A;  1SQV E;  5KLI C;  4HKV A;  1O7W A;  1RFS A;  4HM7 A;  3GTE A;  4NBF D;  1L0N E;  2JZA A;  2JO6 A;  3H1K E;  4P1C H;  1UUW A;  3GB4 A;  2I7F A;  1G8K B;  3GZY A;  1SQQ E;  2D2C D;  1ULI A;  2YFL A;  3H1H E;  1VM9 A;  3DQY A;  5BOK A;  1SQB E;  1KB9 E;  2YFI A;  2A06 E;  4H44 D;  1O7N A;  4HM3 A;  1BE3 E;  4NBA D;  1G8J B;  1Q90 C;  3L74 E;  4QDD A;  2BMO A;  3GOB A;  3VMI D;  3GL0 A;  1NDO A;  3EQQ A;  4NBG D;  4HM4 A;  1NU1 E;  1O7G A;  1O7M A;  4U3F E;  2YIU C;  3CX5 E;  3FOU A;  4NB9 D;  4NBC D;  2HMM A;  1P84 E;  4HM6 A;  2HMJ A;  4HM0 A;  1RIE A;  3GL2 A;  2HMN A;  1SJG A;  3VMG D;  4EMJ B;  3GKE A;  4PD4 E;  1EG9 A;  3H1I E;  1UUV A;  3L70 E;  2XRX A;  4QDF B;  1O7P A;  3TGU E;  5HL4 A;  2B1X A;  2FYN C;  2E75 D;  1FQT A;  5AEU A;  2CKF A;  2QJK C;  2IBZ E;  4P1B H;  3BCC E;  3GTS A;  3AZC A;  2GBW A;  2NVE A;  1NTK E;  4QDC A;  3CXH E;  3C0D A;  1KYO E;  4QUP A;  1VCK A;  4QDF A;  2HMK A;  3L75 E;  5KLV E;  2QPZ A;  4HM8 A;  3VCA A;  1NTZ E;  2NUK A;  4OGQ D;  4PV1 D;  2Q3W A;  2HML A;  2NVG A;  1O7H A;  3VMH D;  2DE7 D;  4QUR A;  4NBH D;  2BMR A;  5KKZ C;  4H13 D;  4NBD D;  3L71 E;  3L72 E;  2YFJ A;  2E4P A;  2NUM A;  1JM1 A;  1NTM E;  1PPJ E;  3H1J E;  2E74 D;  1SQX E;  4NB8 D;  2BCC E;  3GCE A;  1NYK A;  3D89 A;  2E76 D;  2ZYL A;  3GZX A;  4HM5 A;  3H1L E;  2NVF A;  4H0L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...