3FOUA

Low ph structure of the rieske protein from thermus thermophilus at 2.1 a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
TPEKEPLKPGDILVYAQGGGEPKPIRLEELKPGDPFVLAYPMDPKTKVVKSGEAKNTLLVARFDPEELAPEVAQHAAEGVVAYSAVCTHLGCIVSQWVADEEAALCPCHGGVYDLRHGAQVIAGPPPRPVPQLPVRVEDGVLVAAGEFLGPVGVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
publication title Effects of pH on the Rieske Protein from Thermus thermophilus: A Spectroscopic and Structural Analysis
pubmed doi rcsb
source organism Thermus thermophilus
total genus 35
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3fouA00
3D89A 4NBCD 4P1BH 1NU1E 2HMMA 4NB8D 2XRXA 4OGQD 2ZT9D 4NBHD 4PV1D 4HM7A 1O7NA 5AEWA 4H13D 1NTZE 2NVGA 2E4PA 1WQLA 3VMHD 1JM1A 2BCCE 2NVEA 2IBZE 4QCKA 2I7FA 4QDCA 3L74E 4NBFD 1O7WA 1SQVE 1KB9E 5BOKA 3H1HE 3GZXA 4NBBD 1L0NE 1SQPE 4U3FE 1UUWA 4QDFB 5AEUA 4AAYB 1BCCE 5KLVE 2HMNA 1ULIA 1FQTA 3AZCA 1SJGA 2E4QA 5KLIC 3L70E 2DE6D 2XSOA 1RFSA 3CX5E 4HM4A 3GL2A 3DQYA 1KYOE 2QJYC 1PP9E 4H44D 2GBWA 4PD4E 3EQQA 1L0LE 1VCKA 3CWBE 1O7MA 3GL0A 3GOBA 2YFIA 2BMOA 1VF5D 3L72E 3GCEA 2BMQA 1O7GA 3L75E 2XSHA 3GTSA 1RIEA 1G8KB 2QJKC 2ZYLA 3H1IE 4H0LD 4HM5A 2FYNC 3VCAA 4P1CH 1VM9A 4HM3A 3GB4A 2YIUC 1NTME 3H1JE 3CXHE 1UUVA 1O7PA 4HKVA 5HL4A 3TGUE 2JZAA 1SQXE 4NBED 1SQBE 3VMID 3C0DA 3GTEA 3VCPA 1G8JB 2JO6A 1ZRTE 3GZYA 2E75D 1NTKE 2E76D 4QDDA 1BE3E 1ULJA 2E74D 4HM6A 4HM0A 3VMGD 2A06E 2B24A 2CKFA 3BCCE 3N0QA 4NB9D 4NBAD 2HMJA 2YVJB 2FYUE 4NBDD 2QPZA 2HMKA 2DE7D 1P84E 1SQQE 4QURA 1O7HA 5CXMA 2NVFA 2NWFA 4EMJB 2QJPC 1EG9A 4HM2A 1EZVE 2BMRA 2NUKA 4QUQA 4QDFA 2GBXA 2XR8A 2HMLA 4HJLA 4QUPA 3H1KE 4HM1A 1NYKA 1PPJE 2Q3WA 1NDOA 3FOUA 4HM8A 5KKZC 2YFJA 4AIVA 3L71E 3EN1A 2DE5D 1Q90C 2D2CD 4NBGD 3GKEA 3H1LE 3L73E 2NUMA 2HMOA 2YFLA 2B1XA
chains in the Genus database with same CATH superfamily
3D89A 4NBCD 4P1BH 1NU1E 2HMMA 4NB8D 2XRXA 4OGQD 2ZT9D 4NBHD 4PV1D 4HM7A 1O7NA 5AEWA 4H13D 1NTZE 2NVGA 2E4PA 1WQLA 3VMHD 1JM1A 2BCCE 2NVEA 2IBZE 4QCKA 2I7FA 4QDCA 3L74E 4NBFD 1O7WA 1SQVE 1KB9E 5BOKA 3H1HE 3GZXA 4NBBD 1L0NE 1SQPE 4U3FE 1UUWA 4QDFB 5AEUA 4AAYB 1BCCE 5KLVE 2HMNA 1ULIA 1FQTA 3AZCA 1SJGA 2E4QA 5KLIC 3L70E 2DE6D 2XSOA 1RFSA 3CX5E 4HM4A 3GL2A 3DQYA 1KYOE 2QJYC 1PP9E 4H44D 2GBWA 4PD4E 3EQQA 1L0LE 1VCKA 3CWBE 1O7MA 3GL0A 3GOBA 2YFIA 2BMOA 1VF5D 3L72E 3GCEA 2BMQA 1O7GA 3L75E 2XSHA 3GTSA 1RIEA 1G8KB 2QJKC 2ZYLA 3H1IE 4H0LD 4HM5A 2FYNC 3VCAA 4P1CH 1VM9A 4HM3A 3GB4A 2YIUC 1NTME 3H1JE 3CXHE 1UUVA 1O7PA 4HKVA 5HL4A 3TGUE 2JZAA 1SQXE 4NBED 1SQBE 3VMID 3C0DA 3GTEA 3VCPA 1G8JB 2JO6A 1ZRTE 3GZYA 2E75D 1NTKE 2E76D 4QDDA 1BE3E 1ULJA 2E74D 4HM6A 4HM0A 3VMGD 2A06E 2B24A 2CKFA 3BCCE 3N0QA 4NB9D 4NBAD 2HMJA 2YVJB 2FYUE 4NBDD 2QPZA 2HMKA 2DE7D 1P84E 1SQQE 4QURA 1O7HA 5CXMA 2NVFA 2NWFA 4EMJB 2QJPC 1EG9A 4HM2A 1EZVE 2BMRA 2NUKA 4QUQA 4QDFA 2GBXA 2XR8A 2HMLA 4HJLA 4QUPA 3H1KE 4HM1A 1NYKA 1PPJE 2Q3WA 1NDOA 3FOUA 4HM8A 5KKZC 2YFJA 4AIVA 3L71E 3EN1A 2DE5D 1Q90C 2D2CD 4NBGD 3GKEA 3H1LE 3L73E 2NUMA 2HMOA 2YFLA 2B1XA
chains in the Genus database with same CATH topology
3D89A 4NBCD 4P1BH 1NU1E 2HMMA 4NB8D 2XRXA 4OGQD 2ZT9D 4NBHD 4PV1D 4HM7A 1O7NA 5AEWA 4H13D 1NTZE 2NVGA 2E4PA 1WQLA 3VMHD 1JM1A 2BCCE 2NVEA 2IBZE 4QCKA 2I7FA 4QDCA 3L74E 4NBFD 1O7WA 1SQVE 1KB9E 5BOKA 3H1HE 3GZXA 4NBBD 1L0NE 1SQPE 4U3FE 1UUWA 4QDFB 5AEUA 4AAYB 1BCCE 5KLVE 2HMNA 1ULIA 1FQTA 3AZCA 1SJGA 2E4QA 5KLIC 3L70E 2DE6D 2XSOA 1RFSA 3CX5E 4HM4A 3GL2A 3DQYA 1KYOE 2QJYC 1PP9E 4H44D 2GBWA 4PD4E 3EQQA 1L0LE 1VCKA 3CWBE 1O7MA 3GL0A 3GOBA 2YFIA 2BMOA 1VF5D 3L72E 3GCEA 2BMQA 1O7GA 3L75E 2XSHA 3GTSA 1RIEA 1G8KB 2QJKC 2ZYLA 3H1IE 4H0LD 4HM5A 2FYNC 3VCAA 4P1CH 1VM9A 4HM3A 3GB4A 2YIUC 1NTME 3H1JE 3CXHE 1UUVA 1O7PA 4HKVA 5HL4A 3TGUE 2JZAA 1SQXE 4NBED 1SQBE 3VMID 3C0DA 3GTEA 3VCPA 1G8JB 2JO6A 1ZRTE 3GZYA 2E75D 1NTKE 2E76D 4QDDA 1BE3E 1ULJA 2E74D 4HM6A 4HM0A 3VMGD 2A06E 2B24A 2CKFA 3BCCE 3N0QA 4NB9D 4NBAD 2HMJA 2YVJB 2FYUE 4NBDD 2QPZA 2HMKA 2DE7D 1P84E 1SQQE 4QURA 1O7HA 5CXMA 2NVFA 2NWFA 4EMJB 2QJPC 1EG9A 4HM2A 1EZVE 2BMRA 2NUKA 4QUQA 4QDFA 2GBXA 2XR8A 2HMLA 4HJLA 4QUPA 3H1KE 4HM1A 1NYKA 1PPJE 2Q3WA 1NDOA 3FOUA 4HM8A 5KKZC 2YFJA 4AIVA 3L71E 3EN1A 2DE5D 1Q90C 2D2CD 4NBGD 3GKEA 3H1LE 3L73E 2NUMA 2HMOA 2YFLA 2B1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D89 A;  4NBC D;  4P1B H;  1NU1 E;  2HMM A;  4NB8 D;  2XRX A;  4OGQ D;  2ZT9 D;  4NBH D;  4PV1 D;  4HM7 A;  1O7N A;  5AEW A;  4H13 D;  1NTZ E;  2NVG A;  2E4P A;  1WQL A;  3VMH D;  1JM1 A;  2BCC E;  2NVE A;  2IBZ E;  4QCK A;  2I7F A;  4QDC A;  3L74 E;  4NBF D;  1O7W A;  1SQV E;  1KB9 E;  5BOK A;  3H1H E;  3GZX A;  4NBB D;  1L0N E;  1SQP E;  4U3F E;  1UUW A;  4QDF B;  5AEU A;  4AAY B;  1BCC E;  5KLV E;  2HMN A;  1ULI A;  1FQT A;  3AZC A;  1SJG A;  2E4Q A;  5KLI C;  3L70 E;  2DE6 D;  2XSO A;  1RFS A;  3CX5 E;  4HM4 A;  3GL2 A;  3DQY A;  1KYO E;  2QJY C;  1PP9 E;  4H44 D;  2GBW A;  4PD4 E;  3EQQ A;  1L0L E;  1VCK A;  3CWB E;  1O7M A;  3GL0 A;  3GOB A;  2YFI A;  2BMO A;  1VF5 D;  3L72 E;  3GCE A;  2BMQ A;  1O7G A;  3L75 E;  2XSH A;  3GTS A;  1RIE A;  1G8K B;  2QJK C;  2ZYL A;  3H1I E;  4H0L D;  4HM5 A;  2FYN C;  3VCA A;  4P1C H;  1VM9 A;  4HM3 A;  3GB4 A;  2YIU C;  1NTM E;  3H1J E;  3CXH E;  1UUV A;  1O7P A;  4HKV A;  5HL4 A;  3TGU E;  2JZA A;  1SQX E;  4NBE D;  1SQB E;  3VMI D;  3C0D A;  3GTE A;  3VCP A;  1G8J B;  2JO6 A;  1ZRT E;  3GZY A;  2E75 D;  1NTK E;  2E76 D;  4QDD A;  1BE3 E;  1ULJ A;  2E74 D;  4HM6 A;  4HM0 A;  3VMG D;  2A06 E;  2B24 A;  2CKF A;  3BCC E;  3N0Q A;  4NB9 D;  4NBA D;  2HMJ A;  2YVJ B;  2FYU E;  4NBD D;  2QPZ A;  2HMK A;  2DE7 D;  1P84 E;  1SQQ E;  4QUR A;  1O7H A;  5CXM A;  2NVF A;  2NWF A;  4EMJ B;  2QJP C;  1EG9 A;  4HM2 A;  1EZV E;  2BMR A;  2NUK A;  4QUQ A;  4QDF A;  2GBX A;  2XR8 A;  2HML A;  4HJL A;  4QUP A;  3H1K E;  4HM1 A;  1NYK A;  1PPJ E;  2Q3W A;  1NDO A;  3FOU A;  4HM8 A;  5KKZ C;  2YFJ A;  4AIV A;  3L71 E;  3EN1 A;  2DE5 D;  1Q90 C;  2D2C D;  4NBG D;  3GKE A;  3H1L E;  3L73 E;  2NUM A;  2HMO A;  2YFL A;  2B1X A; 
#chains in the Genus database with same CATH topology
 3D89 A;  4NBC D;  4P1B H;  1NU1 E;  2HMM A;  4NB8 D;  2XRX A;  4OGQ D;  2ZT9 D;  4NBH D;  4PV1 D;  4HM7 A;  1O7N A;  5AEW A;  4H13 D;  1NTZ E;  2NVG A;  2E4P A;  1WQL A;  3VMH D;  1JM1 A;  2BCC E;  2NVE A;  2IBZ E;  4QCK A;  2I7F A;  4QDC A;  3L74 E;  4NBF D;  1O7W A;  1SQV E;  1KB9 E;  5BOK A;  3H1H E;  3GZX A;  4NBB D;  1L0N E;  1SQP E;  4U3F E;  1UUW A;  4QDF B;  5AEU A;  4AAY B;  1BCC E;  5KLV E;  2HMN A;  1ULI A;  1FQT A;  3AZC A;  1SJG A;  2E4Q A;  5KLI C;  3L70 E;  2DE6 D;  2XSO A;  1RFS A;  3CX5 E;  4HM4 A;  3GL2 A;  3DQY A;  1KYO E;  2QJY C;  1PP9 E;  4H44 D;  2GBW A;  4PD4 E;  3EQQ A;  1L0L E;  1VCK A;  3CWB E;  1O7M A;  3GL0 A;  3GOB A;  2YFI A;  2BMO A;  1VF5 D;  3L72 E;  3GCE A;  2BMQ A;  1O7G A;  3L75 E;  2XSH A;  3GTS A;  1RIE A;  1G8K B;  2QJK C;  2ZYL A;  3H1I E;  4H0L D;  4HM5 A;  2FYN C;  3VCA A;  4P1C H;  1VM9 A;  4HM3 A;  3GB4 A;  2YIU C;  1NTM E;  3H1J E;  3CXH E;  1UUV A;  1O7P A;  4HKV A;  5HL4 A;  3TGU E;  2JZA A;  1SQX E;  4NBE D;  1SQB E;  3VMI D;  3C0D A;  3GTE A;  3VCP A;  1G8J B;  2JO6 A;  1ZRT E;  3GZY A;  2E75 D;  1NTK E;  2E76 D;  4QDD A;  1BE3 E;  1ULJ A;  2E74 D;  4HM6 A;  4HM0 A;  3VMG D;  2A06 E;  2B24 A;  2CKF A;  3BCC E;  3N0Q A;  4NB9 D;  4NBA D;  2HMJ A;  2YVJ B;  2FYU E;  4NBD D;  2QPZ A;  2HMK A;  2DE7 D;  1P84 E;  1SQQ E;  4QUR A;  1O7H A;  5CXM A;  2NVF A;  2NWF A;  4EMJ B;  2QJP C;  1EG9 A;  4HM2 A;  1EZV E;  2BMR A;  2NUK A;  4QUQ A;  4QDF A;  2GBX A;  2XR8 A;  2HML A;  4HJL A;  4QUP A;  3H1K E;  4HM1 A;  1NYK A;  1PPJ E;  2Q3W A;  1NDO A;  3FOU A;  4HM8 A;  5KKZ C;  2YFJ A;  4AIV A;  3L71 E;  3EN1 A;  2DE5 D;  1Q90 C;  2D2C D;  4NBG D;  3GKE A;  3H1L E;  3L73 E;  2NUM A;  2HMO A;  2YFL A;  2B1X A; 
#chains in the Genus database with same CATH homology
 3D89 A;  4NBC D;  4P1B H;  1NU1 E;  2HMM A;  4NB8 D;  2XRX A;  4OGQ D;  2ZT9 D;  4NBH D;  4PV1 D;  4HM7 A;  1O7N A;  5AEW A;  4H13 D;  1NTZ E;  2NVG A;  2E4P A;  1WQL A;  3VMH D;  1JM1 A;  2BCC E;  2NVE A;  2IBZ E;  4QCK A;  2I7F A;  4QDC A;  3L74 E;  4NBF D;  1O7W A;  1SQV E;  1KB9 E;  5BOK A;  3H1H E;  3GZX A;  4NBB D;  1L0N E;  1SQP E;  4U3F E;  1UUW A;  4QDF B;  5AEU A;  4AAY B;  1BCC E;  5KLV E;  2HMN A;  1ULI A;  1FQT A;  3AZC A;  1SJG A;  2E4Q A;  5KLI C;  3L70 E;  2DE6 D;  2XSO A;  1RFS A;  3CX5 E;  4HM4 A;  3GL2 A;  3DQY A;  1KYO E;  2QJY C;  1PP9 E;  4H44 D;  2GBW A;  4PD4 E;  3EQQ A;  1L0L E;  1VCK A;  3CWB E;  1O7M A;  3GL0 A;  3GOB A;  2YFI A;  2BMO A;  1VF5 D;  3L72 E;  3GCE A;  2BMQ A;  1O7G A;  3L75 E;  2XSH A;  3GTS A;  1RIE A;  1G8K B;  2QJK C;  2ZYL A;  3H1I E;  4H0L D;  4HM5 A;  2FYN C;  3VCA A;  4P1C H;  1VM9 A;  4HM3 A;  3GB4 A;  2YIU C;  1NTM E;  3H1J E;  3CXH E;  1UUV A;  1O7P A;  4HKV A;  5HL4 A;  3TGU E;  2JZA A;  1SQX E;  4NBE D;  1SQB E;  3VMI D;  3C0D A;  3GTE A;  3VCP A;  1G8J B;  2JO6 A;  1ZRT E;  3GZY A;  2E75 D;  1NTK E;  2E76 D;  4QDD A;  1BE3 E;  1ULJ A;  2E74 D;  4HM6 A;  4HM0 A;  3VMG D;  2A06 E;  2B24 A;  2CKF A;  3BCC E;  3N0Q A;  4NB9 D;  4NBA D;  2HMJ A;  2YVJ B;  2FYU E;  4NBD D;  2QPZ A;  2HMK A;  2DE7 D;  1P84 E;  1SQQ E;  4QUR A;  1O7H A;  5CXM A;  2NVF A;  2NWF A;  4EMJ B;  2QJP C;  1EG9 A;  4HM2 A;  1EZV E;  2BMR A;  2NUK A;  4QUQ A;  4QDF A;  2GBX A;  2XR8 A;  2HML A;  4HJL A;  4QUP A;  3H1K E;  4HM1 A;  1NYK A;  1PPJ E;  2Q3W A;  1NDO A;  3FOU A;  4HM8 A;  5KKZ C;  2YFJ A;  4AIV A;  3L71 E;  3EN1 A;  2DE5 D;  1Q90 C;  2D2C D;  4NBG D;  3GKE A;  3H1L E;  3L73 E;  2NUM A;  2HMO A;  2YFL A;  2B1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...