3FOUA

Low ph structure of the rieske protein from thermus thermophilus at 2.1 a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
TPEKEPLKPGDILVYAQGGGEPKPIRLEELKPGDPFVLAYPMDPKTKVVKSGEAKNTLLVARFDPEELAPEVAQHAAEGVVAYSAVCTHLGCIVSQWVADEEAALCPCHGGVYDLRHGAQVIAGPPPRPVPQLPVRVEDGVLVAAGEFLGPVGVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of pH on the Rieske Protein from Thermus thermophilus: A Spectroscopic and Structural Analysis
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Electron transport
molecule keywords Quinol-cytochrome c reductase, Rieske iron-sulfur subunit
total genus 35
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3fouA00
4HM8A 2E76D 4NBDD 1NTZE 1Q90C 1UUVA 2NVFA 2YFIA 2I7FA 1NU1E 3GB4A 3GCEA 1BCCE 1FQTA 1G8JB 4OGQD 3GZYA 2NVGA 2JZAA 2QJPC 4H0LD 2YVJB 2DE5D 2GBXA 4U3FE 5KLVE 1NTME 2JO6A 4NBED 4HM3A 2NWFA 1RIEA 2B24A 3GKEA 4NBHD 3GZXA 4HM2A 3GL2A 1O7WA 1O7HA 4P1BH 1EZVE 1WQLA 3H1HE 1G8KB 4NBBD 1SQXE 1O7PA 1SJGA 1KYOE 4HM1A 1UUWA 4NBAD 2Q3WA 1SQBE 3H1KE 3FOUA 4QDCA 3CX5E 3TGUE 1NYKA 2A06E 2NVEA 2NUMA 3VMHD 2D2CD 2FYUE 2XSOA 3L74E 4NBFD 1O7NA 2E75D 4QURA 4QUPA 1SQPE 3H1IE 1O7GA 4H13D 4P1CH 2HMMA 3CXHE 2BMRA 3BCCE 3D89A 4HJLA 2QJYC 4AIVA 5KLIC 4NB8D 1SQVE 4HM5A 2E4PA 3L75E 2CKFA 5KKZC 5CXMA 2GBWA 2B1XA 4H44D 4HKVA 2E74D 1RFSA 3C0DA 3L72E 3DQYA 2HMNA 2FYNC 1NDOA 5HL4A 1VCKA 3H1JE 1PPJE 1KB9E 5BOKA 2BMQA 1PP9E 2XRXA 2QPZA 1L0LE 2HMLA 4HM4A 4PD4E 4HM7A 3GTEA 1ZRTE 1ULJA 3VMGD 4HM0A 4EMJB 2DE7D 3L71E 3VMID 1O7MA 3N0QA 4QDFA 1ULIA 2YFLA 1SQQE 5AEUA 2XSHA 2BMOA 4AAYB 3AZCA 3H1LE 1EG9A 3CWBE 2YIUC 3L73E 3L70E 4QUQA 2E4QA 2HMJA 1VM9A 4QCKA 3GTSA 3VCPA 3VCAA 5AEWA 3GOBA 1VF5D 1L0NE 3GL0A 4HM6A 4NBCD 2QJKC 3EQQA 4QDDA 2ZYLA 3EN1A 4PV1D 1BE3E 2BCCE 2HMKA 2NUKA 2XR8A 2IBZE 4NBGD 2YFJA 4NB9D 1JM1A 2DE6D 4QDFB 2ZT9D 2HMOA 1NTKE 1P84E
chains in the Genus database with same CATH superfamily
4HM8A 2E76D 4NBDD 1NTZE 1Q90C 1UUVA 2NVFA 2YFIA 2I7FA 1NU1E 3GB4A 3GCEA 1BCCE 1FQTA 1G8JB 4OGQD 3GZYA 2NVGA 2JZAA 2QJPC 4H0LD 2YVJB 2DE5D 2GBXA 4U3FE 5KLVE 1NTME 2JO6A 4NBED 4HM3A 2NWFA 1RIEA 2B24A 3GKEA 4NBHD 3GZXA 4HM2A 3GL2A 1O7WA 1O7HA 4P1BH 1EZVE 1WQLA 3H1HE 1G8KB 4NBBD 1SQXE 1O7PA 1SJGA 1KYOE 4HM1A 1UUWA 4NBAD 2Q3WA 1SQBE 3H1KE 3FOUA 4QDCA 3CX5E 3TGUE 1NYKA 2A06E 2NVEA 2NUMA 3VMHD 2D2CD 2FYUE 2XSOA 3L74E 4NBFD 1O7NA 2E75D 4QURA 4QUPA 1SQPE 3H1IE 1O7GA 4H13D 4P1CH 2HMMA 3CXHE 2BMRA 3BCCE 3D89A 4HJLA 2QJYC 4AIVA 5KLIC 4NB8D 1SQVE 4HM5A 2E4PA 3L75E 2CKFA 5KKZC 5CXMA 2GBWA 2B1XA 4H44D 4HKVA 2E74D 1RFSA 3C0DA 3L72E 3DQYA 2HMNA 2FYNC 1NDOA 5HL4A 1VCKA 3H1JE 1PPJE 1KB9E 5BOKA 2BMQA 1PP9E 2XRXA 2QPZA 1L0LE 2HMLA 4HM4A 4PD4E 4HM7A 3GTEA 1ZRTE 1ULJA 3VMGD 4HM0A 4EMJB 2DE7D 3L71E 3VMID 1O7MA 3N0QA 4QDFA 1ULIA 2YFLA 1SQQE 5AEUA 2XSHA 2BMOA 4AAYB 3AZCA 3H1LE 1EG9A 3CWBE 2YIUC 3L73E 3L70E 4QUQA 2E4QA 2HMJA 1VM9A 4QCKA 3GTSA 3VCPA 3VCAA 5AEWA 3GOBA 1VF5D 1L0NE 3GL0A 4HM6A 4NBCD 2QJKC 3EQQA 4QDDA 2ZYLA 3EN1A 4PV1D 1BE3E 2BCCE 2HMKA 2NUKA 2XR8A 2IBZE 4NBGD 2YFJA 4NB9D 1JM1A 2DE6D 4QDFB 2ZT9D 2HMOA 1NTKE 1P84E
chains in the Genus database with same CATH topology
4HM8A 2E76D 4NBDD 1NTZE 1Q90C 1UUVA 2NVFA 2YFIA 2I7FA 1NU1E 3GB4A 3GCEA 1BCCE 1FQTA 1G8JB 4OGQD 3GZYA 2NVGA 2JZAA 2QJPC 4H0LD 2YVJB 2DE5D 2GBXA 4U3FE 5KLVE 1NTME 2JO6A 4NBED 4HM3A 2NWFA 1RIEA 2B24A 3GKEA 4NBHD 3GZXA 4HM2A 3GL2A 1O7WA 1O7HA 4P1BH 1EZVE 1WQLA 3H1HE 1G8KB 4NBBD 1SQXE 1O7PA 1SJGA 1KYOE 4HM1A 1UUWA 4NBAD 2Q3WA 1SQBE 3H1KE 3FOUA 4QDCA 3CX5E 3TGUE 1NYKA 2A06E 2NVEA 2NUMA 3VMHD 2D2CD 2FYUE 2XSOA 3L74E 4NBFD 1O7NA 2E75D 4QURA 4QUPA 1SQPE 3H1IE 1O7GA 4H13D 4P1CH 2HMMA 3CXHE 2BMRA 3BCCE 3D89A 4HJLA 2QJYC 4AIVA 5KLIC 4NB8D 1SQVE 4HM5A 2E4PA 3L75E 2CKFA 5KKZC 5CXMA 2GBWA 2B1XA 4H44D 4HKVA 2E74D 1RFSA 3C0DA 3L72E 3DQYA 2HMNA 2FYNC 1NDOA 5HL4A 1VCKA 3H1JE 1PPJE 1KB9E 5BOKA 2BMQA 1PP9E 2XRXA 2QPZA 1L0LE 2HMLA 4HM4A 4PD4E 4HM7A 3GTEA 1ZRTE 1ULJA 3VMGD 4HM0A 4EMJB 2DE7D 3L71E 3VMID 1O7MA 3N0QA 4QDFA 1ULIA 2YFLA 1SQQE 5AEUA 2XSHA 2BMOA 4AAYB 3AZCA 3H1LE 1EG9A 3CWBE 2YIUC 3L73E 3L70E 4QUQA 2E4QA 2HMJA 1VM9A 4QCKA 3GTSA 3VCPA 3VCAA 5AEWA 3GOBA 1VF5D 1L0NE 3GL0A 4HM6A 4NBCD 2QJKC 3EQQA 4QDDA 2ZYLA 3EN1A 4PV1D 1BE3E 2BCCE 2HMKA 2NUKA 2XR8A 2IBZE 4NBGD 2YFJA 4NB9D 1JM1A 2DE6D 4QDFB 2ZT9D 2HMOA 1NTKE 1P84E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM8 A;  2E76 D;  4NBD D;  1NTZ E;  1Q90 C;  1UUV A;  2NVF A;  2YFI A;  2I7F A;  1NU1 E;  3GB4 A;  3GCE A;  1BCC E;  1FQT A;  1G8J B;  4OGQ D;  3GZY A;  2NVG A;  2JZA A;  2QJP C;  4H0L D;  2YVJ B;  2DE5 D;  2GBX A;  4U3F E;  5KLV E;  1NTM E;  2JO6 A;  4NBE D;  4HM3 A;  2NWF A;  1RIE A;  2B24 A;  3GKE A;  4NBH D;  3GZX A;  4HM2 A;  3GL2 A;  1O7W A;  1O7H A;  4P1B H;  1EZV E;  1WQL A;  3H1H E;  1G8K B;  4NBB D;  1SQX E;  1O7P A;  1SJG A;  1KYO E;  4HM1 A;  1UUW A;  4NBA D;  2Q3W A;  1SQB E;  3H1K E;  3FOU A;  4QDC A;  3CX5 E;  3TGU E;  1NYK A;  2A06 E;  2NVE A;  2NUM A;  3VMH D;  2D2C D;  2FYU E;  2XSO A;  3L74 E;  4NBF D;  1O7N A;  2E75 D;  4QUR A;  4QUP A;  1SQP E;  3H1I E;  1O7G A;  4H13 D;  4P1C H;  2HMM A;  3CXH E;  2BMR A;  3BCC E;  3D89 A;  4HJL A;  2QJY C;  4AIV A;  5KLI C;  4NB8 D;  1SQV E;  4HM5 A;  2E4P A;  3L75 E;  2CKF A;  5KKZ C;  5CXM A;  2GBW A;  2B1X A;  4H44 D;  4HKV A;  2E74 D;  1RFS A;  3C0D A;  3L72 E;  3DQY A;  2HMN A;  2FYN C;  1NDO A;  5HL4 A;  1VCK A;  3H1J E;  1PPJ E;  1KB9 E;  5BOK A;  2BMQ A;  1PP9 E;  2XRX A;  2QPZ A;  1L0L E;  2HML A;  4HM4 A;  4PD4 E;  4HM7 A;  3GTE A;  1ZRT E;  1ULJ A;  3VMG D;  4HM0 A;  4EMJ B;  2DE7 D;  3L71 E;  3VMI D;  1O7M A;  3N0Q A;  4QDF A;  1ULI A;  2YFL A;  1SQQ E;  5AEU A;  2XSH A;  2BMO A;  4AAY B;  3AZC A;  3H1L E;  1EG9 A;  3CWB E;  2YIU C;  3L73 E;  3L70 E;  4QUQ A;  2E4Q A;  2HMJ A;  1VM9 A;  4QCK A;  3GTS A;  3VCP A;  3VCA A;  5AEW A;  3GOB A;  1VF5 D;  1L0N E;  3GL0 A;  4HM6 A;  4NBC D;  2QJK C;  3EQQ A;  4QDD A;  2ZYL A;  3EN1 A;  4PV1 D;  1BE3 E;  2BCC E;  2HMK A;  2NUK A;  2XR8 A;  2IBZ E;  4NBG D;  2YFJ A;  4NB9 D;  1JM1 A;  2DE6 D;  4QDF B;  2ZT9 D;  2HMO A;  1NTK E;  1P84 E; 
#chains in the Genus database with same CATH topology
 4HM8 A;  2E76 D;  4NBD D;  1NTZ E;  1Q90 C;  1UUV A;  2NVF A;  2YFI A;  2I7F A;  1NU1 E;  3GB4 A;  3GCE A;  1BCC E;  1FQT A;  1G8J B;  4OGQ D;  3GZY A;  2NVG A;  2JZA A;  2QJP C;  4H0L D;  2YVJ B;  2DE5 D;  2GBX A;  4U3F E;  5KLV E;  1NTM E;  2JO6 A;  4NBE D;  4HM3 A;  2NWF A;  1RIE A;  2B24 A;  3GKE A;  4NBH D;  3GZX A;  4HM2 A;  3GL2 A;  1O7W A;  1O7H A;  4P1B H;  1EZV E;  1WQL A;  3H1H E;  1G8K B;  4NBB D;  1SQX E;  1O7P A;  1SJG A;  1KYO E;  4HM1 A;  1UUW A;  4NBA D;  2Q3W A;  1SQB E;  3H1K E;  3FOU A;  4QDC A;  3CX5 E;  3TGU E;  1NYK A;  2A06 E;  2NVE A;  2NUM A;  3VMH D;  2D2C D;  2FYU E;  2XSO A;  3L74 E;  4NBF D;  1O7N A;  2E75 D;  4QUR A;  4QUP A;  1SQP E;  3H1I E;  1O7G A;  4H13 D;  4P1C H;  2HMM A;  3CXH E;  2BMR A;  3BCC E;  3D89 A;  4HJL A;  2QJY C;  4AIV A;  5KLI C;  4NB8 D;  1SQV E;  4HM5 A;  2E4P A;  3L75 E;  2CKF A;  5KKZ C;  5CXM A;  2GBW A;  2B1X A;  4H44 D;  4HKV A;  2E74 D;  1RFS A;  3C0D A;  3L72 E;  3DQY A;  2HMN A;  2FYN C;  1NDO A;  5HL4 A;  1VCK A;  3H1J E;  1PPJ E;  1KB9 E;  5BOK A;  2BMQ A;  1PP9 E;  2XRX A;  2QPZ A;  1L0L E;  2HML A;  4HM4 A;  4PD4 E;  4HM7 A;  3GTE A;  1ZRT E;  1ULJ A;  3VMG D;  4HM0 A;  4EMJ B;  2DE7 D;  3L71 E;  3VMI D;  1O7M A;  3N0Q A;  4QDF A;  1ULI A;  2YFL A;  1SQQ E;  5AEU A;  2XSH A;  2BMO A;  4AAY B;  3AZC A;  3H1L E;  1EG9 A;  3CWB E;  2YIU C;  3L73 E;  3L70 E;  4QUQ A;  2E4Q A;  2HMJ A;  1VM9 A;  4QCK A;  3GTS A;  3VCP A;  3VCA A;  5AEW A;  3GOB A;  1VF5 D;  1L0N E;  3GL0 A;  4HM6 A;  4NBC D;  2QJK C;  3EQQ A;  4QDD A;  2ZYL A;  3EN1 A;  4PV1 D;  1BE3 E;  2BCC E;  2HMK A;  2NUK A;  2XR8 A;  2IBZ E;  4NBG D;  2YFJ A;  4NB9 D;  1JM1 A;  2DE6 D;  4QDF B;  2ZT9 D;  2HMO A;  1NTK E;  1P84 E; 
#chains in the Genus database with same CATH homology
 4HM8 A;  2E76 D;  4NBD D;  1NTZ E;  1Q90 C;  1UUV A;  2NVF A;  2YFI A;  2I7F A;  1NU1 E;  3GB4 A;  3GCE A;  1BCC E;  1FQT A;  1G8J B;  4OGQ D;  3GZY A;  2NVG A;  2JZA A;  2QJP C;  4H0L D;  2YVJ B;  2DE5 D;  2GBX A;  4U3F E;  5KLV E;  1NTM E;  2JO6 A;  4NBE D;  4HM3 A;  2NWF A;  1RIE A;  2B24 A;  3GKE A;  4NBH D;  3GZX A;  4HM2 A;  3GL2 A;  1O7W A;  1O7H A;  4P1B H;  1EZV E;  1WQL A;  3H1H E;  1G8K B;  4NBB D;  1SQX E;  1O7P A;  1SJG A;  1KYO E;  4HM1 A;  1UUW A;  4NBA D;  2Q3W A;  1SQB E;  3H1K E;  3FOU A;  4QDC A;  3CX5 E;  3TGU E;  1NYK A;  2A06 E;  2NVE A;  2NUM A;  3VMH D;  2D2C D;  2FYU E;  2XSO A;  3L74 E;  4NBF D;  1O7N A;  2E75 D;  4QUR A;  4QUP A;  1SQP E;  3H1I E;  1O7G A;  4H13 D;  4P1C H;  2HMM A;  3CXH E;  2BMR A;  3BCC E;  3D89 A;  4HJL A;  2QJY C;  4AIV A;  5KLI C;  4NB8 D;  1SQV E;  4HM5 A;  2E4P A;  3L75 E;  2CKF A;  5KKZ C;  5CXM A;  2GBW A;  2B1X A;  4H44 D;  4HKV A;  2E74 D;  1RFS A;  3C0D A;  3L72 E;  3DQY A;  2HMN A;  2FYN C;  1NDO A;  5HL4 A;  1VCK A;  3H1J E;  1PPJ E;  1KB9 E;  5BOK A;  2BMQ A;  1PP9 E;  2XRX A;  2QPZ A;  1L0L E;  2HML A;  4HM4 A;  4PD4 E;  4HM7 A;  3GTE A;  1ZRT E;  1ULJ A;  3VMG D;  4HM0 A;  4EMJ B;  2DE7 D;  3L71 E;  3VMI D;  1O7M A;  3N0Q A;  4QDF A;  1ULI A;  2YFL A;  1SQQ E;  5AEU A;  2XSH A;  2BMO A;  4AAY B;  3AZC A;  3H1L E;  1EG9 A;  3CWB E;  2YIU C;  3L73 E;  3L70 E;  4QUQ A;  2E4Q A;  2HMJ A;  1VM9 A;  4QCK A;  3GTS A;  3VCP A;  3VCA A;  5AEW A;  3GOB A;  1VF5 D;  1L0N E;  3GL0 A;  4HM6 A;  4NBC D;  2QJK C;  3EQQ A;  4QDD A;  2ZYL A;  3EN1 A;  4PV1 D;  1BE3 E;  2BCC E;  2HMK A;  2NUK A;  2XR8 A;  2IBZ E;  4NBG D;  2YFJ A;  4NB9 D;  1JM1 A;  2DE6 D;  4QDF B;  2ZT9 D;  2HMO A;  1NTK E;  1P84 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...