1SQQE

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqqE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqqE02
3EQQA 2XSOA 2QJYC 1WQLA 3GTSA 5HL4A 1SQBE 2FYUE 1SQXE 1G8KB 4QDCA 2QPZA 4AAYB 2YIUC 4NB9D 4HM5A 5CXMA 3D89A 3N0QA 4P1BH 2NWFA 2YFLA 2DE6D 1EG9A 1ZRTE 4QURA 4PV1D 4QDFA 1NYKA 2BMOA 4NBHD 1FQTA 2NUMA 3H1IE 3DQYA 2D2CD 1L0NE 2FYNC 1NU1E 4QDFB 1L0LE 4NBCD 4QUQA 4HM1A 5BOKA 2DE5D 3TGUE 1O7MA 2HMMA 2NVEA 3CXHE 2JZAA 2BCCE 4D6TE 1O7GA 2XRXA 1VCKA 2YVJB 1VM9A 2BMRA 2HMKA 1G8JB 2GBWA 1O7HA 2QJPC 3VMGD 4EMJB 1UUVA 3CX5E 1Q90C 3H1LE 2XSHA 5KKZC 1O7WA 4H44D 3CWBE 1P84E 1O7PA 2HMLA 1PP9E 2HMNA 1KB9E 2E74D 2E4QA 2NVFA 3GOBA 1SJGA 3L73E 3L70E 2ZYLA 3L74E 3VCPA 2E76D 4P1CH 4HM2A 2E75D 2ZT9D 3H1JE 1VF5D 2A06E 1SQVE 3L75E 4NBAD 3H1KE 4HM6A 4NBED 5AEUA 3VCAA 1ULIA 4OGQD 1O7NA 4HM0A 3H1HE 1NTKE 2IBZE 2B1XA 2E4PA 2NVGA 2QJKC 1BCCE 1NTZE 1JM1A 3FOUA 3GCEA 2YFJA 4HM3A 3GL0A 4NBBD 1NTME 3GKEA 4HJLA 2Q3WA 5KLVE 2B24A 1SQQE 4HM8A 4NBGD 1BGYE 3C0DA 3GTEA 2BMQA 1NDOA 4HM7A 1PPJE 2DE7D 2YFIA 4H0LD 1ULJA 3GZXA 3VMHD 2JO6A 3BCCE 4HKVA 2GBXA 2I7FA 3GZYA 4HM4A 1EZVE 2CKFA 3L71E 2HMOA 1BE3E 4NBFD 4QDDA 4PD4E 5AEWA 3EN1A 4QUPA 4H13D 4NBDD 3GL2A 4AIVA 3L72E 1RIEA 4NB8D 1SQPE 4U3FE 2HMJA 1KYOE 1UUWA 4QCKA 2NUKA 1RFSA 3AZCA 3VMID 2XR8A 3GB4A 5KLIC
chains in the Genus database with same CATH superfamily
2QJYC 2R44A 1ZRTD 3CWBG 4P1BH 3E7KA 2NWFA 2ZXXA 4QURA 1NOHA 1VQ9P 4PV1D 3HD7C 3CCEP 2P7JA 1SQBK 1DX7A 1NYHA 2ZXEB 4JPZB 2ZT9B 3TGUE 2E76B 3L70J 3JCUE 2NVEA 4EI2A 1O7HA 2H43A 3UIAA 3CX5E 2XV5A 4I1LA 1HTLC 1KILA 1DD4A 2WSCJ 1A02F 3L70E 1X22A 2YXRB 1RE4A 3CCVP 4PD4H 4EIJA 1SQVG 2D2CB 4NBED 2OGUA 1LT9A 5AW2B 1MV8A 4GKGA 3AE7C 3L36A 5BVZA 5GTHE 1JY3N 3V2QA 5KLVE 4HKZH 4UB6H 2BMQA 5CHXA 3VMHD 1PGJA 3USSA 3LW5H 2IYPA 4L75A 1FZAA 3WU2H 1NTKJ 1GK4A 1OZHA 3HE4A 3PHLA 5AEWA 1KQSO 4H13D 3GW6A 3AECC 3FXEA 3GG2A 3VOPA 2RMZA 1VQOP 1KYOE 3V5BA 3OW2O 3ZDMA 1OW6A 1DH3A 2QPZA 3H32B 3L73D 4I6MC 1ZLLA 4OGQB 2YFLA 3AE1C 3TGUJ 5AVVB 1CW5A 3MIWA 2W6AA 1L0LE 2G3AA 3ITKA 2YMYA 2ZJSE 1MKMA 1RE4C 2YO3A 2AXCA 1LJ2A 3SWKA 2P67A 3T97A 1KILC 4HJGH 3OJAB 1LT9B 3JSVC 4P1CH 1KTMA 2A06E 3L75E 3HUSB 1KC8Q 5CCHC 1EXIA 4OGQD 2KI7B 4N78E 1ZN5A 3FOUA 3P8MC 5GTIE 1YITP 1Q81Q 3CCMP 1MFTA 2WITA 1FE6A 2C0XA 2OTJP 2N9YB 3CX5H 3A0HE 1N2DC 2QJKB 1JOCA 2KSJA 3I55P 4IOIH 2CPSA 2QJYB 3WMM0 4PV1C 1L4AB 2GA1A 5CJ4A 2FXMA 2N1TB 4EDFA 3RL0B 5CBNA 5APVA 4NB9D 3VMYA 4W7ZA 1N86A 1ZRTE 1NVOA 2FYUD 3TNUB 1OX3A 3H1IE 2W83C 1SQXK 3KPEA 2WVRA 3R4YA 3S9OA 3A0BE 2A45I 3C9IA 2JZAA 2E43A 3V2PA 3L73J 5AW1B 3P7KA 2KK7A 3V2NA 2KLVA 1SQBJ 1AVOA 5AW4B 2Q9IA 3FX0A 5CCHD 2A06G 2MJZA 2Q3EA 2KZIA 1SQBG 4RO0A 1LWUA 1N7SD 3H1KD 3CXHI 1FJKA 1VQKP 3C8VA 4NBBD 5CCGD 1VQ8P 1K04A 1KFNA 2WT7A 1IZNB 3HE4B 1FZEA 4M3LA 1FOSF 4DT0A 1PPJD 1OFCX 1SQVK 1ZR4A 1FDOA 2OTLP 1LP1B 3HE5A 4HYTB 3F5HA 1USEA 3N7NA 1IFNA 2M3EA 3SSUA 2L91A 1SQPE 1RHZB 1YTZI 1N7SC 1UUWA 3AEFC 3GHGA 5KTBA 2Y0EA 3IAOA 3L74G 1GDTA 2B89A 2SPZA 3H1KG 1QGKB 3D89A 3N0QA 3TK1A 2IX7C 3KZIE 4N3YB 1QLED 3H1KJ 2A45H 3L72D 2FYNC 4Z1MH 3RBZA 1PIXA 3CPWO 3JC22 1NKNA 3HD7B 4H13B 5KKZB 4AYCA 2J5UA 3G6EP 3BATA 4JQ0D 3PLNA 1FZCA 2E4QA 3H1HD 2K9JB 2ZYLA 4W7YA 1SQPJ 1GL2B 1VF5D 3H6PA 3M0DC 4ZMDA 3AE9C 4TT3H 5B66E 1JY3P 4RKUJ 2OYIB 2QJKC 2HODA 4H44C 3AE4C 3KXDA 4GODA 4C7NB 1EDKA 4A7PA 1Q86Q 1G2CB 2FYUJ 2ZFCA 1VQ6P 4L76A 4Y99B 2OYOA 4PV1B 1PPJG 1YBKA 1AA0A 1EZVE 3L71J 2M5AB 3CMEP 1BDCA 2QRXA 3RL0C 1IFDA 4NB8D 1IFJA 1GZLA 3MP7B 2QSIA 1URQC 1FAVA 3BCCJ 1M1KQ 1NJIQ 4GDOA 3KDPB 1OXZA 2N1TC 1S5LH 3A2AA 4U3FD 2O1KA 3M0DA 5EFWB 1U7MA 4PD4I 1KORA 1LGHB 3L4FA 4H44B 3II6A 4U3FJ 1NYKA 2BMOA 4NBHD 1L2PA 1NU1J 4HM1A 3OA7A 2R3CA 4YTPC 4YPCA 4I7ZC 3TGUG 4AUWA 4RJTA 1XTCC 3A0HH 2YKPA 4R4MA 2JDIH 1KB9E 1OWAA 2HPCA 4BRYB 3V2RA 1PV3A 5DJUB 1LT9C 3GHGB 3VCAA 3Q3DA 5AVXB 1GU4A 4BRYA 1R8EA 5AVWB 1SQVJ 2LXCB 5AW9B 2O01J 1LWUC 2BCCG 3M0AA 3EFGA 2B24A 4HM7A 1G2CA 4H0LD 3GZXA 2IZ1A 5TISE 4N6JA 3G9RA 3RK2B 2BCCJ 1IK9A 1SFCC 1HWTC 4NBFD 5BU5A 2O1JA 4QUPA 2Z5IA 2FXOA 1OIPA 2KS1A 3H1JJ 3L72E 1SP4A 2IZ0A 2Q1KA 1N73A 1GL2A 4QCKA 2NUKA 2FYZA 1AJYA 1M1JA 1T8ZA 2XSOA 3GTSA 1NU1K 1CZQA 1BCCD 1NTKD 4AAYB 1UIIA 2QE7H 3TSIA 3SFEC 3AE8C 3H1ID 3HTKB 1MUUA 5AVRB 3BASA 4YXDC 4AQRD 1NTZJ 1FBMA 1O7MA 4XA4A 2KYVA 1KD1Q 1NTMG 1KQLA 5C39A 3VMGD 1H0TA 2MKVA 3PH0A 3AE2C 3D71A 2HMNA 2POHA 1T3UA 3AE6C 1NTMJ 2E76D 3L73G 4OGQC 2L5GB 3H1KE 1IFMA 2B9BA 3AEGC 3M9HA 1NTKE 4IL6X 1KILB 3CLQA 2BEQD 1LP1A 4BWNA 2JJLA 3RL0D 4HM3A 3RK3C 1NTKK 5AVSB 2XNDH 3HD7D 3CCQP 3IFMA 1SQQE 1KZUB 2KP8A 1GU5A 1PPJE 1VQLP 1NGMB 1CI6A 1PL5A 3HD7A 2WSEH 1BE3E 3Q5SA 2R3SA 5B5EE 4OH8B 5APWA 1IO4A 1SQBD 2N9BA 3WU2E 3AEEC 5CJ0A 3L75D 3M9BA 1OW8A 2M8RA 4HM5A 3T97B 3W68A 2O01N 3RK3B 1VQNP 4D6TD 5KAFH 4DOJA 3H1LD 3H1LG 1Q2NA 1X0TA 3CXHH 3NXSA 1SQQG 2A45G 3CXHE 1PZQA 1O7GA 1VM9A 4I7ZB 1WT6A 2XU6A 5KKZC 2XKMA 1HGZA 4ZKPA 1SQQJ 4O9BA 5DJTB 1KB9D 2KNCA 3CC2P 1LWUB 2FFDC 3G3ZA 2YKQA 5B66H 1ULIA 4HM0A 1KN7A 1VL2A 5KLIB 1LNQA 2E4PA 2K3RA 1KFMA 2NPSD 3GCEA 3VMZA 2V7QJ 2WTYA 2GM4A 4JF7A 1KYOH 2E5TA 2YKOA 1S9KE 3IN6A 1ULJA 1XTGB 1Y9BA 4XFJA 2HMOA 1JY2N 1JEKA 2FYUG 3FWNA 4KT0J 1NH4A 2LR2A 3KZIH 1N7SA 5E79E 2J59M 1PP9J 2KXPB 1RFSA 1A02J 3R2PA 2RN0A 1E5WA 1YTZT 3RL0g 3D6ZA 1RE3A 2M3BA 3L75J 1BE3D 1JCCA 2JWDA 2PFXA 1HUCA 1JTHA 2D2CD 1L0NE 3L37A 2HR3A 5BOKA 2DE5D 2E75B 1EDLA 1RF0C 2BCCE 5KLVG 2ZYDA 1ZMEC 2KUBA 2XSHA 1NU1G 1LTTC 1IC2A 2WZ7A 2FYNB 2NVFA 3L73E 2AEJA 4U7JA 2C0WA 2ZT9D 2K1AA 2BEZF 2KNCB 1MZ9A 2AEFA 2GUSA 1WRGA 4GOEA 2YNYA 5AVYB 3HUSA 1NTZE 1CSBA 1SFCA 2PAJA 1KYOI 4WB4A 1NTMK 1S5LE 1U57A 3GKEA 3L35A 3SFDC 4DCKA 2E42A 4UB8H 4IFDK 2I7FA 3GZYA 2QJPB 5TISH 2OQQA 1HJBA 4PD4E 1P84D 3RK2C 3GMAA 4BXLA 1URQA 1KQGB 4XE5B 1NTKG 1FDMA 3CXHD 2E5YA 1VQ7P 2OTKE 1L4AA 5AW3B 1M1JB 4GIFA 1SQXE 2K9JA 2FBWC 4Y99C 5AVQB 4KJMA 1FZCB 1L0LD 1TU3F 3KQGA 4W80A 4OWFA 5KJ7C 1CI6B 2OYHA 3DQYA 5GTIH 3VP8A 4QUQA 1SQPK 1T6AA 2YXQB 2P58A 1W2BO 1EZVD 2IBZG 1ZOYC 3S4RA 2QJPC 1WMKA 2J58A 4H0LC 4KHXA 1RE3C 2P2UA 2WPQA 1KMIZ 4QMAA 5APQA 1YJ9P 2W27A 4NPEA 5CBOA 1KYOD 4WVZA 5CMZA 1HH0A 1LTBC 3TDKA 4HM6A 2D2CC 3CCRP 3I5CA 1RQUA 3V6IA 1J1DB 1RF0A 1N7SB 2I8DA 3A3YB 1SQQK 2Y9YA 5M1BA 4EOTA 4ASVA 2NRGA 1KILE 2R5BA 2Q3WA 1FU1A 1BGYE 3GTEA 1FZGA 1PP9D 2N1TD 2AXTH 3O6QB 1EZVG 3B5NB 3A5TA 2JEEA 1ZR2A 3EWKA 2OYHB 1USDA 3GHGC 2H89C 4AIVA 2HMJA 1GL2C 3CC7P 2HG5D 2QG4A 2Z4EA 3VMID 1PFIA 3H1JG 4K35A 3H1HG 1LTJC 1G8KB 3B8EB 2YIUC 4IL6E 2FYUK 3KYQA 4WY4A 2ZYAA 1EG9A 4PD4D 1SQQD 4QDFA 5KAFE 1OVUA 3QWOC 2NUMA 1HGVA 1NTZD 2WWWA 1DEBA 1VCKA 2BMRA 3L71D 4RESB 2E74C 1IK7A 3Q1MA 2R32A 3H1LJ 3RK3D 3CWBE 3M9QA 3PP5A 3MHVA 4GOFA 1K9MQ 1KV4A 4LC1A 1YJNP 2WMMA 1BSNA 1URQD 2NVGA 1Q82Q 1BCCE 3VTPC 3PTZA 5KLVK 2FFDB 2KOGA 3GL0A 2AEMA 1IFPA 2IFMA 1GK6A 3MUDA 4I2LC 3MGNA 2K9YA 1VQ4P 3TYYA 1EDIA 3H1IG 1YQ4C 3MTUE 5KLVD 4PJ0H 2ITAA 3KHUA 2IFNA 1BGYD 2YIUB 2JKVA 1Q7YQ 3BVHA 2KSEA 4NBDD 3GL2A 1NWQA 2I1KA 2WPSA 2WSFJ 1L0LK 3VYIA 2Q5UA 1OW7A 1GMJA 1E79H 2QIWA 1J1EB 3N4XA 3NFQA 1DIPA 1FZBA 1Z56A 1SQBE 1EQ7A 1YJWP 1PP9G 4HH2A 2NPSB 2WQYC 1RF1C 3G4SP 5APYA 1L0NJ 2W8ZA 1M57D 1FZFA 3RGUA 4WY4D 1VQ5P 2ZVOB 2Q7CA 5KAIE 3H1LE 2HYNA 5BU8B 1N8RQ 2WT7B 1Y47A 1K8AQ 1G1JA 3U1AA 5KJ7D 5CCGA 2R5DA 1YYCA 3RK3E 3WUVA 1FDIA 5L8RJ 1OVRA 1K05A 1SQPG 1FC2C 2W6BA 2ZT9C 3IR9A 2XZRA 4MN4C 4DJGA 2GUVA 5KJ7A 1VF5B 1GL2D 1NHLA 3PRJA 4HM8A 1LTGC 3Q2YA 3BRTB 4EYYQ 1NAFA 2XDJA 1JTHB 1GTWA 1L4AD 4HKVA 1BE3G 1GW4A 2BCCD 2FFDA 5APUA 1ZV8A 1GW3A 2QM7A 2IPPA 3TNUA 1DD3A 3E1RA 2NPSA 1BE3J 4U3FE 3W67A 1YQ3C 3PJSK 1SQVD 3H25A 5APSA 3GB4A 1L0NK 1S2EA 1M8OB 1QL1A 3CCUP 3NTNA 2CPBA 2DE6D 3K5BA 3MZWB 2P10A 1OMIA 2WSEJ 1LTJA 3CL3D 1MFZA 4QDFB 1IJDB 4H13C 1AQTA 3MD0A 3I56P 4IFMA 2W6JH 3FXDA 2B88A 2GBWA 4HB1A 4EMJB 2E74B 1S72P 2IYOA 5AW8B 5AVZB 4H44D 1H8AA 2KZJA 3NMDA 3CCJP 3RBXA 3CCLP 1SVFA 3P32A 4NBAD 2FXPA 4L74A 5AEUA 1LTSC 2KS1B 1SQXD 3P8CD 5K5GB 1KILD 1JY3O 1PGOA 2YFJA 2E75C 5GTHH 3ABVC 2G8YA 2M5AA 3SWYA 2YO2A 4NBGD 4TLFA 5KAIH 2XNXA 2Y0DA 2GBXA 2CKFA 1VQPP 1ZW0A 2WPVB 2K88A 3HUSC 4C7NA 3A0BH 3AEBC 3B5NC 3HTKA 5CCHA 1M90Q 1VDFA 3QH9A 4WY4B 1T2KC 3BRVB 1EDJA 2QM8A 2V7QH 5KLIC 1VQMP 1S4XA 2FKWB 4ZNCA 1QVFO 4QDCA 4JYCA 1BGYJ 5AVTB 3B71A 1JNMA 1RY3A 3M06A 3L70G 3H1HJ 3M91A 1DEEG 1BGYG 1L0LG 5AW7B 3JCUH 1FZCC 1P84I 2Z5HA 2HLOA 1G8JB 3FWLA 2M0BA 1NO4A 2H88C 1QVGO 1L0LJ 4LGDE 2AXTE 1NTZG 1M1JC 2W90A 5H2FH 4UB6E 3H1JE 3L72J 4OVNF 1JCDA 1VF5C 1OVVA 3OAKA 3VN0A 2WSFH 3AE3C 5TJHA 2IBZE 4GT1A 1UIXA 5CCGC 3GF7A 1NTMD 1H89A 2BASA 3L72G 2HPCB 3AEDC 2YMKA 2IBZI 3CX5I 3E1IA 1FOSE 1AVYA 3L71G 3C0DA 2QVAA 2P1JA 1J1DC 2DE7D 1JB0J 1NU1D 3U1CA 3BCCE 1KB9H 4C46A 1SQXJ 1SFCB 2Y0CA 3L71E 3F89A 5AW0B 1J2JB 3B5ND 3H32A 3H1IJ 1H88A 5AW5B 2H8PD 2PP6A 2O3JA 2NZ2A 3A7OA 2A06D 3Q5PA 1N73B 3EQQA 1QEXA 4IFFA 3GF3A 1S9KD 4JYBA 4U3FG 1PGQA 1VPCA 1EZVI 3HRNA 3O8ZA 1J1EC 4WWIA 1EC5A 3B5NA 1LTJB 1NU1E 2ZAEB 3CWBD 1W2EA 1G1IA 1FJPA 3L74D 2YVJB 1R5SA 4NPFX 3TGUD 1UUVA 5E79H 3G71P 1L0NG 1R5LA 1O7WA 1N7LA 2E76C 2VRSA 5APTA 2V4HA 3CC4P 3CX5D 1SJGA 4N78D 1EXJA 1KQFB 3D70A 1ZXGA 4HM2A 2RH0A 1X9VA 2OYIA 2HFED 1U7JA 1BSHA 1FS0E 3C1LA 1L4AC 3LIDA 3P8CE 1HF9A 1HBWA 1JMMA 2IBZD 1KB9I 2QA4P 1JY2P 1NDOA 1JUNA 4C7RA 2C9NY 1D7MA 2IDBA 3V4WA 4LLHA 3SWFA 2C9LY 3EN1A 4K3AA 3RK2D 1YI2P 4WBAA 4Y28J 2UWJE 3D6YA 2LKMA 3EFFK 4CPGA 2B87A 1YIJP 5HL4A 2FYUE 2OARA 3BCCD 1L0ND 2OYIC 1QX8A 1AQ5A 4D6TG 1FQTA 2KIKA 3CI9A 3U59A 1T3JA 3LW5J 1S3JA 3HE5B 1X79B 4IL6H 4NBCD 1AV1A 1RQVA 2RKLA 2WPRA 4D6TJ 1W5CE 2HODB 4DZOA 3WUTA 1NAYA 2B87B 1Q90D 1O7PA 2ZYGA 1LTIC 3GOBA 2N1TA 1GD2E 3L74E 5KLVJ 1YHQP 2E75D 1LT1A 2NPSC 1M7LA 3H1JD 3VP9A 3FGAD 2I1JA 1PGPA 2KLUA 2Y9ZA 1NTME 4HJLA 3AE5C 4L73A 5B5EH 1NTZK 2PRRA 1K73Q 1HJ0A 4HM4A 1Y8AA 3S1KA 2JO1A 1SLQA 1RIEA 3AEAC 1AFOA 4R4LA 1JM0A 4YXWH 3GLMA 3AZCA 2XR8A 1S5LX 4WY4C 1N73C 1WQLA 4H0LB 5CXMA 3V4QA 1NKZB 1X8YA 2DW3A 2ZVNB 3EQ2A 2LXBA 5H2FE 3VMAA 2H7HA 2Q6QA 2JP3A 3IF4A 4B86A 3CCSP 2HMMA 3L70D 1BCCG 4D6TE 1HVVA 2XRXA 3MUDC 2HMKA 4ASWA 1Q90C 2PGDA 2WSCH 2Q3IA 1P84E 2FY8A 2HMLA 1PP9E 2E74D 3B4SA 5AW6B 4PJ0E 2O01H 3WUUA 1IFIA 1BCCJ 3LIEA 3VCPA 2WSSH 1JMBA 1SQVE 1S1CX 1ZP0C 3TF5A 5AVUB 1SFCD 1O7NA 3H1HE 2KB7P 1RH5B 2B1XA 1QL2A 1URQB 1JM1A 2OYHC 4JBZA 3O6QA 1JY2O 1JO5A 4ZKUA 1LTAC 2JWAA 1T2KD 1RF1A 1H0TB 2JR8A 2YFIA 5APXA 2JO6A 3CD6P 3CMAP 1BDDA 3BCCG 4NPDA 1RF1B 4QDDA 2K37A 3Q5RA 2CK3H 3VMXA 2QEXP 4UB8E 1SQXG 1M56D 3L74J 1SQPD 1P84H 3CWBJ 1SS1A 3L75G
chains in the Genus database with same CATH topology
3EQQA 2XSOA 2QJYC 1WQLA 3GTSA 5HL4A 1SQBE 2FYUE 1SQXE 1G8KB 4QDCA 2QPZA 4AAYB 2YIUC 4NB9D 4HM5A 5CXMA 3D89A 3N0QA 4P1BH 2NWFA 2YFLA 2DE6D 1EG9A 1ZRTE 4QURA 4PV1D 4QDFA 1NYKA 2BMOA 4NBHD 1FQTA 2NUMA 3H1IE 3DQYA 2D2CD 1L0NE 2FYNC 1NU1E 4QDFB 1L0LE 4NBCD 4QUQA 4HM1A 5BOKA 2DE5D 3TGUE 1O7MA 2HMMA 2NVEA 3CXHE 2JZAA 2BCCE 4D6TE 1O7GA 2XRXA 1VCKA 2YVJB 1VM9A 2BMRA 2HMKA 1G8JB 2GBWA 1O7HA 2QJPC 3VMGD 4EMJB 1UUVA 3CX5E 1Q90C 3H1LE 2XSHA 5KKZC 1O7WA 4H44D 3CWBE 1P84E 1O7PA 2HMLA 1PP9E 2HMNA 1KB9E 2E74D 2E4QA 2NVFA 3GOBA 1SJGA 3L73E 3L70E 2ZYLA 3L74E 3VCPA 2E76D 4P1CH 4HM2A 2E75D 2ZT9D 3H1JE 1VF5D 2A06E 1SQVE 3L75E 4NBAD 3H1KE 4HM6A 4NBED 5AEUA 3VCAA 1ULIA 4OGQD 1O7NA 4HM0A 3H1HE 1NTKE 2IBZE 2B1XA 2E4PA 2NVGA 2QJKC 1BCCE 1NTZE 1JM1A 3FOUA 3GCEA 2YFJA 4HM3A 3GL0A 4NBBD 1NTME 3GKEA 4HJLA 2Q3WA 5KLVE 2B24A 1SQQE 4HM8A 4NBGD 1BGYE 3C0DA 3GTEA 2BMQA 1NDOA 4HM7A 1PPJE 2DE7D 2YFIA 4H0LD 1ULJA 3GZXA 3VMHD 2JO6A 3BCCE 4HKVA 2GBXA 2I7FA 3GZYA 4HM4A 1EZVE 2CKFA 3L71E 2HMOA 1BE3E 4NBFD 4QDDA 4PD4E 5AEWA 3EN1A 4QUPA 4H13D 4NBDD 3GL2A 4AIVA 3L72E 1RIEA 4NB8D 1SQPE 4U3FE 2HMJA 1KYOE 1UUWA 4QCKA 2NUKA 1RFSA 3AZCA 3VMID 2XR8A 3GB4A 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQQ A;  2XSO A;  2QJY C;  1WQL A;  3GTS A;  5HL4 A;  1SQB E;  2FYU E;  1SQX E;  1G8K B;  4QDC A;  2QPZ A;  4AAY B;  2YIU C;  4NB9 D;  4HM5 A;  5CXM A;  3D89 A;  3N0Q A;  4P1B H;  2NWF A;  2YFL A;  2DE6 D;  1EG9 A;  1ZRT E;  4QUR A;  4PV1 D;  4QDF A;  1NYK A;  2BMO A;  4NBH D;  1FQT A;  2NUM A;  3H1I E;  3DQY A;  2D2C D;  1L0N E;  2FYN C;  1NU1 E;  4QDF B;  1L0L E;  4NBC D;  4QUQ A;  4HM1 A;  5BOK A;  2DE5 D;  3TGU E;  1O7M A;  2HMM A;  2NVE A;  3CXH E;  2JZA A;  2BCC E;  4D6T E;  1O7G A;  2XRX A;  1VCK A;  2YVJ B;  1VM9 A;  2BMR A;  2HMK A;  1G8J B;  2GBW A;  1O7H A;  2QJP C;  3VMG D;  4EMJ B;  1UUV A;  3CX5 E;  1Q90 C;  3H1L E;  2XSH A;  5KKZ C;  1O7W A;  4H44 D;  3CWB E;  1P84 E;  1O7P A;  2HML A;  1PP9 E;  2HMN A;  1KB9 E;  2E74 D;  2E4Q A;  2NVF A;  3GOB A;  1SJG A;  3L73 E;  3L70 E;  2ZYL A;  3L74 E;  3VCP A;  2E76 D;  4P1C H;  4HM2 A;  2E75 D;  2ZT9 D;  3H1J E;  1VF5 D;  2A06 E;  1SQV E;  3L75 E;  4NBA D;  3H1K E;  4HM6 A;  4NBE D;  5AEU A;  3VCA A;  1ULI A;  4OGQ D;  1O7N A;  4HM0 A;  3H1H E;  1NTK E;  2IBZ E;  2B1X A;  2E4P A;  2NVG A;  2QJK C;  1BCC E;  1NTZ E;  1JM1 A;  3FOU A;  3GCE A;  2YFJ A;  4HM3 A;  3GL0 A;  4NBB D;  1NTM E;  3GKE A;  4HJL A;  2Q3W A;  5KLV E;  2B24 A;  1SQQ E;  4HM8 A;  4NBG D;  1BGY E;  3C0D A;  3GTE A;  2BMQ A;  1NDO A;  4HM7 A;  1PPJ E;  2DE7 D;  2YFI A;  4H0L D;  1ULJ A;  3GZX A;  3VMH D;  2JO6 A;  3BCC E;  4HKV A;  2GBX A;  2I7F A;  3GZY A;  4HM4 A;  1EZV E;  2CKF A;  3L71 E;  2HMO A;  1BE3 E;  4NBF D;  4QDD A;  4PD4 E;  5AEW A;  3EN1 A;  4QUP A;  4H13 D;  4NBD D;  3GL2 A;  4AIV A;  3L72 E;  1RIE A;  4NB8 D;  1SQP E;  4U3F E;  2HMJ A;  1KYO E;  1UUW A;  4QCK A;  2NUK A;  1RFS A;  3AZC A;  3VMI D;  2XR8 A;  3GB4 A;  5KLI C; 
#chains in the Genus database with same CATH topology
 2QJY C;  2R44 A;  1ZRT D;  3CWB G;  4P1B H;  3E7K A;  2NWF A;  2ZXX A;  4QUR A;  1NOH A;  1VQ9 P;  4PV1 D;  3HD7 C;  3CCE P;  2P7J A;  1SQB K;  1DX7 A;  1NYH A;  2ZXE B;  4JPZ B;  2ZT9 B;  3TGU E;  2E76 B;  3L70 J;  3JCU E;  2NVE A;  4EI2 A;  1O7H A;  2H43 A;  3UIA A;  3CX5 E;  2XV5 A;  4I1L A;  1HTL C;  1KIL A;  1DD4 A;  2WSC J;  1A02 F;  3L70 E;  1X22 A;  2YXR B;  1RE4 A;  3CCV P;  4PD4 H;  4EIJ A;  1SQV G;  2D2C B;  4NBE D;  2OGU A;  1LT9 A;  5AW2 B;  1MV8 A;  4GKG A;  3AE7 C;  3L36 A;  5BVZ A;  5GTH E;  1JY3 N;  3V2Q A;  5KLV E;  4HKZ H;  4UB6 H;  2BMQ A;  5CHX A;  3VMH D;  1PGJ A;  3USS A;  3LW5 H;  2IYP A;  4L75 A;  1FZA A;  3WU2 H;  1NTK J;  1GK4 A;  1OZH A;  3HE4 A;  3PHL A;  5AEW A;  1KQS O;  4H13 D;  3GW6 A;  3AEC C;  3FXE A;  3GG2 A;  3VOP A;  2RMZ A;  1VQO P;  1KYO E;  3V5B A;  3OW2 O;  3ZDM A;  1OW6 A;  1DH3 A;  2QPZ A;  3H32 B;  3L73 D;  4I6M C;  1ZLL A;  4OGQ B;  2YFL A;  3AE1 C;  3TGU J;  5AVV B;  1CW5 A;  3MIW A;  2W6A A;  1L0L E;  2G3A A;  3ITK A;  2YMY A;  2ZJS E;  1MKM A;  1RE4 C;  2YO3 A;  2AXC A;  1LJ2 A;  3SWK A;  2P67 A;  3T97 A;  1KIL C;  4HJG H;  3OJA B;  1LT9 B;  3JSV C;  4P1C H;  1KTM A;  2A06 E;  3L75 E;  3HUS B;  1KC8 Q;  5CCH C;  1EXI A;  4OGQ D;  2KI7 B;  4N78 E;  1ZN5 A;  3FOU A;  3P8M C;  5GTI E;  1YIT P;  1Q81 Q;  3CCM P;  1MFT A;  2WIT A;  1FE6 A;  2C0X A;  2OTJ P;  2N9Y B;  3CX5 H;  3A0H E;  1N2D C;  2QJK B;  1JOC A;  2KSJ A;  3I55 P;  4IOI H;  2CPS A;  2QJY B;  3WMM 0;  4PV1 C;  1L4A B;  2GA1 A;  5CJ4 A;  2FXM A;  2N1T B;  4EDF A;  3RL0 B;  5CBN A;  5APV A;  4NB9 D;  3VMY A;  4W7Z A;  1N86 A;  1ZRT E;  1NVO A;  2FYU D;  3TNU B;  1OX3 A;  3H1I E;  2W83 C;  1SQX K;  3KPE A;  2WVR A;  3R4Y A;  3S9O A;  3A0B E;  2A45 I;  3C9I A;  2JZA A;  2E43 A;  3V2P A;  3L73 J;  5AW1 B;  3P7K A;  2KK7 A;  3V2N A;  2KLV A;  1SQB J;  1AVO A;  5AW4 B;  2Q9I A;  3FX0 A;  5CCH D;  2A06 G;  2MJZ A;  2Q3E A;  2KZI A;  1SQB G;  4RO0 A;  1LWU A;  1N7S D;  3H1K D;  3CXH I;  1FJK A;  1VQK P;  3C8V A;  4NBB D;  5CCG D;  1VQ8 P;  1K04 A;  1KFN A;  2WT7 A;  1IZN B;  3HE4 B;  1FZE A;  4M3L A;  1FOS F;  4DT0 A;  1PPJ D;  1OFC X;  1SQV K;  1ZR4 A;  1FDO A;  2OTL P;  1LP1 B;  3HE5 A;  4HYT B;  3F5H A;  1USE A;  3N7N A;  1IFN A;  2M3E A;  3SSU A;  2L91 A;  1SQP E;  1RHZ B;  1YTZ I;  1N7S C;  1UUW A;  3AEF C;  3GHG A;  5KTB A;  2Y0E A;  3IAO A;  3L74 G;  1GDT A;  2B89 A;  2SPZ A;  3H1K G;  1QGK B;  3D89 A;  3N0Q A;  3TK1 A;  2IX7 C;  3KZI E;  4N3Y B;  1QLE D;  3H1K J;  2A45 H;  3L72 D;  2FYN C;  4Z1M H;  3RBZ A;  1PIX A;  3CPW O;  3JC2 2;  1NKN A;  3HD7 B;  4H13 B;  5KKZ B;  4AYC A;  2J5U A;  3G6E P;  3BAT A;  4JQ0 D;  3PLN A;  1FZC A;  2E4Q A;  3H1H D;  2K9J B;  2ZYL A;  4W7Y A;  1SQP J;  1GL2 B;  1VF5 D;  3H6P A;  3M0D C;  4ZMD A;  3AE9 C;  4TT3 H;  5B66 E;  1JY3 P;  4RKU J;  2OYI B;  2QJK C;  2HOD A;  4H44 C;  3AE4 C;  3KXD A;  4GOD A;  4C7N B;  1EDK A;  4A7P A;  1Q86 Q;  1G2C B;  2FYU J;  2ZFC A;  1VQ6 P;  4L76 A;  4Y99 B;  2OYO A;  4PV1 B;  1PPJ G;  1YBK A;  1AA0 A;  1EZV E;  3L71 J;  2M5A B;  3CME P;  1BDC A;  2QRX A;  3RL0 C;  1IFD A;  4NB8 D;  1IFJ A;  1GZL A;  3MP7 B;  2QSI A;  1URQ C;  1FAV A;  3BCC J;  1M1K Q;  1NJI Q;  4GDO A;  3KDP B;  1OXZ A;  2N1T C;  1S5L H;  3A2A A;  4U3F D;  2O1K A;  3M0D A;  5EFW B;  1U7M A;  4PD4 I;  1KOR A;  1LGH B;  3L4F A;  4H44 B;  3II6 A;  4U3F J;  1NYK A;  2BMO A;  4NBH D;  1L2P A;  1NU1 J;  4HM1 A;  3OA7 A;  2R3C A;  4YTP C;  4YPC A;  4I7Z C;  3TGU G;  4AUW A;  4RJT A;  1XTC C;  3A0H H;  2YKP A;  4R4M A;  2JDI H;  1KB9 E;  1OWA A;  2HPC A;  4BRY B;  3V2R A;  1PV3 A;  5DJU B;  1LT9 C;  3GHG B;  3VCA A;  3Q3D A;  5AVX B;  1GU4 A;  4BRY A;  1R8E A;  5AVW B;  1SQV J;  2LXC B;  5AW9 B;  2O01 J;  1LWU C;  2BCC G;  3M0A A;  3EFG A;  2B24 A;  4HM7 A;  1G2C A;  4H0L D;  3GZX A;  2IZ1 A;  5TIS E;  4N6J A;  3G9R A;  3RK2 B;  2BCC J;  1IK9 A;  1SFC C;  1HWT C;  4NBF D;  5BU5 A;  2O1J A;  4QUP A;  2Z5I A;  2FXO A;  1OIP A;  2KS1 A;  3H1J J;  3L72 E;  1SP4 A;  2IZ0 A;  2Q1K A;  1N73 A;  1GL2 A;  4QCK A;  2NUK A;  2FYZ A;  1AJY A;  1M1J A;  1T8Z A;  2XSO A;  3GTS A;  1NU1 K;  1CZQ A;  1BCC D;  1NTK D;  4AAY B;  1UII A;  2QE7 H;  3TSI A;  3SFE C;  3AE8 C;  3H1I D;  3HTK B;  1MUU A;  5AVR B;  3BAS A;  4YXD C;  4AQR D;  1NTZ J;  1FBM A;  1O7M A;  4XA4 A;  2KYV A;  1KD1 Q;  1NTM G;  1KQL A;  5C39 A;  3VMG D;  1H0T A;  2MKV A;  3PH0 A;  3AE2 C;  3D71 A;  2HMN A;  2POH A;  1T3U A;  3AE6 C;  1NTM J;  2E76 D;  3L73 G;  4OGQ C;  2L5G B;  3H1K E;  1IFM A;  2B9B A;  3AEG C;  3M9H A;  1NTK E;  4IL6 X;  1KIL B;  3CLQ A;  2BEQ D;  1LP1 A;  4BWN A;  2JJL A;  3RL0 D;  4HM3 A;  3RK3 C;  1NTK K;  5AVS B;  2XND H;  3HD7 D;  3CCQ P;  3IFM A;  1SQQ E;  1KZU B;  2KP8 A;  1GU5 A;  1PPJ E;  1VQL P;  1NGM B;  1CI6 A;  1PL5 A;  3HD7 A;  2WSE H;  1BE3 E;  3Q5S A;  2R3S A;  5B5E E;  4OH8 B;  5APW A;  1IO4 A;  1SQB D;  2N9B A;  3WU2 E;  3AEE C;  5CJ0 A;  3L75 D;  3M9B A;  1OW8 A;  2M8R A;  4HM5 A;  3T97 B;  3W68 A;  2O01 N;  3RK3 B;  1VQN P;  4D6T D;  5KAF H;  4DOJ A;  3H1L D;  3H1L G;  1Q2N A;  1X0T A;  3CXH H;  3NXS A;  1SQQ G;  2A45 G;  3CXH E;  1PZQ A;  1O7G A;  1VM9 A;  4I7Z B;  1WT6 A;  2XU6 A;  5KKZ C;  2XKM A;  1HGZ A;  4ZKP A;  1SQQ J;  4O9B A;  5DJT B;  1KB9 D;  2KNC A;  3CC2 P;  1LWU B;  2FFD C;  3G3Z A;  2YKQ A;  5B66 H;  1ULI A;  4HM0 A;  1KN7 A;  1VL2 A;  5KLI B;  1LNQ A;  2E4P A;  2K3R A;  1KFM A;  2NPS D;  3GCE A;  3VMZ A;  2V7Q J;  2WTY A;  2GM4 A;  4JF7 A;  1KYO H;  2E5T A;  2YKO A;  1S9K E;  3IN6 A;  1ULJ A;  1XTG B;  1Y9B A;  4XFJ A;  2HMO A;  1JY2 N;  1JEK A;  2FYU G;  3FWN A;  4KT0 J;  1NH4 A;  2LR2 A;  3KZI H;  1N7S A;  5E79 E;  2J59 M;  1PP9 J;  2KXP B;  1RFS A;  1A02 J;  3R2P A;  2RN0 A;  1E5W A;  1YTZ T;  3RL0 g;  3D6Z A;  1RE3 A;  2M3B A;  3L75 J;  1BE3 D;  1JCC A;  2JWD A;  2PFX A;  1HUC A;  1JTH A;  2D2C D;  1L0N E;  3L37 A;  2HR3 A;  5BOK A;  2DE5 D;  2E75 B;  1EDL A;  1RF0 C;  2BCC E;  5KLV G;  2ZYD A;  1ZME C;  2KUB A;  2XSH A;  1NU1 G;  1LTT C;  1IC2 A;  2WZ7 A;  2FYN B;  2NVF A;  3L73 E;  2AEJ A;  4U7J A;  2C0W A;  2ZT9 D;  2K1A A;  2BEZ F;  2KNC B;  1MZ9 A;  2AEF A;  2GUS A;  1WRG A;  4GOE A;  2YNY A;  5AVY B;  3HUS A;  1NTZ E;  1CSB A;  1SFC A;  2PAJ A;  1KYO I;  4WB4 A;  1NTM K;  1S5L E;  1U57 A;  3GKE A;  3L35 A;  3SFD C;  4DCK A;  2E42 A;  4UB8 H;  4IFD K;  2I7F A;  3GZY A;  2QJP B;  5TIS H;  2OQQ A;  1HJB A;  4PD4 E;  1P84 D;  3RK2 C;  3GMA A;  4BXL A;  1URQ A;  1KQG B;  4XE5 B;  1NTK G;  1FDM A;  3CXH D;  2E5Y A;  1VQ7 P;  2OTK E;  1L4A A;  5AW3 B;  1M1J B;  4GIF A;  1SQX E;  2K9J A;  2FBW C;  4Y99 C;  5AVQ B;  4KJM A;  1FZC B;  1L0L D;  1TU3 F;  3KQG A;  4W80 A;  4OWF A;  5KJ7 C;  1CI6 B;  2OYH A;  3DQY A;  5GTI H;  3VP8 A;  4QUQ A;  1SQP K;  1T6A A;  2YXQ B;  2P58 A;  1W2B O;  1EZV D;  2IBZ G;  1ZOY C;  3S4R A;  2QJP C;  1WMK A;  2J58 A;  4H0L C;  4KHX A;  1RE3 C;  2P2U A;  2WPQ A;  1KMI Z;  4QMA A;  5APQ A;  1YJ9 P;  2W27 A;  4NPE A;  5CBO A;  1KYO D;  4WVZ A;  5CMZ A;  1HH0 A;  1LTB C;  3TDK A;  4HM6 A;  2D2C C;  3CCR P;  3I5C A;  1RQU A;  3V6I A;  1J1D B;  1RF0 A;  1N7S B;  2I8D A;  3A3Y B;  1SQQ K;  2Y9Y A;  5M1B A;  4EOT A;  4ASV A;  2NRG A;  1KIL E;  2R5B A;  2Q3W A;  1FU1 A;  1BGY E;  3GTE A;  1FZG A;  1PP9 D;  2N1T D;  2AXT H;  3O6Q B;  1EZV G;  3B5N B;  3A5T A;  2JEE A;  1ZR2 A;  3EWK A;  2OYH B;  1USD A;  3GHG C;  2H89 C;  4AIV A;  2HMJ A;  1GL2 C;  3CC7 P;  2HG5 D;  2QG4 A;  2Z4E A;  3VMI D;  1PFI A;  3H1J G;  4K35 A;  3H1H G;  1LTJ C;  1G8K B;  3B8E B;  2YIU C;  4IL6 E;  2FYU K;  3KYQ A;  4WY4 A;  2ZYA A;  1EG9 A;  4PD4 D;  1SQQ D;  4QDF A;  5KAF E;  1OVU A;  3QWO C;  2NUM A;  1HGV A;  1NTZ D;  2WWW A;  1DEB A;  1VCK A;  2BMR A;  3L71 D;  4RES B;  2E74 C;  1IK7 A;  3Q1M A;  2R32 A;  3H1L J;  3RK3 D;  3CWB E;  3M9Q A;  3PP5 A;  3MHV A;  4GOF A;  1K9M Q;  1KV4 A;  4LC1 A;  1YJN P;  2WMM A;  1BSN A;  1URQ D;  2NVG A;  1Q82 Q;  1BCC E;  3VTP C;  3PTZ A;  5KLV K;  2FFD B;  2KOG A;  3GL0 A;  2AEM A;  1IFP A;  2IFM A;  1GK6 A;  3MUD A;  4I2L C;  3MGN A;  2K9Y A;  1VQ4 P;  3TYY A;  1EDI A;  3H1I G;  1YQ4 C;  3MTU E;  5KLV D;  4PJ0 H;  2ITA A;  3KHU A;  2IFN A;  1BGY D;  2YIU B;  2JKV A;  1Q7Y Q;  3BVH A;  2KSE A;  4NBD D;  3GL2 A;  1NWQ A;  2I1K A;  2WPS A;  2WSF J;  1L0L K;  3VYI A;  2Q5U A;  1OW7 A;  1GMJ A;  1E79 H;  2QIW A;  1J1E B;  3N4X A;  3NFQ A;  1DIP A;  1FZB A;  1Z56 A;  1SQB E;  1EQ7 A;  1YJW P;  1PP9 G;  4HH2 A;  2NPS B;  2WQY C;  1RF1 C;  3G4S P;  5APY A;  1L0N J;  2W8Z A;  1M57 D;  1FZF A;  3RGU A;  4WY4 D;  1VQ5 P;  2ZVO B;  2Q7C A;  5KAI E;  3H1L E;  2HYN A;  5BU8 B;  1N8R Q;  2WT7 B;  1Y47 A;  1K8A Q;  1G1J A;  3U1A A;  5KJ7 D;  5CCG A;  2R5D A;  1YYC A;  3RK3 E;  3WUV A;  1FDI A;  5L8R J;  1OVR A;  1K05 A;  1SQP G;  1FC2 C;  2W6B A;  2ZT9 C;  3IR9 A;  2XZR A;  4MN4 C;  4DJG A;  2GUV A;  5KJ7 A;  1VF5 B;  1GL2 D;  1NHL A;  3PRJ A;  4HM8 A;  1LTG C;  3Q2Y A;  3BRT B;  4EYY Q;  1NAF A;  2XDJ A;  1JTH B;  1GTW A;  1L4A D;  4HKV A;  1BE3 G;  1GW4 A;  2BCC D;  2FFD A;  5APU A;  1ZV8 A;  1GW3 A;  2QM7 A;  2IPP A;  3TNU A;  1DD3 A;  3E1R A;  2NPS A;  1BE3 J;  4U3F E;  3W67 A;  1YQ3 C;  3PJS K;  1SQV D;  3H25 A;  5APS A;  3GB4 A;  1L0N K;  1S2E A;  1M8O B;  1QL1 A;  3CCU P;  3NTN A;  2CPB A;  2DE6 D;  3K5B A;  3MZW B;  2P10 A;  1OMI A;  2WSE J;  1LTJ A;  3CL3 D;  1MFZ A;  4QDF B;  1IJD B;  4H13 C;  1AQT A;  3MD0 A;  3I56 P;  4IFM A;  2W6J H;  3FXD A;  2B88 A;  2GBW A;  4HB1 A;  4EMJ B;  2E74 B;  1S72 P;  2IYO A;  5AW8 B;  5AVZ B;  4H44 D;  1H8A A;  2KZJ A;  3NMD A;  3CCJ P;  3RBX A;  3CCL P;  1SVF A;  3P32 A;  4NBA D;  2FXP A;  4L74 A;  5AEU A;  1LTS C;  2KS1 B;  1SQX D;  3P8C D;  5K5G B;  1KIL D;  1JY3 O;  1PGO A;  2YFJ A;  2E75 C;  5GTH H;  3ABV C;  2G8Y A;  2M5A A;  3SWY A;  2YO2 A;  4NBG D;  4TLF A;  5KAI H;  2XNX A;  2Y0D A;  2GBX A;  2CKF A;  1VQP P;  1ZW0 A;  2WPV B;  2K88 A;  3HUS C;  4C7N A;  3A0B H;  3AEB C;  3B5N C;  3HTK A;  5CCH A;  1M90 Q;  1VDF A;  3QH9 A;  4WY4 B;  1T2K C;  3BRV B;  1EDJ A;  2QM8 A;  2V7Q H;  5KLI C;  1VQM P;  1S4X A;  2FKW B;  4ZNC A;  1QVF O;  4QDC A;  4JYC A;  1BGY J;  5AVT B;  3B71 A;  1JNM A;  1RY3 A;  3M06 A;  3L70 G;  3H1H J;  3M91 A;  1DEE G;  1BGY G;  1L0L G;  5AW7 B;  3JCU H;  1FZC C;  1P84 I;  2Z5H A;  2HLO A;  1G8J B;  3FWL A;  2M0B A;  1NO4 A;  2H88 C;  1QVG O;  1L0L J;  4LGD E;  2AXT E;  1NTZ G;  1M1J C;  2W90 A;  5H2F H;  4UB6 E;  3H1J E;  3L72 J;  4OVN F;  1JCD A;  1VF5 C;  1OVV A;  3OAK A;  3VN0 A;  2WSF H;  3AE3 C;  5TJH A;  2IBZ E;  4GT1 A;  1UIX A;  5CCG C;  3GF7 A;  1NTM D;  1H89 A;  2BAS A;  3L72 G;  2HPC B;  3AED C;  2YMK A;  2IBZ I;  3CX5 I;  3E1I A;  1FOS E;  1AVY A;  3L71 G;  3C0D A;  2QVA A;  2P1J A;  1J1D C;  2DE7 D;  1JB0 J;  1NU1 D;  3U1C A;  3BCC E;  1KB9 H;  4C46 A;  1SQX J;  1SFC B;  2Y0C A;  3L71 E;  3F89 A;  5AW0 B;  1J2J B;  3B5N D;  3H32 A;  3H1I J;  1H88 A;  5AW5 B;  2H8P D;  2PP6 A;  2O3J A;  2NZ2 A;  3A7O A;  2A06 D;  3Q5P A;  1N73 B;  3EQQ A;  1QEX A;  4IFF A;  3GF3 A;  1S9K D;  4JYB A;  4U3F G;  1PGQ A;  1VPC A;  1EZV I;  3HRN A;  3O8Z A;  1J1E C;  4WWI A;  1EC5 A;  3B5N A;  1LTJ B;  1NU1 E;  2ZAE B;  3CWB D;  1W2E A;  1G1I A;  1FJP A;  3L74 D;  2YVJ B;  1R5S A;  4NPF X;  3TGU D;  1UUV A;  5E79 H;  3G71 P;  1L0N G;  1R5L A;  1O7W A;  1N7L A;  2E76 C;  2VRS A;  5APT A;  2V4H A;  3CC4 P;  3CX5 D;  1SJG A;  4N78 D;  1EXJ A;  1KQF B;  3D70 A;  1ZXG A;  4HM2 A;  2RH0 A;  1X9V A;  2OYI A;  2HFE D;  1U7J A;  1BSH A;  1FS0 E;  3C1L A;  1L4A C;  3LID A;  3P8C E;  1HF9 A;  1HBW A;  1JMM A;  2IBZ D;  1KB9 I;  2QA4 P;  1JY2 P;  1NDO A;  1JUN A;  4C7R A;  2C9N Y;  1D7M A;  2IDB A;  3V4W A;  4LLH A;  3SWF A;  2C9L Y;  3EN1 A;  4K3A A;  3RK2 D;  1YI2 P;  4WBA A;  4Y28 J;  2UWJ E;  3D6Y A;  2LKM A;  3EFF K;  4CPG A;  2B87 A;  1YIJ P;  5HL4 A;  2FYU E;  2OAR A;  3BCC D;  1L0N D;  2OYI C;  1QX8 A;  1AQ5 A;  4D6T G;  1FQT A;  2KIK A;  3CI9 A;  3U59 A;  1T3J A;  3LW5 J;  1S3J A;  3HE5 B;  1X79 B;  4IL6 H;  4NBC D;  1AV1 A;  1RQV A;  2RKL A;  2WPR A;  4D6T J;  1W5C E;  2HOD B;  4DZO A;  3WUT A;  1NAY A;  2B87 B;  1Q90 D;  1O7P A;  2ZYG A;  1LTI C;  3GOB A;  2N1T A;  1GD2 E;  3L74 E;  5KLV J;  1YHQ P;  2E75 D;  1LT1 A;  2NPS C;  1M7L A;  3H1J D;  3VP9 A;  3FGA D;  2I1J A;  1PGP A;  2KLU A;  2Y9Z A;  1NTM E;  4HJL A;  3AE5 C;  4L73 A;  5B5E H;  1NTZ K;  2PRR A;  1K73 Q;  1HJ0 A;  4HM4 A;  1Y8A A;  3S1K A;  2JO1 A;  1SLQ A;  1RIE A;  3AEA C;  1AFO A;  4R4L A;  1JM0 A;  4YXW H;  3GLM A;  3AZC A;  2XR8 A;  1S5L X;  4WY4 C;  1N73 C;  1WQL A;  4H0L B;  5CXM A;  3V4Q A;  1NKZ B;  1X8Y A;  2DW3 A;  2ZVN B;  3EQ2 A;  2LXB A;  5H2F E;  3VMA A;  2H7H A;  2Q6Q A;  2JP3 A;  3IF4 A;  4B86 A;  3CCS P;  2HMM A;  3L70 D;  1BCC G;  4D6T E;  1HVV A;  2XRX A;  3MUD C;  2HMK A;  4ASW A;  1Q90 C;  2PGD A;  2WSC H;  2Q3I A;  1P84 E;  2FY8 A;  2HML A;  1PP9 E;  2E74 D;  3B4S A;  5AW6 B;  4PJ0 E;  2O01 H;  3WUU A;  1IFI A;  1BCC J;  3LIE A;  3VCP A;  2WSS H;  1JMB A;  1SQV E;  1S1C X;  1ZP0 C;  3TF5 A;  5AVU B;  1SFC D;  1O7N A;  3H1H E;  2KB7 P;  1RH5 B;  2B1X A;  1QL2 A;  1URQ B;  1JM1 A;  2OYH C;  4JBZ A;  3O6Q A;  1JY2 O;  1JO5 A;  4ZKU A;  1LTA C;  2JWA A;  1T2K D;  1RF1 A;  1H0T B;  2JR8 A;  2YFI A;  5APX A;  2JO6 A;  3CD6 P;  3CMA P;  1BDD A;  3BCC G;  4NPD A;  1RF1 B;  4QDD A;  2K37 A;  3Q5R A;  2CK3 H;  3VMX A;  2QEX P;  4UB8 E;  1SQX G;  1M56 D;  3L74 J;  1SQP D;  1P84 H;  3CWB J;  1SS1 A;  3L75 G; 
#chains in the Genus database with same CATH homology
 3EQQ A;  2XSO A;  2QJY C;  1WQL A;  3GTS A;  5HL4 A;  1SQB E;  2FYU E;  1SQX E;  1G8K B;  4QDC A;  2QPZ A;  4AAY B;  2YIU C;  4NB9 D;  4HM5 A;  5CXM A;  3D89 A;  3N0Q A;  4P1B H;  2NWF A;  2YFL A;  2DE6 D;  1EG9 A;  1ZRT E;  4QUR A;  4PV1 D;  4QDF A;  1NYK A;  2BMO A;  4NBH D;  1FQT A;  2NUM A;  3H1I E;  3DQY A;  2D2C D;  1L0N E;  2FYN C;  1NU1 E;  4QDF B;  1L0L E;  4NBC D;  4QUQ A;  4HM1 A;  5BOK A;  2DE5 D;  3TGU E;  1O7M A;  2HMM A;  2NVE A;  3CXH E;  2JZA A;  2BCC E;  4D6T E;  1O7G A;  2XRX A;  1VCK A;  2YVJ B;  1VM9 A;  2BMR A;  2HMK A;  1G8J B;  2GBW A;  1O7H A;  2QJP C;  3VMG D;  4EMJ B;  1UUV A;  3CX5 E;  1Q90 C;  3H1L E;  2XSH A;  5KKZ C;  1O7W A;  4H44 D;  3CWB E;  1P84 E;  1O7P A;  2HML A;  1PP9 E;  2HMN A;  1KB9 E;  2E74 D;  2E4Q A;  2NVF A;  3GOB A;  1SJG A;  3L73 E;  3L70 E;  2ZYL A;  3L74 E;  3VCP A;  2E76 D;  4P1C H;  4HM2 A;  2E75 D;  2ZT9 D;  3H1J E;  1VF5 D;  2A06 E;  1SQV E;  3L75 E;  4NBA D;  3H1K E;  4HM6 A;  4NBE D;  5AEU A;  3VCA A;  1ULI A;  4OGQ D;  1O7N A;  4HM0 A;  3H1H E;  1NTK E;  2IBZ E;  2B1X A;  2E4P A;  2NVG A;  2QJK C;  1BCC E;  1NTZ E;  1JM1 A;  3FOU A;  3GCE A;  2YFJ A;  4HM3 A;  3GL0 A;  4NBB D;  1NTM E;  3GKE A;  4HJL A;  2Q3W A;  5KLV E;  2B24 A;  1SQQ E;  4HM8 A;  4NBG D;  1BGY E;  3C0D A;  3GTE A;  2BMQ A;  1NDO A;  4HM7 A;  1PPJ E;  2DE7 D;  2YFI A;  4H0L D;  1ULJ A;  3GZX A;  3VMH D;  2JO6 A;  3BCC E;  4HKV A;  2GBX A;  2I7F A;  3GZY A;  4HM4 A;  1EZV E;  2CKF A;  3L71 E;  2HMO A;  1BE3 E;  4NBF D;  4QDD A;  4PD4 E;  5AEW A;  3EN1 A;  4QUP A;  4H13 D;  4NBD D;  3GL2 A;  4AIV A;  3L72 E;  1RIE A;  4NB8 D;  1SQP E;  4U3F E;  2HMJ A;  1KYO E;  1UUW A;  4QCK A;  2NUK A;  1RFS A;  3AZC A;  3VMI D;  2XR8 A;  3GB4 A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...