1SQQE

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqqE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqqE02
1WQLA 1NTZE 2B24A 2BMRA 3H1KE 2I7FA 2QJYC 3VMID 1O7PA 2NUMA 2HMNA 2XSHA 1SQVE 1SQBE 4P1CH 1G8JB 4NB9D 2E74D 4HM3A 3EQQA 1RFSA 3VMGD 5HL4A 2YIUC 2QPZA 3L74E 2E75D 3CX5E 2DE6D 3GOBA 2E76D 4HM1A 2HMOA 3GZYA 5KLVE 4HM2A 3VMHD 4NBGD 2Q3WA 3L72E 2ZT9D 2HMKA 2XSOA 4AIVA 1O7WA 1PPJE 3L75E 2NVFA 1FQTA 2GBXA 2ZYLA 4OGQD 5KLIC 4AAYB 1O7GA 1BE3E 1L0NE 1NTME 3C0DA 3H1HE 5BOKA 1NTKE 2BMQA 3VCPA 2DE7D 3GTSA 3FOUA 5KKZC 1BCCE 4HJLA 1NYKA 2E4PA 3GL2A 1ULIA 2CKFA 1VF5D 4HM5A 4EMJB 3GZXA 2YFLA 4H0LD 4NBED 3AZCA 1VCKA 2NVGA 4QCKA 1SQXE 1ZRTE 2HMLA 4HM4A 2XRXA 5AEWA 3GTEA 4HM7A 1PP9E 2NWFA 5AEUA 1SQPE 2D2CD 4PV1D 3DQYA 3CXHE 4NBBD 3CWBE 3GKEA 3GCEA 2E4QA 3TGUE 2FYUE 2HMMA 4QUQA 3N0QA 2IBZE 4D6TE 3L71E 3L70E 2FYNC 3D89A 2YFJA 1O7MA 1UUWA 2XR8A 2HMJA 1EG9A 2JO6A 1SJGA 1NU1E 3H1JE 4QUPA 1NDOA 2NVEA 4NBFD 2NUKA 4QDCA 4NBCD 2YFIA 1KYOE 3GB4A 4QURA 1RIEA 3H1LE 4QDFB 3H1IE 4HM8A 1VM9A 4QDFA 4HM6A 2QJPC 2A06E 1BGYE 2B1XA 2BMOA 1Q90C 4U3FE 2DE5D 2YVJB 4HKVA 1JM1A 4NBHD 3VCAA 5CXMA 1ULJA 3BCCE 2BCCE 2JZAA 1UUVA 3L73E 1P84E 4NB8D 1O7NA 4QDDA 1SQQE 4H13D 4HM0A 1KB9E 2QJKC 1EZVE 2GBWA 4NBDD 3GL0A 4H44D 1O7HA 1G8KB 4P1BH 3EN1A 1L0LE 4NBAD 4PD4E
chains in the Genus database with same CATH superfamily
1Z56A 1KQGB 3VMID 3C8VA 3AE5C 3VMGD 5HL4A 1SQBK 3CWBG 1GW3A 5TISE 1W2EA 2E76D 2O01J 1RHZB 2OTJP 1JY3P 3A0BH 3WMM0 1NTME 2E75B 2B89A 1KYOI 2IBZG 1VQ4P 1HF9A 1IFIA 1SQXD 2BCCD 3G4SP 1N73A 2K9JB 5AVRB 5AEUA 1PGQA 3VMAA 4GOFA 1KFMA 3RGUA 2HMMA 1G1JA 2R3SA 5APSA 1EC5A 2WWWA 1T2KD 5CJ0A 1L0NJ 1HVVA 1S4XA 1IC2A 2FKWB 4YXWH 2QVAA 3HD7B 2N1TA 2K3RA 2I8DA 3KHUA 1L4AA 5KLVG 3V2RA 3AE2C 1K04A 2Z5HA 1YYCA 5EFWB 5AW9B 1YITP 3CCQP 3G71P 3BASA 4H44B 4HB1A 4C46A 1J2JB 2WZ7A 1GL2A 3QWOC 1SQQD 1L0LG 2C9LY 3KPEA 4H44D 1G8KB 2W6BA 4IOIH 2QEXP 1M8OB 3RK3E 3L75G 5CBNA 1O7PA 3RK3B 4D6TD 3BCCG 3D71A 1PV3A 1R5LA 3FXDA 4H0LB 1Q90D 1NJIQ 2ZVNB 3H1JJ 4C7RA 4HM1A 1NKZB 3HD7D 5B66E 3H1KG 1AV1A 3H25A 2QA4P 1CW5A 3MUDC 2RH0A 2GA1A 3JSVC 3H32A 2E4PA 1YJWP 1LWUC 4BXLA 1AQ5A 1LTJB 1FZBA 5GTHH 1NTKD 2UWJE 3PRJA 1L0LD 2KP8A 1NTZG 2WSCJ 4HM4A 3SWKA 1ZRTD 4U7JA 3CWBE 5APVA 1GL2D 2E75C 2KNCA 1M56D 4QUQA 1LT9A 2M8RA 2Q3EA 1LJ2A 1UIIA 3A0HH 1P84I 3HD7A 1K8AQ 3S9OA 1NDOA 1Q2NA 2FXPA 1SQVD 2CK3H 3PH0A 3TNUA 1EDIA 2FBWC 2FYUK 3AE6C 1JMBA 4NPFX 1VQ7P 4U3FE 5L8RJ 2KZIA 3PLNA 4YXDC 3VYIA 3RBXA 2M5AA 4A7PA 2QJKC 1SQPG 2GUVA 2WSSH 4Y99C 1O7HA 4P1BH 2M3EA 1VQMP 4DCKA 1VQ5P 1VL2A 4NB9D 2WSEJ 1BCCJ 1Y8AA 2E74D 2AXTH 1MFTA 1JEKA 4B86A 3CCVP 2WT7B 4MN4C 3BRVB 4WWIA 2R5BA 1IJDB 3L37A 5CCHC 1EDLA 4H13C 3USSA 5KLVJ 3GMAA 1ZXGA 2P67A 1SVFA 2P10A 3TGUG 1FJKA 1VF5C 1RE4A 3AZCA 1FZFA 2NVGA 1N86A 4HYTB 1OX3A 1NU1K 3M91A 1Q82Q 2ZT9C 2OTKE 1S9KE 1BSHA 2OYHC 1JTHB 2BCCG 3DQYA 2JO1A 2V7QH 2WPVB 1FE6A 3JC22 1KILD 1YTZT 4I1LA 3I56P 1QEXA 2JO6A 3L72J 1SQQK 3H1JE 2WVRA 3CXHD 3L72G 5CBOA 1HUCA 1KYOE 2FYZA 2AXTE 2JP3A 3MTUE 2IYPA 1SQPD 1H8AA 2O1JA 3CX5H 2JR8A 3RK2C 1PP9D 2ZJSE 3PP5A 1XTGB 2XKMA 4NPEA 3L74J 3MHVA 4I7ZB 3NMDA 3AE7C 2P2UA 5AVZB 2XSOA 1M1KQ 5KLIC 1H88A 2QJPB 3P8CD 1T2KC 3O8ZA 3N4XA 4U3FJ 1GZLA 4U3FG 5CHXA 2E43A 1KN7A 3OA7A 3JCUH 1VQPP 1GL2B 3CX5I 3TF5A 1ZRTE 3N7NA 3U59A 4PV1D 3Q5PA 1BDDA 3WUVA 3B5NB 3S1KA 2E4QA 5AW7B 3MIWA 1LTBC 3RL0g 2NPSD 4K3AA 2A45I 3O6QA 1BCCG 2QE7H 3ABVC 3BCCD 4NBFD 3L73D 4QDCA 2LXBA 1FDIA 2ZFCA 1VPCA 2XNDH 5AVUB 2KK7A 3L75D 4QURA 4QDFB 1BE3D 1NU1J 3EFGA 2DE5D 1PGPA 3TNUB 1KILA 1EZVD 1R8EA 1DD3A 4H13D 3G3ZA 1ZW0A 4AYCA 2J59M 3L35A 4RJTA 1SQQG 2YNYA 1VF5B 2KNCB 1YQ3C 1ZLLA 2WITA 4HM3A 3H1IG 1ZV8A 3CWBJ 1ZR4A 3GOBA 5CMZA 3WUUA 3TGUD 3C9IA 1FZCB 1UIXA 1BSNA 1PZQA 5AVYB 3L70D 3M0AA 3WUTA 5AW8B 1ULIA 1YHQP 1VF5D 4EMJB 2ZAEB 2YFLA 1N73C 4JPZB 2HPCB 2JDIH 2N1TC 3H1LD 2B9BA 1OW7A 4C7NB 1VQNP 2YXRB 2KSEA 1RQVA 1JCCA 4CPGA 2FFDA 1VDFA 2KXPB 3L75J 4BRYA 4L73A 4ZNCA 2FYNC 3BCCJ 3FX0A 3H32B 5AW5B 1JNMA 1USEA 5TISH 1K9MQ 2NUKA 1SQPK 2YO3A 1LTIC 1BCCD 1URQB 2QIWA 1EDJA 1R5SA 5CCGC 3G9RA 1UUVA 2FYUG 1O7NA 2QM7A 2YMYA 1Q81Q 3GHGB 1JO5A 3PHLA 2KZJA 5AW0B 1G1IA 2OARA 4GDOA 4U3FD 1M7LA 1HWTC 1QX8A 2XDJA 3Q1MA 1X0TA 4UB6E 2PFXA 2LR2A 3VMYA 1E79H 2JEEA 3OW2O 1SLQA 2YIUC 1BGYD 1YBKA 1NTKG 3F89A 4W7ZA 4HM2A 1K05A 1GU5A 4DZOA 4PJ0H 2ZYLA 4AAYB 4DJGA 2HR3A 3H1KJ 3KQGA 3BATA 1IFNA 2Z5IA 3FOUA 2ZYAA 4PJ0E 3AEAC 4HJLA 1NYKA 2RN0A 2H43A 1NTZD 3M0DA 1GK4A 2OTLP 1QVFO 3E7KA 3B5NA 1FAVA 1PP9G 2WPRA 1NTZJ 2Q1KA 3W68A 2FFDC 3IFMA 3CPWO 1OZHA 3GF7A 1L2PA 3O6QB 3GKEA 4LGDE 3WU2E 4H0LC 3H1KD 1JUNA 2XV5A 1P84H 2LKMA 4EIJA 4JYBA 1YJNP 1L0LK 1LP1B 1USDA 4HM6A 2J58A 3CX5D 3I5CA 5KJ7D 3RK2B 1NWQA 1S9KD 4UB8H 4PD4D 4I2LC 2FXMA 1QLED 3M0DC 3CCMP 3EN1A 1L0LE 2I7FA 5B5EH 4ASWA 2I1JA 2Q7CA 1KQLA 4AQRD 4W7YA 2A45H 1KQSO 3AEEC 4Z1MH 3H1IJ 3NTNA 2W83C 5AW4B 5KLVE 2HMKA 2YIUB 2KS1B 4OGQD 3M06A 1BDCA 4GT1A 2YMKA 2NPSB 1HJBA 3V6IA 1ZOYC 2KLUA 3CLQA 2G3AA 5H2FE 2O1KA 3TK1A 4JBZA 2HLOA 2NZ2A 2JWDA 2J5UA 3AE4C 1SQXE 2E76C 2YKQA 3E1IA 3PTZA 4LLHA 3BRTB 1SQBJ 3AE3C 2Z4EA 1SQBG 2C0WA 2Y9ZA 1FDOA 2P1JA 1L0NG 1URQD 2W6AA 5CJ4A 1NU1D 1WMKA 3SSUA 3VN0A 1BE3J 1VQ6P 1GDTA 4HM8A 3B5NC 4QDFA 1BGYE 3SFDC 3WU2H 2E42A 3CXHH 3H1ID 1L4AB 4Y99B 3CC7P 1N7SA 2HYNA 4NB8D 4LC1A 2PRRA 1N73B 1KB9E 2FYUJ 3A7OA 1OVVA 1EDKA 2CPSA 3V4QA 1EQ7A 1RF1C 3F5HA 1FJPA 4PD4E 2H7HA 1NTZE 3L74G 2I1KA 2QJYC 2HMNA 2FFDB 3GHGA 2BEZF 3CCLP 1S72P 2RMZA 2V7QJ 3L75E 3CD6P 3L73G 3H1HE 1HH0A 3GTSA 4GOEA 3SWFA 4UB6H 1IO4A 4XFJA 3RK3D 4N78D 1NOHA 2R5DA 1FZEA 2ITAA 5APWA 1JMMA 2WQYC 1GD2E 1CSBA 3E1RA 2OYIA 3VP8A 3VP9A 4HM7A 3IAOA 4NBBD 3A0BE 3TGUE 3G6EP 1IK7A 3L74D 1NHLA 2PGDA 3L71E 3L70E 2XR8A 2AEMA 2WSEH 4QUPA 3P7KA 1EZVI 4GKGA 3KDPB 5APXA 1IFMA 3CCJP 3NXSA 4Y28J 3GF3A 4BWNA 4YTPC 1YI2P 1S5LH 1NTMD 1S2EA 2Y0DA 5CCGD 5E79H 1BGYG 4EDFA 3CI9A 3M9BA 1LT9C 1N7LA 1PP9J 3RBZA 2ZXEB 4QDDA 3AEFC 3HUSC 5APQA 1AVYA 1SQXJ 1PIXA 1N7SD 1SQPJ 3KZIH 1SQXG 1SQBD 1L0NK 4OH8B 1SQVE 2ZVOB 1G8JB 3PJSK 2H89C 2QM8A 2N9BA 2E75D 3VMXA 3V2QA 4L74A 1CI6B 4AIVA 1U7MA 1SS1A 1KZUB 1JY2O 2P7JA 2KB7P 1X8YA 4JQ0D 4RESB 2KYVA 2XZRA 2XRXA 2NWFA 2B87A 3NFQA 4OVNF 4KJMA 1SFCD 2K1AA 1IZNB 3H1LJ 1SP4A 1PGJA 1GK6A 2A06G 2YFJA 1G2CA 1PGOA 5K5GB 3H1HG 1LTAC 3GLMA 1S5LE 1YJ9P 4WY4D 2YFIA 1NAFA 3AE8C 3H1JG 3TGUJ 5CCHD 3H1IE 5KTBA 1CI6A 3OAKA 1MZ9A 1KYOH 1AA0A 1S3JA 4NPDA 1KILB 2BCCE 2Y0EA 2Q5UA 1JM0A 4HM0A 1RF1A 2YO2A 1NVOA 2R3CA 2IZ1A 1AFOA 3A2AA 5AW1B 1AQTA 3IR9A 2HG5D 4H13B 4IL6H 4ZKPA 1BE3G 1LTTC 2KIKA 2GBXA 2D2CC 2XNXA 2FXOA 5KAIE 1NTKE 1ZMEC 1NYHA 2IDBA 2DE7D 3L73J 3TSIA 1BCCE 2L91A 5BU5A 4D6TG 1RQUA 1L0LJ 4QMAA 3FWLA 1BGYJ 4ZMDA 3B5ND 3LW5H 2IBZI 3R2PA 3IN6A 2HMLA 3GHGC 1AVOA 4M3LA 1NTKK 2QSIA 2H8PD 1DD4A 2FYUE 4HKZH 3L4FA 2ZXXA 3MGNA 1S1CX 3H1JD 4I6MC 3D6YA 2E76B 3LIDA 4ASVA 4NBCD 2P58A 1FBMA 4D6TJ 4WY4A 1PPJD 4WBAA 1VM9A 3V4WA 2B1XA 3B4SA 1PFIA 2FY8A 5CXMA 2G8YA 1ULJA 1JB0J 1FOSF 2K37A 1N7SB 1H0TA 1JOCA 1L0ND 1KFNA 1A02F 2YXQB 2GUSA 5AVTB 1N2DC 3LIEA 1MUUA 4NBDD 1LTJA 3CCRP 3MUDA 3QH9A 5AW3B 5B66H 2OYOA 2POHA 3KZIE 2BCCJ 3IF4A 3VOPA 3H1LG 1FZCA 2WSCH 1FOSE 2VRSA 1AJYA 1EXJA 3L72E 4IFMA 1O7GA 3FGAD 3L70J 5BOKA 4O9BA 1ZN5A 3AEDC 5BVZA 3GL2A 5AVSB 3CC4P 1GMJA 4H0LD 1PL5A 3MZWB 1KILE 3CCEP 1WRGA 1OVRA 3RK2D 2W90A 1PP9E 1EXIA 4AUWA 1W2BO 1IFDA 3HE5A 4KHXA 2K9JA 1DH3A 2M0BA 3L71G 3FXEA 3M9HA 3Q2YA 1SJGA 2Q9IA 2AEFA 3VMZA 1FZCC 1XTCC 1KV4A 2Y0CA 5KAFH 3ITKA 1H89A 5GTIE 1LP1A 1IK9A 2DW3A 1M57D 3AEBC 1MV8A 3V2NA 1Q90C 3BVHA 1S5LX 4HJGH 4NBHD 2C0XA 2AEJA 3CXHI 3D6ZA 2JZAA 1P84E 1Y47A 2WSFH 1U57A 3GL0A 2JJLA 1LNQA 2QRXA 4GODA 1PPJG 3L71J 2QJYB 3U1AA 2XSHA 5CCGA 1WT6A 3P8CE 2BASA 3H1HJ 1RE3A 1G2CB 2WMMA 2ZYDA 3U1CA 1LTJC 3CL3D 2B88A 1ZR2A 1SFCC 1QL1A 1FU1A 1HBWA 3P8MC 3C0DA 2IX7C 3RL0D 2NPSA 4JYCA 4PD4I 2K88A 1IFJA 4R4MA 1A02J 1Q7YQ 1M90Q 1VCKA 1OW8A 1CZQA 1QL2A 1MKMA 1L4AC 5APUA 1DX7A 2B87B 1YQ4C 3HTKA 2KSJA 4JF7A 1KB9H 4GIFA 1LGHB 4I7ZC 1QVGO 4DT0A 1O7MA 5AVXB 2BEQD 4OGQB 1JCDA 1LT9B 2IFMA 4WY4C 4XE5B 2N1TB 2OQQA 1M1JC 1T8ZA 5DJUB 2R32A 1X79B 4IL6E 1RIEA 4UB8E 1OVUA 2BMOA 2WTYA 3L72D 4IFFA 3BCCE 1LTGC 1MFZA 3L73E 1YTZI 3P32A 3ZDMA 2IFNA 3MP7B 3R4YA 4HH2A 2D2CB 1JY3N 4NBAD 2YKOA 1WQLA 1OWAA 2WT7A 2NPSC 3GG2A 2NUMA 1JTHA 1SQQJ 1GTWA 2HODA 2OYIB 1LT1A 1HJ0A 3CX5E 2DE6D 1RF0C 2HMOA 1URQA 2ZT9B 2Q3WA 2ZT9D 2M3BA 2N9YB 2L5GB 3CCSP 2NVFA 1FQTA 1NU1G 5KLVD 4WY4B 1LTSC 2BMQA 1X9VA 4PD4H 3L70G 1GU4A 1KILC 4R4LA 4OWFA 3T97A 4HM5A 3GW6A 1KD1Q 4QCKA 1HTLC 1FS0E 2QJKB 3GTEA 5H2FH 3C1LA 3N0QA 4N6JA 2IBZE 3V5BA 1UUWA 3II6A 3SWYA 2QG4A 3W67A 1K73Q 1W5CE 2JKVA 3S4RA 2K9YA 5AVVB 3GB4A 4N3YB 1P84D 1T3UA 3CWBD 3VCAA 3A3YB 4WB4A 1FC2C 3MD0A 2O3JA 1EZVE 2O01H 3Q3DA 5KJ7A 1KQFB 5DJTB 1NAYA 5GTIH 2B24A 2BMRA 1FZGA 1DEEG 2Q6QA 5KKZB 3V2PA 3Q5SA 3EFFK 3OJAB 3HRNA 4K35A 1RFSA 2QPZA 3RL0B 1NTKJ 5AW6B 1FZAA 1J1EB 3GZYA 2JWAA 1ZP0C 5AVQB 3A5TA 2H88C 3CCUP 1O7WA 1PPJE 3HE4A 2ZYGA 4PV1C 1NTZK 1L0NE 1URQC 1KB9D 5KKZC 2LXCB 1VQOP 1RY3A 3EQ2A 3A0HE 4L75A 3CMAP 2W27A 1D7MA 3SFEC 4IFDK 3I55P 4EOTA 1FDMA 5AEWA 3HUSA 1E5WA 4TT3H 3AEGC 2R44A 3HE5B 2E5TA 4BRYB 2XU6A 3RK3C 4D6TE 1KMIZ 3D89A 3HTKB 4IL6X 2HMJA 1EG9A 1DEBA 3TDKA 1NU1E 2GM4A 2OYHA 1Y9BA 4DOJA 5CCHA 2IYOA 1U7JA 1RH5B 5KAIH 1T3JA 5BU8B 1RE4C 3HE4B 3JCUE 2KOGA 1IFPA 3KYQA 4KT0J 3RL0C 1KYOD 3TYYA 3KXDA 5KLVK 1SFCA 2W8ZA 1DIPA 2WPSA 2OYIC 1OIPA 3H1KE 4EYYQ 1SQBE 4P1CH 1HGVA 3EQQA 2V4HA 1T6AA 1L4AD 5AVWB 2N1TD 1Q86Q 1VQKP 3T97B 2YKPA 3HD7C 1N7SC 1NO4A 3VCPA 2IBZD 2IPPA 1M1JA 2E74B 1RE3C 5B5EE 5KJ7C 1OXZA 4W80A 3Q5RA 1HGZA 1JY2N 4L76A 3VTPC 1RF1B 3HUSB 2Y9YA 2E5YA 3AE9C 1EZVG 2SPZA 3H6PA 5E79E 1VQ9P 2HODB 2HPCA 5KLIB 1J1DB 1LWUB 1NKNA 2AXCA 5M1BA 1SQXK 3L36A 1KTMA 1KC8Q 3B8EB 1VQ8P 1GW4A 1JY2P 2KLVA 3LW5J 2WSFJ 2KI7B 5TJHA 2YVJB 1J1DC 4ZKUA 1SQVG 2M5AB 2FYNB 2GBWA 2O01N 1NTMG 4H44C 1NTMJ 2PAJA 3FWNA 3AECC 1JY3O 1YIJP 3L74E 2E74C 2A45G 3M9QA 1RF0A 2WPQA 2NRGA 3VMHD 2RKLA 2Q3IA 4NBGD 2KS1A 2C9NY 1LWUA 1OFCX 1BE3E 1KORA 5AW2B 2IZ0A 1SQVJ 2W6JH 1M1JB 2PP6A 3CMEP 2CKFA 3GZXA 1J1EC 5KAFE 4EI2A 3AE1C 4NBED 2MKVA 1NGMB 1OW6A 5APYA 3UIAA 3CC2P 1VQLP 1QGKB 1SQPE 2D2CD 3CXHE 3D70A 3EWKA 1N8RQ 3GCEA 4WVZA 1X22A 3B71A 1KB9I 4OGQC 2MJZA 3H1HD 1TU3F 1NTMK 3K5BA 2NVEA 4TLFA 1NH4A 2HFED 5C39A 3H1LE 4XA4A 4YPCA 4N78E 2QJPC 2A06E 3L71D 2OYHB 1H0TB 1SQVK 1OMIA 4RO0A 1SFCB 4HKVA 1JM1A 5GTHE 2FYUD 1GL2C 2KUBA 4C7NA 2OGUA 2CPBA 4RKUJ 1SQQE 5APTA 4PV1B 2A06D
chains in the Genus database with same CATH topology
1WQLA 1NTZE 2B24A 2BMRA 3H1KE 2I7FA 2QJYC 3VMID 1O7PA 2NUMA 2HMNA 2XSHA 1SQVE 1SQBE 4P1CH 1G8JB 4NB9D 2E74D 4HM3A 3EQQA 1RFSA 3VMGD 5HL4A 2YIUC 2QPZA 3L74E 2E75D 3CX5E 2DE6D 3GOBA 2E76D 4HM1A 2HMOA 3GZYA 5KLVE 4HM2A 3VMHD 4NBGD 2Q3WA 3L72E 2ZT9D 2HMKA 2XSOA 4AIVA 1O7WA 1PPJE 3L75E 2NVFA 1FQTA 2GBXA 2ZYLA 4OGQD 5KLIC 4AAYB 1O7GA 1BE3E 1L0NE 1NTME 3C0DA 3H1HE 5BOKA 1NTKE 2BMQA 3VCPA 2DE7D 3GTSA 3FOUA 5KKZC 1BCCE 4HJLA 1NYKA 2E4PA 3GL2A 1ULIA 2CKFA 1VF5D 4HM5A 4EMJB 3GZXA 2YFLA 4H0LD 4NBED 3AZCA 1VCKA 2NVGA 4QCKA 1SQXE 1ZRTE 2HMLA 4HM4A 2XRXA 5AEWA 3GTEA 4HM7A 1PP9E 2NWFA 5AEUA 1SQPE 2D2CD 4PV1D 3DQYA 3CXHE 4NBBD 3CWBE 3GKEA 3GCEA 2E4QA 3TGUE 2FYUE 2HMMA 4QUQA 3N0QA 2IBZE 4D6TE 3L71E 3L70E 2FYNC 3D89A 2YFJA 1O7MA 1UUWA 2XR8A 2HMJA 1EG9A 2JO6A 1SJGA 1NU1E 3H1JE 4QUPA 1NDOA 2NVEA 4NBFD 2NUKA 4QDCA 4NBCD 2YFIA 1KYOE 3GB4A 4QURA 1RIEA 3H1LE 4QDFB 3H1IE 4HM8A 1VM9A 4QDFA 4HM6A 2QJPC 2A06E 1BGYE 2B1XA 2BMOA 1Q90C 4U3FE 2DE5D 2YVJB 4HKVA 1JM1A 4NBHD 3VCAA 5CXMA 1ULJA 3BCCE 2BCCE 2JZAA 1UUVA 3L73E 1P84E 4NB8D 1O7NA 4QDDA 1SQQE 4H13D 4HM0A 1KB9E 2QJKC 1EZVE 2GBWA 4NBDD 3GL0A 4H44D 1O7HA 1G8KB 4P1BH 3EN1A 1L0LE 4NBAD 4PD4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQL A;  1NTZ E;  2B24 A;  2BMR A;  3H1K E;  2I7F A;  2QJY C;  3VMI D;  1O7P A;  2NUM A;  2HMN A;  2XSH A;  1SQV E;  1SQB E;  4P1C H;  1G8J B;  4NB9 D;  2E74 D;  4HM3 A;  3EQQ A;  1RFS A;  3VMG D;  5HL4 A;  2YIU C;  2QPZ A;  3L74 E;  2E75 D;  3CX5 E;  2DE6 D;  3GOB A;  2E76 D;  4HM1 A;  2HMO A;  3GZY A;  5KLV E;  4HM2 A;  3VMH D;  4NBG D;  2Q3W A;  3L72 E;  2ZT9 D;  2HMK A;  2XSO A;  4AIV A;  1O7W A;  1PPJ E;  3L75 E;  2NVF A;  1FQT A;  2GBX A;  2ZYL A;  4OGQ D;  5KLI C;  4AAY B;  1O7G A;  1BE3 E;  1L0N E;  1NTM E;  3C0D A;  3H1H E;  5BOK A;  1NTK E;  2BMQ A;  3VCP A;  2DE7 D;  3GTS A;  3FOU A;  5KKZ C;  1BCC E;  4HJL A;  1NYK A;  2E4P A;  3GL2 A;  1ULI A;  2CKF A;  1VF5 D;  4HM5 A;  4EMJ B;  3GZX A;  2YFL A;  4H0L D;  4NBE D;  3AZC A;  1VCK A;  2NVG A;  4QCK A;  1SQX E;  1ZRT E;  2HML A;  4HM4 A;  2XRX A;  5AEW A;  3GTE A;  4HM7 A;  1PP9 E;  2NWF A;  5AEU A;  1SQP E;  2D2C D;  4PV1 D;  3DQY A;  3CXH E;  4NBB D;  3CWB E;  3GKE A;  3GCE A;  2E4Q A;  3TGU E;  2FYU E;  2HMM A;  4QUQ A;  3N0Q A;  2IBZ E;  4D6T E;  3L71 E;  3L70 E;  2FYN C;  3D89 A;  2YFJ A;  1O7M A;  1UUW A;  2XR8 A;  2HMJ A;  1EG9 A;  2JO6 A;  1SJG A;  1NU1 E;  3H1J E;  4QUP A;  1NDO A;  2NVE A;  4NBF D;  2NUK A;  4QDC A;  4NBC D;  2YFI A;  1KYO E;  3GB4 A;  4QUR A;  1RIE A;  3H1L E;  4QDF B;  3H1I E;  4HM8 A;  1VM9 A;  4QDF A;  4HM6 A;  2QJP C;  2A06 E;  1BGY E;  2B1X A;  2BMO A;  1Q90 C;  4U3F E;  2DE5 D;  2YVJ B;  4HKV A;  1JM1 A;  4NBH D;  3VCA A;  5CXM A;  1ULJ A;  3BCC E;  2BCC E;  2JZA A;  1UUV A;  3L73 E;  1P84 E;  4NB8 D;  1O7N A;  4QDD A;  1SQQ E;  4H13 D;  4HM0 A;  1KB9 E;  2QJK C;  1EZV E;  2GBW A;  4NBD D;  3GL0 A;  4H44 D;  1O7H A;  1G8K B;  4P1B H;  3EN1 A;  1L0L E;  4NBA D;  4PD4 E; 
#chains in the Genus database with same CATH topology
 1Z56 A;  1KQG B;  3VMI D;  3C8V A;  3AE5 C;  3VMG D;  5HL4 A;  1SQB K;  3CWB G;  1GW3 A;  5TIS E;  1W2E A;  2E76 D;  2O01 J;  1RHZ B;  2OTJ P;  1JY3 P;  3A0B H;  3WMM 0;  1NTM E;  2E75 B;  2B89 A;  1KYO I;  2IBZ G;  1VQ4 P;  1HF9 A;  1IFI A;  1SQX D;  2BCC D;  3G4S P;  1N73 A;  2K9J B;  5AVR B;  5AEU A;  1PGQ A;  3VMA A;  4GOF A;  1KFM A;  3RGU A;  2HMM A;  1G1J A;  2R3S A;  5APS A;  1EC5 A;  2WWW A;  1T2K D;  5CJ0 A;  1L0N J;  1HVV A;  1S4X A;  1IC2 A;  2FKW B;  4YXW H;  2QVA A;  3HD7 B;  2N1T A;  2K3R A;  2I8D A;  3KHU A;  1L4A A;  5KLV G;  3V2R A;  3AE2 C;  1K04 A;  2Z5H A;  1YYC A;  5EFW B;  5AW9 B;  1YIT P;  3CCQ P;  3G71 P;  3BAS A;  4H44 B;  4HB1 A;  4C46 A;  1J2J B;  2WZ7 A;  1GL2 A;  3QWO C;  1SQQ D;  1L0L G;  2C9L Y;  3KPE A;  4H44 D;  1G8K B;  2W6B A;  4IOI H;  2QEX P;  1M8O B;  3RK3 E;  3L75 G;  5CBN A;  1O7P A;  3RK3 B;  4D6T D;  3BCC G;  3D71 A;  1PV3 A;  1R5L A;  3FXD A;  4H0L B;  1Q90 D;  1NJI Q;  2ZVN B;  3H1J J;  4C7R A;  4HM1 A;  1NKZ B;  3HD7 D;  5B66 E;  3H1K G;  1AV1 A;  3H25 A;  2QA4 P;  1CW5 A;  3MUD C;  2RH0 A;  2GA1 A;  3JSV C;  3H32 A;  2E4P A;  1YJW P;  1LWU C;  4BXL A;  1AQ5 A;  1LTJ B;  1FZB A;  5GTH H;  1NTK D;  2UWJ E;  3PRJ A;  1L0L D;  2KP8 A;  1NTZ G;  2WSC J;  4HM4 A;  3SWK A;  1ZRT D;  4U7J A;  3CWB E;  5APV A;  1GL2 D;  2E75 C;  2KNC A;  1M56 D;  4QUQ A;  1LT9 A;  2M8R A;  2Q3E A;  1LJ2 A;  1UII A;  3A0H H;  1P84 I;  3HD7 A;  1K8A Q;  3S9O A;  1NDO A;  1Q2N A;  2FXP A;  1SQV D;  2CK3 H;  3PH0 A;  3TNU A;  1EDI A;  2FBW C;  2FYU K;  3AE6 C;  1JMB A;  4NPF X;  1VQ7 P;  4U3F E;  5L8R J;  2KZI A;  3PLN A;  4YXD C;  3VYI A;  3RBX A;  2M5A A;  4A7P A;  2QJK C;  1SQP G;  2GUV A;  2WSS H;  4Y99 C;  1O7H A;  4P1B H;  2M3E A;  1VQM P;  4DCK A;  1VQ5 P;  1VL2 A;  4NB9 D;  2WSE J;  1BCC J;  1Y8A A;  2E74 D;  2AXT H;  1MFT A;  1JEK A;  4B86 A;  3CCV P;  2WT7 B;  4MN4 C;  3BRV B;  4WWI A;  2R5B A;  1IJD B;  3L37 A;  5CCH C;  1EDL A;  4H13 C;  3USS A;  5KLV J;  3GMA A;  1ZXG A;  2P67 A;  1SVF A;  2P10 A;  3TGU G;  1FJK A;  1VF5 C;  1RE4 A;  3AZC A;  1FZF A;  2NVG A;  1N86 A;  4HYT B;  1OX3 A;  1NU1 K;  3M91 A;  1Q82 Q;  2ZT9 C;  2OTK E;  1S9K E;  1BSH A;  2OYH C;  1JTH B;  2BCC G;  3DQY A;  2JO1 A;  2V7Q H;  2WPV B;  1FE6 A;  3JC2 2;  1KIL D;  1YTZ T;  4I1L A;  3I56 P;  1QEX A;  2JO6 A;  3L72 J;  1SQQ K;  3H1J E;  2WVR A;  3CXH D;  3L72 G;  5CBO A;  1HUC A;  1KYO E;  2FYZ A;  2AXT E;  2JP3 A;  3MTU E;  2IYP A;  1SQP D;  1H8A A;  2O1J A;  3CX5 H;  2JR8 A;  3RK2 C;  1PP9 D;  2ZJS E;  3PP5 A;  1XTG B;  2XKM A;  4NPE A;  3L74 J;  3MHV A;  4I7Z B;  3NMD A;  3AE7 C;  2P2U A;  5AVZ B;  2XSO A;  1M1K Q;  5KLI C;  1H88 A;  2QJP B;  3P8C D;  1T2K C;  3O8Z A;  3N4X A;  4U3F J;  1GZL A;  4U3F G;  5CHX A;  2E43 A;  1KN7 A;  3OA7 A;  3JCU H;  1VQP P;  1GL2 B;  3CX5 I;  3TF5 A;  1ZRT E;  3N7N A;  3U59 A;  4PV1 D;  3Q5P A;  1BDD A;  3WUV A;  3B5N B;  3S1K A;  2E4Q A;  5AW7 B;  3MIW A;  1LTB C;  3RL0 g;  2NPS D;  4K3A A;  2A45 I;  3O6Q A;  1BCC G;  2QE7 H;  3ABV C;  3BCC D;  4NBF D;  3L73 D;  4QDC A;  2LXB A;  1FDI A;  2ZFC A;  1VPC A;  2XND H;  5AVU B;  2KK7 A;  3L75 D;  4QUR A;  4QDF B;  1BE3 D;  1NU1 J;  3EFG A;  2DE5 D;  1PGP A;  3TNU B;  1KIL A;  1EZV D;  1R8E A;  1DD3 A;  4H13 D;  3G3Z A;  1ZW0 A;  4AYC A;  2J59 M;  3L35 A;  4RJT A;  1SQQ G;  2YNY A;  1VF5 B;  2KNC B;  1YQ3 C;  1ZLL A;  2WIT A;  4HM3 A;  3H1I G;  1ZV8 A;  3CWB J;  1ZR4 A;  3GOB A;  5CMZ A;  3WUU A;  3TGU D;  3C9I A;  1FZC B;  1UIX A;  1BSN A;  1PZQ A;  5AVY B;  3L70 D;  3M0A A;  3WUT A;  5AW8 B;  1ULI A;  1YHQ P;  1VF5 D;  4EMJ B;  2ZAE B;  2YFL A;  1N73 C;  4JPZ B;  2HPC B;  2JDI H;  2N1T C;  3H1L D;  2B9B A;  1OW7 A;  4C7N B;  1VQN P;  2YXR B;  2KSE A;  1RQV A;  1JCC A;  4CPG A;  2FFD A;  1VDF A;  2KXP B;  3L75 J;  4BRY A;  4L73 A;  4ZNC A;  2FYN C;  3BCC J;  3FX0 A;  3H32 B;  5AW5 B;  1JNM A;  1USE A;  5TIS H;  1K9M Q;  2NUK A;  1SQP K;  2YO3 A;  1LTI C;  1BCC D;  1URQ B;  2QIW A;  1EDJ A;  1R5S A;  5CCG C;  3G9R A;  1UUV A;  2FYU G;  1O7N A;  2QM7 A;  2YMY A;  1Q81 Q;  3GHG B;  1JO5 A;  3PHL A;  2KZJ A;  5AW0 B;  1G1I A;  2OAR A;  4GDO A;  4U3F D;  1M7L A;  1HWT C;  1QX8 A;  2XDJ A;  3Q1M A;  1X0T A;  4UB6 E;  2PFX A;  2LR2 A;  3VMY A;  1E79 H;  2JEE A;  3OW2 O;  1SLQ A;  2YIU C;  1BGY D;  1YBK A;  1NTK G;  3F89 A;  4W7Z A;  4HM2 A;  1K05 A;  1GU5 A;  4DZO A;  4PJ0 H;  2ZYL A;  4AAY B;  4DJG A;  2HR3 A;  3H1K J;  3KQG A;  3BAT A;  1IFN A;  2Z5I A;  3FOU A;  2ZYA A;  4PJ0 E;  3AEA C;  4HJL A;  1NYK A;  2RN0 A;  2H43 A;  1NTZ D;  3M0D A;  1GK4 A;  2OTL P;  1QVF O;  3E7K A;  3B5N A;  1FAV A;  1PP9 G;  2WPR A;  1NTZ J;  2Q1K A;  3W68 A;  2FFD C;  3IFM A;  3CPW O;  1OZH A;  3GF7 A;  1L2P A;  3O6Q B;  3GKE A;  4LGD E;  3WU2 E;  4H0L C;  3H1K D;  1JUN A;  2XV5 A;  1P84 H;  2LKM A;  4EIJ A;  4JYB A;  1YJN P;  1L0L K;  1LP1 B;  1USD A;  4HM6 A;  2J58 A;  3CX5 D;  3I5C A;  5KJ7 D;  3RK2 B;  1NWQ A;  1S9K D;  4UB8 H;  4PD4 D;  4I2L C;  2FXM A;  1QLE D;  3M0D C;  3CCM P;  3EN1 A;  1L0L E;  2I7F A;  5B5E H;  4ASW A;  2I1J A;  2Q7C A;  1KQL A;  4AQR D;  4W7Y A;  2A45 H;  1KQS O;  3AEE C;  4Z1M H;  3H1I J;  3NTN A;  2W83 C;  5AW4 B;  5KLV E;  2HMK A;  2YIU B;  2KS1 B;  4OGQ D;  3M06 A;  1BDC A;  4GT1 A;  2YMK A;  2NPS B;  1HJB A;  3V6I A;  1ZOY C;  2KLU A;  3CLQ A;  2G3A A;  5H2F E;  2O1K A;  3TK1 A;  4JBZ A;  2HLO A;  2NZ2 A;  2JWD A;  2J5U A;  3AE4 C;  1SQX E;  2E76 C;  2YKQ A;  3E1I A;  3PTZ A;  4LLH A;  3BRT B;  1SQB J;  3AE3 C;  2Z4E A;  1SQB G;  2C0W A;  2Y9Z A;  1FDO A;  2P1J A;  1L0N G;  1URQ D;  2W6A A;  5CJ4 A;  1NU1 D;  1WMK A;  3SSU A;  3VN0 A;  1BE3 J;  1VQ6 P;  1GDT A;  4HM8 A;  3B5N C;  4QDF A;  1BGY E;  3SFD C;  3WU2 H;  2E42 A;  3CXH H;  3H1I D;  1L4A B;  4Y99 B;  3CC7 P;  1N7S A;  2HYN A;  4NB8 D;  4LC1 A;  2PRR A;  1N73 B;  1KB9 E;  2FYU J;  3A7O A;  1OVV A;  1EDK A;  2CPS A;  3V4Q A;  1EQ7 A;  1RF1 C;  3F5H A;  1FJP A;  4PD4 E;  2H7H A;  1NTZ E;  3L74 G;  2I1K A;  2QJY C;  2HMN A;  2FFD B;  3GHG A;  2BEZ F;  3CCL P;  1S72 P;  2RMZ A;  2V7Q J;  3L75 E;  3CD6 P;  3L73 G;  3H1H E;  1HH0 A;  3GTS A;  4GOE A;  3SWF A;  4UB6 H;  1IO4 A;  4XFJ A;  3RK3 D;  4N78 D;  1NOH A;  2R5D A;  1FZE A;  2ITA A;  5APW A;  1JMM A;  2WQY C;  1GD2 E;  1CSB A;  3E1R A;  2OYI A;  3VP8 A;  3VP9 A;  4HM7 A;  3IAO A;  4NBB D;  3A0B E;  3TGU E;  3G6E P;  1IK7 A;  3L74 D;  1NHL A;  2PGD A;  3L71 E;  3L70 E;  2XR8 A;  2AEM A;  2WSE H;  4QUP A;  3P7K A;  1EZV I;  4GKG A;  3KDP B;  5APX A;  1IFM A;  3CCJ P;  3NXS A;  4Y28 J;  3GF3 A;  4BWN A;  4YTP C;  1YI2 P;  1S5L H;  1NTM D;  1S2E A;  2Y0D A;  5CCG D;  5E79 H;  1BGY G;  4EDF A;  3CI9 A;  3M9B A;  1LT9 C;  1N7L A;  1PP9 J;  3RBZ A;  2ZXE B;  4QDD A;  3AEF C;  3HUS C;  5APQ A;  1AVY A;  1SQX J;  1PIX A;  1N7S D;  1SQP J;  3KZI H;  1SQX G;  1SQB D;  1L0N K;  4OH8 B;  1SQV E;  2ZVO B;  1G8J B;  3PJS K;  2H89 C;  2QM8 A;  2N9B A;  2E75 D;  3VMX A;  3V2Q A;  4L74 A;  1CI6 B;  4AIV A;  1U7M A;  1SS1 A;  1KZU B;  1JY2 O;  2P7J A;  2KB7 P;  1X8Y A;  4JQ0 D;  4RES B;  2KYV A;  2XZR A;  2XRX A;  2NWF A;  2B87 A;  3NFQ A;  4OVN F;  4KJM A;  1SFC D;  2K1A A;  1IZN B;  3H1L J;  1SP4 A;  1PGJ A;  1GK6 A;  2A06 G;  2YFJ A;  1G2C A;  1PGO A;  5K5G B;  3H1H G;  1LTA C;  3GLM A;  1S5L E;  1YJ9 P;  4WY4 D;  2YFI A;  1NAF A;  3AE8 C;  3H1J G;  3TGU J;  5CCH D;  3H1I E;  5KTB A;  1CI6 A;  3OAK A;  1MZ9 A;  1KYO H;  1AA0 A;  1S3J A;  4NPD A;  1KIL B;  2BCC E;  2Y0E A;  2Q5U A;  1JM0 A;  4HM0 A;  1RF1 A;  2YO2 A;  1NVO A;  2R3C A;  2IZ1 A;  1AFO A;  3A2A A;  5AW1 B;  1AQT A;  3IR9 A;  2HG5 D;  4H13 B;  4IL6 H;  4ZKP A;  1BE3 G;  1LTT C;  2KIK A;  2GBX A;  2D2C C;  2XNX A;  2FXO A;  5KAI E;  1NTK E;  1ZME C;  1NYH A;  2IDB A;  2DE7 D;  3L73 J;  3TSI A;  1BCC E;  2L91 A;  5BU5 A;  4D6T G;  1RQU A;  1L0L J;  4QMA A;  3FWL A;  1BGY J;  4ZMD A;  3B5N D;  3LW5 H;  2IBZ I;  3R2P A;  3IN6 A;  2HML A;  3GHG C;  1AVO A;  4M3L A;  1NTK K;  2QSI A;  2H8P D;  1DD4 A;  2FYU E;  4HKZ H;  3L4F A;  2ZXX A;  3MGN A;  1S1C X;  3H1J D;  4I6M C;  3D6Y A;  2E76 B;  3LID A;  4ASV A;  4NBC D;  2P58 A;  1FBM A;  4D6T J;  4WY4 A;  1PPJ D;  4WBA A;  1VM9 A;  3V4W A;  2B1X A;  3B4S A;  1PFI A;  2FY8 A;  5CXM A;  2G8Y A;  1ULJ A;  1JB0 J;  1FOS F;  2K37 A;  1N7S B;  1H0T A;  1JOC A;  1L0N D;  1KFN A;  1A02 F;  2YXQ B;  2GUS A;  5AVT B;  1N2D C;  3LIE A;  1MUU A;  4NBD D;  1LTJ A;  3CCR P;  3MUD A;  3QH9 A;  5AW3 B;  5B66 H;  2OYO A;  2POH A;  3KZI E;  2BCC J;  3IF4 A;  3VOP A;  3H1L G;  1FZC A;  2WSC H;  1FOS E;  2VRS A;  1AJY A;  1EXJ A;  3L72 E;  4IFM A;  1O7G A;  3FGA D;  3L70 J;  5BOK A;  4O9B A;  1ZN5 A;  3AED C;  5BVZ A;  3GL2 A;  5AVS B;  3CC4 P;  1GMJ A;  4H0L D;  1PL5 A;  3MZW B;  1KIL E;  3CCE P;  1WRG A;  1OVR A;  3RK2 D;  2W90 A;  1PP9 E;  1EXI A;  4AUW A;  1W2B O;  1IFD A;  3HE5 A;  4KHX A;  2K9J A;  1DH3 A;  2M0B A;  3L71 G;  3FXE A;  3M9H A;  3Q2Y A;  1SJG A;  2Q9I A;  2AEF A;  3VMZ A;  1FZC C;  1XTC C;  1KV4 A;  2Y0C A;  5KAF H;  3ITK A;  1H89 A;  5GTI E;  1LP1 A;  1IK9 A;  2DW3 A;  1M57 D;  3AEB C;  1MV8 A;  3V2N A;  1Q90 C;  3BVH A;  1S5L X;  4HJG H;  4NBH D;  2C0X A;  2AEJ A;  3CXH I;  3D6Z A;  2JZA A;  1P84 E;  1Y47 A;  2WSF H;  1U57 A;  3GL0 A;  2JJL A;  1LNQ A;  2QRX A;  4GOD A;  1PPJ G;  3L71 J;  2QJY B;  3U1A A;  2XSH A;  5CCG A;  1WT6 A;  3P8C E;  2BAS A;  3H1H J;  1RE3 A;  1G2C B;  2WMM A;  2ZYD A;  3U1C A;  1LTJ C;  3CL3 D;  2B88 A;  1ZR2 A;  1SFC C;  1QL1 A;  1FU1 A;  1HBW A;  3P8M C;  3C0D A;  2IX7 C;  3RL0 D;  2NPS A;  4JYC A;  4PD4 I;  2K88 A;  1IFJ A;  4R4M A;  1A02 J;  1Q7Y Q;  1M90 Q;  1VCK A;  1OW8 A;  1CZQ A;  1QL2 A;  1MKM A;  1L4A C;  5APU A;  1DX7 A;  2B87 B;  1YQ4 C;  3HTK A;  2KSJ A;  4JF7 A;  1KB9 H;  4GIF A;  1LGH B;  4I7Z C;  1QVG O;  4DT0 A;  1O7M A;  5AVX B;  2BEQ D;  4OGQ B;  1JCD A;  1LT9 B;  2IFM A;  4WY4 C;  4XE5 B;  2N1T B;  2OQQ A;  1M1J C;  1T8Z A;  5DJU B;  2R32 A;  1X79 B;  4IL6 E;  1RIE A;  4UB8 E;  1OVU A;  2BMO A;  2WTY A;  3L72 D;  4IFF A;  3BCC E;  1LTG C;  1MFZ A;  3L73 E;  1YTZ I;  3P32 A;  3ZDM A;  2IFN A;  3MP7 B;  3R4Y A;  4HH2 A;  2D2C B;  1JY3 N;  4NBA D;  2YKO A;  1WQL A;  1OWA A;  2WT7 A;  2NPS C;  3GG2 A;  2NUM A;  1JTH A;  1SQQ J;  1GTW A;  2HOD A;  2OYI B;  1LT1 A;  1HJ0 A;  3CX5 E;  2DE6 D;  1RF0 C;  2HMO A;  1URQ A;  2ZT9 B;  2Q3W A;  2ZT9 D;  2M3B A;  2N9Y B;  2L5G B;  3CCS P;  2NVF A;  1FQT A;  1NU1 G;  5KLV D;  4WY4 B;  1LTS C;  2BMQ A;  1X9V A;  4PD4 H;  3L70 G;  1GU4 A;  1KIL C;  4R4L A;  4OWF A;  3T97 A;  4HM5 A;  3GW6 A;  1KD1 Q;  4QCK A;  1HTL C;  1FS0 E;  2QJK B;  3GTE A;  5H2F H;  3C1L A;  3N0Q A;  4N6J A;  2IBZ E;  3V5B A;  1UUW A;  3II6 A;  3SWY A;  2QG4 A;  3W67 A;  1K73 Q;  1W5C E;  2JKV A;  3S4R A;  2K9Y A;  5AVV B;  3GB4 A;  4N3Y B;  1P84 D;  1T3U A;  3CWB D;  3VCA A;  3A3Y B;  4WB4 A;  1FC2 C;  3MD0 A;  2O3J A;  1EZV E;  2O01 H;  3Q3D A;  5KJ7 A;  1KQF B;  5DJT B;  1NAY A;  5GTI H;  2B24 A;  2BMR A;  1FZG A;  1DEE G;  2Q6Q A;  5KKZ B;  3V2P A;  3Q5S A;  3EFF K;  3OJA B;  3HRN A;  4K35 A;  1RFS A;  2QPZ A;  3RL0 B;  1NTK J;  5AW6 B;  1FZA A;  1J1E B;  3GZY A;  2JWA A;  1ZP0 C;  5AVQ B;  3A5T A;  2H88 C;  3CCU P;  1O7W A;  1PPJ E;  3HE4 A;  2ZYG A;  4PV1 C;  1NTZ K;  1L0N E;  1URQ C;  1KB9 D;  5KKZ C;  2LXC B;  1VQO P;  1RY3 A;  3EQ2 A;  3A0H E;  4L75 A;  3CMA P;  2W27 A;  1D7M A;  3SFE C;  4IFD K;  3I55 P;  4EOT A;  1FDM A;  5AEW A;  3HUS A;  1E5W A;  4TT3 H;  3AEG C;  2R44 A;  3HE5 B;  2E5T A;  4BRY B;  2XU6 A;  3RK3 C;  4D6T E;  1KMI Z;  3D89 A;  3HTK B;  4IL6 X;  2HMJ A;  1EG9 A;  1DEB A;  3TDK A;  1NU1 E;  2GM4 A;  2OYH A;  1Y9B A;  4DOJ A;  5CCH A;  2IYO A;  1U7J A;  1RH5 B;  5KAI H;  1T3J A;  5BU8 B;  1RE4 C;  3HE4 B;  3JCU E;  2KOG A;  1IFP A;  3KYQ A;  4KT0 J;  3RL0 C;  1KYO D;  3TYY A;  3KXD A;  5KLV K;  1SFC A;  2W8Z A;  1DIP A;  2WPS A;  2OYI C;  1OIP A;  3H1K E;  4EYY Q;  1SQB E;  4P1C H;  1HGV A;  3EQQ A;  2V4H A;  1T6A A;  1L4A D;  5AVW B;  2N1T D;  1Q86 Q;  1VQK P;  3T97 B;  2YKP A;  3HD7 C;  1N7S C;  1NO4 A;  3VCP A;  2IBZ D;  2IPP A;  1M1J A;  2E74 B;  1RE3 C;  5B5E E;  5KJ7 C;  1OXZ A;  4W80 A;  3Q5R A;  1HGZ A;  1JY2 N;  4L76 A;  3VTP C;  1RF1 B;  3HUS B;  2Y9Y A;  2E5Y A;  3AE9 C;  1EZV G;  2SPZ A;  3H6P A;  5E79 E;  1VQ9 P;  2HOD B;  2HPC A;  5KLI B;  1J1D B;  1LWU B;  1NKN A;  2AXC A;  5M1B A;  1SQX K;  3L36 A;  1KTM A;  1KC8 Q;  3B8E B;  1VQ8 P;  1GW4 A;  1JY2 P;  2KLV A;  3LW5 J;  2WSF J;  2KI7 B;  5TJH A;  2YVJ B;  1J1D C;  4ZKU A;  1SQV G;  2M5A B;  2FYN B;  2GBW A;  2O01 N;  1NTM G;  4H44 C;  1NTM J;  2PAJ A;  3FWN A;  3AEC C;  1JY3 O;  1YIJ P;  3L74 E;  2E74 C;  2A45 G;  3M9Q A;  1RF0 A;  2WPQ A;  2NRG A;  3VMH D;  2RKL A;  2Q3I A;  4NBG D;  2KS1 A;  2C9N Y;  1LWU A;  1OFC X;  1BE3 E;  1KOR A;  5AW2 B;  2IZ0 A;  1SQV J;  2W6J H;  1M1J B;  2PP6 A;  3CME P;  2CKF A;  3GZX A;  1J1E C;  5KAF E;  4EI2 A;  3AE1 C;  4NBE D;  2MKV A;  1NGM B;  1OW6 A;  5APY A;  3UIA A;  3CC2 P;  1VQL P;  1QGK B;  1SQP E;  2D2C D;  3CXH E;  3D70 A;  3EWK A;  1N8R Q;  3GCE A;  4WVZ A;  1X22 A;  3B71 A;  1KB9 I;  4OGQ C;  2MJZ A;  3H1H D;  1TU3 F;  1NTM K;  3K5B A;  2NVE A;  4TLF A;  1NH4 A;  2HFE D;  5C39 A;  3H1L E;  4XA4 A;  4YPC A;  4N78 E;  2QJP C;  2A06 E;  3L71 D;  2OYH B;  1H0T B;  1SQV K;  1OMI A;  4RO0 A;  1SFC B;  4HKV A;  1JM1 A;  5GTH E;  2FYU D;  1GL2 C;  2KUB A;  4C7N A;  2OGU A;  2CPB A;  4RKU J;  1SQQ E;  5APT A;  4PV1 B;  2A06 D; 
#chains in the Genus database with same CATH homology
 1WQL A;  1NTZ E;  2B24 A;  2BMR A;  3H1K E;  2I7F A;  2QJY C;  3VMI D;  1O7P A;  2NUM A;  2HMN A;  2XSH A;  1SQV E;  1SQB E;  4P1C H;  1G8J B;  4NB9 D;  2E74 D;  4HM3 A;  3EQQ A;  1RFS A;  3VMG D;  5HL4 A;  2YIU C;  2QPZ A;  3L74 E;  2E75 D;  3CX5 E;  2DE6 D;  3GOB A;  2E76 D;  4HM1 A;  2HMO A;  3GZY A;  5KLV E;  4HM2 A;  3VMH D;  4NBG D;  2Q3W A;  3L72 E;  2ZT9 D;  2HMK A;  2XSO A;  4AIV A;  1O7W A;  1PPJ E;  3L75 E;  2NVF A;  1FQT A;  2GBX A;  2ZYL A;  4OGQ D;  5KLI C;  4AAY B;  1O7G A;  1BE3 E;  1L0N E;  1NTM E;  3C0D A;  3H1H E;  5BOK A;  1NTK E;  2BMQ A;  3VCP A;  2DE7 D;  3GTS A;  3FOU A;  5KKZ C;  1BCC E;  4HJL A;  1NYK A;  2E4P A;  3GL2 A;  1ULI A;  2CKF A;  1VF5 D;  4HM5 A;  4EMJ B;  3GZX A;  2YFL A;  4H0L D;  4NBE D;  3AZC A;  1VCK A;  2NVG A;  4QCK A;  1SQX E;  1ZRT E;  2HML A;  4HM4 A;  2XRX A;  5AEW A;  3GTE A;  4HM7 A;  1PP9 E;  2NWF A;  5AEU A;  1SQP E;  2D2C D;  4PV1 D;  3DQY A;  3CXH E;  4NBB D;  3CWB E;  3GKE A;  3GCE A;  2E4Q A;  3TGU E;  2FYU E;  2HMM A;  4QUQ A;  3N0Q A;  2IBZ E;  4D6T E;  3L71 E;  3L70 E;  2FYN C;  3D89 A;  2YFJ A;  1O7M A;  1UUW A;  2XR8 A;  2HMJ A;  1EG9 A;  2JO6 A;  1SJG A;  1NU1 E;  3H1J E;  4QUP A;  1NDO A;  2NVE A;  4NBF D;  2NUK A;  4QDC A;  4NBC D;  2YFI A;  1KYO E;  3GB4 A;  4QUR A;  1RIE A;  3H1L E;  4QDF B;  3H1I E;  4HM8 A;  1VM9 A;  4QDF A;  4HM6 A;  2QJP C;  2A06 E;  1BGY E;  2B1X A;  2BMO A;  1Q90 C;  4U3F E;  2DE5 D;  2YVJ B;  4HKV A;  1JM1 A;  4NBH D;  3VCA A;  5CXM A;  1ULJ A;  3BCC E;  2BCC E;  2JZA A;  1UUV A;  3L73 E;  1P84 E;  4NB8 D;  1O7N A;  4QDD A;  1SQQ E;  4H13 D;  4HM0 A;  1KB9 E;  2QJK C;  1EZV E;  2GBW A;  4NBD D;  3GL0 A;  4H44 D;  1O7H A;  1G8K B;  4P1B H;  3EN1 A;  1L0L E;  4NBA D;  4PD4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...