1SQQE

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqqE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqqE02
5KLVE 3H1IE 3L74E 4QDDA 2D2CD 4HJLA 4PD4E 2HMMA 2BCCE 3GL0A 3GKEA 2XR8A 2XSOA 4HM8A 2B1XA 2Q3WA 4QUPA 1NYKA 4HM4A 2GBXA 1O7HA 1SQPE 1VCKA 1VF5D 4HM1A 3GOBA 2XSHA 3VCPA 1SQBE 2DE6D 2QPZA 2YIUC 1RFSA 4NBHD 3GZXA 1NTZE 2JO6A 4NBED 1P84E 2QJKC 1EG9A 1JM1A 5AEWA 1SJGA 2BMOA 4HM6A 3EQQA 1O7MA 4AAYB 3GL2A 4HM3A 1O7WA 1SQQE 3L75E 4NBAD 3DQYA 5AEUA 2NWFA 1RIEA 4HM0A 1SQXE 1KYOE 2YFJA 1O7PA 3VMGD 4AIVA 2HMKA 2A06E 3H1LE 3CXHE 1BCCE 3L73E 4D6TE 3GB4A 1UUVA 2JZAA 1G8JB 2QJYC 3N0QA 4QCKA 3CX5E 2HMLA 4H13D 3H1KE 2FYUE 1FQTA 2YVJB 2FYNC 1ULIA 1EZVE 3GCEA 4HM7A 5KLIC 1WQLA 3VMHD 1VM9A 1BGYE 3GTSA 2B24A 2ZT9D 2YFLA 1L0NE 5BOKA 4U3FE 2BMRA 3L71E 2E4PA 4NBBD 4NB9D 1NU1E 2E76D 4NBFD 3CWBE 3FOUA 3VCAA 2HMOA 4PV1D 3VMID 1O7GA 1PPJE 2XRXA 5KKZC 3C0DA 3GTEA 2E4QA 2NUKA 2NVEA 2ZYLA 4EMJB 3GZYA 3EN1A 4P1BH 3AZCA 1NTME 5HL4A 3L72E 1O7NA 2BMQA 4NB8D 1L0LE 2YFIA 1SQVE 1PP9E 3TGUE 4QDCA 2E74D 2NUMA 2I7FA 4NBCD 1BE3E 1ZRTE 2QJPC 2E75D 4NBDD 2IBZE 2HMNA 2HMJA 2NVFA 4OGQD 4QDFA 3L70E 1Q90C 3BCCE 3D89A 1KB9E 4QURA 4QUQA 3H1JE 2CKFA 4P1CH 4HKVA 4QDFB 4HM2A 1NDOA 2NVGA 2DE5D 4H44D 4H0LD 2DE7D 4NBGD 5CXMA 3H1HE 2GBWA 4HM5A 1G8KB 1ULJA 1UUWA 1NTKE
chains in the Genus database with same CATH superfamily
2GUSA 2D2CD 3GKEA 2IZ1A 3RL0g 1L0LD 4AUWA 3II6A 1S2EA 1LTIC 1L0ND 1WMKA 1EG9A 3CC4P 5AEUA 1CI6A 2JDIH 2K9JA 5L8RJ 5KJ7D 1KILD 3NXSA 3H1LE 4N3YB 2P7JA 4GOEA 2WPRA 2AXTH 1PP9D 1J1EC 3V2PA 4ASWA 2Q5UA 3H1JD 1YJNP 1FBMA 3MUDA 1PPJE 1JY2N 4I7ZB 3C0DA 1SQQK 4PJ0H 1MFZA 2AEFA 1SFCB 3EN1A 1VQPP 1VQKP 3RK3B 2WWWA 4RKUJ 1KN7A 5CBOA 1LP1A 2M5AB 3PRJA 4I6MC 3KHUA 1J1EB 4R4LA 1ZMEC 3KZIE 2E75D 2HPCA 2HMJA 2VRSA 1KFMA 3BCCE 1KB9E 3VOPA 1KYOD 4U7JA 4ZMDA 3HTKB 5KLVE 3H1IE 3L74E 1XTCC 3B5NA 1USDA 2B1XA 1LT9A 3CCSP 4OGQC 3CMAP 4L75A 3GOBA 1P84I 3V4QA 4Z1MH 3A0HE 1GZLA 3EFGA 2E42A 3CCJP 4IL6H 2BMOA 1R5LA 3PHLA 1LNQA 1SQXE 2CPSA 3P8CD 3WUUA 3CX5I 1LT1A 2WITA 1U7MA 2FKWB 3WUVA 3AE7C 5B5EE 1TU3F 3O6QA 1N86A 1BE3D 2HFED 1JO5A 1OWAA 1G1IA 1ULIA 2WSCH 2M8RA 3CC2P 3FGAD 2QE7H 2E76D 2Q3EA 4EYYQ 1RQUA 4GIFA 3KZIH 3S9OA 3BVHA 4P1BH 3CXHD 1KB9H 2Y9YA 3L37A 1RQVA 1GTWA 1HGVA 2H89C 4NBDD 1M1JC 2V4HA 1M90Q 1KC8Q 5KJ7A 1KILA 3AE8C 2P1JA 1IZNB 1KZUB 1LTGC 1SQQJ 3KQGA 3H1HE 3L73G 2L91A 5AVQB 3A0HH 2FYUG 2G3AA 4ZKPA 3V2NA 2I1JA 3GG2A 3H32A 2E43A 1DIPA 1EZVD 1SQPE 1MKMA 3C1LA 1S3JA 1OXZA 1GL2A 3F89A 4XFJA 2XSHA 1FJKA 2E75B 1M1JB 2E5YA 2POHA 4EIJA 2WSFH 4IOIH 5B5EH 4JYBA 3L73J 3SWFA 1RHZB 2BASA 3HE4A 2FXMA 4AQRD 1IJDB 3FWNA 3TGUD 1BGYG 1VF5C 4H13D 1ZXGA 1FQTA 1URQA 1VQNP 2R44A 3M0DC 3BRVB 1IFJA 5APSA 2BMRA 1VQ9P 1NTMG 4NBFD 1Q90D 2YKOA 1J1DC 2QA4P 4RESB 1HTLC 2OYHB 1KFNA 3RK3E 1FZFA 1FOSF 2C9NY 2O01N 3AEDC 3SWKA 2P58A 1FOSE 3CD6P 1PV3A 3H1KD 1E79H 3KDPB 1LTSC 1EDLA 1FZGA 3L75D 3D89A 4QURA 4NPDA 4BRYB 4RJTA 1SQXK 1NVOA 4OWFA 3B71A 1FAVA 3CWBD 4NBGD 2WPVB 3H1LG 1NU1K 4JYCA 2E76B 2JP3A 1G8KB 1K04A 1RE3A 4W7YA 1YTZT 4EI2A 2IZ0A 1LWUC 3CMEP 2QPZA 1BSNA 1RH5B 3GZXA 2QJKC 1AFOA 1NU1D 3NMDA 3W67A 1M1KQ 4U3FJ 2RN0A 1QVGO 2JKVA 3H1LJ 1BCCE 1ZLLA 1PIXA 3TK1A 2KS1B 2NZ2A 1K8AQ 3TSIA 3GCEA 1A02F 3BCCG 1LWUB 1S4XA 1L0NE 4I1LA 2WPSA 2QJKB 1MFTA 2WSCJ 3VMID 2AEMA 1LTJC 3CCVP 4GOFA 3H1IG 3L74G 5KLVG 2B87B 3SSUA 4NPFX 1O7NA 4OVNF 2KZJA 3FX0A 1PP9E 2NUMA 3F5HA 1NO4A 4H13B 1T2KD 1IFMA 1KTMA 2B87A 3P7KA 2HMNA 4B86A 5CBNA 3GHGC 3BCCJ 4KT0J 1OW7A 3M9BA 5AVTB 2JJLA 3H1JE 1SQXG 1NTKG 2B9BA 2NPSD 1NDOA 3D6YA 1YIJP 3HE5A 2DE7D 2OYOA 2Y0CA 5AVZB 2W90A 1GK4A 1NKNA 5KLVJ 3L74J 3G71P 4C46A 3GF7A 1QGKB 2GBXA 2LXBA 1SP4A 1T3UA 3L71D 1S9KD 4DJGA 2ZXXA 4H0LC 1LTTC 1QLED 1RF0C 3VYIA 4D6TG 4CPGA 1SQQE 1SQXJ 2O01H 2YIUB 4KJMA 1W2BO 4WY4C 1KYOE 2OARA 4IFMA 3PH0A 3I5CA 2WSFJ 3N0QA 1OW6A 2KNCB 2Q6QA 1HJ0A 1PZQA 4IL6X 4C7RA 3A7OA 1NTZK 2FYNB 2JEEA 3CCEP 3H1HG 4KHXA 4HH2A 2KNCA 3GTEA 1YHQP 1EC5A 2PGDA 3ZDMA 1SQPG 1UIXA 3IFMA 2YFIA 2WT7B 2E74D 3B5ND 1SQBD 2YMYA 5CCHC 3G6EP 1GU4A 1BE3E 1NTZD 1P84D 4QDFA 1G2CB 1MV8A 2R5DA 1DX7A 3AE3C 1GMJA 3A3YB 3TNUB 1NKZB 1AQTA 3H1HJ 3RL0D 4JF7A 3V6IA 3G3ZA 3P32A 1S5LE 3CX5D 5AVWB 2OTLP 4XA4A 1SQPJ 1CSBA 4QUPA 1L0LK 1GW4A 2QM7A 1KYOH 3BATA 5AW3B 3M0AA 4HM6A 2WMMA 5AW1B 4GT1A 3MUDC 3N7NA 5K5GB 2WSSH 2P2UA 2NPSB 4LC1A 1U7JA 1CI6B 2K9JB 2QVAA 5GTIE 1QX8A 3IAOA 1EZVE 3MP7B 5E79H 2NPSA 4I7ZC 3GF3A 2QJYB 1Q82Q 2B89A 2ZT9D 1YBKA 1SFCC 4U3FE 3AE9C 4IFDK 3PJSK 1ZR4A 1LJ2A 3RK3C 1JCDA 1N7SD 5APVA 2Z5IA 4IL6E 2M3EA 2NVEA 2KUBA 1FZCA 1JTHB 3AEAC 1Z56A 2C0XA 3Q1MA 2W83C 4YPCA 3TGUE 2BEZF 3GMAA 2I7FA 4NBCD 2H88C 1GL2D 4ZKUA 1OIPA 1LP1B 1EXIA 2XDJA 2W8ZA 1JTHA 3PP5A 2K3RA 1S5LH 5BU5A 2HPCB 3CXHH 1BCCG 3NFQA 3RK2D 1VQ8P 5AW2B 4HB1A 3M06A 2BCCE 3I55P 4DOJA 4HM4A 4JQ0D 3Q5RA 2H8PD 3B8EB 2FXPA 1Q86Q 1HH0A 1L0NG 1URQD 2E74B 3B5NB 1LT9B 5AEWA 3BRTB 4HM3A 3L75E 5GTIH 4AIVA 2D2CC 1BCCJ 1M7LA 3RL0B 1PP9G 1AVOA 2O01J 2A45G 1K73Q 2HMLA 3CL3D 1L0LJ 3MIWA 3PTZA 5KTBA 2W6BA 3Q5PA 1K9MQ 1QL1A 1L0NJ 3H1JG 3O6QB 1A02J 2Q9IA 2I8DA 3MD0A 1L4AD 1NU1E 5KJ7C 1KILC 5KLIB 1HF9A 4PV1D 1KMIZ 2HYNA 2ZJSE 1N73A 3IF4A 4Y28J 1DEEG 3AEEC 3T97A 2IBZG 2D2CB 3L73D 1PP9J 3CCQP 2WTYA 2FYUD 2FFDB 2OTKE 3V2RA 4M3LA 3Q5SA 1SQQG 3H1JJ 2NRGA 2WVRA 3OA7A 2WPQA 2ZT9B 1Y9BA 2BEQD 2JO1A 2FFDA 2J58A 1N7SB 1KILB 2RMZA 3M91A 2V7QH 4QDDA 2RH0A 1Q7YQ 5CJ0A 4HM8A 3WMM0 2O1KA 2E75C 4YXWH 3JSVC 3D6ZA 1N7SA 1BGYD 3H32B 1GL2B 1RY3A 1SVFA 3GL2A 2NWFA 3S1KA 1NTMD 1PFIA 2A06E 2YXRB 1VQ7P 3RK2B 2JZAA 2FBWC 2ZYGA 1BE3G 1ZRTD 3HE4B 1WT6A 1EDJA 1IFIA 2A45I 1VQLP 4XE5B 3HD7D 2OYHC 1FE6A 2N1TD 3OJAB 1URQB 1FDMA 3L71E 3V4WA 1DD3A 1XTGB 1S9KE 1O7GA 3RBXA 3R2PA 3L72E 2KYVA 3G9RA 3TYYA 2G8YA 4W7ZA 1BE3J 2IBZI 3N4XA 2KLVA 2R32A 4EOTA 3M9QA 3FXEA 2E76C 4GKGA 2GM4A 2FYZA 3MGNA 3G4SP 5AVYB 4O9BA 3AE2C 2HG5D 4PD4I 2IYPA 1HBWA 2WZ7A 1KQSO 5CHXA 1IFDA 2KP8A 2OTJP 3Q3DA 2XSOA 1EZVG 1NYKA 3EQ2A 1L4AA 2IX7C 4HM1A 3VCPA 1SQBE 4HJGH 4U3FG 2OYIA 4Y99C 1NTZE 1P84E 1RE4A 3EQQA 1JUNA 1KB9D 2PFXA 1O7PA 1JOCA 1AQ5A 1SS1A 3TGUG 3CX5E 3H1ID 4YTPC 1YQ4C 3VP8A 2GA1A 4JPZB 1IFNA 1PPJG 2Z4EA 1VM9A 2W6AA 3AE4C 3P8MC 4Y99B 4WB4A 1W5CE 2HMOA 2XRXA 1OZHA 3CLQA 2NUKA 1NTKD 2BCCG 4H13C 4UB8E 1DD4A 3TGUJ 1Q2NA 1L0LE 5APUA 1PGQA 2LXCB 1IK9A 2YXQB 1RF1A 3CC7P 3QWOC 1VQOP 1YTZI 2Q7CA 5APXA 2KK7A 1JB0J 4HKZH 1BDCA 2IFNA 3L75G 1Q90C 1YJ9P 4P1CH 1AA0A 4H44D 1KILE 2Y0EA 1LTBC 4D6TD 3W68A 2BCCJ 1P84H 3VMAA 3HE5B 2Q3WA 3HD7A 1CZQA 2N1TA 3CCMP 1VCKA 3HUSA 1SQVK 2W27A 2XU6A 1PGJA 2YIUC 3A5TA 1H8AA 1S5LX 2V7QJ 1HWTC 4RO0A 1JY3O 1HGZA 5CCGD 1NU1G 2E5TA 2KIKA 1JY3P 1OFCX 3L75J 1SJGA 2WSEH 3CX5H 1JMBA 1HVVA 4LLHA 5DJTB 2DW3A 5AVXB 3R4YA 1FDIA 2JWAA 1X79B 1SQVD 1YITP 1G8JB 3U1CA 1VQ5P 1NAFA 2FYNC 1X9VA 1SQPD 3KXDA 1KQGB 3VMHD 3L70D 1NU1J 2IFMA 4UB8H 2E4PA 1JMMA 5KKZC 1LGHB 1LTJA 2OGUA 3I56P 2ZYDA 5HL4A 2PP6A 1H89A 3VMYA 1HJBA 1SLQA 2K1AA 4AYCA 3C8VA 1AJYA 1SQBK 3ABVC 3B4SA 3AEGC 1VQMP 1KB9I 3GHGA 2ZXEB 2ITAA 5E79E 3CCLP 1GU5A 5KAIH 4QDFB 3P8CE 2A06G 3CPWO 1ZV8A 1NAYA 5KKZB 1ULJA 3A0BH 5GTHH 2QM8A 1NWQA 2XNDH 5M1BA 1T2KC 1O7HA 2KSEA 2M3BA 1USEA 1X22A 2R3CA 3L71G 2JO6A 2NPSC 2J59M 1IFPA 4BXLA 1O7WA 1FU1A 1RIEA 4HM0A 5APQA 1NH4A 3VMGD 4WY4A 2KLUA 3JCUE 3L72G 4K3AA 2XKMA 4H44B 3CXHE 2QJYC 4QCKA 2Q3IA 2RKLA 2R3SA 1ZOYC 3LIDA 2LR2A 4WVZA 1BGYE 1FZEA 3L71J 4NB9D 1GD2E 1KQFB 2LKMA 3L72J 3OAKA 1NTME 4R4MA 1N8RQ 1VQ4P 2Q1KA 3SFDC 5CCGA 1SQBG 1YQ3C 1FZCB 1NTZG 2JR8A 4L74A 1ZRTE 2QJPC 5CCHA 3K5BA 4OGQD 2XNXA 1Q81Q 3L35A 5C39A 5B66H 2JWDA 5CXMA 2K9YA 4N6JA 3WU2E 2E74C 3B5NC 1LT9C 2QSIA 2M0BA 5AVRB 1EXJA 1SQBJ 1NTZJ 3JCUH 3MTUE 4UB6E 1S72P 1OVVA 5TISE 2QJPB 1JM1A 1ZP0C 2HR3A 3V2QA 3RL0C 3E7KA 3BASA 3AEFC 1S1CX 3VP9A 2YFJA 2KXPB 1IO4A 2KZIA 1AVYA 1VPCA 1L0LG 3GLMA 2WSEJ 1N73C 1UUVA 5EFWB 2C9LY 2K88A 3U59A 1R5SA 3H1KE 2IBZD 2YKQA 3WUTA 5KLIC 1KD1Q 5H2FE 4I2LC 2YFLA 1JY2O 2N9BA 1SFCA 2O3JA 3CWBE 1JY2P 1SQQD 1YI2P 1OX3A 2M5AA 2HLOA 2FFDC 4PD4D 4DT0A 1M56D 2C0WA 1EDKA 4NB8D 3D70A 1G1JA 5AW5B 3PLNA 1N73B 1VQ6P 3AE1C 1L2PA 1KORA 3NTNA 3KYQA 1NYHA 3T97B 1JCCA 2ZT9C 2B88A 2FYUK 4N78D 1N7SC 1HUCA 1EQ7A 4WWIA 3WU2H 3GW6A 4QUQA 3O8ZA 1WRGA 1BSHA 3HTKA 2WQYC 4HM5A 5AVSB 4UB6H 1NTKE 4OH8B 3D71A 5TISH 4HJLA 2XR8A 2YKPA 1GL2C 2UWJE 3UIAA 3L36A 4LGDE 1VF5D 1M57D 2DE6D 1DH3A 4OGQB 1VDFA 1Y47A 5AW6B 5BVZA 5KAFE 3RK2C 4NBAD 1NTMK 3USSA 5CJ4A 5H2FH 4D6TE 4MN4C 1X8YA 2N9YB 2ZVNB 4C7NB 1URQC 2P67A 3TDKA 2PRRA 3CCRP 5AW0B 2FXOA 2B24A 1JEKA 3TF5A 4C7NA 1U57A 1YJWP 2E4QA 1OMIA 4BWNA 1NOHA 4EMJB 2QG4A 3GZYA 2KOGA 5CMZA 2BMQA 1X0TA 1SQVE 3LW5H 2I1KA 3C9IA 1NGMB 1L4AC 3L70E 2OYIC 4PV1C 4GODA 2YO3A 2J5UA 1RE4C 4U3FD 2CKFA 5DJUB 3AE5C 2DE5D 1N7LA 2GBWA 3H1LD 1RE3C 2QEXP 2HODB 3Q2YA 3L4FA 5AVUB 2IDBA 5KAFH 4ZNCA 1M1JA 2ZAEB 2PAJA 2FYUJ 3H6PA 2Y9ZA 3A2AA 2HODA 3RGUA 1L4AB 1JM0A 1E5WA 4AAYB 1PPJD 1KYOI 1H88A 2OYIB 4PV1B 1W2EA 2YO2A 1NHLA 4L76A 1CW5A 3QH9A 1FJPA 3ITKA 4WBAA 2O1JA 1LTAC 1PGOA 2BCCD 5KLVK 2KSJA 1DEBA 1WQLA 1EDIA 1BGYJ 1RF1C 3BCCD 3V5BA 1VF5B 1IC2A 3GTSA 4HYTB 2OYHA 3H25A 3MHVA 4TLFA 4NBBD 1ZN5A 2KB7P 3LIEA 2YMKA 3JC22 1YYCA 1FZBA 1NTMJ 2ZYLA 5KLVD 3L74D 3EFFK 1NTKK 2H7HA 3RBZA 3FWLA 4DZOA 1J1DB 3SFEC 2H43A 2KI7B 4QDCA 3M0DA 2R5BA 5AW9B 3HD7C 4BRYA 2N1TC 3HUSC 1UIIA 3FXDA 1RF1B 3E1RA 1BDDA 3HRNA 3MZWB 1FZAA 1SQXD 1R8EA 1NJIQ 4HM2A 4H0LD 3E1IA 1T3JA 4WY4D 2CK3H 3IR9A 2L5GB 3H1KG 3CXHI 2HMMA 3GL0A 3VTPC 1ZR2A 2ZFCA 1RFSA 1QEXA 1FC2C 4NBED 3HD7B 2N1TB 3CWBG 1GK6A 3HUSB 4JBZA 3OW2O 1JY3N 3SWYA 2YNYA 1H0TB 3DQYA 1J2JB 2HMKA 2KS1A 5KAIE 3AECC 2ZVOB 4L73A 1K05A 3H1KJ 2ZYAA 1LWUA 1H0TA 3A0BE 1EZVI 5GTHE 4DCKA 2YVJB 3AE6C 2FY8A 1SQPK 2IPPA 3U1AA 5CCHD 1GDTA 4TT3H 3VMXA 3CWBJ 1MZ9A 5BU8B 2XZRA 3H1HD 4EDFA 1T8ZA 1ZW0A 1IK7A 3AZCA 4K35A 2A06D 2XV5A 1LTJB 3H1IJ 2AEJA 3CI9A 2IBZE 1MUUA 1N2DC 1OVRA 1PL5A 3M9HA 1Y8AA 4NPEA 1OW8A 3LW5J 4A7PA 3GHGB 1NTKJ 1UUWA 1FS0E 4ASVA 1OVUA 1KV4A 4PD4E 3L72D 1PGPA 5AVVB 5AW4B 2K37A 2AXCA 2IYOA 3VN0A 4NBHD 5TJHA 4YXDC 2P10A 4H44C 4N78E 1O7MA 2Z5HA 1QVFO 1SFCD 2MJZA 5AW7B 3RK3D 4GDOA 3AEBC 5B66E 4D6TJ 2CPBA 5AW8B 4H0LB 3L73E 1SQVG 3GB4A 1AV1A 2A45H 4WY4B 5APYA 2FYUE 1GW3A 2GUVA 5CCGC 4HM7A 3L70G 1RF0A 2AXTE 5BOKA 4W80A 1D7MA 5APTA 3FOUA 3VCAA 3EWKA 1M8OB 4QMAA 1VL2A 3IN6A 3VMZA 2WT7A 1T6AA 1FZCC 2QRXA 4IFFA 3KPEA 1SQVJ 1G2CA 2OQQA 3TNUA 2MKVA 4PJ0E 5APWA 3S4RA 1FDOA 2NVFA 3L70J 2SPZA 1QL2A 2Y0DA 4PD4H 1JNMA 4HKVA 1L0NK 2NVGA 3CCUP 1BCCD 2W6JH 1KQLA 2QIWA
chains in the Genus database with same CATH topology
5KLVE 3H1IE 3L74E 4QDDA 2D2CD 4HJLA 4PD4E 2HMMA 2BCCE 3GL0A 3GKEA 2XR8A 2XSOA 4HM8A 2B1XA 2Q3WA 4QUPA 1NYKA 4HM4A 2GBXA 1O7HA 1SQPE 1VCKA 1VF5D 4HM1A 3GOBA 2XSHA 3VCPA 1SQBE 2DE6D 2QPZA 2YIUC 1RFSA 4NBHD 3GZXA 1NTZE 2JO6A 4NBED 1P84E 2QJKC 1EG9A 1JM1A 5AEWA 1SJGA 2BMOA 4HM6A 3EQQA 1O7MA 4AAYB 3GL2A 4HM3A 1O7WA 1SQQE 3L75E 4NBAD 3DQYA 5AEUA 2NWFA 1RIEA 4HM0A 1SQXE 1KYOE 2YFJA 1O7PA 3VMGD 4AIVA 2HMKA 2A06E 3H1LE 3CXHE 1BCCE 3L73E 4D6TE 3GB4A 1UUVA 2JZAA 1G8JB 2QJYC 3N0QA 4QCKA 3CX5E 2HMLA 4H13D 3H1KE 2FYUE 1FQTA 2YVJB 2FYNC 1ULIA 1EZVE 3GCEA 4HM7A 5KLIC 1WQLA 3VMHD 1VM9A 1BGYE 3GTSA 2B24A 2ZT9D 2YFLA 1L0NE 5BOKA 4U3FE 2BMRA 3L71E 2E4PA 4NBBD 4NB9D 1NU1E 2E76D 4NBFD 3CWBE 3FOUA 3VCAA 2HMOA 4PV1D 3VMID 1O7GA 1PPJE 2XRXA 5KKZC 3C0DA 3GTEA 2E4QA 2NUKA 2NVEA 2ZYLA 4EMJB 3GZYA 3EN1A 4P1BH 3AZCA 1NTME 5HL4A 3L72E 1O7NA 2BMQA 4NB8D 1L0LE 2YFIA 1SQVE 1PP9E 3TGUE 4QDCA 2E74D 2NUMA 2I7FA 4NBCD 1BE3E 1ZRTE 2QJPC 2E75D 4NBDD 2IBZE 2HMNA 2HMJA 2NVFA 4OGQD 4QDFA 3L70E 1Q90C 3BCCE 3D89A 1KB9E 4QURA 4QUQA 3H1JE 2CKFA 4P1CH 4HKVA 4QDFB 4HM2A 1NDOA 2NVGA 2DE5D 4H44D 4H0LD 2DE7D 4NBGD 5CXMA 3H1HE 2GBWA 4HM5A 1G8KB 1ULJA 1UUWA 1NTKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV E;  3H1I E;  3L74 E;  4QDD A;  2D2C D;  4HJL A;  4PD4 E;  2HMM A;  2BCC E;  3GL0 A;  3GKE A;  2XR8 A;  2XSO A;  4HM8 A;  2B1X A;  2Q3W A;  4QUP A;  1NYK A;  4HM4 A;  2GBX A;  1O7H A;  1SQP E;  1VCK A;  1VF5 D;  4HM1 A;  3GOB A;  2XSH A;  3VCP A;  1SQB E;  2DE6 D;  2QPZ A;  2YIU C;  1RFS A;  4NBH D;  3GZX A;  1NTZ E;  2JO6 A;  4NBE D;  1P84 E;  2QJK C;  1EG9 A;  1JM1 A;  5AEW A;  1SJG A;  2BMO A;  4HM6 A;  3EQQ A;  1O7M A;  4AAY B;  3GL2 A;  4HM3 A;  1O7W A;  1SQQ E;  3L75 E;  4NBA D;  3DQY A;  5AEU A;  2NWF A;  1RIE A;  4HM0 A;  1SQX E;  1KYO E;  2YFJ A;  1O7P A;  3VMG D;  4AIV A;  2HMK A;  2A06 E;  3H1L E;  3CXH E;  1BCC E;  3L73 E;  4D6T E;  3GB4 A;  1UUV A;  2JZA A;  1G8J B;  2QJY C;  3N0Q A;  4QCK A;  3CX5 E;  2HML A;  4H13 D;  3H1K E;  2FYU E;  1FQT A;  2YVJ B;  2FYN C;  1ULI A;  1EZV E;  3GCE A;  4HM7 A;  5KLI C;  1WQL A;  3VMH D;  1VM9 A;  1BGY E;  3GTS A;  2B24 A;  2ZT9 D;  2YFL A;  1L0N E;  5BOK A;  4U3F E;  2BMR A;  3L71 E;  2E4P A;  4NBB D;  4NB9 D;  1NU1 E;  2E76 D;  4NBF D;  3CWB E;  3FOU A;  3VCA A;  2HMO A;  4PV1 D;  3VMI D;  1O7G A;  1PPJ E;  2XRX A;  5KKZ C;  3C0D A;  3GTE A;  2E4Q A;  2NUK A;  2NVE A;  2ZYL A;  4EMJ B;  3GZY A;  3EN1 A;  4P1B H;  3AZC A;  1NTM E;  5HL4 A;  3L72 E;  1O7N A;  2BMQ A;  4NB8 D;  1L0L E;  2YFI A;  1SQV E;  1PP9 E;  3TGU E;  4QDC A;  2E74 D;  2NUM A;  2I7F A;  4NBC D;  1BE3 E;  1ZRT E;  2QJP C;  2E75 D;  4NBD D;  2IBZ E;  2HMN A;  2HMJ A;  2NVF A;  4OGQ D;  4QDF A;  3L70 E;  1Q90 C;  3BCC E;  3D89 A;  1KB9 E;  4QUR A;  4QUQ A;  3H1J E;  2CKF A;  4P1C H;  4HKV A;  4QDF B;  4HM2 A;  1NDO A;  2NVG A;  2DE5 D;  4H44 D;  4H0L D;  2DE7 D;  4NBG D;  5CXM A;  3H1H E;  2GBW A;  4HM5 A;  1G8K B;  1ULJ A;  1UUW A;  1NTK E; 
#chains in the Genus database with same CATH topology
 2GUS A;  2D2C D;  3GKE A;  2IZ1 A;  3RL0 g;  1L0L D;  4AUW A;  3II6 A;  1S2E A;  1LTI C;  1L0N D;  1WMK A;  1EG9 A;  3CC4 P;  5AEU A;  1CI6 A;  2JDI H;  2K9J A;  5L8R J;  5KJ7 D;  1KIL D;  3NXS A;  3H1L E;  4N3Y B;  2P7J A;  4GOE A;  2WPR A;  2AXT H;  1PP9 D;  1J1E C;  3V2P A;  4ASW A;  2Q5U A;  3H1J D;  1YJN P;  1FBM A;  3MUD A;  1PPJ E;  1JY2 N;  4I7Z B;  3C0D A;  1SQQ K;  4PJ0 H;  1MFZ A;  2AEF A;  1SFC B;  3EN1 A;  1VQP P;  1VQK P;  3RK3 B;  2WWW A;  4RKU J;  1KN7 A;  5CBO A;  1LP1 A;  2M5A B;  3PRJ A;  4I6M C;  3KHU A;  1J1E B;  4R4L A;  1ZME C;  3KZI E;  2E75 D;  2HPC A;  2HMJ A;  2VRS A;  1KFM A;  3BCC E;  1KB9 E;  3VOP A;  1KYO D;  4U7J A;  4ZMD A;  3HTK B;  5KLV E;  3H1I E;  3L74 E;  1XTC C;  3B5N A;  1USD A;  2B1X A;  1LT9 A;  3CCS P;  4OGQ C;  3CMA P;  4L75 A;  3GOB A;  1P84 I;  3V4Q A;  4Z1M H;  3A0H E;  1GZL A;  3EFG A;  2E42 A;  3CCJ P;  4IL6 H;  2BMO A;  1R5L A;  3PHL A;  1LNQ A;  1SQX E;  2CPS A;  3P8C D;  3WUU A;  3CX5 I;  1LT1 A;  2WIT A;  1U7M A;  2FKW B;  3WUV A;  3AE7 C;  5B5E E;  1TU3 F;  3O6Q A;  1N86 A;  1BE3 D;  2HFE D;  1JO5 A;  1OWA A;  1G1I A;  1ULI A;  2WSC H;  2M8R A;  3CC2 P;  3FGA D;  2QE7 H;  2E76 D;  2Q3E A;  4EYY Q;  1RQU A;  4GIF A;  3KZI H;  3S9O A;  3BVH A;  4P1B H;  3CXH D;  1KB9 H;  2Y9Y A;  3L37 A;  1RQV A;  1GTW A;  1HGV A;  2H89 C;  4NBD D;  1M1J C;  2V4H A;  1M90 Q;  1KC8 Q;  5KJ7 A;  1KIL A;  3AE8 C;  2P1J A;  1IZN B;  1KZU B;  1LTG C;  1SQQ J;  3KQG A;  3H1H E;  3L73 G;  2L91 A;  5AVQ B;  3A0H H;  2FYU G;  2G3A A;  4ZKP A;  3V2N A;  2I1J A;  3GG2 A;  3H32 A;  2E43 A;  1DIP A;  1EZV D;  1SQP E;  1MKM A;  3C1L A;  1S3J A;  1OXZ A;  1GL2 A;  3F89 A;  4XFJ A;  2XSH A;  1FJK A;  2E75 B;  1M1J B;  2E5Y A;  2POH A;  4EIJ A;  2WSF H;  4IOI H;  5B5E H;  4JYB A;  3L73 J;  3SWF A;  1RHZ B;  2BAS A;  3HE4 A;  2FXM A;  4AQR D;  1IJD B;  3FWN A;  3TGU D;  1BGY G;  1VF5 C;  4H13 D;  1ZXG A;  1FQT A;  1URQ A;  1VQN P;  2R44 A;  3M0D C;  3BRV B;  1IFJ A;  5APS A;  2BMR A;  1VQ9 P;  1NTM G;  4NBF D;  1Q90 D;  2YKO A;  1J1D C;  2QA4 P;  4RES B;  1HTL C;  2OYH B;  1KFN A;  3RK3 E;  1FZF A;  1FOS F;  2C9N Y;  2O01 N;  3AED C;  3SWK A;  2P58 A;  1FOS E;  3CD6 P;  1PV3 A;  3H1K D;  1E79 H;  3KDP B;  1LTS C;  1EDL A;  1FZG A;  3L75 D;  3D89 A;  4QUR A;  4NPD A;  4BRY B;  4RJT A;  1SQX K;  1NVO A;  4OWF A;  3B71 A;  1FAV A;  3CWB D;  4NBG D;  2WPV B;  3H1L G;  1NU1 K;  4JYC A;  2E76 B;  2JP3 A;  1G8K B;  1K04 A;  1RE3 A;  4W7Y A;  1YTZ T;  4EI2 A;  2IZ0 A;  1LWU C;  3CME P;  2QPZ A;  1BSN A;  1RH5 B;  3GZX A;  2QJK C;  1AFO A;  1NU1 D;  3NMD A;  3W67 A;  1M1K Q;  4U3F J;  2RN0 A;  1QVG O;  2JKV A;  3H1L J;  1BCC E;  1ZLL A;  1PIX A;  3TK1 A;  2KS1 B;  2NZ2 A;  1K8A Q;  3TSI A;  3GCE A;  1A02 F;  3BCC G;  1LWU B;  1S4X A;  1L0N E;  4I1L A;  2WPS A;  2QJK B;  1MFT A;  2WSC J;  3VMI D;  2AEM A;  1LTJ C;  3CCV P;  4GOF A;  3H1I G;  3L74 G;  5KLV G;  2B87 B;  3SSU A;  4NPF X;  1O7N A;  4OVN F;  2KZJ A;  3FX0 A;  1PP9 E;  2NUM A;  3F5H A;  1NO4 A;  4H13 B;  1T2K D;  1IFM A;  1KTM A;  2B87 A;  3P7K A;  2HMN A;  4B86 A;  5CBN A;  3GHG C;  3BCC J;  4KT0 J;  1OW7 A;  3M9B A;  5AVT B;  2JJL A;  3H1J E;  1SQX G;  1NTK G;  2B9B A;  2NPS D;  1NDO A;  3D6Y A;  1YIJ P;  3HE5 A;  2DE7 D;  2OYO A;  2Y0C A;  5AVZ B;  2W90 A;  1GK4 A;  1NKN A;  5KLV J;  3L74 J;  3G71 P;  4C46 A;  3GF7 A;  1QGK B;  2GBX A;  2LXB A;  1SP4 A;  1T3U A;  3L71 D;  1S9K D;  4DJG A;  2ZXX A;  4H0L C;  1LTT C;  1QLE D;  1RF0 C;  3VYI A;  4D6T G;  4CPG A;  1SQQ E;  1SQX J;  2O01 H;  2YIU B;  4KJM A;  1W2B O;  4WY4 C;  1KYO E;  2OAR A;  4IFM A;  3PH0 A;  3I5C A;  2WSF J;  3N0Q A;  1OW6 A;  2KNC B;  2Q6Q A;  1HJ0 A;  1PZQ A;  4IL6 X;  4C7R A;  3A7O A;  1NTZ K;  2FYN B;  2JEE A;  3CCE P;  3H1H G;  4KHX A;  4HH2 A;  2KNC A;  3GTE A;  1YHQ P;  1EC5 A;  2PGD A;  3ZDM A;  1SQP G;  1UIX A;  3IFM A;  2YFI A;  2WT7 B;  2E74 D;  3B5N D;  1SQB D;  2YMY A;  5CCH C;  3G6E P;  1GU4 A;  1BE3 E;  1NTZ D;  1P84 D;  4QDF A;  1G2C B;  1MV8 A;  2R5D A;  1DX7 A;  3AE3 C;  1GMJ A;  3A3Y B;  3TNU B;  1NKZ B;  1AQT A;  3H1H J;  3RL0 D;  4JF7 A;  3V6I A;  3G3Z A;  3P32 A;  1S5L E;  3CX5 D;  5AVW B;  2OTL P;  4XA4 A;  1SQP J;  1CSB A;  4QUP A;  1L0L K;  1GW4 A;  2QM7 A;  1KYO H;  3BAT A;  5AW3 B;  3M0A A;  4HM6 A;  2WMM A;  5AW1 B;  4GT1 A;  3MUD C;  3N7N A;  5K5G B;  2WSS H;  2P2U A;  2NPS B;  4LC1 A;  1U7J A;  1CI6 B;  2K9J B;  2QVA A;  5GTI E;  1QX8 A;  3IAO A;  1EZV E;  3MP7 B;  5E79 H;  2NPS A;  4I7Z C;  3GF3 A;  2QJY B;  1Q82 Q;  2B89 A;  2ZT9 D;  1YBK A;  1SFC C;  4U3F E;  3AE9 C;  4IFD K;  3PJS K;  1ZR4 A;  1LJ2 A;  3RK3 C;  1JCD A;  1N7S D;  5APV A;  2Z5I A;  4IL6 E;  2M3E A;  2NVE A;  2KUB A;  1FZC A;  1JTH B;  3AEA C;  1Z56 A;  2C0X A;  3Q1M A;  2W83 C;  4YPC A;  3TGU E;  2BEZ F;  3GMA A;  2I7F A;  4NBC D;  2H88 C;  1GL2 D;  4ZKU A;  1OIP A;  1LP1 B;  1EXI A;  2XDJ A;  2W8Z A;  1JTH A;  3PP5 A;  2K3R A;  1S5L H;  5BU5 A;  2HPC B;  3CXH H;  1BCC G;  3NFQ A;  3RK2 D;  1VQ8 P;  5AW2 B;  4HB1 A;  3M06 A;  2BCC E;  3I55 P;  4DOJ A;  4HM4 A;  4JQ0 D;  3Q5R A;  2H8P D;  3B8E B;  2FXP A;  1Q86 Q;  1HH0 A;  1L0N G;  1URQ D;  2E74 B;  3B5N B;  1LT9 B;  5AEW A;  3BRT B;  4HM3 A;  3L75 E;  5GTI H;  4AIV A;  2D2C C;  1BCC J;  1M7L A;  3RL0 B;  1PP9 G;  1AVO A;  2O01 J;  2A45 G;  1K73 Q;  2HML A;  3CL3 D;  1L0L J;  3MIW A;  3PTZ A;  5KTB A;  2W6B A;  3Q5P A;  1K9M Q;  1QL1 A;  1L0N J;  3H1J G;  3O6Q B;  1A02 J;  2Q9I A;  2I8D A;  3MD0 A;  1L4A D;  1NU1 E;  5KJ7 C;  1KIL C;  5KLI B;  1HF9 A;  4PV1 D;  1KMI Z;  2HYN A;  2ZJS E;  1N73 A;  3IF4 A;  4Y28 J;  1DEE G;  3AEE C;  3T97 A;  2IBZ G;  2D2C B;  3L73 D;  1PP9 J;  3CCQ P;  2WTY A;  2FYU D;  2FFD B;  2OTK E;  3V2R A;  4M3L A;  3Q5S A;  1SQQ G;  3H1J J;  2NRG A;  2WVR A;  3OA7 A;  2WPQ A;  2ZT9 B;  1Y9B A;  2BEQ D;  2JO1 A;  2FFD A;  2J58 A;  1N7S B;  1KIL B;  2RMZ A;  3M91 A;  2V7Q H;  4QDD A;  2RH0 A;  1Q7Y Q;  5CJ0 A;  4HM8 A;  3WMM 0;  2O1K A;  2E75 C;  4YXW H;  3JSV C;  3D6Z A;  1N7S A;  1BGY D;  3H32 B;  1GL2 B;  1RY3 A;  1SVF A;  3GL2 A;  2NWF A;  3S1K A;  1NTM D;  1PFI A;  2A06 E;  2YXR B;  1VQ7 P;  3RK2 B;  2JZA A;  2FBW C;  2ZYG A;  1BE3 G;  1ZRT D;  3HE4 B;  1WT6 A;  1EDJ A;  1IFI A;  2A45 I;  1VQL P;  4XE5 B;  3HD7 D;  2OYH C;  1FE6 A;  2N1T D;  3OJA B;  1URQ B;  1FDM A;  3L71 E;  3V4W A;  1DD3 A;  1XTG B;  1S9K E;  1O7G A;  3RBX A;  3R2P A;  3L72 E;  2KYV A;  3G9R A;  3TYY A;  2G8Y A;  4W7Z A;  1BE3 J;  2IBZ I;  3N4X A;  2KLV A;  2R32 A;  4EOT A;  3M9Q A;  3FXE A;  2E76 C;  4GKG A;  2GM4 A;  2FYZ A;  3MGN A;  3G4S P;  5AVY B;  4O9B A;  3AE2 C;  2HG5 D;  4PD4 I;  2IYP A;  1HBW A;  2WZ7 A;  1KQS O;  5CHX A;  1IFD A;  2KP8 A;  2OTJ P;  3Q3D A;  2XSO A;  1EZV G;  1NYK A;  3EQ2 A;  1L4A A;  2IX7 C;  4HM1 A;  3VCP A;  1SQB E;  4HJG H;  4U3F G;  2OYI A;  4Y99 C;  1NTZ E;  1P84 E;  1RE4 A;  3EQQ A;  1JUN A;  1KB9 D;  2PFX A;  1O7P A;  1JOC A;  1AQ5 A;  1SS1 A;  3TGU G;  3CX5 E;  3H1I D;  4YTP C;  1YQ4 C;  3VP8 A;  2GA1 A;  4JPZ B;  1IFN A;  1PPJ G;  2Z4E A;  1VM9 A;  2W6A A;  3AE4 C;  3P8M C;  4Y99 B;  4WB4 A;  1W5C E;  2HMO A;  2XRX A;  1OZH A;  3CLQ A;  2NUK A;  1NTK D;  2BCC G;  4H13 C;  4UB8 E;  1DD4 A;  3TGU J;  1Q2N A;  1L0L E;  5APU A;  1PGQ A;  2LXC B;  1IK9 A;  2YXQ B;  1RF1 A;  3CC7 P;  3QWO C;  1VQO P;  1YTZ I;  2Q7C A;  5APX A;  2KK7 A;  1JB0 J;  4HKZ H;  1BDC A;  2IFN A;  3L75 G;  1Q90 C;  1YJ9 P;  4P1C H;  1AA0 A;  4H44 D;  1KIL E;  2Y0E A;  1LTB C;  4D6T D;  3W68 A;  2BCC J;  1P84 H;  3VMA A;  3HE5 B;  2Q3W A;  3HD7 A;  1CZQ A;  2N1T A;  3CCM P;  1VCK A;  3HUS A;  1SQV K;  2W27 A;  2XU6 A;  1PGJ A;  2YIU C;  3A5T A;  1H8A A;  1S5L X;  2V7Q J;  1HWT C;  4RO0 A;  1JY3 O;  1HGZ A;  5CCG D;  1NU1 G;  2E5T A;  2KIK A;  1JY3 P;  1OFC X;  3L75 J;  1SJG A;  2WSE H;  3CX5 H;  1JMB A;  1HVV A;  4LLH A;  5DJT B;  2DW3 A;  5AVX B;  3R4Y A;  1FDI A;  2JWA A;  1X79 B;  1SQV D;  1YIT P;  1G8J B;  3U1C A;  1VQ5 P;  1NAF A;  2FYN C;  1X9V A;  1SQP D;  3KXD A;  1KQG B;  3VMH D;  3L70 D;  1NU1 J;  2IFM A;  4UB8 H;  2E4P A;  1JMM A;  5KKZ C;  1LGH B;  1LTJ A;  2OGU A;  3I56 P;  2ZYD A;  5HL4 A;  2PP6 A;  1H89 A;  3VMY A;  1HJB A;  1SLQ A;  2K1A A;  4AYC A;  3C8V A;  1AJY A;  1SQB K;  3ABV C;  3B4S A;  3AEG C;  1VQM P;  1KB9 I;  3GHG A;  2ZXE B;  2ITA A;  5E79 E;  3CCL P;  1GU5 A;  5KAI H;  4QDF B;  3P8C E;  2A06 G;  3CPW O;  1ZV8 A;  1NAY A;  5KKZ B;  1ULJ A;  3A0B H;  5GTH H;  2QM8 A;  1NWQ A;  2XND H;  5M1B A;  1T2K C;  1O7H A;  2KSE A;  2M3B A;  1USE A;  1X22 A;  2R3C A;  3L71 G;  2JO6 A;  2NPS C;  2J59 M;  1IFP A;  4BXL A;  1O7W A;  1FU1 A;  1RIE A;  4HM0 A;  5APQ A;  1NH4 A;  3VMG D;  4WY4 A;  2KLU A;  3JCU E;  3L72 G;  4K3A A;  2XKM A;  4H44 B;  3CXH E;  2QJY C;  4QCK A;  2Q3I A;  2RKL A;  2R3S A;  1ZOY C;  3LID A;  2LR2 A;  4WVZ A;  1BGY E;  1FZE A;  3L71 J;  4NB9 D;  1GD2 E;  1KQF B;  2LKM A;  3L72 J;  3OAK A;  1NTM E;  4R4M A;  1N8R Q;  1VQ4 P;  2Q1K A;  3SFD C;  5CCG A;  1SQB G;  1YQ3 C;  1FZC B;  1NTZ G;  2JR8 A;  4L74 A;  1ZRT E;  2QJP C;  5CCH A;  3K5B A;  4OGQ D;  2XNX A;  1Q81 Q;  3L35 A;  5C39 A;  5B66 H;  2JWD A;  5CXM A;  2K9Y A;  4N6J A;  3WU2 E;  2E74 C;  3B5N C;  1LT9 C;  2QSI A;  2M0B A;  5AVR B;  1EXJ A;  1SQB J;  1NTZ J;  3JCU H;  3MTU E;  4UB6 E;  1S72 P;  1OVV A;  5TIS E;  2QJP B;  1JM1 A;  1ZP0 C;  2HR3 A;  3V2Q A;  3RL0 C;  3E7K A;  3BAS A;  3AEF C;  1S1C X;  3VP9 A;  2YFJ A;  2KXP B;  1IO4 A;  2KZI A;  1AVY A;  1VPC A;  1L0L G;  3GLM A;  2WSE J;  1N73 C;  1UUV A;  5EFW B;  2C9L Y;  2K88 A;  3U59 A;  1R5S A;  3H1K E;  2IBZ D;  2YKQ A;  3WUT A;  5KLI C;  1KD1 Q;  5H2F E;  4I2L C;  2YFL A;  1JY2 O;  2N9B A;  1SFC A;  2O3J A;  3CWB E;  1JY2 P;  1SQQ D;  1YI2 P;  1OX3 A;  2M5A A;  2HLO A;  2FFD C;  4PD4 D;  4DT0 A;  1M56 D;  2C0W A;  1EDK A;  4NB8 D;  3D70 A;  1G1J A;  5AW5 B;  3PLN A;  1N73 B;  1VQ6 P;  3AE1 C;  1L2P A;  1KOR A;  3NTN A;  3KYQ A;  1NYH A;  3T97 B;  1JCC A;  2ZT9 C;  2B88 A;  2FYU K;  4N78 D;  1N7S C;  1HUC A;  1EQ7 A;  4WWI A;  3WU2 H;  3GW6 A;  4QUQ A;  3O8Z A;  1WRG A;  1BSH A;  3HTK A;  2WQY C;  4HM5 A;  5AVS B;  4UB6 H;  1NTK E;  4OH8 B;  3D71 A;  5TIS H;  4HJL A;  2XR8 A;  2YKP A;  1GL2 C;  2UWJ E;  3UIA A;  3L36 A;  4LGD E;  1VF5 D;  1M57 D;  2DE6 D;  1DH3 A;  4OGQ B;  1VDF A;  1Y47 A;  5AW6 B;  5BVZ A;  5KAF E;  3RK2 C;  4NBA D;  1NTM K;  3USS A;  5CJ4 A;  5H2F H;  4D6T E;  4MN4 C;  1X8Y A;  2N9Y B;  2ZVN B;  4C7N B;  1URQ C;  2P67 A;  3TDK A;  2PRR A;  3CCR P;  5AW0 B;  2FXO A;  2B24 A;  1JEK A;  3TF5 A;  4C7N A;  1U57 A;  1YJW P;  2E4Q A;  1OMI A;  4BWN A;  1NOH A;  4EMJ B;  2QG4 A;  3GZY A;  2KOG A;  5CMZ A;  2BMQ A;  1X0T A;  1SQV E;  3LW5 H;  2I1K A;  3C9I A;  1NGM B;  1L4A C;  3L70 E;  2OYI C;  4PV1 C;  4GOD A;  2YO3 A;  2J5U A;  1RE4 C;  4U3F D;  2CKF A;  5DJU B;  3AE5 C;  2DE5 D;  1N7L A;  2GBW A;  3H1L D;  1RE3 C;  2QEX P;  2HOD B;  3Q2Y A;  3L4F A;  5AVU B;  2IDB A;  5KAF H;  4ZNC A;  1M1J A;  2ZAE B;  2PAJ A;  2FYU J;  3H6P A;  2Y9Z A;  3A2A A;  2HOD A;  3RGU A;  1L4A B;  1JM0 A;  1E5W A;  4AAY B;  1PPJ D;  1KYO I;  1H88 A;  2OYI B;  4PV1 B;  1W2E A;  2YO2 A;  1NHL A;  4L76 A;  1CW5 A;  3QH9 A;  1FJP A;  3ITK A;  4WBA A;  2O1J A;  1LTA C;  1PGO A;  2BCC D;  5KLV K;  2KSJ A;  1DEB A;  1WQL A;  1EDI A;  1BGY J;  1RF1 C;  3BCC D;  3V5B A;  1VF5 B;  1IC2 A;  3GTS A;  4HYT B;  2OYH A;  3H25 A;  3MHV A;  4TLF A;  4NBB D;  1ZN5 A;  2KB7 P;  3LIE A;  2YMK A;  3JC2 2;  1YYC A;  1FZB A;  1NTM J;  2ZYL A;  5KLV D;  3L74 D;  3EFF K;  1NTK K;  2H7H A;  3RBZ A;  3FWL A;  4DZO A;  1J1D B;  3SFE C;  2H43 A;  2KI7 B;  4QDC A;  3M0D A;  2R5B A;  5AW9 B;  3HD7 C;  4BRY A;  2N1T C;  3HUS C;  1UII A;  3FXD A;  1RF1 B;  3E1R A;  1BDD A;  3HRN A;  3MZW B;  1FZA A;  1SQX D;  1R8E A;  1NJI Q;  4HM2 A;  4H0L D;  3E1I A;  1T3J A;  4WY4 D;  2CK3 H;  3IR9 A;  2L5G B;  3H1K G;  3CXH I;  2HMM A;  3GL0 A;  3VTP C;  1ZR2 A;  2ZFC A;  1RFS A;  1QEX A;  1FC2 C;  4NBE D;  3HD7 B;  2N1T B;  3CWB G;  1GK6 A;  3HUS B;  4JBZ A;  3OW2 O;  1JY3 N;  3SWY A;  2YNY A;  1H0T B;  3DQY A;  1J2J B;  2HMK A;  2KS1 A;  5KAI E;  3AEC C;  2ZVO B;  4L73 A;  1K05 A;  3H1K J;  2ZYA A;  1LWU A;  1H0T A;  3A0B E;  1EZV I;  5GTH E;  4DCK A;  2YVJ B;  3AE6 C;  2FY8 A;  1SQP K;  2IPP A;  3U1A A;  5CCH D;  1GDT A;  4TT3 H;  3VMX A;  3CWB J;  1MZ9 A;  5BU8 B;  2XZR A;  3H1H D;  4EDF A;  1T8Z A;  1ZW0 A;  1IK7 A;  3AZC A;  4K35 A;  2A06 D;  2XV5 A;  1LTJ B;  3H1I J;  2AEJ A;  3CI9 A;  2IBZ E;  1MUU A;  1N2D C;  1OVR A;  1PL5 A;  3M9H A;  1Y8A A;  4NPE A;  1OW8 A;  3LW5 J;  4A7P A;  3GHG B;  1NTK J;  1UUW A;  1FS0 E;  4ASV A;  1OVU A;  1KV4 A;  4PD4 E;  3L72 D;  1PGP A;  5AVV B;  5AW4 B;  2K37 A;  2AXC A;  2IYO A;  3VN0 A;  4NBH D;  5TJH A;  4YXD C;  2P10 A;  4H44 C;  4N78 E;  1O7M A;  2Z5H A;  1QVF O;  1SFC D;  2MJZ A;  5AW7 B;  3RK3 D;  4GDO A;  3AEB C;  5B66 E;  4D6T J;  2CPB A;  5AW8 B;  4H0L B;  3L73 E;  1SQV G;  3GB4 A;  1AV1 A;  2A45 H;  4WY4 B;  5APY A;  2FYU E;  1GW3 A;  2GUV A;  5CCG C;  4HM7 A;  3L70 G;  1RF0 A;  2AXT E;  5BOK A;  4W80 A;  1D7M A;  5APT A;  3FOU A;  3VCA A;  3EWK A;  1M8O B;  4QMA A;  1VL2 A;  3IN6 A;  3VMZ A;  2WT7 A;  1T6A A;  1FZC C;  2QRX A;  4IFF A;  3KPE A;  1SQV J;  1G2C A;  2OQQ A;  3TNU A;  2MKV A;  4PJ0 E;  5APW A;  3S4R A;  1FDO A;  2NVF A;  3L70 J;  2SPZ A;  1QL2 A;  2Y0D A;  4PD4 H;  1JNM A;  4HKV A;  1L0N K;  2NVG A;  3CCU P;  1BCC D;  2W6J H;  1KQL A;  2QIW A; 
#chains in the Genus database with same CATH homology
 5KLV E;  3H1I E;  3L74 E;  4QDD A;  2D2C D;  4HJL A;  4PD4 E;  2HMM A;  2BCC E;  3GL0 A;  3GKE A;  2XR8 A;  2XSO A;  4HM8 A;  2B1X A;  2Q3W A;  4QUP A;  1NYK A;  4HM4 A;  2GBX A;  1O7H A;  1SQP E;  1VCK A;  1VF5 D;  4HM1 A;  3GOB A;  2XSH A;  3VCP A;  1SQB E;  2DE6 D;  2QPZ A;  2YIU C;  1RFS A;  4NBH D;  3GZX A;  1NTZ E;  2JO6 A;  4NBE D;  1P84 E;  2QJK C;  1EG9 A;  1JM1 A;  5AEW A;  1SJG A;  2BMO A;  4HM6 A;  3EQQ A;  1O7M A;  4AAY B;  3GL2 A;  4HM3 A;  1O7W A;  1SQQ E;  3L75 E;  4NBA D;  3DQY A;  5AEU A;  2NWF A;  1RIE A;  4HM0 A;  1SQX E;  1KYO E;  2YFJ A;  1O7P A;  3VMG D;  4AIV A;  2HMK A;  2A06 E;  3H1L E;  3CXH E;  1BCC E;  3L73 E;  4D6T E;  3GB4 A;  1UUV A;  2JZA A;  1G8J B;  2QJY C;  3N0Q A;  4QCK A;  3CX5 E;  2HML A;  4H13 D;  3H1K E;  2FYU E;  1FQT A;  2YVJ B;  2FYN C;  1ULI A;  1EZV E;  3GCE A;  4HM7 A;  5KLI C;  1WQL A;  3VMH D;  1VM9 A;  1BGY E;  3GTS A;  2B24 A;  2ZT9 D;  2YFL A;  1L0N E;  5BOK A;  4U3F E;  2BMR A;  3L71 E;  2E4P A;  4NBB D;  4NB9 D;  1NU1 E;  2E76 D;  4NBF D;  3CWB E;  3FOU A;  3VCA A;  2HMO A;  4PV1 D;  3VMI D;  1O7G A;  1PPJ E;  2XRX A;  5KKZ C;  3C0D A;  3GTE A;  2E4Q A;  2NUK A;  2NVE A;  2ZYL A;  4EMJ B;  3GZY A;  3EN1 A;  4P1B H;  3AZC A;  1NTM E;  5HL4 A;  3L72 E;  1O7N A;  2BMQ A;  4NB8 D;  1L0L E;  2YFI A;  1SQV E;  1PP9 E;  3TGU E;  4QDC A;  2E74 D;  2NUM A;  2I7F A;  4NBC D;  1BE3 E;  1ZRT E;  2QJP C;  2E75 D;  4NBD D;  2IBZ E;  2HMN A;  2HMJ A;  2NVF A;  4OGQ D;  4QDF A;  3L70 E;  1Q90 C;  3BCC E;  3D89 A;  1KB9 E;  4QUR A;  4QUQ A;  3H1J E;  2CKF A;  4P1C H;  4HKV A;  4QDF B;  4HM2 A;  1NDO A;  2NVG A;  2DE5 D;  4H44 D;  4H0L D;  2DE7 D;  4NBG D;  5CXM A;  3H1H E;  2GBW A;  4HM5 A;  1G8K B;  1ULJ A;  1UUW A;  1NTK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...