1SQQE

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqqE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqqE02
2JO6A 4AAYB 3BCCE 2I7FA 4NBBD 4H0LD 1L0LE 3GZXA 2NWFA 2NUMA 2BMQA 2DE7D 1NTKE 3FOUA 4QUQA 3GZYA 1JM1A 4HM0A 1VM9A 3VMID 3VCPA 1SQVE 4QDDA 4HM7A 1ZRTE 1O7GA 2FYNC 5BOKA 2NVGA 2XRXA 2E75D 5KLVE 4H44D 1VF5D 2GBXA 4NBDD 2HMLA 2JZAA 3GOBA 1UUVA 2QJPC 4HJLA 3GTSA 1Q90C 2E4PA 4NB8D 1SQXE 2E74D 3D89A 3CXHE 2XSHA 1EZVE 3L71E 2XR8A 3L70E 3VMHD 1BCCE 1O7PA 3EN1A 3N0QA 4HM8A 5KKZC 1WQLA 4EMJB 2DE5D 2YFIA 2ZT9D 1SJGA 3VCAA 1NU1E 1O7WA 1G8KB 3L74E 4QCKA 1SQBE 1ULJA 5CXMA 4D6TE 3EQQA 4NBED 3L75E 1P84E 1O7MA 2QJKC 2IBZE 1VCKA 2ZYLA 4HM4A 4OGQD 4NBAD 1NTZE 4AIVA 2HMOA 3TGUE 2DE6D 1L0NE 1PPJE 2B24A 1NDOA 2NVFA 4HM1A 4NBCD 4P1BH 1SQQE 3GL0A 4U3FE 2NVEA 1KYOE 3C0DA 2XSOA 2FYUE 1O7HA 3GTEA 2QPZA 2GBWA 3GKEA 2B1XA 1NTME 2NUKA 2YFLA 2BCCE 3H1KE 4HM2A 4NBGD 2YVJB 3GL2A 3DQYA 4HKVA 4PV1D 1EG9A 1O7NA 2E76D 3GCEA 1RIEA 3AZCA 2HMNA 1G8JB 4QUPA 1SQPE 1KB9E 4HM3A 3GB4A 3VMGD 4QDFB 5KLIC 1PP9E 2YIUC 3CX5E 3H1IE 1FQTA 4HM6A 1UUWA 4NBFD 2CKFA 3H1LE 1RFSA 5AEWA 1BGYE 1NYKA 2YFJA 2A06E 4QDFA 2QJYC 2HMMA 5AEUA 3L73E 1ULIA 2HMJA 3H1JE 1BE3E 3CWBE 2E4QA 4NBHD 2HMKA 4P1CH 3H1HE 2Q3WA 2D2CD 4QURA 4QDCA 4H13D 2BMRA 4PD4E 5HL4A 4HM5A 4NB9D 2BMOA 3L72E
chains in the Genus database with same CATH superfamily
1PL5A 2YMKA 4NBBD 4JBZA 1KB9I 4IL6H 1LTIC 4I2LC 1T3JA 3HD7B 4C7NB 2A06G 1EDLA 3AEDC 5APQA 1IFPA 1N73C 5AW2B 4H0LB 2YIUB 2AEJA 3L70J 1BGYD 1Q90C 2E74D 2HG5D 4WWIA 1PZQA 1IJDB 2E75B 1K9MQ 5TJHA 1YI2P 2Q7CA 1YQ3C 1GL2C 1O7MA 2KYVA 1FOSF 1N8RQ 1RF1A 4HJGH 2FYUK 3FXEA 3CCRP 5APYA 4PJ0H 1NTME 3KYQA 3H1KE 5GTIH 3TF5A 1KFMA 3NTNA 1SQPE 2H88C 1M56D 1YQ4C 2LXCB 1BGYE 5AEUA 3Q5SA 1OVRA 1DEBA 1G2CA 4H13D 2BMRA 2K9YA 4R4MA 1J1EB 3JCUH 1L0LJ 4HH2A 2OYIB 2JO6A 2WT7A 1YHQP 2AXCA 1KQLA 3H1IG 2DE7D 4A7PA 4QUQA 2L5GB 4CPGA 3ABVC 1WRGA 3H1JG 1M1JA 1L0LD 1NTZJ 3BATA 2Y0CA 1X9VA 4HKZH 2XDJA 1MFTA 2QJPC 2RH0A 2YNYA 3D89A 1N7SD 3CXHH 4RESB 2IPPA 2C0XA 1VQKP 2K3RA 1NU1J 2N1TD 4XFJA 1Y47A 3C1LA 4D6TJ 1O7WA 5AW0B 3PTZA 3V4QA 1ULJA 3AEAC 1G1JA 1IFJA 3HD7A 4C7NA 3CCJP 1VQPP 2RMZA 1EDIA 5TISE 2W6JH 2ZT9B 2OTLP 2JDIH 4D6TD 2FY8A 1QL2A 1O7HA 3D6YA 1YITP 4OVNF 2B1XA 3B5ND 3PHLA 1EXIA 1FZCB 3RL0B 4H13C 5AW6B 3RGUA 4HKVA 1KYOD 2K37A 1N86A 3AZCA 1ZW0A 2HMNA 3CCVP 1M90Q 1HUCA 3U1AA 2IYOA 2JR8A 5DJUB 2LXBA 1U7JA 2HODB 2PFXA 1JNMA 1KC8Q 1OXZA 2H43A 1VQLP 4QURA 3C9IA 3O6QB 2OGUA 1HGVA 2E5YA 2P58A 4L74A 3VP9A 1MZ9A 2IBZI 1N7SC 4DT0A 3BCCE 3EFGA 2NWFA 1RQUA 1NTKE 3AE5C 1KZUB 2HLOA 2N1TC 5B5EE 1G1IA 4I7ZB 1SQVE 2Q9IA 3VMYA 2RKLA 3M9BA 1VF5D 3A3YB 1YJ9P 3BRVB 2C0WA 4RKUJ 2ZXXA 3SFDC 1IK7A 4ZKPA 4JYCA 1ZMEC 2OYIA 2QIWA 2YFIA 5AW7B 2G8YA 4Z1MH 3L75J 1SQBE 3B5NC 1M1KQ 1RE4C 2JWDA 4B86A 1L0NE 3CC4P 2B24A 2NVFA 1X8YA 3R4YA 3WMM0 3L75D 1KV4A 3TDKA 3VMZA 1Q86Q 2BCCE 2W6AA 1L0LK 1EG9A 3M91A 1R8EA 2A45I 4EI2A 1KORA 2HPCB 2ZYDA 1BE3J 3NFQA 2A06E 2QJYC 1T8ZA 4XE5B 4Y99B 1VF5C 1GK6A 2NRGA 1ZR4A 2WSEJ 1MUUA 4UB6E 5AVSB 1BE3D 1Y8AA 3CPWO 1PP9G 4N3YB 1QLED 3E1RA 3H1LG 1LWUB 4O9BA 2QJKB 1VL2A 2XKMA 4GOEA 1YTZI 1FE6A 2C9NY 2NPSB 1UUVA 2HODA 3D6ZA 2XSHA 1AQ5A 2YO3A 5B66E 3O6QA 1BCCE 2V7QH 2DE5D 1SVFA 3L74J 1CW5A 2HFED 1SLQA 2POHA 1MFZA 2M3EA 3CXHD 1OW7A 2JWAA 1GK4A 2KUBA 3RK2B 2DW3A 1DD4A 1RF0C 4ASWA 3L74D 2XZRA 3Q5PA 4NBCD 3L70G 2ZFCA 2QPZA 1OZHA 2ZVNB 3AE2C 3FWLA 3A0BE 1M8OB 1MKMA 5KAFE 3KDPB 3CCEP 3H1IE 4OH8B 1T2KD 1JEKA 2YFJA 3AE1C 3H1JE 3B5NA 2D2CD 1AVOA 1P84I 2IX7C 1DEEG 1BSHA 1VM9A 2B9BA 1NOHA 1GTWA 3MIWA 2HPCA 1SFCD 2AEMA 3BASA 5APVA 3GG2A 5KLIB 4DCKA 4U3FJ 1L0LG 1EXJA 1YJNP 3A7OA 1ZV8A 2R3CA 1K73Q 1RF1B 1L4AD 4KHXA 3I56P 2IDBA 1LWUA 2YXRB 2WSFH 1VCKA 5KJ7D 2KZIA 2Y0DA 3HRNA 1HGZA 2FFDC 4PD4I 1Y9BA 2NPSA 5CMZA 4P1BH 1OFCX 1T2KC 1NO4A 4U7JA 1K05A 3FX0A 2W90A 1ZP0C 3QH9A 3GF3A 1NU1G 3HUSC 1D7MA 2D2CC 4D6TG 2M3BA 3SFEC 2HR3A 2IZ0A 1RHZB 3SWKA 1VQ4P 5AW1B 3CX5E 3GF7A 1EZVI 1W2BO 1USEA 2WITA 3PH0A 1G2CB 1OVVA 4PV1B 3V6IA 4LGDE 1SFCC 2O01N 5BVZA 1LTTC 3HE4A 3M0DC 1JMMA 2Q1KA 3MGNA 1HJBA 5APSA 1KQSO 1JMBA 3UIAA 4DZOA 5CBNA 1YJWP 1FC2C 2QM8A 2Q5UA 1URQD 2B88A 1L4AC 1ZRTE 2WQYC 2XRXA 4H44D 1NHLA 5KJ7C 3H6PA 2V7QJ 5KKZC 4I6MC 3S4RA 3MHVA 1VQ8P 4WY4B 1LT9A 5AVTB 1IK9A 4HYTB 1FJPA 1NAFA 3A0HE 2WVRA 1P84H 1FZEA 3TGUJ 3TYYA 1YYCA 1IFNA 1SQQJ 1K04A 3G71P 1NYHA 2ZYAA 2AXTH 1AQTA 2ZYGA 3LIEA 1N73B 4YXWH 2IBZD 2KLVA 3U1CA 1LTJC 2AEFA 3LW5H 1EDJA 4DJGA 3L70D 3L75G 4DOJA 2QSIA 2E76D 1RIEA 3D71A 2JEEA 1LTBC 1PP9E 2MKVA 2G3AA 2CKFA 3H1LE 1URQC 4W7ZA 4WVZA 1GL2B 5CCGA 1JTHA 4H44C 1IZNB 5AVYB 4PD4H 1KILD 1U7MA 1E5WA 1FS0E 1JY2P 3WU2H 2BMOA 5H2FE 3RBXA 2P7JA 2I7FA 1HF9A 5EFWB 2Q3IA 2YKOA 2BMQA 1VQNP 1A02F 2QA4P 5KLVJ 4HM7A 1RE3C 2NVGA 1BE3G 1AA0A 3CI9A 1SQXJ 3GOBA 3L71J 1VQOP 3W68A 1J1EC 2WSEH 3VMHD 3L70E 3N0QA 1KFNA 3Q1MA 3CCLP 1WQLA 5GTHH 1N7LA 2J5UA 3VCAA 3RK3D 1EDKA 1SS1A 3M9QA 1AJYA 1SQXD 1JCCA 2WSFJ 3L71D 1S5LH 2E74B 1NVOA 1H88A 2E76C 3M0AA 1ZN5A 4R4LA 5AVQB 1KILE 3GTEA 4IFMA 1NTZD 4KT0J 3L74G 2FXOA 2QJPB 3R2PA 2OYHC 2GUSA 2NUKA 4WY4A 1KILC 1KB9H 1FZGA 1OMIA 1NU1D 1SQVJ 1CZQA 3VYIA 1FZFA 2HMJA 2W83C 1N73A 1PIXA 2N9BA 3CCSP 3P7KA 2E5TA 3NMDA 4HM5A 1S4XA 1L0LE 4IL6X 3GHGC 2YKQA 3RK3C 4H13B 1GMJA 1JOCA 1GL2A 2WSSH 2E4PA 4NB8D 1IFMA 2QEXP 4K3AA 1NU1E 3A2AA 2Z4EA 4I1LA 1UIXA 4BRYB 1FBMA 4D6TE 1N7SB 3KZIE 1EQ7A 4K35A 4Y28J 4OGQD 1JY3N 5DJTB 2HMOA 3WUVA 1FU1A 1P84D 1ZOYC 1KYOE 1SP4A 2I1KA 1QEXA 2O01H 1AVYA 3LW5J 5E79H 2FXMA 2WPVB 1QX8A 1WMKA 3DQYA 2IFNA 1H0TB 1BSNA 2H89C 1LJ2A 5AEWA 3L73J 3B5NB 2W6BA 3FXDA 1NYKA 3CWBJ 2FYZA 3HTKA 3VOPA 2E4QA 3H32B 1J1DB 4P1CH 1SQXK 3L72J 1TU3F 3V4WA 2KNCB 1BCCJ 2O1JA 3L73D 3RBZA 2B87B 3CL3D 2R3SA 1FDIA 5CCHD 3CWBD 4IL6E 4PD4D 3B8EB 3H25A 1NTZK 2GBXA 1GD2E 3V5BA 2Q6QA 4OGQC 2OTKE 3B71A 4Y99C 1MV8A 4N78D 2QJYB 1NU1K 1X0TA 2M8RA 1SJGA 1VF5B 2JJLA 1BDDA 1G8KB 2JO1A 3L75E 3KXDA 2QJKC 2P2UA 3IN6A 4JQ0D 2K88A 2P1JA 3H1IJ 5CHXA 2CK3H 1HTLC 2K9JB 4QMAA 4NPEA 4PJ0E 1HJ0A 4C7RA 5GTIE 3GL2A 2IBZG 3U59A 1FZBA 1CI6B 4BRYA 3TGUG 2J59M 1N7SA 5CCHC 1SQQG 1JY3O 3IFMA 3B4SA 5AW3B 2N1TA 3HE4B 1BE3E 1KB9D 1NGMB 1IFDA 2Q3WA 3JCUE 4NB9D 2KZJA 2B89A 3HE5B 2R5BA 1KN7A 3MUDC 3PP5A 1H0TA 3VMID 4QDDA 3CCUP 5BOKA 2KIKA 1GDTA 1DIPA 2L91A 2JZAA 1RE4A 2P67A 1LT9B 3AE7C 3H32A 3CXHE 2KNCA 3AEEC 2B87A 2BEQD 3L74E 3GLMA 2FBWC 2ITAA 5KLVG 1S2EA 4GT1A 5TISH 2A45G 2A45H 2YMYA 1QVGO 1SQXG 1KTMA 3L71G 2PP6A 2FYUJ 2O01J 2KLUA 3V2NA 1PV3A 2WWWA 2Y0EA 3GKEA 1PPJD 1LGHB 5APXA 2YFLA 1KQFB 3P32A 1RF1C 3O8ZA 3OJAB 4U3FD 1NTZG 4QUPA 1G8JB 2E43A 3AEFC 4MN4C 3VMGD 2UWJE 1JTHB 5BU8B 1UUWA 4QDFA 2K9JA 4EYYQ 2HMMA 3H1HJ 3P8CD 1E79H 3HD7D 4IFFA 5APUA 2FFDB 1KD1Q 1Z56A 3OAKA 1NAYA 5C39A 3CD6P 4H0LD 3T97A 2KI7B 3H1HD 3HUSB 5B5EH 1CI6A 1JM1A 2D2CB 1SQVG 3LIDA 4ZKUA 2FYNC 2E75D 5APTA 2WMMA 5AVZB 1GW4A 2O3JA 1RF0A 1K8AQ 1HWTC 3EN1A 3ITKA 1EC5A 1SFCB 3AE6C 3V2PA 1JB0J 2KP8A 1VQMP 1M1JC 3IF4A 1VQ6P 3HE5A 1IO4A 5AW5B 3MZWB 5CJ0A 1NH4A 4M3LA 2QVAA 1PGQA 1R5SA 3P8CE 2IYPA 2OTJP 1A02J 1L4AB 2M0BA 4ZNCA 4EOTA 1FZAA 3V2QA 3ZDMA 2Y9YA 1NTMJ 1OWAA 3H1KJ 2KB7P 4AUWA 3HD7C 4HM2A 1SQPJ 1W2EA 5KKZB 4NPFX 4H0LC 3G9RA 1NTMD 2YIUC 1BGYJ 5AVXB 1RH5B 3H1KD 2ZAEB 2WZ7A 3G3ZA 1SQPD 3TGUD 2E75C 2GUVA 3OW2O 3BVHA 2M5AA 1SQQD 1FOSE 4HB1A 1GU5A 4AYCA 3F89A 4UB6H 1X22A 3GZXA 3KPEA 2YO2A 3Q5RA 2XNXA 2KS1B 1LTJB 3N7NA 4ASVA 2V4HA 3L73G 1QGKB 3CWBG 2PGDA 5KAIH 2I8DA 4IOIH 2K1AA 2MJZA 4HJLA 2KSEA 3L72G 5AW9B 4BWNA 3AE4C 3PJSK 2FFDA 1URQB 5B66H 1BCCG 1OVUA 3L36A 3VMXA 1FDOA 2ZT9D 3CX5I 1VQ5P 1LP1B 3OA7A 4H44B 4RO0A 1NKNA 2HYNA 1HH0A 5CXMA 3HUSA 4NBED 3M06A 2JKVA 2IBZE 1J2JB 5AW8B 2SPZA 3TGUE 2DE6D 1USDA 3RL0D 1EZVG 4ZMDA 4HM1A 2OYIC 1SQQE 5KLVD 4C46A 2NVEA 2IZ1A 1NWQA 2GBWA 1Q2NA 1SFCA 4GKGA 3A0BH 3M0DA 5K5GB 3CC2P 3L37A 2E74C 5KAFH 4BXLA 2ZVOB 3HTKB 2QRXA 3L4FA 1FQTA 4TT3H 4KJMA 1S1CX 2E76B 1L4AA 4NBHD 2HMKA 1W5CE 2FKWB 4JPZB 4UB8H 3BCCJ 5KJ7A 2XNDH 1NTKJ 1R5LA 3EFFK 3FGAD 3FOUA 2ZT9C 2OYHB 4N6JA 4JF7A 1KILB 1OW6A 3BCCD 5KLVE 3CCQP 1NTKD 2LKMA 2HMLA 3TK1A 2E42A 3RK3E 1LTAC 1FZCC 1SQVD 1SQXE 5L8RJ 3RL0C 3L71E 2XR8A 3G4SP 3I55P 3JC22 2QG4A 1CSBA 3PRJA 3G6EP 3AE8C 1NTMK 1SQBJ 1DX7A 1LT1A 3CLQA 1X79B 3P8MC 2QM7A 1JCDA 2KS1A 1LTJA 5APWA 1SQPK 4TLFA 1L0NJ 3GHGB 2W8ZA 1NTZE 3EWKA 1SQQK 1L2PA 2KXPB 1S9KD 1SQBD 1T3UA 1NDOA 3RK3B 1GW3A 5M1BA 1PGOA 3Q3DA 3MTUE 3SWYA 1H8AA 2C9LY 3C0DA 2XSOA 1ZLLA 1URQA 2Z5IA 1L0ND 1OW8A 2BCCJ 2BEZF 4W7YA 3MD0A 4I7ZC 1LP1A 1JO5A 4HM3A 3MP7B 2N1TB 3TNUB 1PPJG 3CX5H 4HM6A 1YTZT 2BCCD 1AV1A 1N2DC 4U3FG 2FYUG 2CPBA 1ULIA 4LC1A 1RE3A 1YBKA 3NXSA 3SSUA 4QDCA 2A06D 2Z5HA 3BRTB 3GW6A 2NPSD 3KHUA 2NUMA 3WUTA 3CMEP 3GZYA 3AECC 3RL0g 4HM0A 5KLVK 3FWNA 3VCPA 1S9KE 1DH3A 1Q81Q 3M9HA 2FXPA 4JYBA 3H1HG 1PFIA 1J1DC 2Y9ZA 4L76A 3S1KA 1Q7YQ 2WSCH 3RK2D 4LLHA 4HM8A 1WT6A 1XTGB 4EMJB 4L75A 5CJ4A 4QCKA 3CCMP 3A0HH 3L72D 1JM0A 1S5LX 3KQGA 1BCCD 4AQRD 3Q2YA 1P84E 1LNQA 2OYHA 3N4XA 1KILA 4AIVA 1AFOA 1JY2N 1LTSC 1OX3A 3F5HA 2ZXEB 2AXTE 2OQQA 2WTYA 1RY3A 3II6A 4OGQB 2KK7A 1LWUC 3V2RA 1EZVD 1U57A 4GIFA 2QE7H 2N9YB 4NBGD 3GCEA 3WUUA 1NTKK 1FZCA 2NPSC 4WBAA 4QDFB 1SQVK 2VRSA 3GHGA 2PRRA 3H1JJ 1HBWA 2IFMA 3L73E 2LR2A 3VTPC 3CWBE 1NTMG 5KAIE 3H1ID 3H1KG 3T97B 4PD4E 2P10A 3EQ2A 3WU2E 3L72E 5H2FH 4AAYB 1PGJA 1SQPG 3H1JD 3RK2C 5CBOA 3USSA 1Q82Q 3AE3C 1SQBK 2RN0A 1BGYG 3W67A 3TNUA 4N78E 1KYOI 2YKPA 1ZXGA 2NZ2A 1XTCC 2GA1A 5KTBA 1L0NK 2OARA 4GDOA 4NBDD 1IFIA 2WPSA 4W80A 1EZVE 1M57D 5AVWB 5GTHE 1HVVA 5CCGD 1S72P 1S5LE 4L73A 3A5TA 4YXDC 2XU6A 3JSVC 1GU4A 2ZYLA 4HM4A 3I5CA 1FDMA 4NBAD 2O1KA 3TSIA 2R32A 2W27A 3CC7P 3E1IA 1YIJP 1FJKA 1LT9C 3C8VA 1BDCA 3GL0A 5AW4B 2ZJSE 1JUNA 4EDFA 4UB8E 2YVJB 4PV1D 5AVRB 1KB9E 5KLIC 1PGPA 1KMIZ 4OWFA 1RFSA 2I1JA 1JY2O 3L35A 3CMAP 1OIPA 2M5AB 4RJTA 3D70A 4EIJA 3CX5D 3E7KA 3S9OA 5BU5A 5AVUB 2XV5A 5HL4A 3AEBC 2WPQA 2FYUD 3VMAA 1T6AA 2J58A 3AE9C 2Q3EA 3VN0A 2PAJA 1VPCA 4GOFA 5CCGC 1UIIA 1O7GA 2CPSA 4WY4D 1DD3A 1H89A 2WSCJ 3GMAA 3GTSA 1ZRTD 3BCCG 1O7PA 1VQ9P 2R5DA 1KQGB 1NTKG 1ZR2A 3AEGC 1FAVA 1S3JA 5AVVB 4YPCA 3K5BA 3EQQA 4PV1C 2R44A 1QL1A 1VDFA 2BASA 3KZIH 1NKZB 3SWFA 1Q90D 4XA4A 1M7LA 1PPJE 1LTGC 1NJIQ 5CCHA 2WPRA 4GODA 2H8PD 2OYOA 2FYNB 1RQVA 4U3FE 1KYOH 3PLNA 2FYUE 3VP8A 5E79E 3IAOA 1SQBG 3IR9A 2WT7B 1GL2D 1O7NA 1VQ7P 1GZLA 3QWOC 1PP9J 4YTPC 1L0NG 2GM4A 3H1LJ 3GB4A 2JP3A 1M1JB 3CXHI 4NBFD 2KSJA 3MUDA 4IFDK 4NPDA 2H7HA 4WY4C 2YXQB 1PP9D 1QVFO 3H1HE 2BCCG 3H1LD 1JY3P 4WB4A 2KOGA 1IC2A
chains in the Genus database with same CATH topology
2JO6A 4AAYB 3BCCE 2I7FA 4NBBD 4H0LD 1L0LE 3GZXA 2NWFA 2NUMA 2BMQA 2DE7D 1NTKE 3FOUA 4QUQA 3GZYA 1JM1A 4HM0A 1VM9A 3VMID 3VCPA 1SQVE 4QDDA 4HM7A 1ZRTE 1O7GA 2FYNC 5BOKA 2NVGA 2XRXA 2E75D 5KLVE 4H44D 1VF5D 2GBXA 4NBDD 2HMLA 2JZAA 3GOBA 1UUVA 2QJPC 4HJLA 3GTSA 1Q90C 2E4PA 4NB8D 1SQXE 2E74D 3D89A 3CXHE 2XSHA 1EZVE 3L71E 2XR8A 3L70E 3VMHD 1BCCE 1O7PA 3EN1A 3N0QA 4HM8A 5KKZC 1WQLA 4EMJB 2DE5D 2YFIA 2ZT9D 1SJGA 3VCAA 1NU1E 1O7WA 1G8KB 3L74E 4QCKA 1SQBE 1ULJA 5CXMA 4D6TE 3EQQA 4NBED 3L75E 1P84E 1O7MA 2QJKC 2IBZE 1VCKA 2ZYLA 4HM4A 4OGQD 4NBAD 1NTZE 4AIVA 2HMOA 3TGUE 2DE6D 1L0NE 1PPJE 2B24A 1NDOA 2NVFA 4HM1A 4NBCD 4P1BH 1SQQE 3GL0A 4U3FE 2NVEA 1KYOE 3C0DA 2XSOA 2FYUE 1O7HA 3GTEA 2QPZA 2GBWA 3GKEA 2B1XA 1NTME 2NUKA 2YFLA 2BCCE 3H1KE 4HM2A 4NBGD 2YVJB 3GL2A 3DQYA 4HKVA 4PV1D 1EG9A 1O7NA 2E76D 3GCEA 1RIEA 3AZCA 2HMNA 1G8JB 4QUPA 1SQPE 1KB9E 4HM3A 3GB4A 3VMGD 4QDFB 5KLIC 1PP9E 2YIUC 3CX5E 3H1IE 1FQTA 4HM6A 1UUWA 4NBFD 2CKFA 3H1LE 1RFSA 5AEWA 1BGYE 1NYKA 2YFJA 2A06E 4QDFA 2QJYC 2HMMA 5AEUA 3L73E 1ULIA 2HMJA 3H1JE 1BE3E 3CWBE 2E4QA 4NBHD 2HMKA 4P1CH 3H1HE 2Q3WA 2D2CD 4QURA 4QDCA 4H13D 2BMRA 4PD4E 5HL4A 4HM5A 4NB9D 2BMOA 3L72E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JO6 A;  4AAY B;  3BCC E;  2I7F A;  4NBB D;  4H0L D;  1L0L E;  3GZX A;  2NWF A;  2NUM A;  2BMQ A;  2DE7 D;  1NTK E;  3FOU A;  4QUQ A;  3GZY A;  1JM1 A;  4HM0 A;  1VM9 A;  3VMI D;  3VCP A;  1SQV E;  4QDD A;  4HM7 A;  1ZRT E;  1O7G A;  2FYN C;  5BOK A;  2NVG A;  2XRX A;  2E75 D;  5KLV E;  4H44 D;  1VF5 D;  2GBX A;  4NBD D;  2HML A;  2JZA A;  3GOB A;  1UUV A;  2QJP C;  4HJL A;  3GTS A;  1Q90 C;  2E4P A;  4NB8 D;  1SQX E;  2E74 D;  3D89 A;  3CXH E;  2XSH A;  1EZV E;  3L71 E;  2XR8 A;  3L70 E;  3VMH D;  1BCC E;  1O7P A;  3EN1 A;  3N0Q A;  4HM8 A;  5KKZ C;  1WQL A;  4EMJ B;  2DE5 D;  2YFI A;  2ZT9 D;  1SJG A;  3VCA A;  1NU1 E;  1O7W A;  1G8K B;  3L74 E;  4QCK A;  1SQB E;  1ULJ A;  5CXM A;  4D6T E;  3EQQ A;  4NBE D;  3L75 E;  1P84 E;  1O7M A;  2QJK C;  2IBZ E;  1VCK A;  2ZYL A;  4HM4 A;  4OGQ D;  4NBA D;  1NTZ E;  4AIV A;  2HMO A;  3TGU E;  2DE6 D;  1L0N E;  1PPJ E;  2B24 A;  1NDO A;  2NVF A;  4HM1 A;  4NBC D;  4P1B H;  1SQQ E;  3GL0 A;  4U3F E;  2NVE A;  1KYO E;  3C0D A;  2XSO A;  2FYU E;  1O7H A;  3GTE A;  2QPZ A;  2GBW A;  3GKE A;  2B1X A;  1NTM E;  2NUK A;  2YFL A;  2BCC E;  3H1K E;  4HM2 A;  4NBG D;  2YVJ B;  3GL2 A;  3DQY A;  4HKV A;  4PV1 D;  1EG9 A;  1O7N A;  2E76 D;  3GCE A;  1RIE A;  3AZC A;  2HMN A;  1G8J B;  4QUP A;  1SQP E;  1KB9 E;  4HM3 A;  3GB4 A;  3VMG D;  4QDF B;  5KLI C;  1PP9 E;  2YIU C;  3CX5 E;  3H1I E;  1FQT A;  4HM6 A;  1UUW A;  4NBF D;  2CKF A;  3H1L E;  1RFS A;  5AEW A;  1BGY E;  1NYK A;  2YFJ A;  2A06 E;  4QDF A;  2QJY C;  2HMM A;  5AEU A;  3L73 E;  1ULI A;  2HMJ A;  3H1J E;  1BE3 E;  3CWB E;  2E4Q A;  4NBH D;  2HMK A;  4P1C H;  3H1H E;  2Q3W A;  2D2C D;  4QUR A;  4QDC A;  4H13 D;  2BMR A;  4PD4 E;  5HL4 A;  4HM5 A;  4NB9 D;  2BMO A;  3L72 E; 
#chains in the Genus database with same CATH topology
 1PL5 A;  2YMK A;  4NBB D;  4JBZ A;  1KB9 I;  4IL6 H;  1LTI C;  4I2L C;  1T3J A;  3HD7 B;  4C7N B;  2A06 G;  1EDL A;  3AED C;  5APQ A;  1IFP A;  1N73 C;  5AW2 B;  4H0L B;  2YIU B;  2AEJ A;  3L70 J;  1BGY D;  1Q90 C;  2E74 D;  2HG5 D;  4WWI A;  1PZQ A;  1IJD B;  2E75 B;  1K9M Q;  5TJH A;  1YI2 P;  2Q7C A;  1YQ3 C;  1GL2 C;  1O7M A;  2KYV A;  1FOS F;  1N8R Q;  1RF1 A;  4HJG H;  2FYU K;  3FXE A;  3CCR P;  5APY A;  4PJ0 H;  1NTM E;  3KYQ A;  3H1K E;  5GTI H;  3TF5 A;  1KFM A;  3NTN A;  1SQP E;  2H88 C;  1M56 D;  1YQ4 C;  2LXC B;  1BGY E;  5AEU A;  3Q5S A;  1OVR A;  1DEB A;  1G2C A;  4H13 D;  2BMR A;  2K9Y A;  4R4M A;  1J1E B;  3JCU H;  1L0L J;  4HH2 A;  2OYI B;  2JO6 A;  2WT7 A;  1YHQ P;  2AXC A;  1KQL A;  3H1I G;  2DE7 D;  4A7P A;  4QUQ A;  2L5G B;  4CPG A;  3ABV C;  1WRG A;  3H1J G;  1M1J A;  1L0L D;  1NTZ J;  3BAT A;  2Y0C A;  1X9V A;  4HKZ H;  2XDJ A;  1MFT A;  2QJP C;  2RH0 A;  2YNY A;  3D89 A;  1N7S D;  3CXH H;  4RES B;  2IPP A;  2C0X A;  1VQK P;  2K3R A;  1NU1 J;  2N1T D;  4XFJ A;  1Y47 A;  3C1L A;  4D6T J;  1O7W A;  5AW0 B;  3PTZ A;  3V4Q A;  1ULJ A;  3AEA C;  1G1J A;  1IFJ A;  3HD7 A;  4C7N A;  3CCJ P;  1VQP P;  2RMZ A;  1EDI A;  5TIS E;  2W6J H;  2ZT9 B;  2OTL P;  2JDI H;  4D6T D;  2FY8 A;  1QL2 A;  1O7H A;  3D6Y A;  1YIT P;  4OVN F;  2B1X A;  3B5N D;  3PHL A;  1EXI A;  1FZC B;  3RL0 B;  4H13 C;  5AW6 B;  3RGU A;  4HKV A;  1KYO D;  2K37 A;  1N86 A;  3AZC A;  1ZW0 A;  2HMN A;  3CCV P;  1M90 Q;  1HUC A;  3U1A A;  2IYO A;  2JR8 A;  5DJU B;  2LXB A;  1U7J A;  2HOD B;  2PFX A;  1JNM A;  1KC8 Q;  1OXZ A;  2H43 A;  1VQL P;  4QUR A;  3C9I A;  3O6Q B;  2OGU A;  1HGV A;  2E5Y A;  2P58 A;  4L74 A;  3VP9 A;  1MZ9 A;  2IBZ I;  1N7S C;  4DT0 A;  3BCC E;  3EFG A;  2NWF A;  1RQU A;  1NTK E;  3AE5 C;  1KZU B;  2HLO A;  2N1T C;  5B5E E;  1G1I A;  4I7Z B;  1SQV E;  2Q9I A;  3VMY A;  2RKL A;  3M9B A;  1VF5 D;  3A3Y B;  1YJ9 P;  3BRV B;  2C0W A;  4RKU J;  2ZXX A;  3SFD C;  1IK7 A;  4ZKP A;  4JYC A;  1ZME C;  2OYI A;  2QIW A;  2YFI A;  5AW7 B;  2G8Y A;  4Z1M H;  3L75 J;  1SQB E;  3B5N C;  1M1K Q;  1RE4 C;  2JWD A;  4B86 A;  1L0N E;  3CC4 P;  2B24 A;  2NVF A;  1X8Y A;  3R4Y A;  3WMM 0;  3L75 D;  1KV4 A;  3TDK A;  3VMZ A;  1Q86 Q;  2BCC E;  2W6A A;  1L0L K;  1EG9 A;  3M91 A;  1R8E A;  2A45 I;  4EI2 A;  1KOR A;  2HPC B;  2ZYD A;  1BE3 J;  3NFQ A;  2A06 E;  2QJY C;  1T8Z A;  4XE5 B;  4Y99 B;  1VF5 C;  1GK6 A;  2NRG A;  1ZR4 A;  2WSE J;  1MUU A;  4UB6 E;  5AVS B;  1BE3 D;  1Y8A A;  3CPW O;  1PP9 G;  4N3Y B;  1QLE D;  3E1R A;  3H1L G;  1LWU B;  4O9B A;  2QJK B;  1VL2 A;  2XKM A;  4GOE A;  1YTZ I;  1FE6 A;  2C9N Y;  2NPS B;  1UUV A;  2HOD A;  3D6Z A;  2XSH A;  1AQ5 A;  2YO3 A;  5B66 E;  3O6Q A;  1BCC E;  2V7Q H;  2DE5 D;  1SVF A;  3L74 J;  1CW5 A;  2HFE D;  1SLQ A;  2POH A;  1MFZ A;  2M3E A;  3CXH D;  1OW7 A;  2JWA A;  1GK4 A;  2KUB A;  3RK2 B;  2DW3 A;  1DD4 A;  1RF0 C;  4ASW A;  3L74 D;  2XZR A;  3Q5P A;  4NBC D;  3L70 G;  2ZFC A;  2QPZ A;  1OZH A;  2ZVN B;  3AE2 C;  3FWL A;  3A0B E;  1M8O B;  1MKM A;  5KAF E;  3KDP B;  3CCE P;  3H1I E;  4OH8 B;  1T2K D;  1JEK A;  2YFJ A;  3AE1 C;  3H1J E;  3B5N A;  2D2C D;  1AVO A;  1P84 I;  2IX7 C;  1DEE G;  1BSH A;  1VM9 A;  2B9B A;  1NOH A;  1GTW A;  3MIW A;  2HPC A;  1SFC D;  2AEM A;  3BAS A;  5APV A;  3GG2 A;  5KLI B;  4DCK A;  4U3F J;  1L0L G;  1EXJ A;  1YJN P;  3A7O A;  1ZV8 A;  2R3C A;  1K73 Q;  1RF1 B;  1L4A D;  4KHX A;  3I56 P;  2IDB A;  1LWU A;  2YXR B;  2WSF H;  1VCK A;  5KJ7 D;  2KZI A;  2Y0D A;  3HRN A;  1HGZ A;  2FFD C;  4PD4 I;  1Y9B A;  2NPS A;  5CMZ A;  4P1B H;  1OFC X;  1T2K C;  1NO4 A;  4U7J A;  1K05 A;  3FX0 A;  2W90 A;  1ZP0 C;  3QH9 A;  3GF3 A;  1NU1 G;  3HUS C;  1D7M A;  2D2C C;  4D6T G;  2M3B A;  3SFE C;  2HR3 A;  2IZ0 A;  1RHZ B;  3SWK A;  1VQ4 P;  5AW1 B;  3CX5 E;  3GF7 A;  1EZV I;  1W2B O;  1USE A;  2WIT A;  3PH0 A;  1G2C B;  1OVV A;  4PV1 B;  3V6I A;  4LGD E;  1SFC C;  2O01 N;  5BVZ A;  1LTT C;  3HE4 A;  3M0D C;  1JMM A;  2Q1K A;  3MGN A;  1HJB A;  5APS A;  1KQS O;  1JMB A;  3UIA A;  4DZO A;  5CBN A;  1YJW P;  1FC2 C;  2QM8 A;  2Q5U A;  1URQ D;  2B88 A;  1L4A C;  1ZRT E;  2WQY C;  2XRX A;  4H44 D;  1NHL A;  5KJ7 C;  3H6P A;  2V7Q J;  5KKZ C;  4I6M C;  3S4R A;  3MHV A;  1VQ8 P;  4WY4 B;  1LT9 A;  5AVT B;  1IK9 A;  4HYT B;  1FJP A;  1NAF A;  3A0H E;  2WVR A;  1P84 H;  1FZE A;  3TGU J;  3TYY A;  1YYC A;  1IFN A;  1SQQ J;  1K04 A;  3G71 P;  1NYH A;  2ZYA A;  2AXT H;  1AQT A;  2ZYG A;  3LIE A;  1N73 B;  4YXW H;  2IBZ D;  2KLV A;  3U1C A;  1LTJ C;  2AEF A;  3LW5 H;  1EDJ A;  4DJG A;  3L70 D;  3L75 G;  4DOJ A;  2QSI A;  2E76 D;  1RIE A;  3D71 A;  2JEE A;  1LTB C;  1PP9 E;  2MKV A;  2G3A A;  2CKF A;  3H1L E;  1URQ C;  4W7Z A;  4WVZ A;  1GL2 B;  5CCG A;  1JTH A;  4H44 C;  1IZN B;  5AVY B;  4PD4 H;  1KIL D;  1U7M A;  1E5W A;  1FS0 E;  1JY2 P;  3WU2 H;  2BMO A;  5H2F E;  3RBX A;  2P7J A;  2I7F A;  1HF9 A;  5EFW B;  2Q3I A;  2YKO A;  2BMQ A;  1VQN P;  1A02 F;  2QA4 P;  5KLV J;  4HM7 A;  1RE3 C;  2NVG A;  1BE3 G;  1AA0 A;  3CI9 A;  1SQX J;  3GOB A;  3L71 J;  1VQO P;  3W68 A;  1J1E C;  2WSE H;  3VMH D;  3L70 E;  3N0Q A;  1KFN A;  3Q1M A;  3CCL P;  1WQL A;  5GTH H;  1N7L A;  2J5U A;  3VCA A;  3RK3 D;  1EDK A;  1SS1 A;  3M9Q A;  1AJY A;  1SQX D;  1JCC A;  2WSF J;  3L71 D;  1S5L H;  2E74 B;  1NVO A;  1H88 A;  2E76 C;  3M0A A;  1ZN5 A;  4R4L A;  5AVQ B;  1KIL E;  3GTE A;  4IFM A;  1NTZ D;  4KT0 J;  3L74 G;  2FXO A;  2QJP B;  3R2P A;  2OYH C;  2GUS A;  2NUK A;  4WY4 A;  1KIL C;  1KB9 H;  1FZG A;  1OMI A;  1NU1 D;  1SQV J;  1CZQ A;  3VYI A;  1FZF A;  2HMJ A;  2W83 C;  1N73 A;  1PIX A;  2N9B A;  3CCS P;  3P7K A;  2E5T A;  3NMD A;  4HM5 A;  1S4X A;  1L0L E;  4IL6 X;  3GHG C;  2YKQ A;  3RK3 C;  4H13 B;  1GMJ A;  1JOC A;  1GL2 A;  2WSS H;  2E4P A;  4NB8 D;  1IFM A;  2QEX P;  4K3A A;  1NU1 E;  3A2A A;  2Z4E A;  4I1L A;  1UIX A;  4BRY B;  1FBM A;  4D6T E;  1N7S B;  3KZI E;  1EQ7 A;  4K35 A;  4Y28 J;  4OGQ D;  1JY3 N;  5DJT B;  2HMO A;  3WUV A;  1FU1 A;  1P84 D;  1ZOY C;  1KYO E;  1SP4 A;  2I1K A;  1QEX A;  2O01 H;  1AVY A;  3LW5 J;  5E79 H;  2FXM A;  2WPV B;  1QX8 A;  1WMK A;  3DQY A;  2IFN A;  1H0T B;  1BSN A;  2H89 C;  1LJ2 A;  5AEW A;  3L73 J;  3B5N B;  2W6B A;  3FXD A;  1NYK A;  3CWB J;  2FYZ A;  3HTK A;  3VOP A;  2E4Q A;  3H32 B;  1J1D B;  4P1C H;  1SQX K;  3L72 J;  1TU3 F;  3V4W A;  2KNC B;  1BCC J;  2O1J A;  3L73 D;  3RBZ A;  2B87 B;  3CL3 D;  2R3S A;  1FDI A;  5CCH D;  3CWB D;  4IL6 E;  4PD4 D;  3B8E B;  3H25 A;  1NTZ K;  2GBX A;  1GD2 E;  3V5B A;  2Q6Q A;  4OGQ C;  2OTK E;  3B71 A;  4Y99 C;  1MV8 A;  4N78 D;  2QJY B;  1NU1 K;  1X0T A;  2M8R A;  1SJG A;  1VF5 B;  2JJL A;  1BDD A;  1G8K B;  2JO1 A;  3L75 E;  3KXD A;  2QJK C;  2P2U A;  3IN6 A;  4JQ0 D;  2K88 A;  2P1J A;  3H1I J;  5CHX A;  2CK3 H;  1HTL C;  2K9J B;  4QMA A;  4NPE A;  4PJ0 E;  1HJ0 A;  4C7R A;  5GTI E;  3GL2 A;  2IBZ G;  3U59 A;  1FZB A;  1CI6 B;  4BRY A;  3TGU G;  2J59 M;  1N7S A;  5CCH C;  1SQQ G;  1JY3 O;  3IFM A;  3B4S A;  5AW3 B;  2N1T A;  3HE4 B;  1BE3 E;  1KB9 D;  1NGM B;  1IFD A;  2Q3W A;  3JCU E;  4NB9 D;  2KZJ A;  2B89 A;  3HE5 B;  2R5B A;  1KN7 A;  3MUD C;  3PP5 A;  1H0T A;  3VMI D;  4QDD A;  3CCU P;  5BOK A;  2KIK A;  1GDT A;  1DIP A;  2L91 A;  2JZA A;  1RE4 A;  2P67 A;  1LT9 B;  3AE7 C;  3H32 A;  3CXH E;  2KNC A;  3AEE C;  2B87 A;  2BEQ D;  3L74 E;  3GLM A;  2FBW C;  2ITA A;  5KLV G;  1S2E A;  4GT1 A;  5TIS H;  2A45 G;  2A45 H;  2YMY A;  1QVG O;  1SQX G;  1KTM A;  3L71 G;  2PP6 A;  2FYU J;  2O01 J;  2KLU A;  3V2N A;  1PV3 A;  2WWW A;  2Y0E A;  3GKE A;  1PPJ D;  1LGH B;  5APX A;  2YFL A;  1KQF B;  3P32 A;  1RF1 C;  3O8Z A;  3OJA B;  4U3F D;  1NTZ G;  4QUP A;  1G8J B;  2E43 A;  3AEF C;  4MN4 C;  3VMG D;  2UWJ E;  1JTH B;  5BU8 B;  1UUW A;  4QDF A;  2K9J A;  4EYY Q;  2HMM A;  3H1H J;  3P8C D;  1E79 H;  3HD7 D;  4IFF A;  5APU A;  2FFD B;  1KD1 Q;  1Z56 A;  3OAK A;  1NAY A;  5C39 A;  3CD6 P;  4H0L D;  3T97 A;  2KI7 B;  3H1H D;  3HUS B;  5B5E H;  1CI6 A;  1JM1 A;  2D2C B;  1SQV G;  3LID A;  4ZKU A;  2FYN C;  2E75 D;  5APT A;  2WMM A;  5AVZ B;  1GW4 A;  2O3J A;  1RF0 A;  1K8A Q;  1HWT C;  3EN1 A;  3ITK A;  1EC5 A;  1SFC B;  3AE6 C;  3V2P A;  1JB0 J;  2KP8 A;  1VQM P;  1M1J C;  3IF4 A;  1VQ6 P;  3HE5 A;  1IO4 A;  5AW5 B;  3MZW B;  5CJ0 A;  1NH4 A;  4M3L A;  2QVA A;  1PGQ A;  1R5S A;  3P8C E;  2IYP A;  2OTJ P;  1A02 J;  1L4A B;  2M0B A;  4ZNC A;  4EOT A;  1FZA A;  3V2Q A;  3ZDM A;  2Y9Y A;  1NTM J;  1OWA A;  3H1K J;  2KB7 P;  4AUW A;  3HD7 C;  4HM2 A;  1SQP J;  1W2E A;  5KKZ B;  4NPF X;  4H0L C;  3G9R A;  1NTM D;  2YIU C;  1BGY J;  5AVX B;  1RH5 B;  3H1K D;  2ZAE B;  2WZ7 A;  3G3Z A;  1SQP D;  3TGU D;  2E75 C;  2GUV A;  3OW2 O;  3BVH A;  2M5A A;  1SQQ D;  1FOS E;  4HB1 A;  1GU5 A;  4AYC A;  3F89 A;  4UB6 H;  1X22 A;  3GZX A;  3KPE A;  2YO2 A;  3Q5R A;  2XNX A;  2KS1 B;  1LTJ B;  3N7N A;  4ASV A;  2V4H A;  3L73 G;  1QGK B;  3CWB G;  2PGD A;  5KAI H;  2I8D A;  4IOI H;  2K1A A;  2MJZ A;  4HJL A;  2KSE A;  3L72 G;  5AW9 B;  4BWN A;  3AE4 C;  3PJS K;  2FFD A;  1URQ B;  5B66 H;  1BCC G;  1OVU A;  3L36 A;  3VMX A;  1FDO A;  2ZT9 D;  3CX5 I;  1VQ5 P;  1LP1 B;  3OA7 A;  4H44 B;  4RO0 A;  1NKN A;  2HYN A;  1HH0 A;  5CXM A;  3HUS A;  4NBE D;  3M06 A;  2JKV A;  2IBZ E;  1J2J B;  5AW8 B;  2SPZ A;  3TGU E;  2DE6 D;  1USD A;  3RL0 D;  1EZV G;  4ZMD A;  4HM1 A;  2OYI C;  1SQQ E;  5KLV D;  4C46 A;  2NVE A;  2IZ1 A;  1NWQ A;  2GBW A;  1Q2N A;  1SFC A;  4GKG A;  3A0B H;  3M0D A;  5K5G B;  3CC2 P;  3L37 A;  2E74 C;  5KAF H;  4BXL A;  2ZVO B;  3HTK B;  2QRX A;  3L4F A;  1FQT A;  4TT3 H;  4KJM A;  1S1C X;  2E76 B;  1L4A A;  4NBH D;  2HMK A;  1W5C E;  2FKW B;  4JPZ B;  4UB8 H;  3BCC J;  5KJ7 A;  2XND H;  1NTK J;  1R5L A;  3EFF K;  3FGA D;  3FOU A;  2ZT9 C;  2OYH B;  4N6J A;  4JF7 A;  1KIL B;  1OW6 A;  3BCC D;  5KLV E;  3CCQ P;  1NTK D;  2LKM A;  2HML A;  3TK1 A;  2E42 A;  3RK3 E;  1LTA C;  1FZC C;  1SQV D;  1SQX E;  5L8R J;  3RL0 C;  3L71 E;  2XR8 A;  3G4S P;  3I55 P;  3JC2 2;  2QG4 A;  1CSB A;  3PRJ A;  3G6E P;  3AE8 C;  1NTM K;  1SQB J;  1DX7 A;  1LT1 A;  3CLQ A;  1X79 B;  3P8M C;  2QM7 A;  1JCD A;  2KS1 A;  1LTJ A;  5APW A;  1SQP K;  4TLF A;  1L0N J;  3GHG B;  2W8Z A;  1NTZ E;  3EWK A;  1SQQ K;  1L2P A;  2KXP B;  1S9K D;  1SQB D;  1T3U A;  1NDO A;  3RK3 B;  1GW3 A;  5M1B A;  1PGO A;  3Q3D A;  3MTU E;  3SWY A;  1H8A A;  2C9L Y;  3C0D A;  2XSO A;  1ZLL A;  1URQ A;  2Z5I A;  1L0N D;  1OW8 A;  2BCC J;  2BEZ F;  4W7Y A;  3MD0 A;  4I7Z C;  1LP1 A;  1JO5 A;  4HM3 A;  3MP7 B;  2N1T B;  3TNU B;  1PPJ G;  3CX5 H;  4HM6 A;  1YTZ T;  2BCC D;  1AV1 A;  1N2D C;  4U3F G;  2FYU G;  2CPB A;  1ULI A;  4LC1 A;  1RE3 A;  1YBK A;  3NXS A;  3SSU A;  4QDC A;  2A06 D;  2Z5H A;  3BRT B;  3GW6 A;  2NPS D;  3KHU A;  2NUM A;  3WUT A;  3CME P;  3GZY A;  3AEC C;  3RL0 g;  4HM0 A;  5KLV K;  3FWN A;  3VCP A;  1S9K E;  1DH3 A;  1Q81 Q;  3M9H A;  2FXP A;  4JYB A;  3H1H G;  1PFI A;  1J1D C;  2Y9Z A;  4L76 A;  3S1K A;  1Q7Y Q;  2WSC H;  3RK2 D;  4LLH A;  4HM8 A;  1WT6 A;  1XTG B;  4EMJ B;  4L75 A;  5CJ4 A;  4QCK A;  3CCM P;  3A0H H;  3L72 D;  1JM0 A;  1S5L X;  3KQG A;  1BCC D;  4AQR D;  3Q2Y A;  1P84 E;  1LNQ A;  2OYH A;  3N4X A;  1KIL A;  4AIV A;  1AFO A;  1JY2 N;  1LTS C;  1OX3 A;  3F5H A;  2ZXE B;  2AXT E;  2OQQ A;  2WTY A;  1RY3 A;  3II6 A;  4OGQ B;  2KK7 A;  1LWU C;  3V2R A;  1EZV D;  1U57 A;  4GIF A;  2QE7 H;  2N9Y B;  4NBG D;  3GCE A;  3WUU A;  1NTK K;  1FZC A;  2NPS C;  4WBA A;  4QDF B;  1SQV K;  2VRS A;  3GHG A;  2PRR A;  3H1J J;  1HBW A;  2IFM A;  3L73 E;  2LR2 A;  3VTP C;  3CWB E;  1NTM G;  5KAI E;  3H1I D;  3H1K G;  3T97 B;  4PD4 E;  2P10 A;  3EQ2 A;  3WU2 E;  3L72 E;  5H2F H;  4AAY B;  1PGJ A;  1SQP G;  3H1J D;  3RK2 C;  5CBO A;  3USS A;  1Q82 Q;  3AE3 C;  1SQB K;  2RN0 A;  1BGY G;  3W67 A;  3TNU A;  4N78 E;  1KYO I;  2YKP A;  1ZXG A;  2NZ2 A;  1XTC C;  2GA1 A;  5KTB A;  1L0N K;  2OAR A;  4GDO A;  4NBD D;  1IFI A;  2WPS A;  4W80 A;  1EZV E;  1M57 D;  5AVW B;  5GTH E;  1HVV A;  5CCG D;  1S72 P;  1S5L E;  4L73 A;  3A5T A;  4YXD C;  2XU6 A;  3JSV C;  1GU4 A;  2ZYL A;  4HM4 A;  3I5C A;  1FDM A;  4NBA D;  2O1K A;  3TSI A;  2R32 A;  2W27 A;  3CC7 P;  3E1I A;  1YIJ P;  1FJK A;  1LT9 C;  3C8V A;  1BDC A;  3GL0 A;  5AW4 B;  2ZJS E;  1JUN A;  4EDF A;  4UB8 E;  2YVJ B;  4PV1 D;  5AVR B;  1KB9 E;  5KLI C;  1PGP A;  1KMI Z;  4OWF A;  1RFS A;  2I1J A;  1JY2 O;  3L35 A;  3CMA P;  1OIP A;  2M5A B;  4RJT A;  3D70 A;  4EIJ A;  3CX5 D;  3E7K A;  3S9O A;  5BU5 A;  5AVU B;  2XV5 A;  5HL4 A;  3AEB C;  2WPQ A;  2FYU D;  3VMA A;  1T6A A;  2J58 A;  3AE9 C;  2Q3E A;  3VN0 A;  2PAJ A;  1VPC A;  4GOF A;  5CCG C;  1UII A;  1O7G A;  2CPS A;  4WY4 D;  1DD3 A;  1H89 A;  2WSC J;  3GMA A;  3GTS A;  1ZRT D;  3BCC G;  1O7P A;  1VQ9 P;  2R5D A;  1KQG B;  1NTK G;  1ZR2 A;  3AEG C;  1FAV A;  1S3J A;  5AVV B;  4YPC A;  3K5B A;  3EQQ A;  4PV1 C;  2R44 A;  1QL1 A;  1VDF A;  2BAS A;  3KZI H;  1NKZ B;  3SWF A;  1Q90 D;  4XA4 A;  1M7L A;  1PPJ E;  1LTG C;  1NJI Q;  5CCH A;  2WPR A;  4GOD A;  2H8P D;  2OYO A;  2FYN B;  1RQV A;  4U3F E;  1KYO H;  3PLN A;  2FYU E;  3VP8 A;  5E79 E;  3IAO A;  1SQB G;  3IR9 A;  2WT7 B;  1GL2 D;  1O7N A;  1VQ7 P;  1GZL A;  3QWO C;  1PP9 J;  4YTP C;  1L0N G;  2GM4 A;  3H1L J;  3GB4 A;  2JP3 A;  1M1J B;  3CXH I;  4NBF D;  2KSJ A;  3MUD A;  4IFD K;  4NPD A;  2H7H A;  4WY4 C;  2YXQ B;  1PP9 D;  1QVF O;  3H1H E;  2BCC G;  3H1L D;  1JY3 P;  4WB4 A;  2KOG A;  1IC2 A; 
#chains in the Genus database with same CATH homology
 2JO6 A;  4AAY B;  3BCC E;  2I7F A;  4NBB D;  4H0L D;  1L0L E;  3GZX A;  2NWF A;  2NUM A;  2BMQ A;  2DE7 D;  1NTK E;  3FOU A;  4QUQ A;  3GZY A;  1JM1 A;  4HM0 A;  1VM9 A;  3VMI D;  3VCP A;  1SQV E;  4QDD A;  4HM7 A;  1ZRT E;  1O7G A;  2FYN C;  5BOK A;  2NVG A;  2XRX A;  2E75 D;  5KLV E;  4H44 D;  1VF5 D;  2GBX A;  4NBD D;  2HML A;  2JZA A;  3GOB A;  1UUV A;  2QJP C;  4HJL A;  3GTS A;  1Q90 C;  2E4P A;  4NB8 D;  1SQX E;  2E74 D;  3D89 A;  3CXH E;  2XSH A;  1EZV E;  3L71 E;  2XR8 A;  3L70 E;  3VMH D;  1BCC E;  1O7P A;  3EN1 A;  3N0Q A;  4HM8 A;  5KKZ C;  1WQL A;  4EMJ B;  2DE5 D;  2YFI A;  2ZT9 D;  1SJG A;  3VCA A;  1NU1 E;  1O7W A;  1G8K B;  3L74 E;  4QCK A;  1SQB E;  1ULJ A;  5CXM A;  4D6T E;  3EQQ A;  4NBE D;  3L75 E;  1P84 E;  1O7M A;  2QJK C;  2IBZ E;  1VCK A;  2ZYL A;  4HM4 A;  4OGQ D;  4NBA D;  1NTZ E;  4AIV A;  2HMO A;  3TGU E;  2DE6 D;  1L0N E;  1PPJ E;  2B24 A;  1NDO A;  2NVF A;  4HM1 A;  4NBC D;  4P1B H;  1SQQ E;  3GL0 A;  4U3F E;  2NVE A;  1KYO E;  3C0D A;  2XSO A;  2FYU E;  1O7H A;  3GTE A;  2QPZ A;  2GBW A;  3GKE A;  2B1X A;  1NTM E;  2NUK A;  2YFL A;  2BCC E;  3H1K E;  4HM2 A;  4NBG D;  2YVJ B;  3GL2 A;  3DQY A;  4HKV A;  4PV1 D;  1EG9 A;  1O7N A;  2E76 D;  3GCE A;  1RIE A;  3AZC A;  2HMN A;  1G8J B;  4QUP A;  1SQP E;  1KB9 E;  4HM3 A;  3GB4 A;  3VMG D;  4QDF B;  5KLI C;  1PP9 E;  2YIU C;  3CX5 E;  3H1I E;  1FQT A;  4HM6 A;  1UUW A;  4NBF D;  2CKF A;  3H1L E;  1RFS A;  5AEW A;  1BGY E;  1NYK A;  2YFJ A;  2A06 E;  4QDF A;  2QJY C;  2HMM A;  5AEU A;  3L73 E;  1ULI A;  2HMJ A;  3H1J E;  1BE3 E;  3CWB E;  2E4Q A;  4NBH D;  2HMK A;  4P1C H;  3H1H E;  2Q3W A;  2D2C D;  4QUR A;  4QDC A;  4H13 D;  2BMR A;  4PD4 E;  5HL4 A;  4HM5 A;  4NB9 D;  2BMO A;  3L72 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...