3L71E

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 37
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l71E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l71E02
3EQQA 2NWFA 3N0QA 2QJPC 3VCPA 2BMRA 4HM6A 3VCAA 2E74D 3VMHD 4D6TE 2B24A 2BMQA 4QDFB 3GTEA 4NBGD 1SJGA 3H1KE 3H1LE 2Q3WA 4HJLA 4HKVA 1O7HA 4HM1A 4EMJB 1VF5D 1FQTA 2HMMA 5AEUA 2JO6A 2YFIA 2E4QA 3L71E 4QDCA 1BE3E 2ZYLA 4NBHD 4P1CH 1SQQE 3VMID 3L72E 2NUKA 1SQVE 2FYUE 1O7PA 4PV1D 1PP9E 1KB9E 3L75E 1WQLA 2DE5D 2GBWA 5KLIC 3GZXA 4P1BH 5BOKA 1UUWA 1L0LE 2A06E 2YFLA 3GB4A 4QUQA 3CX5E 4NBAD 1NTZE 3DQYA 4AIVA 2DE7D 1Q90C 2XSHA 2E76D 3H1IE 5CXMA 3GCEA 4NBBD 3EN1A 2QPZA 5AEWA 4NBED 2BMOA 2QJYC 1PPJE 4U3FE 2BCCE 1G8KB 2JZAA 1NDOA 2IBZE 2E75D 1NTKE 3GTSA 4NBDD 1NTME 1VCKA 2HMLA 4HM4A 1L0NE 4HM8A 4PD4E 1SQBE 1EG9A 3CWBE 2XRXA 3GOBA 3H1HE 1O7GA 1ULIA 5KKZC 1NYKA 1ULJA 3D89A 4QDDA 3C0DA 4QDFA 2DE6D 3L70E 2XSOA 1BGYE 2YFJA 4QURA 4NBFD 1RFSA 2E4PA 4H44D 1G8JB 1P84E 1ZRTE 3GKEA 3GZYA 4HM2A 2YVJB 4HM3A 5HL4A 2NVFA 4HM7A 4QUPA 4NB8D 1BCCE 1RIEA 1O7NA 2GBXA 3H1JE 2YIUC 3TGUE 4NBCD 2HMJA 1UUVA 3GL0A 2HMOA 3FOUA 4HM0A 1EZVE 2NVGA 1NU1E 3GL2A 2B1XA 2HMKA 1KYOE 1JM1A 2QJKC 4QCKA 2D2CD 2I7FA 1O7MA 3CXHE 4OGQD 3BCCE 2NUMA 3L74E 3VMGD 2HMNA 4NB9D 1O7WA 2FYNC 4H0LD 2ZT9D 3AZCA 4H13D 1VM9A 1SQXE 2NVEA 4HM5A 4AAYB 1SQPE 5KLVE 2XR8A 3L73E 2CKFA
chains in the Genus database with same CATH superfamily
5GTHE 1JY2O 4EDFA 1HTLC 4NBGD 1SQQJ 2WPRA 4EMJB 3W68A 1FQTA 1JCCA 2M3BA 2QRXA 5AEUA 1WRGA 2A45G 4D6TG 3H1KJ 1O7PA 4OWFA 1PP9E 1ZOYC 3V4QA 1KB9E 2BCCG 2L91A 1JY3P 1HGVA 3CX5E 3D6YA 5CCGA 5BU8B 2KP8A 1CZQA 3L72J 2FYNB 3WMM0 1EDIA 2QJKB 1SQXK 2QPZA 5AVYB 4GT1A 3IAOA 1AJYA 4H0LB 4IFFA 2IBZI 3QWOC 1ULIA 3KPEA 3LW5H 2J5UA 4K35A 2HFED 4GIFA 2JKVA 3NFQA 1EDKA 1L0LK 5TISE 1JTHB 3AEDC 1SQVD 3WU2H 4HYTB 1M1JA 3G9RA 2PGDA 1SQQK 5CMZA 1L4AB 1HVVA 1OWAA 2KNCA 2N1TA 1URQD 1VF5C 1OW6A 3SSUA 1GL2A 3H1ID 1KFNA 2XR8A 2H89C 2Y9ZA 2FBWC 4D6TD 3I5CA 2Q7CA 2BMRA 3G4SP 4YXWH 3PRJA 1KMIZ 1DEBA 2YKOA 4DCKA 1S9KE 2MKVA 2M5AB 1VQMP 1SQQE 4WWIA 5C39A 2KS1A 5KAFH 1DEEG 5KLIC 1X0TA 3KZIH 1L0LE 2JR8A 1NTMG 4JYBA 1Q90C 1RE4A 4NBBD 5CCHC 1FJKA 3AECC 4YPCA 2IBZG 3BCCD 1LTAC 1FZCC 2HPCA 3RK3E 3R4YA 1L0LJ 1PGQA 1VCKA 3QH9A 1Q86Q 3FGAD 1FZCB 3E7KA 5B66E 3U1AA 3AE7C 1LTTC 4W80A 2Z5IA 1PV3A 2RMZA 1KORA 1AFOA 2HMJA 1DX7A 1SQQG 4LLHA 1S5LE 1BGYG 1QVGO 1NU1E 2B1XA 4Y99C 5CBNA 1G1JA 2D2CD 3CXHE 2E42A 1N8RQ 3C9IA 2YXQB 4D6TJ 5AVWB 3H32A 3H1KG 3HTKA 3CLQA 2Y0CA 1USEA 2W6AA 1IJDB 2QM7A 3L4FA 3N0QA 3L35A 4PD4I 3VCPA 4B86A 3VMZA 2B24A 1KILD 2Q3WA 4HJLA 3FWNA 1H89A 2G8YA 3C8VA 5KJ7C 1RY3A 1A02F 3L37A 4GOEA 2KLUA 3N7NA 3AE4C 5K5GB 4A7PA 1PP9G 4NBHD 4QMAA 3L72E 2B9BA 4ASVA 2UWJE 1GL2B 3BASA 2G3AA 3RBXA 1EXJA 2YFLA 3TYYA 1MFZA 2QM8A 4XA4A 2WSEH 2WSFJ 2ZXEB 2BCCE 2W8ZA 2XZRA 3KQGA 2GUVA 4XE5B 1SQPG 1LWUB 3ITKA 3D89A 4QDFA 1RF1C 2DE6D 4H44C 2PP6A 3CCUP 1IK7A 1BGYD 1DD4A 2Q9IA 3GZYA 1ZRTD 3BCCG 1M57D 5BVZA 1EDJA 2KSJA 1VF5B 4PD4H 3M0AA 2E76C 1N73B 3CX5D 4AUWA 1FZFA 1PPJD 2KK7A 2Q6QA 2FYUG 4ZKPA 1HH0A 2E74C 4C7NA 1EXIA 3O8ZA 2XV5A 1IFMA 3CL3D 2FYNC 2ZT9D 2ZAEB 1JEKA 2WPVB 3GMAA 2NZ2A 4IL6H 1SQBJ 1LTSC 1UIXA 2PFXA 4IL6X 2Q5UA 1LTJB 1R8EA 2K9YA 1N7SB 3VMID 1MV8A 1GW4A 2NUKA 1W5CE 3L75E 1Y9BA 1Q90D 3GB4A 1ZR4A 1FZAA 2DW3A 3L74D 1YI2P 3TDKA 3RGUA 2WTYA 1L4AC 5AEWA 2BEZF 1MZ9A 2IZ0A 5AVTB 3A0HE 1BGYJ 2E74B 5AW0B 3P8CD 3LW5J 1EDLA 1K05A 3IN6A 2XNXA 2POHA 3Q5SA 1LTGC 4HM2A 2Q1KA 2YVJB 3O6QB 3MP7B 1RHZB 3EQ2A 1JOCA 2GA1A 1VQ9P 2JJLA 4U3FD 2FY8A 1P84H 1O7MA 1ZMEC 5APSA 1PP9J 3V2QA 2M5AA 2N1TC 2N9YB 3SFDC 2WMMA 2HYNA 3BATA 3HE4B 4XFJA 1U7JA 1KILE 3CCRP 3M0DC 5H2FH 2AXTE 2SPZA 4HM1A 1USDA 1VF5D 2HMMA 2CK3H 4NPEA 3MZWB 1NU1K 1HJ0A 3G71P 2KLVA 2WITA 2N1TB 1JMBA 3PLNA 1EQ7A 1IZNB 4W7YA 2V7QH 1JY3N 3E1RA 2QJYC 5GTHH 5APVA 3L73G 5AVXB 5KAIE 1N73A 5B5EE 2Q3IA 3C1LA 1SQPJ 3P8CE 2MJZA 1P84I 3L70G 5DJTB 2KIKA 1SQPD 1RF1B 1L0ND 5KLVK 3RK3D 1FDOA 2LKMA 3BCCJ 3CCEP 1URQC 1NAYA 4U3FJ 4PD4D 1OVUA 3Q3DA 3H1JE 1M1JC 2FYUJ 4I7ZC 3P7KA 2W27A 1Y8AA 1BE3D 2I7FA 1SLQA 2K88A 3VMGD 4Y99B 2FYZA 2AEFA 1LTIC 5KLVG 3V2RA 4LC1A 4EYYQ 1ZP0C 3L73E 5E79E 1VQOP 1NU1J 2QE7H 1KILC 5DJUB 2I1JA 1Z56A 1T3UA 3H6PA 3M9HA 1FAVA 2ZJSE 3RL0B 4L76A 3L71E 3HUSB 3RK3B 3L75G 3ABVC 3V5BA 4C7NB 1M8OB 2I1KA 2GBWA 1EZVI 2E5TA 3FXEA 1NTZE 3DQYA 3H1HJ 4AQRD 3D71A 4HKZH 3EN1A 2W90A 1KN7A 3PH0A 1NVOA 2KOGA 1NH4A 5APXA 3VP8A 2IBZE 4PJ0E 5AVZB 3CPWO 1FC2C 3JSVC 4BXLA 4BRYB 3GOBA 2M8RA 1Y47A 1S5LH 1LWUC 3EFFK 4HM7A 3V2NA 4JBZA 3F5HA 2OYIC 4Y28J 3GL0A 1KB9I 1A02J 4RESB 4RO0A 1NHLA 1H0TA 1HF9A 3RK2C 2GUSA 4TLFA 3U59A 4H13D 4AAYB 1KQFB 4RJTA 2A45H 3RK3C 5KLVE 2WT7B 2QJPC 1SFCD 1ZXGA 5TJHA 1VDFA 3OAKA 1MUUA 1SFCA 1GK4A 4OGQB 3H1IG 3D70A 1Q82Q 1BE3E 3CCSP 2YMKA 1VL2A 2NPSB 1J1DC 5BU5A 2KZJA 3A0BH 4MN4C 3UIAA 1YBKA 1KQSO 1CW5A 2IDBA 1X9VA 2CPSA 1NGMB 1EZVD 3HUSA 3MGNA 1CSBA 3SWKA 1RE4C 2Y0EA 4NBDD 1MFTA 1OVVA 5CJ4A 1RE3C 1LTJA 4QDDA 4U3FG 2XDJA 4H0LC 4NPFX 4HB1A 1G1IA 3MIWA 2FXOA 4KJMA 1N7SD 3KHUA 2K3RA 1UUVA 1DH3A 3WUUA 2KB7P 1H8AA 2NPSD 1SQXD 4ZNCA 4OGQD 4PV1C 3B5ND 1VQKP 4PV1B 4NB9D 1HBWA 3CX5H 4M3LA 2J59M 3LIEA 3AZCA 3P32A 4DZOA 2AXCA 3EQQA 5APTA 3KYQA 4H13C 1GK6A 3VMHD 2IPPA 3VOPA 3VMYA 2FXMA 5APUA 3GTEA 1N7SA 1OW8A 1L2PA 2E75C 3IR9A 3M06A 1LWUA 1E79H 2Q3EA 3VYIA 1SQVE 1NU1D 1GZLA 2WSEJ 2ZT9B 1VQ8P 5AVSB 2YIUB 2FYUD 3CXHI 1JO5A 1HGZA 2BEQD 5E79H 1KTMA 3L73J 3HE5A 5KLVD 2BMOA 3O6QA 1LJ2A 3MTUE 1LP1A 1PIXA 1VQNP 3N4XA 2R44A 1TU3F 4I6MC 1NTMK 3S4RA 1NDOA 3EWKA 3L70J 5KJ7A 3A5TA 1J1DB 2FXPA 4I1LA 3TK1A 1AA0A 1NYKA 2WVRA 3H1HD 3C0DA 2LXBA 2Z5HA 1PPJG 4H13B 1P84E 1ZRTE 2P2UA 1NTZJ 4HM3A 3L71D 2JWDA 1RIEA 2O3JA 1X8YA 3CCMP 3VMAA 2YIUC 1L0LD 3TNUB 3GL2A 1Q2NA 2O1JA 3CMAP 2E43A 2KNCB 3HTKB 2H7HA 1W2BO 2NUMA 3IFMA 2IBZD 3B5NA 5KLVJ 1T2KC 3USSA 3L73D 3CCQP 2AXTH 1NWQA 2NPSC 1JY2P 1BCCG 2P7JA 2IZ1A 3JCUH 4HM5A 5AVVB 2WZ7A 2CKFA 3CWBD 3CXHH 2YNYA 1YTZT 2YKPA 4D6TE 1M90Q 3IF4A 2L5GB 2ZYDA 1L0LG 2WT7A 1OXZA 4EOTA 3L72D 5B5EH 3H1IJ 2QJPB 1FZBA 2E5YA 3L75J 4QDCA 5AVQB 1RH5B 1PP9D 1S2EA 4PV1D 2DE5D 4P1BH 2JWAA 4BRYA 2Z4EA 4I2LC 2DE7D 3GHGC 3HE5B 2XSHA 1W2EA 3GCEA 2K37A 4ZKUA 3HD7A 2C0XA 1YYCA 1SQXJ 1VQ4P 3H1LD 2ZVOB 3CXHD 5AW2B 3D6ZA 3GTSA 1G2CB 1VQPP 1OX3A 1IFPA 2BCCD 4WB4A 3L70E 4QURA 4UB6H 3FX0A 4WBAA 1T3JA 5KTBA 4QUPA 2AEMA 1QX8A 2JO1A 1LGHB 3FOUA 3H1JG 2NVGA 2HMKA 4QCKA 1S5LX 1QL1A 3GLMA 1SVFA 3MUDA 3JC22 4N3YB 5H2FE 1L4AA 1BDDA 1JTHA 3B71A 2ZXXA 5AW9B 1SQBD 3VCAA 1ZLLA 3MHVA 3H1KD 2BMQA 4QDFB 2QIWA 2OTLP 2WSCJ 1FJPA 5KKZB 3E1IA 2OYOA 2YFIA 2WPQA 3P8MC 1PGPA 2IX7C 1FZEA 2K9JB 3CI9A 1L0NG 1QEXA 1NTZG 5TISH 1BDCA 2K9JA 1KYOH 3I55P 1NTZK 1G8KB 1NTKG 1FZCA 3TGUG 5KKZC 1P84D 4WY4A 3HE4A 2K1AA 4OVNF 2XSOA 1PZQA 2XU6A 1G8JB 1SQVG 2YXRB 5GTIH 3AEAC 4DJGA 5KJ7D 3II6A 2WSSH 4N78D 3AEBC 3TGUE 2YO2A 3NTNA 2O1KA 2AEJA 1GW3A 4PJ0H 3R2PA 2C0WA 1T6AA 2HMNA 4EI2A 1YJWP 4H0LD 1VM9A 4C46A 1N7SC 3HD7C 2JEEA 2NWFA 2HODB 3H1LG 1NKZB 4K3AA 1H88A 3A0HH 1VQ5P 4HKVA 3RL0C 3L75D 1XTCC 1KYOI 1X22A 2IFNA 3AE1C 1YIJP 5CHXA 4IFDK 3GW6A 2RKLA 1UIIA 1R5LA 1JY2N 2KXPB 1M1JB 3AEGC 1XTGB 3CMEP 2E76D 1AVOA 3FXDA 3TGUD 4IFMA 5AW7B 1SQXG 1JM0A 1GMJA 4LGDE 1FOSF 1SS1A 2ITAA 2IYOA 4UB6E 1L0NK 5L8RJ 1NTME 3Q2YA 4C7RA 1EG9A 1SQBE 2D2CC 3NMDA 1YHQP 2GM4A 3L71J 1ZR2A 1K73Q 4W7ZA 2N9BA 1LT9B 2FFDA 1RQUA 3GKEA 3RK2B 4JQ0D 3B4SA 5AVRB 2A06D 2KUBA 3T97B 1X79B 4NB8D 1NTMJ 2R3SA 3H1JJ 1WMKA 5APWA 1EZVE 3HD7B 1KYOE 2QJKC 2OYIB 2Y9YA 1QLED 3BCCE 2I8DA 1BCCJ 3Q5RA 4ZMDA 3CCJP 1RF0C 3L70D 1N2DC 1SQXE 3B5NC 5AW5B 3G6EP 1U57A 1OVRA 5GTIE 1BE3J 3H1LE 1RE3A 1FU1A 2O01J 1D7MA 1T2KD 4YTPC 1NYHA 1QVFO 1OFCX 2D2CB 1S9KD 4GODA 3TSIA 1L4AD 3GHGA 2ZFCA 3GZXA 1L0NJ 4HJGH 2A45I 3CCVP 4NBAD 3B5NB 4UB8E 1IK9A 1SQVJ 3PTZA 2RH0A 3H1IE 3L36A 2R5DA 1K8AQ 1N73C 2CPBA 2P58A 1PL5A 2QG4A 4U3FE 3AE6C 2LR2A 3B8EB 1KZUB 1SP4A 1HWTC 2OTJP 2E75D 3TGUJ 3CC4P 1HJBA 1FS0E 1N86A 3CWBE 4ASWA 1JB0J 3U1CA 3AE5C 1NU1G 1JCDA 3CX5I 2YMYA 1KC8Q 3RL0g 5AW4B 4IL6E 5AW1B 3AE9C 2WSFH 1VPCA 3A7OA 1YJ9P 4HM0A 2KYVA 2R3CA 1KV4A 1PGJA 2YKQA 1KQGB 2NRGA 3F89A 2V7QJ 1YQ3C 1LTJC 1GTWA 1RF1A 3HUSC 3AE3C 2P10A 3AEFC 4I7ZB 5B66H 1ZN5A 2WSCH 2KS1B 1SQBK 1S4XA 2QSIA 1J2JB 1O7HA 4KT0J 1SQVK 3VTPC 3V2PA 1OZHA 1SQQD 2E75B 1YITP 2OYHB 1R5SA 2FYUE 3L71G 1M1KQ 2HLOA 2WQYC 4N6JA 3M91A 4AIVA 3VMXA 4JF7A 4HH2A 2HPCB 2B87B 1J1EC 2JP3A 2QA4P 2WWWA 4N78E 1NTKJ 5KAFE 1VQ6P 1M56D 2JZAA 3OJAB 1KQLA 1SQBG 1IO4A 1URQB 5KLIB 4HM8A 4PD4E 2KI7B 2XRXA 3H1HE 3TF5A 4Z1MH 1IC2A 2YO3A 1BGYE 4GKGA 4WY4B 1G2CA 1Q7YQ 5CJ0A 5AVUB 1N7LA 4R4LA 3H25A 4UB8H 5HL4A 1NOHA 2A06G 2OYIA 4RKUJ 1AQ5A 2P1JA 5AW8B 3JCUE 2J58A 4L75A 3PHLA 1H0TB 2FKWB 5CBOA 3A0BE 2W6JH 1JMMA 1RF0A 3H1LJ 2M3EA 3M9BA 3FWLA 3LIDA 4AYCA 4HM6A 2BASA 1K9MQ 1CI6B 3GF3A 1SJGA 3H1KE 3T97A 1NTKK 1KB9D 1HUCA 4EIJA 3CC2P 4U7JA 2JO6A 2M0BA 2ZYLA 5CCGC 1DD3A 3CC7P 1WQLA 3RBZA 2ZT9C 3PP5A 3Q1MA 2A06E 2IYPA 2BCCJ 2JDIH 2H88C 4BWNA 3AE2C 1BSHA 3L72G 4OGQC 1S1CX 1KILA 3CWBJ 1KFMA 1FE6A 1AVYA 1NTKE 2HMLA 4HM4A 2O01H 2HODA 3GF7A 1NAFA 1GU5A 1BCCD 3WU2E 5APQA 3S1KA 3SFEC 2OGUA 4NBFD 3OA7A 1KILB 1KYOD 3G3ZA 2NVFA 1QL2A 4GOFA 4L74A 1YJNP 3NXSA 4O9BA 1URQA 4OH8B 1FBMA 2FYUK 1NTZD 1NKNA 1JM1A 1IFDA 3HRNA 1GL2D 3TNUA 3L74E 2VRSA 1YQ4C 3A3YB 2H8PD 1VQ7P 5EFWB 1O7WA 2N1TD 1OIPA 4WY4D 1NJIQ 3V4WA 4H44B 2NVEA 1BE3G 5CCHA 2E76B 1LT9A 3PJSK 2QVAA 1CI6A 3L74G 4WVZA 3SWFA 5CCHD 3CD6P 2OQQA 2R32A 2HR3A 3AEEC 3S9OA 2WPSA 1VQLP 4P1CH 4KHXA 1AV1A 1LP1B 1YTZI 2QJYB 3CCLP 5AW6B 3M9QA 5CCGD 1IFNA 5APYA 1UUWA 1JNMA 4QUQA 5KAIH 3RK2D 3H1JD 2V4HA 3H32B 2LXCB 1LTBC 3MUDC 4NBED 1T8ZA 1PPJE 1Q81Q 3I56P 2H43A 2O01N 3RL0D 1NTMD 2ZVNB 1O7GA 3BRVB 3K5BA 4JPZB 2XKMA 4CPGA 2OYHA 4L73A 1RFSA 2E4PA 4TT3H 1IFIA 4IOIH 1S3JA 2OTKE 1NO4A 1SFCB 1FDIA 1BCCE 1O7NA 3H1HG 2C9LY 2RN0A 3ZDMA 2GBXA 4NBCD 3KXDA 1ZV8A 2W83C 1U7MA 3VP9A 1GDTA 1S72P 1GL2C 2W6BA 2HG5D 4DT0A 1SQPE 1SQPK 2FFDC 2E74D 4YXDC 1MKMA 2B89A 4WY4C 1BSNA 1KB9H 1KD1Q 4DOJA 3A2AA 2C9NY 1FOSE 3CWBG 3HD7D 2R5BA 2ZYGA 1ZW0A 2E4QA 2QEXP 1M7LA 5M1BA 2B88A 2ZYAA 1JY3O 5BOKA 1J1EB 4GDOA 1RQVA 2KZIA 1WT6A 5CXMA 1LT1A 3EFGA 2OARA 3Q5PA 2PAJA 2OYHC 3WUVA 1E5WA 1SFCC 3KZIE 1PFIA 1FDMA 1L0NE 1FZGA 1DIPA 3V6IA 3M0DA 1LT9C 4R4MA 5AW3B 1ULJA 2YFJA 1EZVG 3W67A 1QGKB 3BRTB 3KDPB 3WUTA 4H44D 2FFDB 1K04A 3AE8C 2XNDH 3MD0A 3L74J 3BVHA 1OW7A 2HMOA 1LNQA 2P67A 3VN0A 1JUNA 2B87A 2PRRA 1GU4A 1NTKD 1IFJA 1OMIA 3GHGB 2KSEA 3GG2A 1PGOA 2IFMA 2Y0DA 4NPDA 1AQTA 2NPSA 1EC5A 3OW2O 4JYCA 1GD2E 3SWYA
chains in the Genus database with same CATH topology
3EQQA 2NWFA 3N0QA 2QJPC 3VCPA 2BMRA 4HM6A 3VCAA 2E74D 3VMHD 4D6TE 2B24A 2BMQA 4QDFB 3GTEA 4NBGD 1SJGA 3H1KE 3H1LE 2Q3WA 4HJLA 4HKVA 1O7HA 4HM1A 4EMJB 1VF5D 1FQTA 2HMMA 5AEUA 2JO6A 2YFIA 2E4QA 3L71E 4QDCA 1BE3E 2ZYLA 4NBHD 4P1CH 1SQQE 3VMID 3L72E 2NUKA 1SQVE 2FYUE 1O7PA 4PV1D 1PP9E 1KB9E 3L75E 1WQLA 2DE5D 2GBWA 5KLIC 3GZXA 4P1BH 5BOKA 1UUWA 1L0LE 2A06E 2YFLA 3GB4A 4QUQA 3CX5E 4NBAD 1NTZE 3DQYA 4AIVA 2DE7D 1Q90C 2XSHA 2E76D 3H1IE 5CXMA 3GCEA 4NBBD 3EN1A 2QPZA 5AEWA 4NBED 2BMOA 2QJYC 1PPJE 4U3FE 2BCCE 1G8KB 2JZAA 1NDOA 2IBZE 2E75D 1NTKE 3GTSA 4NBDD 1NTME 1VCKA 2HMLA 4HM4A 1L0NE 4HM8A 4PD4E 1SQBE 1EG9A 3CWBE 2XRXA 3GOBA 3H1HE 1O7GA 1ULIA 5KKZC 1NYKA 1ULJA 3D89A 4QDDA 3C0DA 4QDFA 2DE6D 3L70E 2XSOA 1BGYE 2YFJA 4QURA 4NBFD 1RFSA 2E4PA 4H44D 1G8JB 1P84E 1ZRTE 3GKEA 3GZYA 4HM2A 2YVJB 4HM3A 5HL4A 2NVFA 4HM7A 4QUPA 4NB8D 1BCCE 1RIEA 1O7NA 2GBXA 3H1JE 2YIUC 3TGUE 4NBCD 2HMJA 1UUVA 3GL0A 2HMOA 3FOUA 4HM0A 1EZVE 2NVGA 1NU1E 3GL2A 2B1XA 2HMKA 1KYOE 1JM1A 2QJKC 4QCKA 2D2CD 2I7FA 1O7MA 3CXHE 4OGQD 3BCCE 2NUMA 3L74E 3VMGD 2HMNA 4NB9D 1O7WA 2FYNC 4H0LD 2ZT9D 3AZCA 4H13D 1VM9A 1SQXE 2NVEA 4HM5A 4AAYB 1SQPE 5KLVE 2XR8A 3L73E 2CKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQQ A;  2NWF A;  3N0Q A;  2QJP C;  3VCP A;  2BMR A;  4HM6 A;  3VCA A;  2E74 D;  3VMH D;  4D6T E;  2B24 A;  2BMQ A;  4QDF B;  3GTE A;  4NBG D;  1SJG A;  3H1K E;  3H1L E;  2Q3W A;  4HJL A;  4HKV A;  1O7H A;  4HM1 A;  4EMJ B;  1VF5 D;  1FQT A;  2HMM A;  5AEU A;  2JO6 A;  2YFI A;  2E4Q A;  3L71 E;  4QDC A;  1BE3 E;  2ZYL A;  4NBH D;  4P1C H;  1SQQ E;  3VMI D;  3L72 E;  2NUK A;  1SQV E;  2FYU E;  1O7P A;  4PV1 D;  1PP9 E;  1KB9 E;  3L75 E;  1WQL A;  2DE5 D;  2GBW A;  5KLI C;  3GZX A;  4P1B H;  5BOK A;  1UUW A;  1L0L E;  2A06 E;  2YFL A;  3GB4 A;  4QUQ A;  3CX5 E;  4NBA D;  1NTZ E;  3DQY A;  4AIV A;  2DE7 D;  1Q90 C;  2XSH A;  2E76 D;  3H1I E;  5CXM A;  3GCE A;  4NBB D;  3EN1 A;  2QPZ A;  5AEW A;  4NBE D;  2BMO A;  2QJY C;  1PPJ E;  4U3F E;  2BCC E;  1G8K B;  2JZA A;  1NDO A;  2IBZ E;  2E75 D;  1NTK E;  3GTS A;  4NBD D;  1NTM E;  1VCK A;  2HML A;  4HM4 A;  1L0N E;  4HM8 A;  4PD4 E;  1SQB E;  1EG9 A;  3CWB E;  2XRX A;  3GOB A;  3H1H E;  1O7G A;  1ULI A;  5KKZ C;  1NYK A;  1ULJ A;  3D89 A;  4QDD A;  3C0D A;  4QDF A;  2DE6 D;  3L70 E;  2XSO A;  1BGY E;  2YFJ A;  4QUR A;  4NBF D;  1RFS A;  2E4P A;  4H44 D;  1G8J B;  1P84 E;  1ZRT E;  3GKE A;  3GZY A;  4HM2 A;  2YVJ B;  4HM3 A;  5HL4 A;  2NVF A;  4HM7 A;  4QUP A;  4NB8 D;  1BCC E;  1RIE A;  1O7N A;  2GBX A;  3H1J E;  2YIU C;  3TGU E;  4NBC D;  2HMJ A;  1UUV A;  3GL0 A;  2HMO A;  3FOU A;  4HM0 A;  1EZV E;  2NVG A;  1NU1 E;  3GL2 A;  2B1X A;  2HMK A;  1KYO E;  1JM1 A;  2QJK C;  4QCK A;  2D2C D;  2I7F A;  1O7M A;  3CXH E;  4OGQ D;  3BCC E;  2NUM A;  3L74 E;  3VMG D;  2HMN A;  4NB9 D;  1O7W A;  2FYN C;  4H0L D;  2ZT9 D;  3AZC A;  4H13 D;  1VM9 A;  1SQX E;  2NVE A;  4HM5 A;  4AAY B;  1SQP E;  5KLV E;  2XR8 A;  3L73 E;  2CKF A; 
#chains in the Genus database with same CATH topology
 5GTH E;  1JY2 O;  4EDF A;  1HTL C;  4NBG D;  1SQQ J;  2WPR A;  4EMJ B;  3W68 A;  1FQT A;  1JCC A;  2M3B A;  2QRX A;  5AEU A;  1WRG A;  2A45 G;  4D6T G;  3H1K J;  1O7P A;  4OWF A;  1PP9 E;  1ZOY C;  3V4Q A;  1KB9 E;  2BCC G;  2L91 A;  1JY3 P;  1HGV A;  3CX5 E;  3D6Y A;  5CCG A;  5BU8 B;  2KP8 A;  1CZQ A;  3L72 J;  2FYN B;  3WMM 0;  1EDI A;  2QJK B;  1SQX K;  2QPZ A;  5AVY B;  4GT1 A;  3IAO A;  1AJY A;  4H0L B;  4IFF A;  2IBZ I;  3QWO C;  1ULI A;  3KPE A;  3LW5 H;  2J5U A;  4K35 A;  2HFE D;  4GIF A;  2JKV A;  3NFQ A;  1EDK A;  1L0L K;  5TIS E;  1JTH B;  3AED C;  1SQV D;  3WU2 H;  4HYT B;  1M1J A;  3G9R A;  2PGD A;  1SQQ K;  5CMZ A;  1L4A B;  1HVV A;  1OWA A;  2KNC A;  2N1T A;  1URQ D;  1VF5 C;  1OW6 A;  3SSU A;  1GL2 A;  3H1I D;  1KFN A;  2XR8 A;  2H89 C;  2Y9Z A;  2FBW C;  4D6T D;  3I5C A;  2Q7C A;  2BMR A;  3G4S P;  4YXW H;  3PRJ A;  1KMI Z;  1DEB A;  2YKO A;  4DCK A;  1S9K E;  2MKV A;  2M5A B;  1VQM P;  1SQQ E;  4WWI A;  5C39 A;  2KS1 A;  5KAF H;  1DEE G;  5KLI C;  1X0T A;  3KZI H;  1L0L E;  2JR8 A;  1NTM G;  4JYB A;  1Q90 C;  1RE4 A;  4NBB D;  5CCH C;  1FJK A;  3AEC C;  4YPC A;  2IBZ G;  3BCC D;  1LTA C;  1FZC C;  2HPC A;  3RK3 E;  3R4Y A;  1L0L J;  1PGQ A;  1VCK A;  3QH9 A;  1Q86 Q;  3FGA D;  1FZC B;  3E7K A;  5B66 E;  3U1A A;  3AE7 C;  1LTT C;  4W80 A;  2Z5I A;  1PV3 A;  2RMZ A;  1KOR A;  1AFO A;  2HMJ A;  1DX7 A;  1SQQ G;  4LLH A;  1S5L E;  1BGY G;  1QVG O;  1NU1 E;  2B1X A;  4Y99 C;  5CBN A;  1G1J A;  2D2C D;  3CXH E;  2E42 A;  1N8R Q;  3C9I A;  2YXQ B;  4D6T J;  5AVW B;  3H32 A;  3H1K G;  3HTK A;  3CLQ A;  2Y0C A;  1USE A;  2W6A A;  1IJD B;  2QM7 A;  3L4F A;  3N0Q A;  3L35 A;  4PD4 I;  3VCP A;  4B86 A;  3VMZ A;  2B24 A;  1KIL D;  2Q3W A;  4HJL A;  3FWN A;  1H89 A;  2G8Y A;  3C8V A;  5KJ7 C;  1RY3 A;  1A02 F;  3L37 A;  4GOE A;  2KLU A;  3N7N A;  3AE4 C;  5K5G B;  4A7P A;  1PP9 G;  4NBH D;  4QMA A;  3L72 E;  2B9B A;  4ASV A;  2UWJ E;  1GL2 B;  3BAS A;  2G3A A;  3RBX A;  1EXJ A;  2YFL A;  3TYY A;  1MFZ A;  2QM8 A;  4XA4 A;  2WSE H;  2WSF J;  2ZXE B;  2BCC E;  2W8Z A;  2XZR A;  3KQG A;  2GUV A;  4XE5 B;  1SQP G;  1LWU B;  3ITK A;  3D89 A;  4QDF A;  1RF1 C;  2DE6 D;  4H44 C;  2PP6 A;  3CCU P;  1IK7 A;  1BGY D;  1DD4 A;  2Q9I A;  3GZY A;  1ZRT D;  3BCC G;  1M57 D;  5BVZ A;  1EDJ A;  2KSJ A;  1VF5 B;  4PD4 H;  3M0A A;  2E76 C;  1N73 B;  3CX5 D;  4AUW A;  1FZF A;  1PPJ D;  2KK7 A;  2Q6Q A;  2FYU G;  4ZKP A;  1HH0 A;  2E74 C;  4C7N A;  1EXI A;  3O8Z A;  2XV5 A;  1IFM A;  3CL3 D;  2FYN C;  2ZT9 D;  2ZAE B;  1JEK A;  2WPV B;  3GMA A;  2NZ2 A;  4IL6 H;  1SQB J;  1LTS C;  1UIX A;  2PFX A;  4IL6 X;  2Q5U A;  1LTJ B;  1R8E A;  2K9Y A;  1N7S B;  3VMI D;  1MV8 A;  1GW4 A;  2NUK A;  1W5C E;  3L75 E;  1Y9B A;  1Q90 D;  3GB4 A;  1ZR4 A;  1FZA A;  2DW3 A;  3L74 D;  1YI2 P;  3TDK A;  3RGU A;  2WTY A;  1L4A C;  5AEW A;  2BEZ F;  1MZ9 A;  2IZ0 A;  5AVT B;  3A0H E;  1BGY J;  2E74 B;  5AW0 B;  3P8C D;  3LW5 J;  1EDL A;  1K05 A;  3IN6 A;  2XNX A;  2POH A;  3Q5S A;  1LTG C;  4HM2 A;  2Q1K A;  2YVJ B;  3O6Q B;  3MP7 B;  1RHZ B;  3EQ2 A;  1JOC A;  2GA1 A;  1VQ9 P;  2JJL A;  4U3F D;  2FY8 A;  1P84 H;  1O7M A;  1ZME C;  5APS A;  1PP9 J;  3V2Q A;  2M5A A;  2N1T C;  2N9Y B;  3SFD C;  2WMM A;  2HYN A;  3BAT A;  3HE4 B;  4XFJ A;  1U7J A;  1KIL E;  3CCR P;  3M0D C;  5H2F H;  2AXT E;  2SPZ A;  4HM1 A;  1USD A;  1VF5 D;  2HMM A;  2CK3 H;  4NPE A;  3MZW B;  1NU1 K;  1HJ0 A;  3G71 P;  2KLV A;  2WIT A;  2N1T B;  1JMB A;  3PLN A;  1EQ7 A;  1IZN B;  4W7Y A;  2V7Q H;  1JY3 N;  3E1R A;  2QJY C;  5GTH H;  5APV A;  3L73 G;  5AVX B;  5KAI E;  1N73 A;  5B5E E;  2Q3I A;  3C1L A;  1SQP J;  3P8C E;  2MJZ A;  1P84 I;  3L70 G;  5DJT B;  2KIK A;  1SQP D;  1RF1 B;  1L0N D;  5KLV K;  3RK3 D;  1FDO A;  2LKM A;  3BCC J;  3CCE P;  1URQ C;  1NAY A;  4U3F J;  4PD4 D;  1OVU A;  3Q3D A;  3H1J E;  1M1J C;  2FYU J;  4I7Z C;  3P7K A;  2W27 A;  1Y8A A;  1BE3 D;  2I7F A;  1SLQ A;  2K88 A;  3VMG D;  4Y99 B;  2FYZ A;  2AEF A;  1LTI C;  5KLV G;  3V2R A;  4LC1 A;  4EYY Q;  1ZP0 C;  3L73 E;  5E79 E;  1VQO P;  1NU1 J;  2QE7 H;  1KIL C;  5DJU B;  2I1J A;  1Z56 A;  1T3U A;  3H6P A;  3M9H A;  1FAV A;  2ZJS E;  3RL0 B;  4L76 A;  3L71 E;  3HUS B;  3RK3 B;  3L75 G;  3ABV C;  3V5B A;  4C7N B;  1M8O B;  2I1K A;  2GBW A;  1EZV I;  2E5T A;  3FXE A;  1NTZ E;  3DQY A;  3H1H J;  4AQR D;  3D71 A;  4HKZ H;  3EN1 A;  2W90 A;  1KN7 A;  3PH0 A;  1NVO A;  2KOG A;  1NH4 A;  5APX A;  3VP8 A;  2IBZ E;  4PJ0 E;  5AVZ B;  3CPW O;  1FC2 C;  3JSV C;  4BXL A;  4BRY B;  3GOB A;  2M8R A;  1Y47 A;  1S5L H;  1LWU C;  3EFF K;  4HM7 A;  3V2N A;  4JBZ A;  3F5H A;  2OYI C;  4Y28 J;  3GL0 A;  1KB9 I;  1A02 J;  4RES B;  4RO0 A;  1NHL A;  1H0T A;  1HF9 A;  3RK2 C;  2GUS A;  4TLF A;  3U59 A;  4H13 D;  4AAY B;  1KQF B;  4RJT A;  2A45 H;  3RK3 C;  5KLV E;  2WT7 B;  2QJP C;  1SFC D;  1ZXG A;  5TJH A;  1VDF A;  3OAK A;  1MUU A;  1SFC A;  1GK4 A;  4OGQ B;  3H1I G;  3D70 A;  1Q82 Q;  1BE3 E;  3CCS P;  2YMK A;  1VL2 A;  2NPS B;  1J1D C;  5BU5 A;  2KZJ A;  3A0B H;  4MN4 C;  3UIA A;  1YBK A;  1KQS O;  1CW5 A;  2IDB A;  1X9V A;  2CPS A;  1NGM B;  1EZV D;  3HUS A;  3MGN A;  1CSB A;  3SWK A;  1RE4 C;  2Y0E A;  4NBD D;  1MFT A;  1OVV A;  5CJ4 A;  1RE3 C;  1LTJ A;  4QDD A;  4U3F G;  2XDJ A;  4H0L C;  4NPF X;  4HB1 A;  1G1I A;  3MIW A;  2FXO A;  4KJM A;  1N7S D;  3KHU A;  2K3R A;  1UUV A;  1DH3 A;  3WUU A;  2KB7 P;  1H8A A;  2NPS D;  1SQX D;  4ZNC A;  4OGQ D;  4PV1 C;  3B5N D;  1VQK P;  4PV1 B;  4NB9 D;  1HBW A;  3CX5 H;  4M3L A;  2J59 M;  3LIE A;  3AZC A;  3P32 A;  4DZO A;  2AXC A;  3EQQ A;  5APT A;  3KYQ A;  4H13 C;  1GK6 A;  3VMH D;  2IPP A;  3VOP A;  3VMY A;  2FXM A;  5APU A;  3GTE A;  1N7S A;  1OW8 A;  1L2P A;  2E75 C;  3IR9 A;  3M06 A;  1LWU A;  1E79 H;  2Q3E A;  3VYI A;  1SQV E;  1NU1 D;  1GZL A;  2WSE J;  2ZT9 B;  1VQ8 P;  5AVS B;  2YIU B;  2FYU D;  3CXH I;  1JO5 A;  1HGZ A;  2BEQ D;  5E79 H;  1KTM A;  3L73 J;  3HE5 A;  5KLV D;  2BMO A;  3O6Q A;  1LJ2 A;  3MTU E;  1LP1 A;  1PIX A;  1VQN P;  3N4X A;  2R44 A;  1TU3 F;  4I6M C;  1NTM K;  3S4R A;  1NDO A;  3EWK A;  3L70 J;  5KJ7 A;  3A5T A;  1J1D B;  2FXP A;  4I1L A;  3TK1 A;  1AA0 A;  1NYK A;  2WVR A;  3H1H D;  3C0D A;  2LXB A;  2Z5H A;  1PPJ G;  4H13 B;  1P84 E;  1ZRT E;  2P2U A;  1NTZ J;  4HM3 A;  3L71 D;  2JWD A;  1RIE A;  2O3J A;  1X8Y A;  3CCM P;  3VMA A;  2YIU C;  1L0L D;  3TNU B;  3GL2 A;  1Q2N A;  2O1J A;  3CMA P;  2E43 A;  2KNC B;  3HTK B;  2H7H A;  1W2B O;  2NUM A;  3IFM A;  2IBZ D;  3B5N A;  5KLV J;  1T2K C;  3USS A;  3L73 D;  3CCQ P;  2AXT H;  1NWQ A;  2NPS C;  1JY2 P;  1BCC G;  2P7J A;  2IZ1 A;  3JCU H;  4HM5 A;  5AVV B;  2WZ7 A;  2CKF A;  3CWB D;  3CXH H;  2YNY A;  1YTZ T;  2YKP A;  4D6T E;  1M90 Q;  3IF4 A;  2L5G B;  2ZYD A;  1L0L G;  2WT7 A;  1OXZ A;  4EOT A;  3L72 D;  5B5E H;  3H1I J;  2QJP B;  1FZB A;  2E5Y A;  3L75 J;  4QDC A;  5AVQ B;  1RH5 B;  1PP9 D;  1S2E A;  4PV1 D;  2DE5 D;  4P1B H;  2JWA A;  4BRY A;  2Z4E A;  4I2L C;  2DE7 D;  3GHG C;  3HE5 B;  2XSH A;  1W2E A;  3GCE A;  2K37 A;  4ZKU A;  3HD7 A;  2C0X A;  1YYC A;  1SQX J;  1VQ4 P;  3H1L D;  2ZVO B;  3CXH D;  5AW2 B;  3D6Z A;  3GTS A;  1G2C B;  1VQP P;  1OX3 A;  1IFP A;  2BCC D;  4WB4 A;  3L70 E;  4QUR A;  4UB6 H;  3FX0 A;  4WBA A;  1T3J A;  5KTB A;  4QUP A;  2AEM A;  1QX8 A;  2JO1 A;  1LGH B;  3FOU A;  3H1J G;  2NVG A;  2HMK A;  4QCK A;  1S5L X;  1QL1 A;  3GLM A;  1SVF A;  3MUD A;  3JC2 2;  4N3Y B;  5H2F E;  1L4A A;  1BDD A;  1JTH A;  3B71 A;  2ZXX A;  5AW9 B;  1SQB D;  3VCA A;  1ZLL A;  3MHV A;  3H1K D;  2BMQ A;  4QDF B;  2QIW A;  2OTL P;  2WSC J;  1FJP A;  5KKZ B;  3E1I A;  2OYO A;  2YFI A;  2WPQ A;  3P8M C;  1PGP A;  2IX7 C;  1FZE A;  2K9J B;  3CI9 A;  1L0N G;  1QEX A;  1NTZ G;  5TIS H;  1BDC A;  2K9J A;  1KYO H;  3I55 P;  1NTZ K;  1G8K B;  1NTK G;  1FZC A;  3TGU G;  5KKZ C;  1P84 D;  4WY4 A;  3HE4 A;  2K1A A;  4OVN F;  2XSO A;  1PZQ A;  2XU6 A;  1G8J B;  1SQV G;  2YXR B;  5GTI H;  3AEA C;  4DJG A;  5KJ7 D;  3II6 A;  2WSS H;  4N78 D;  3AEB C;  3TGU E;  2YO2 A;  3NTN A;  2O1K A;  2AEJ A;  1GW3 A;  4PJ0 H;  3R2P A;  2C0W A;  1T6A A;  2HMN A;  4EI2 A;  1YJW P;  4H0L D;  1VM9 A;  4C46 A;  1N7S C;  3HD7 C;  2JEE A;  2NWF A;  2HOD B;  3H1L G;  1NKZ B;  4K3A A;  1H88 A;  3A0H H;  1VQ5 P;  4HKV A;  3RL0 C;  3L75 D;  1XTC C;  1KYO I;  1X22 A;  2IFN A;  3AE1 C;  1YIJ P;  5CHX A;  4IFD K;  3GW6 A;  2RKL A;  1UII A;  1R5L A;  1JY2 N;  2KXP B;  1M1J B;  3AEG C;  1XTG B;  3CME P;  2E76 D;  1AVO A;  3FXD A;  3TGU D;  4IFM A;  5AW7 B;  1SQX G;  1JM0 A;  1GMJ A;  4LGD E;  1FOS F;  1SS1 A;  2ITA A;  2IYO A;  4UB6 E;  1L0N K;  5L8R J;  1NTM E;  3Q2Y A;  4C7R A;  1EG9 A;  1SQB E;  2D2C C;  3NMD A;  1YHQ P;  2GM4 A;  3L71 J;  1ZR2 A;  1K73 Q;  4W7Z A;  2N9B A;  1LT9 B;  2FFD A;  1RQU A;  3GKE A;  3RK2 B;  4JQ0 D;  3B4S A;  5AVR B;  2A06 D;  2KUB A;  3T97 B;  1X79 B;  4NB8 D;  1NTM J;  2R3S A;  3H1J J;  1WMK A;  5APW A;  1EZV E;  3HD7 B;  1KYO E;  2QJK C;  2OYI B;  2Y9Y A;  1QLE D;  3BCC E;  2I8D A;  1BCC J;  3Q5R A;  4ZMD A;  3CCJ P;  1RF0 C;  3L70 D;  1N2D C;  1SQX E;  3B5N C;  5AW5 B;  3G6E P;  1U57 A;  1OVR A;  5GTI E;  1BE3 J;  3H1L E;  1RE3 A;  1FU1 A;  2O01 J;  1D7M A;  1T2K D;  4YTP C;  1NYH A;  1QVF O;  1OFC X;  2D2C B;  1S9K D;  4GOD A;  3TSI A;  1L4A D;  3GHG A;  2ZFC A;  3GZX A;  1L0N J;  4HJG H;  2A45 I;  3CCV P;  4NBA D;  3B5N B;  4UB8 E;  1IK9 A;  1SQV J;  3PTZ A;  2RH0 A;  3H1I E;  3L36 A;  2R5D A;  1K8A Q;  1N73 C;  2CPB A;  2P58 A;  1PL5 A;  2QG4 A;  4U3F E;  3AE6 C;  2LR2 A;  3B8E B;  1KZU B;  1SP4 A;  1HWT C;  2OTJ P;  2E75 D;  3TGU J;  3CC4 P;  1HJB A;  1FS0 E;  1N86 A;  3CWB E;  4ASW A;  1JB0 J;  3U1C A;  3AE5 C;  1NU1 G;  1JCD A;  3CX5 I;  2YMY A;  1KC8 Q;  3RL0 g;  5AW4 B;  4IL6 E;  5AW1 B;  3AE9 C;  2WSF H;  1VPC A;  3A7O A;  1YJ9 P;  4HM0 A;  2KYV A;  2R3C A;  1KV4 A;  1PGJ A;  2YKQ A;  1KQG B;  2NRG A;  3F89 A;  2V7Q J;  1YQ3 C;  1LTJ C;  1GTW A;  1RF1 A;  3HUS C;  3AE3 C;  2P10 A;  3AEF C;  4I7Z B;  5B66 H;  1ZN5 A;  2WSC H;  2KS1 B;  1SQB K;  1S4X A;  2QSI A;  1J2J B;  1O7H A;  4KT0 J;  1SQV K;  3VTP C;  3V2P A;  1OZH A;  1SQQ D;  2E75 B;  1YIT P;  2OYH B;  1R5S A;  2FYU E;  3L71 G;  1M1K Q;  2HLO A;  2WQY C;  4N6J A;  3M91 A;  4AIV A;  3VMX A;  4JF7 A;  4HH2 A;  2HPC B;  2B87 B;  1J1E C;  2JP3 A;  2QA4 P;  2WWW A;  4N78 E;  1NTK J;  5KAF E;  1VQ6 P;  1M56 D;  2JZA A;  3OJA B;  1KQL A;  1SQB G;  1IO4 A;  1URQ B;  5KLI B;  4HM8 A;  4PD4 E;  2KI7 B;  2XRX A;  3H1H E;  3TF5 A;  4Z1M H;  1IC2 A;  2YO3 A;  1BGY E;  4GKG A;  4WY4 B;  1G2C A;  1Q7Y Q;  5CJ0 A;  5AVU B;  1N7L A;  4R4L A;  3H25 A;  4UB8 H;  5HL4 A;  1NOH A;  2A06 G;  2OYI A;  4RKU J;  1AQ5 A;  2P1J A;  5AW8 B;  3JCU E;  2J58 A;  4L75 A;  3PHL A;  1H0T B;  2FKW B;  5CBO A;  3A0B E;  2W6J H;  1JMM A;  1RF0 A;  3H1L J;  2M3E A;  3M9B A;  3FWL A;  3LID A;  4AYC A;  4HM6 A;  2BAS A;  1K9M Q;  1CI6 B;  3GF3 A;  1SJG A;  3H1K E;  3T97 A;  1NTK K;  1KB9 D;  1HUC A;  4EIJ A;  3CC2 P;  4U7J A;  2JO6 A;  2M0B A;  2ZYL A;  5CCG C;  1DD3 A;  3CC7 P;  1WQL A;  3RBZ A;  2ZT9 C;  3PP5 A;  3Q1M A;  2A06 E;  2IYP A;  2BCC J;  2JDI H;  2H88 C;  4BWN A;  3AE2 C;  1BSH A;  3L72 G;  4OGQ C;  1S1C X;  1KIL A;  3CWB J;  1KFM A;  1FE6 A;  1AVY A;  1NTK E;  2HML A;  4HM4 A;  2O01 H;  2HOD A;  3GF7 A;  1NAF A;  1GU5 A;  1BCC D;  3WU2 E;  5APQ A;  3S1K A;  3SFE C;  2OGU A;  4NBF D;  3OA7 A;  1KIL B;  1KYO D;  3G3Z A;  2NVF A;  1QL2 A;  4GOF A;  4L74 A;  1YJN P;  3NXS A;  4O9B A;  1URQ A;  4OH8 B;  1FBM A;  2FYU K;  1NTZ D;  1NKN A;  1JM1 A;  1IFD A;  3HRN A;  1GL2 D;  3TNU A;  3L74 E;  2VRS A;  1YQ4 C;  3A3Y B;  2H8P D;  1VQ7 P;  5EFW B;  1O7W A;  2N1T D;  1OIP A;  4WY4 D;  1NJI Q;  3V4W A;  4H44 B;  2NVE A;  1BE3 G;  5CCH A;  2E76 B;  1LT9 A;  3PJS K;  2QVA A;  1CI6 A;  3L74 G;  4WVZ A;  3SWF A;  5CCH D;  3CD6 P;  2OQQ A;  2R32 A;  2HR3 A;  3AEE C;  3S9O A;  2WPS A;  1VQL P;  4P1C H;  4KHX A;  1AV1 A;  1LP1 B;  1YTZ I;  2QJY B;  3CCL P;  5AW6 B;  3M9Q A;  5CCG D;  1IFN A;  5APY A;  1UUW A;  1JNM A;  4QUQ A;  5KAI H;  3RK2 D;  3H1J D;  2V4H A;  3H32 B;  2LXC B;  1LTB C;  3MUD C;  4NBE D;  1T8Z A;  1PPJ E;  1Q81 Q;  3I56 P;  2H43 A;  2O01 N;  3RL0 D;  1NTM D;  2ZVN B;  1O7G A;  3BRV B;  3K5B A;  4JPZ B;  2XKM A;  4CPG A;  2OYH A;  4L73 A;  1RFS A;  2E4P A;  4TT3 H;  1IFI A;  4IOI H;  1S3J A;  2OTK E;  1NO4 A;  1SFC B;  1FDI A;  1BCC E;  1O7N A;  3H1H G;  2C9L Y;  2RN0 A;  3ZDM A;  2GBX A;  4NBC D;  3KXD A;  1ZV8 A;  2W83 C;  1U7M A;  3VP9 A;  1GDT A;  1S72 P;  1GL2 C;  2W6B A;  2HG5 D;  4DT0 A;  1SQP E;  1SQP K;  2FFD C;  2E74 D;  4YXD C;  1MKM A;  2B89 A;  4WY4 C;  1BSN A;  1KB9 H;  1KD1 Q;  4DOJ A;  3A2A A;  2C9N Y;  1FOS E;  3CWB G;  3HD7 D;  2R5B A;  2ZYG A;  1ZW0 A;  2E4Q A;  2QEX P;  1M7L A;  5M1B A;  2B88 A;  2ZYA A;  1JY3 O;  5BOK A;  1J1E B;  4GDO A;  1RQV A;  2KZI A;  1WT6 A;  5CXM A;  1LT1 A;  3EFG A;  2OAR A;  3Q5P A;  2PAJ A;  2OYH C;  3WUV A;  1E5W A;  1SFC C;  3KZI E;  1PFI A;  1FDM A;  1L0N E;  1FZG A;  1DIP A;  3V6I A;  3M0D A;  1LT9 C;  4R4M A;  5AW3 B;  1ULJ A;  2YFJ A;  1EZV G;  3W67 A;  1QGK B;  3BRT B;  3KDP B;  3WUT A;  4H44 D;  2FFD B;  1K04 A;  3AE8 C;  2XND H;  3MD0 A;  3L74 J;  3BVH A;  1OW7 A;  2HMO A;  1LNQ A;  2P67 A;  3VN0 A;  1JUN A;  2B87 A;  2PRR A;  1GU4 A;  1NTK D;  1IFJ A;  1OMI A;  3GHG B;  2KSE A;  3GG2 A;  1PGO A;  2IFM A;  2Y0D A;  4NPD A;  1AQT A;  2NPS A;  1EC5 A;  3OW2 O;  4JYC A;  1GD2 E;  3SWY A; 
#chains in the Genus database with same CATH homology
 3EQQ A;  2NWF A;  3N0Q A;  2QJP C;  3VCP A;  2BMR A;  4HM6 A;  3VCA A;  2E74 D;  3VMH D;  4D6T E;  2B24 A;  2BMQ A;  4QDF B;  3GTE A;  4NBG D;  1SJG A;  3H1K E;  3H1L E;  2Q3W A;  4HJL A;  4HKV A;  1O7H A;  4HM1 A;  4EMJ B;  1VF5 D;  1FQT A;  2HMM A;  5AEU A;  2JO6 A;  2YFI A;  2E4Q A;  3L71 E;  4QDC A;  1BE3 E;  2ZYL A;  4NBH D;  4P1C H;  1SQQ E;  3VMI D;  3L72 E;  2NUK A;  1SQV E;  2FYU E;  1O7P A;  4PV1 D;  1PP9 E;  1KB9 E;  3L75 E;  1WQL A;  2DE5 D;  2GBW A;  5KLI C;  3GZX A;  4P1B H;  5BOK A;  1UUW A;  1L0L E;  2A06 E;  2YFL A;  3GB4 A;  4QUQ A;  3CX5 E;  4NBA D;  1NTZ E;  3DQY A;  4AIV A;  2DE7 D;  1Q90 C;  2XSH A;  2E76 D;  3H1I E;  5CXM A;  3GCE A;  4NBB D;  3EN1 A;  2QPZ A;  5AEW A;  4NBE D;  2BMO A;  2QJY C;  1PPJ E;  4U3F E;  2BCC E;  1G8K B;  2JZA A;  1NDO A;  2IBZ E;  2E75 D;  1NTK E;  3GTS A;  4NBD D;  1NTM E;  1VCK A;  2HML A;  4HM4 A;  1L0N E;  4HM8 A;  4PD4 E;  1SQB E;  1EG9 A;  3CWB E;  2XRX A;  3GOB A;  3H1H E;  1O7G A;  1ULI A;  5KKZ C;  1NYK A;  1ULJ A;  3D89 A;  4QDD A;  3C0D A;  4QDF A;  2DE6 D;  3L70 E;  2XSO A;  1BGY E;  2YFJ A;  4QUR A;  4NBF D;  1RFS A;  2E4P A;  4H44 D;  1G8J B;  1P84 E;  1ZRT E;  3GKE A;  3GZY A;  4HM2 A;  2YVJ B;  4HM3 A;  5HL4 A;  2NVF A;  4HM7 A;  4QUP A;  4NB8 D;  1BCC E;  1RIE A;  1O7N A;  2GBX A;  3H1J E;  2YIU C;  3TGU E;  4NBC D;  2HMJ A;  1UUV A;  3GL0 A;  2HMO A;  3FOU A;  4HM0 A;  1EZV E;  2NVG A;  1NU1 E;  3GL2 A;  2B1X A;  2HMK A;  1KYO E;  1JM1 A;  2QJK C;  4QCK A;  2D2C D;  2I7F A;  1O7M A;  3CXH E;  4OGQ D;  3BCC E;  2NUM A;  3L74 E;  3VMG D;  2HMN A;  4NB9 D;  1O7W A;  2FYN C;  4H0L D;  2ZT9 D;  3AZC A;  4H13 D;  1VM9 A;  1SQX E;  2NVE A;  4HM5 A;  4AAY B;  1SQP E;  5KLV E;  2XR8 A;  3L73 E;  2CKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...