3L71E

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l71E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l71E02
2E76D 3N0QA 5KLVE 3C0DA 2E74D 3TGUE 2B24A 4QDDA 1UUWA 3GKEA 2NUMA 2FYNC 2NWFA 4QDFA 5KLIC 1NTZE 2QJYC 2ZYLA 5KKZC 4NBED 2DE5D 2YVJB 2CKFA 2DE6D 1L0NE 2HMJA 3FOUA 3VMGD 2B1XA 3BCCE 4P1CH 1SQPE 4HM0A 1SQBE 1SQXE 3D89A 1EZVE 4NBFD 4HM8A 3H1KE 2GBXA 2GBWA 1O7NA 2YIUC 4NBBD 3L75E 2Q3WA 3H1LE 2HMMA 4HM3A 3EN1A 1SQQE 2E75D 2XSOA 3H1JE 4QURA 1NYKA 4QUQA 4H0LD 3L70E 3AZCA 1WQLA 4D6TE 3CX5E 2I7FA 1BGYE 4PD4E 3GL0A 2JO6A 4NBCD 2ZT9D 1O7GA 4HM6A 2IBZE 4AAYB 3L74E 2BMOA 4HM4A 1BCCE 2YFJA 4AIVA 2D2CD 4QDFB 1VM9A 2HMOA 2NVGA 1O7HA 3CXHE 1O7WA 1ULIA 2DE7D 3EQQA 5CXMA 2FYUE 3GZXA 4QDCA 1SQVE 2A06E 1O7MA 3GTEA 1SJGA 4HJLA 1NTME 2E4PA 1FQTA 4HM2A 2E4QA 5HL4A 4H44D 2BMQA 3CWBE 1KB9E 1NU1E 1EG9A 3H1HE 4NBGD 1O7PA 3VMHD 2HMKA 2QJKC 1NTKE 2HMLA 1BE3E 4U3FE 4PV1D 1PP9E 2NUKA 2XR8A 3GL2A 1Q90C 4QUPA 2QJPC 1G8KB 4P1BH 3GOBA 3H1IE 1KYOE 4EMJB 4H13D 1NDOA 2BMRA 2QPZA 1RIEA 1G8JB 4NB9D 4OGQD 3L73E 1UUVA 3L72E 4HKVA 3GZYA 3DQYA 4NBDD 1JM1A 4NB8D 2YFIA 2BCCE 4HM5A 5AEWA 3GTSA 4HM1A 5BOKA 1P84E 2XRXA 4NBHD 3GB4A 1L0LE 4NBAD 2HMNA 2NVFA 4QCKA 1ULJA 3VCPA 3VCAA 2JZAA 1PPJE 2YFLA 2XSHA 2NVEA 1VF5D 1VCKA 3VMID 3GCEA 4HM7A 1ZRTE 5AEUA 1RFSA 3L71E
chains in the Genus database with same CATH superfamily
2BEZF 4I2LC 1E5WA 2XKMA 3WMM0 4L74A 1L0NE 5KLIB 1PV3A 1EZVE 1X0TA 2GBWA 2YIUC 3P7KA 2OYIA 1MUUA 2HMMA 4H0LD 2R3CA 2N9YB 2A45H 5DJTB 1VQLP 3TGUD 5CMZA 3L72G 4LGDE 1O7GA 1L0NK 3M91A 3P8CD 1VM9A 1L0LG 1SQXD 3NXSA 3CCVP 3WUTA 1VQNP 5CXMA 3GZXA 1AVYA 2WSEH 2ZFCA 4BXLA 5KAIH 3V6IA 2E4PA 2WQYC 2QM8A 1LTJB 4I7ZB 1IFMA 3SFEC 2HR3A 1R5LA 1Z56A 1FDIA 1WMKA 2WSSH 2I1KA 2NUKA 1LWUB 3O6QA 3GL2A 1Y47A 3IR9A 4P1BH 2Q7CA 4HH2A 1G8JB 3CWBJ 2E76B 1S4XA 3A0BE 3CCUP 2KLUA 3L72D 1FDOA 5B66E 3VTPC 1L4AC 4IOIH 2JWDA 3V4WA 1L0LD 1HJ0A 2PAJA 3G71P 3W68A 3M0AA 3C0DA 4QDDA 3GKEA 4JPZB 2O01N 4LLHA 1LTSC 3RK3D 3HE5A 1MZ9A 3V2QA 3TGUJ 1K73Q 1IZNB 1YITP 2G8YA 1SQQE 1L2PA 1J1DC 4QURA 2P1JA 2KS1B 3L70E 3BCCJ 2JJLA 2LXBA 1SQXJ 2Y0DA 3CMAP 4C46A 2ITAA 3B5NB 1SQVG 3L75J 4AYCA 1EDLA 1S9KD 1IK9A 2YFJA 2WPSA 3CCJP 3H1HG 1FS0E 3V5BA 2Y9ZA 2ZYGA 1SQQK 2HPCA 4NPEA 1O7MA 3H1IG 1JTHB 1KB9I 1NU1E 3VP8A 5GTHH 1S2EA 2LR2A 3AE6C 2C9LY 3KDPB 3PJSK 2FFDB 5CCGA 1DD3A 4NB9D 4ZKUA 1RY3A 5BU8B 3RK3C 4UB6H 1N7SA 2B89A 2GA1A 4HB1A 1D7MA 3ITKA 5KLVG 3V2NA 1VQ4P 1SQVD 1NU1K 1RH5B 3FXEA 4QCKA 3H1HD 2KSEA 2D2CB 2AEFA 3VMID 2RN0A 3L71E 3LW5J 5APTA 1FOSE 3BATA 1T3JA 1JCCA 3H1ID 2QRXA 3H1JG 1NTZE 1KQGB 5APYA 3I56P 1YI2P 2DE5D 3TYYA 3TSIA 3U1AA 1OW8A 3D89A 2XV5A 1IFDA 1RE4C 3CXHI 2O01J 3GHGB 3WU2E 2M3EA 1KQLA 2OYIC 3M9BA 2JWAA 3U59A 2W6BA 3D6ZA 5KLVD 1YHQP 3GF7A 1NTZK 2JKVA 3A0HE 3RGUA 3BVHA 1N73B 2D2CD 3Q1MA 1OWAA 3HUSC 3MD0A 1O7WA 3EQQA 2FYUE 2P58A 2FXMA 2YXRB 3GTEA 3H1JD 4QMAA 1KB9H 4IFMA 2KB7P 2OGUA 3L70J 4ASWA 2M0BA 1FOSF 1PP9D 5BVZA 1KYOE 2FXOA 3H1HJ 3HE4B 3L73E 3EFFK 1BDCA 3GZYA 2IYPA 2FYUK 2YFIA 5AVVB 4EDFA 1H0TB 1H8AA 2NVFA 1S5LX 3H1IJ 1IFPA 2K88A 4OVNF 3MUDC 3KXDA 2JO1A 1YJWP 2B24A 2NWFA 5B5EH 3Q2YA 1EDJA 1YQ3C 1ZMEC 1GW4A 1PIXA 2ZT9B 4B86A 5KLVJ 2WT7A 4JF7A 3AE4C 1KILB 3L74G 4XE5B 3A3YB 3AECC 2FYZA 4QUQA 1VQ8P 1AQTA 1WQLA 1LTAC 2P10A 3CX5E 4PD4H 3GLMA 2NPSA 4HJGH 1NTMG 4RJTA 1XTGB 1BCCE 1W2BO 5AVQB 1M1JA 3CXHE 4GKGA 2K9JB 3TF5A 1BGYJ 1FJPA 2KP8A 3CCLP 1NVOA 3NFQA 1FQTA 4HM2A 2K37A 1Q81Q 1VQMP 4HKZH 4RO0A 2QA4P 2QJKC 1K9MQ 1MKMA 2RMZA 4U3FE 1S72P 3L74D 2Z4EA 1G8KB 1ZR2A 1Q86Q 3H1LG 2J58A 4JQ0D 2DW3A 3VMZA 1CI6A 1WT6A 5BOKA 3EFGA 2V7QJ 2XRXA 1DD4A 1NWQA 2KIKA 3VCAA 3CL3D 4W7ZA 1VQ9P 2R44A 3D6YA 3AE7C 5KJ7D 1CW5A 2FYUJ 1ZRTE 3A2AA 2KK7A 2YO3A 2H88C 3C1LA 3EWKA 2FXPA 4Y99C 1KFMA 1YTZT 5TISH 2B1XA 2I1JA 4HM0A 4NBFD 3CMEP 1GK6A 5L8RJ 2H89C 2E42A 1RF1A 2YIUB 4OH8B 1Q90D 3H1LD 1RE3A 3CLQA 1M7LA 1X22A 3M06A 2AEMA 2A06G 2K1AA 4PD4D 4HM4A 1UIXA 1BSNA 1S5LH 5DJUB 2OYHA 2HODA 2OQQA 5AW1B 1FZCC 3HD7A 3CI9A 2ZYDA 2MKVA 1NTKG 1BE3G 2R3SA 1NKNA 1IFJA 3M0DC 3L74J 1JEKA 4H44D 1P84I 3SFDC 3CWBE 4WY4D 2FY8A 2XDJA 5AVTB 1X8YA 1OW7A 5KJ7C 2WSFH 1GW3A 3B71A 1BDDA 1W5CE 2YNYA 1NTMJ 2Q1KA 2XZRA 3OAKA 3RBZA 1PPJG 2CPSA 1QVFO 3O8ZA 1PGJA 3AEFC 2QIWA 2A06D 2XNDH 2G3AA 2NVEA 1L4AB 1NTKD 3BRVB 1BE3D 3CCSP 3N0QA 1YYCA 3TGUE 2FYNC 1ZXGA 5APQA 3CC4P 1GL2D 3F89A 3RK2C 3BCCE 4PV1C 1SQXE 3L75E 1LTJA 1SQBD 3G4SP 1USDA 2IBZG 3H1KD 1PPJD 2O1KA 4H44C 4EI2A 1LWUA 3K5BA 2CK3H 2AXTE 5AVZB 1J1DB 4WY4C 5AW2B 4I1LA 1VQ7P 5CBOA 1E79H 2BMOA 5AW3B 1NJIQ 1SQXK 1HWTC 1CZQA 1L4AD 3PLNA 1J2JB 1YBKA 4GIFA 4TT3H 1VPCA 4KHXA 4I6MC 1SJGA 1KQSO 2BMQA 1LT1A 2ZJSE 1H88A 1Q2NA 1L0NG 2IBZD 2XR8A 1LTTC 1EZVG 4QUPA 5CBNA 2RH0A 2KZJA 2OTKE 2PP6A 2Z5IA 2LKMA 5AW5B 3RK3E 1AFOA 3TNUB 2OYOA 4OWFA 3JCUE 3A0BH 4HKVA 1GL2C 2N1TD 1LT9C 3HTKB 1NTKJ 4W80A 5E79E 1EDKA 1BE3J 1IFIA 3RK3B 4DZOA 1P84E 5B66H 4NBHD 2KS1A 4NBAD 1KMIZ 3LIDA 3I5CA 1L0LK 3CCEP 3B5NA 4N6JA 1SFCC 2R5DA 1EQ7A 1FDMA 2XNXA 3D71A 2NUMA 3PRJA 1Q82Q 4HYTB 5TJHA 3E7KA 1VL2A 1PGPA 1S9KE 4Y28J 1Y8AA 5AW4B 2A45G 1L0ND 1JTHA 4NBBD 1N86A 1EZVD 1YJNP 3WUVA 3PP5A 1W2EA 2ZAEB 1YIJP 1RE3C 2FFDA 1AA0A 4ZNCA 2P2UA 1S1CX 3CPWO 1KFNA 3AE2C 1OW6A 3CCRP 2AEJA 1DX7A 1KN7A 2HLOA 3AEBC 2N1TC 1M90Q 3HUSB 1SQVE 3SWKA 5K5GB 1FE6A 4IL6E 2E4QA 3A5TA 1LNQA 3H1HE 3GG2A 1TU3F 1FU1A 3BRTB 1FAVA 4XFJA 4R4LA 2IX7C 2NZ2A 4O9BA 3KZIH 2YMKA 4BRYB 1KYOI 2L91A 3H1IE 2BMRA 3SSUA 4RKUJ 2WSCH 1SQVK 4JYBA 3GHGA 3FWLA 3GB4A 3G3ZA 4IFDK 1SP4A 2JZAA 1RF0C 3L72J 1SQPG 1URQC 2KYVA 2YMYA 1KZUB 1FZBA 5KLVE 1N73A 2GUSA 3PHLA 1OMIA 1L0LJ 5KKZC 1LTGC 2HMJA 2W90A 4AQRD 4HM8A 1ZN5A 1NU1G 5AW6B 3WU2H 4NPDA 2W8ZA 2E75D 2KSJA 2XSOA 3H1JE 1NAYA 1HUCA 5KLVK 3CX5I 5EFWB 1BGYE 1DH3A 3A0HH 4NBCD 2GM4A 4CPGA 3HE4A 1ZV8A 1JY2N 5GTHE 5CCHA 1LP1B 3IFMA 1SQPD 1IJDB 1H0TA 1R8EA 1FZFA 4IFFA 1PP9G 4MN4C 4ASVA 1U57A 2Q5UA 3AE5C 1R5SA 4EIJA 1EXIA 1NU1D 1JCDA 4GODA 1KD1Q 1ZLLA 2YKPA 1QX8A 3KQGA 4KT0J 1KYOH 2QJKB 2WITA 1AV1A 2WSEJ 2KUBA 1UUVA 4YXDC 2NRGA 3IAOA 1HGVA 1KILA 4HM5A 1KTMA 3EQ2A 1XTCC 1JO5A 1JM0A 3A7OA 2E75C 2JDIH 1IFNA 1VCKA 1SQVJ 1EDIA 3G6EP 3L71D 1NKZB 2QJYC 3L35A 2YXQB 4NBED 2K9JA 2CKFA 4D6TG 4Y99B 4WVZA 1PFIA 4M3LA 3L36A 2OTJP 2P67A 1GU5A 1OFCX 3CX5H 1SQPJ 5H2FE 2IDBA 3GMAA 1KILE 3L74E 2QSIA 3II6A 1VF5C 1N7SD 1FBMA 2I8DA 2KLVA 4QDFB 2VRSA 3CXHH 4N78E 4PJ0E 1FZEA 5AW7B 1FZCB 1GK4A 5KAFE 3C9IA 1NTME 3MP7B 2QM7A 1ZR4A 1EG9A 3AEDC 1OZHA 4D6TD 5AW9B 1M57D 2WWWA 3H1JJ 2J5UA 2QJPC 3QWOC 1NYHA 4BWNA 4U7JA 1JY3P 1NAFA 3Q5PA 1H89A 4EYYQ 4WB4A 1NTMK 4NPFX 1PP9J 1AVOA 5APXA 1JY3O 1KB9D 4YXWH 2JP3A 1JMBA 1DIPA 1CSBA 2XSHA 2IPPA 2XU6A 1BCCG 1K04A 2O3JA 5CJ0A 2QPZA 1PGOA 2C0WA 5CCGC 3NMDA 2ZYLA 1FJKA 4WBAA 3H32B 4WWIA 2FYNB 1PGQA 1N7SC 1KQFB 5C39A 2UWJE 2B87B 3L4FA 4A7PA 1LTIC 3CCMP 2KNCB 1AQ5A 3RK2B 3D70A 4PV1B 3UIAA 2QEXP 1G1IA 4KJMA 3AE3C 4U3FG 1LTBC 3IN6A 1AJYA 3MTUE 1MFTA 4H44B 4JYCA 5AVYB 5AW0B 4WY4B 3CCQP 3HRNA 4AIVA 4DT0A 2NVGA 1BCCD 3V2RA 4D6TJ 3CXHD 2A06E 4DOJA 1N7LA 3BASA 1L4AA 4UB8E 1N2DC 1NTKE 1BE3E 3RK2D 4PV1D 5M1BA 1OIPA 1UIIA 2HFED 4U3FD 3GOBA 5APSA 4NBDD 1U7MA 3VMAA 5AEWA 2P7JA 1GL2B 3FX0A 3T97B 1LT9B 3MHVA 3VP9A 1SS1A 2JEEA 1PPJE 1NTKK 1YTZI 1SQBG 3GCEA 3H1KG 2E74D 4IL6X 1SFCB 3IF4A 1BSHA 4W7YA 2C9NY 3VMGD 5GTIE 3R4YA 3N7NA 1VQPP 2ZXEB 1O7NA 2E43A 1PZQA 4OGQC 2Y0EA 4HM3A 3RL0D 2OARA 3M9HA 1NYKA 1QEXA 2AXTH 1T2KC 1QVGO 2W6AA 3AEEC 3TNUA 2IBZE 3H1LJ 3P8CE 2B9BA 3HTKA 2M5AB 3JSVC 2W83C 2SPZA 1SFCD 1DEEG 4QDCA 1YQ4C 3CD6P 4AUWA 1HJBA 2N1TB 2QG4A 1QGKB 3VMHD 2ZVNB 2BCCG 1DEBA 2R5BA 2NPSC 3BCCG 2E74C 1T3UA 4C7NB 4H13D 3L75G 1G2CB 4K3AA 3FGAD 3JCUH 4L73A 3L72E 1SVFA 4YPCA 3LW5H 1M1JC 5E79H 3G9RA 4XA4A 1P84H 3KPEA 1RE4A 1L0LE 3PTZA 3VMYA 3CC2P 5APUA 1JOCA 2K9YA 3RL0C 2OTLP 4GOEA 1GMJA 5AVWB 1NGMB 2K3RA 2O01H 1KV4A 1URQB 3HD7D 1RQUA 2YVJB 4P1CH 3HUSA 5KKZB 2BCCD 1VQ6P 3BCCD 2Q3WA 3RL0g 3OJAB 3L75D 3R2PA 5KTBA 1SQBJ 4BRYA 1MV8A 3H1KJ 2I7FA 3GL0A 2WTYA 3RBXA 3TK1A 1WRGA 4H13C 2WPRA 3Q5SA 2BASA 1VQKP 1FZAA 4TLFA 1URQD 4IL6H 4N3YB 1RF1C 3P8MC 3V4QA 5KAIE 2OYIB 1M1KQ 5CJ4A 1PL5A 2O1JA 2CPBA 2WPVB 3MUDA 3JC22 1OXZA 4H0LC 1RHZB 1J1EC 2HYNA 1GD2E 2OYHC 3HD7C 1HTLC 3F5HA 1K05A 3PH0A 1JNMA 2WSFJ 2ZVOB 5APVA 3H6PA 1GU4A 1ULJA 3VCPA 3Q5RA 1P84D 2YO2A 2N9BA 2Y0CA 3B8EB 2YKOA 1IC2A 1NO4A 2E76D 2BCCJ 2E75B 1IO4A 2YKQA 1LP1A 5KLIC 3AEAC 1SQQG 1M8OB 3O6QB 3L70G 1GDTA 4GT1A 1KORA 1SQPE 2QJYB 2B88A 2POHA 2H7HA 1X79B 2E5TA 2KXPB 1ZP0C 3FWNA 4EOTA 1L0NJ 3C8VA 4DCKA 2HG5D 3AE9C 2V4HA 1YJ9P 4LC1A 2KOGA 5BU5A 1JB0J 4C7RA 1SQPK 4YTPC 3FXDA 3H25A 3KZIE 1VF5B 1MFZA 1ULIA 2DE7D 1LTJC 4I7ZC 3HE5B 1SQQD 4HJLA 2IYOA 3B5ND 1M56D 3L70D 3S4RA 1LWUC 2AXCA 1QL1A 2HMKA 3WUUA 1SLQA 2V7QH 1LGHB 1PP9E 2E76C 1NHLA 2L5GB 3AE1C 3VMXA 2QJPB 4RESB 4UB6E 3L71G 1JMMA 2FBWC 4HM1A 1FC2C 2HMNA 1BGYG 1NTZG 2HPCB 1FZGA 1VF5D 3TDKA 1UUWA 1QLED 4QDFA 4PD4I 2WVRA 3FOUA 1FZCA 1T8ZA 3VOPA 1NOHA 2QE7H 1N7SB 1JY2P 3M0DA 1NH4A 3B5NC 3AZCA 3ZDMA 4D6TE 2W6JH 1JY2O 3Q3DA 5H2FH 2QVAA 5KJ7A 2FYUG 2KZIA 1BGYD 1NTZD 1SQQJ 2LXCB 4PJ0H 3GF3A 1VQ5P 2MJZA 5KAFH 1Q7YQ 1EXJA 2C0XA 1ZOYC 2E5YA 5AW8B 5HL4A 1KB9E 1T6AA 5CCGD 4NBGD 3L73G 2JR8A 3VN0A 5AVUB 2FFDC 2Z5HA 2HMLA 3H32A 1JY3N 2W27A 3KHUA 2M3BA 3B4SA 1OVVA 2B87A 1NU1J 2KNCA 3DQYA 2Q9IA 4L76A 3GTSA 2FYUD 2IZ0A 1IK7A 1G1JA 2D2CC 4R4MA 1Y9BA 2ZYAA 1VQOP 3MGNA 1U7JA 2WSCJ 4WY4A 5CCHD 1KYOD 2Q3IA 5B5EE 1VDFA 3L73D 2DE6D 5APWA 3GHGC 2GBXA 3L71J 3H1LE 1ZW0A 3EN1A 1K8AQ 1NTZJ 1HH0A 3ABVC 2KI7B 4OGQB 4K35A 3QH9A 3N4XA 4GDOA 2IZ1A 4GOFA 4PD4E 2JO6A 1N73C 2ZT9D 2IBZI 3M9QA 2BEQD 4AAYB 2H8PD 3U1CA 3E1IA 1KILD 4ZKPA 2HMOA 3AEGC 4Z1MH 1O7HA 1GL2A 3T97A 1S3JA 1LT9A 1GZLA 4N78D 3V2PA 3OA7A 1QL2A 2M8RA 3NTNA 4UB8H 1HVVA 2WT7B 1NTMD 2FKWB 1O7PA 3CX5D 1SFCA 3S9OA 3USSA 3MIWA 2R32A 4L75A 2PGDA 2GUVA 5CCHC 1KC8Q 3E1RA 3SWYA 2NPSB 3I55P 3LIEA 1RIEA 4OGQD 2E74B 2PFXA 2WMMA 3L37A 1JUNA 2WPQA 2Q3EA 3SWFA 3P32A 1T2KD 1EZVI 1M1JB 3OW2O 1A02F 2ZXXA 3AE8C 2YFLA 3L73J 4HM7A 2RKLA 1RQVA 1RFSA 1OVUA 3RL0B 2H43A 5AVSB 1X9VA 2M5AA 2ZT9C 5GTIH 4ZMDA 3GW6A 1SQBE 5TISE 3S1KA 1KILC 3H1KE 2N1TA 3W67A 1CI6B 2NPSD 3MZWB 1OX3A 1ZRTD 2A45I 1HF9A 1USEA 1HBWA 5AVXB 4C7NA 1G2CA 4HM6A 2J59M 3CWBG 1SQBK 1OVRA 1S5LE 3KYQA 2Y9YA 4H13B 1BCCJ 1RF1B 4JBZA 1RF0A 1URQA 1A02J 1N8RQ 4DJGA 1Q90C 5AVRB 4EMJB 1NDOA 3VYIA 1LJ2A 4H0LB 2IFMA 1GTWA 1J1EB 1HGZA 2WZ7A 1JM1A 4NB8D 2OYHB 2HODB 2BCCE 3HD7B 3TGUG 1EC5A 4U3FJ 5CHXA 2PRRA 3CWBD 2IFNA 3CC7P 1SQXG 2Q6QA 5AEUA
chains in the Genus database with same CATH topology
2E76D 3N0QA 5KLVE 3C0DA 2E74D 3TGUE 2B24A 4QDDA 1UUWA 3GKEA 2NUMA 2FYNC 2NWFA 4QDFA 5KLIC 1NTZE 2QJYC 2ZYLA 5KKZC 4NBED 2DE5D 2YVJB 2CKFA 2DE6D 1L0NE 2HMJA 3FOUA 3VMGD 2B1XA 3BCCE 4P1CH 1SQPE 4HM0A 1SQBE 1SQXE 3D89A 1EZVE 4NBFD 4HM8A 3H1KE 2GBXA 2GBWA 1O7NA 2YIUC 4NBBD 3L75E 2Q3WA 3H1LE 2HMMA 4HM3A 3EN1A 1SQQE 2E75D 2XSOA 3H1JE 4QURA 1NYKA 4QUQA 4H0LD 3L70E 3AZCA 1WQLA 4D6TE 3CX5E 2I7FA 1BGYE 4PD4E 3GL0A 2JO6A 4NBCD 2ZT9D 1O7GA 4HM6A 2IBZE 4AAYB 3L74E 2BMOA 4HM4A 1BCCE 2YFJA 4AIVA 2D2CD 4QDFB 1VM9A 2HMOA 2NVGA 1O7HA 3CXHE 1O7WA 1ULIA 2DE7D 3EQQA 5CXMA 2FYUE 3GZXA 4QDCA 1SQVE 2A06E 1O7MA 3GTEA 1SJGA 4HJLA 1NTME 2E4PA 1FQTA 4HM2A 2E4QA 5HL4A 4H44D 2BMQA 3CWBE 1KB9E 1NU1E 1EG9A 3H1HE 4NBGD 1O7PA 3VMHD 2HMKA 2QJKC 1NTKE 2HMLA 1BE3E 4U3FE 4PV1D 1PP9E 2NUKA 2XR8A 3GL2A 1Q90C 4QUPA 2QJPC 1G8KB 4P1BH 3GOBA 3H1IE 1KYOE 4EMJB 4H13D 1NDOA 2BMRA 2QPZA 1RIEA 1G8JB 4NB9D 4OGQD 3L73E 1UUVA 3L72E 4HKVA 3GZYA 3DQYA 4NBDD 1JM1A 4NB8D 2YFIA 2BCCE 4HM5A 5AEWA 3GTSA 4HM1A 5BOKA 1P84E 2XRXA 4NBHD 3GB4A 1L0LE 4NBAD 2HMNA 2NVFA 4QCKA 1ULJA 3VCPA 3VCAA 2JZAA 1PPJE 2YFLA 2XSHA 2NVEA 1VF5D 1VCKA 3VMID 3GCEA 4HM7A 1ZRTE 5AEUA 1RFSA 3L71E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 D;  3N0Q A;  5KLV E;  3C0D A;  2E74 D;  3TGU E;  2B24 A;  4QDD A;  1UUW A;  3GKE A;  2NUM A;  2FYN C;  2NWF A;  4QDF A;  5KLI C;  1NTZ E;  2QJY C;  2ZYL A;  5KKZ C;  4NBE D;  2DE5 D;  2YVJ B;  2CKF A;  2DE6 D;  1L0N E;  2HMJ A;  3FOU A;  3VMG D;  2B1X A;  3BCC E;  4P1C H;  1SQP E;  4HM0 A;  1SQB E;  1SQX E;  3D89 A;  1EZV E;  4NBF D;  4HM8 A;  3H1K E;  2GBX A;  2GBW A;  1O7N A;  2YIU C;  4NBB D;  3L75 E;  2Q3W A;  3H1L E;  2HMM A;  4HM3 A;  3EN1 A;  1SQQ E;  2E75 D;  2XSO A;  3H1J E;  4QUR A;  1NYK A;  4QUQ A;  4H0L D;  3L70 E;  3AZC A;  1WQL A;  4D6T E;  3CX5 E;  2I7F A;  1BGY E;  4PD4 E;  3GL0 A;  2JO6 A;  4NBC D;  2ZT9 D;  1O7G A;  4HM6 A;  2IBZ E;  4AAY B;  3L74 E;  2BMO A;  4HM4 A;  1BCC E;  2YFJ A;  4AIV A;  2D2C D;  4QDF B;  1VM9 A;  2HMO A;  2NVG A;  1O7H A;  3CXH E;  1O7W A;  1ULI A;  2DE7 D;  3EQQ A;  5CXM A;  2FYU E;  3GZX A;  4QDC A;  1SQV E;  2A06 E;  1O7M A;  3GTE A;  1SJG A;  4HJL A;  1NTM E;  2E4P A;  1FQT A;  4HM2 A;  2E4Q A;  5HL4 A;  4H44 D;  2BMQ A;  3CWB E;  1KB9 E;  1NU1 E;  1EG9 A;  3H1H E;  4NBG D;  1O7P A;  3VMH D;  2HMK A;  2QJK C;  1NTK E;  2HML A;  1BE3 E;  4U3F E;  4PV1 D;  1PP9 E;  2NUK A;  2XR8 A;  3GL2 A;  1Q90 C;  4QUP A;  2QJP C;  1G8K B;  4P1B H;  3GOB A;  3H1I E;  1KYO E;  4EMJ B;  4H13 D;  1NDO A;  2BMR A;  2QPZ A;  1RIE A;  1G8J B;  4NB9 D;  4OGQ D;  3L73 E;  1UUV A;  3L72 E;  4HKV A;  3GZY A;  3DQY A;  4NBD D;  1JM1 A;  4NB8 D;  2YFI A;  2BCC E;  4HM5 A;  5AEW A;  3GTS A;  4HM1 A;  5BOK A;  1P84 E;  2XRX A;  4NBH D;  3GB4 A;  1L0L E;  4NBA D;  2HMN A;  2NVF A;  4QCK A;  1ULJ A;  3VCP A;  3VCA A;  2JZA A;  1PPJ E;  2YFL A;  2XSH A;  2NVE A;  1VF5 D;  1VCK A;  3VMI D;  3GCE A;  4HM7 A;  1ZRT E;  5AEU A;  1RFS A;  3L71 E; 
#chains in the Genus database with same CATH topology
 2BEZ F;  4I2L C;  1E5W A;  2XKM A;  3WMM 0;  4L74 A;  1L0N E;  5KLI B;  1PV3 A;  1EZV E;  1X0T A;  2GBW A;  2YIU C;  3P7K A;  2OYI A;  1MUU A;  2HMM A;  4H0L D;  2R3C A;  2N9Y B;  2A45 H;  5DJT B;  1VQL P;  3TGU D;  5CMZ A;  3L72 G;  4LGD E;  1O7G A;  1L0N K;  3M91 A;  3P8C D;  1VM9 A;  1L0L G;  1SQX D;  3NXS A;  3CCV P;  3WUT A;  1VQN P;  5CXM A;  3GZX A;  1AVY A;  2WSE H;  2ZFC A;  4BXL A;  5KAI H;  3V6I A;  2E4P A;  2WQY C;  2QM8 A;  1LTJ B;  4I7Z B;  1IFM A;  3SFE C;  2HR3 A;  1R5L A;  1Z56 A;  1FDI A;  1WMK A;  2WSS H;  2I1K A;  2NUK A;  1LWU B;  3O6Q A;  3GL2 A;  1Y47 A;  3IR9 A;  4P1B H;  2Q7C A;  4HH2 A;  1G8J B;  3CWB J;  2E76 B;  1S4X A;  3A0B E;  3CCU P;  2KLU A;  3L72 D;  1FDO A;  5B66 E;  3VTP C;  1L4A C;  4IOI H;  2JWD A;  3V4W A;  1L0L D;  1HJ0 A;  2PAJ A;  3G71 P;  3W68 A;  3M0A A;  3C0D A;  4QDD A;  3GKE A;  4JPZ B;  2O01 N;  4LLH A;  1LTS C;  3RK3 D;  3HE5 A;  1MZ9 A;  3V2Q A;  3TGU J;  1K73 Q;  1IZN B;  1YIT P;  2G8Y A;  1SQQ E;  1L2P A;  1J1D C;  4QUR A;  2P1J A;  2KS1 B;  3L70 E;  3BCC J;  2JJL A;  2LXB A;  1SQX J;  2Y0D A;  3CMA P;  4C46 A;  2ITA A;  3B5N B;  1SQV G;  3L75 J;  4AYC A;  1EDL A;  1S9K D;  1IK9 A;  2YFJ A;  2WPS A;  3CCJ P;  3H1H G;  1FS0 E;  3V5B A;  2Y9Z A;  2ZYG A;  1SQQ K;  2HPC A;  4NPE A;  1O7M A;  3H1I G;  1JTH B;  1KB9 I;  1NU1 E;  3VP8 A;  5GTH H;  1S2E A;  2LR2 A;  3AE6 C;  2C9L Y;  3KDP B;  3PJS K;  2FFD B;  5CCG A;  1DD3 A;  4NB9 D;  4ZKU A;  1RY3 A;  5BU8 B;  3RK3 C;  4UB6 H;  1N7S A;  2B89 A;  2GA1 A;  4HB1 A;  1D7M A;  3ITK A;  5KLV G;  3V2N A;  1VQ4 P;  1SQV D;  1NU1 K;  1RH5 B;  3FXE A;  4QCK A;  3H1H D;  2KSE A;  2D2C B;  2AEF A;  3VMI D;  2RN0 A;  3L71 E;  3LW5 J;  5APT A;  1FOS E;  3BAT A;  1T3J A;  1JCC A;  3H1I D;  2QRX A;  3H1J G;  1NTZ E;  1KQG B;  5APY A;  3I56 P;  1YI2 P;  2DE5 D;  3TYY A;  3TSI A;  3U1A A;  1OW8 A;  3D89 A;  2XV5 A;  1IFD A;  1RE4 C;  3CXH I;  2O01 J;  3GHG B;  3WU2 E;  2M3E A;  1KQL A;  2OYI C;  3M9B A;  2JWA A;  3U59 A;  2W6B A;  3D6Z A;  5KLV D;  1YHQ P;  3GF7 A;  1NTZ K;  2JKV A;  3A0H E;  3RGU A;  3BVH A;  1N73 B;  2D2C D;  3Q1M A;  1OWA A;  3HUS C;  3MD0 A;  1O7W A;  3EQQ A;  2FYU E;  2P58 A;  2FXM A;  2YXR B;  3GTE A;  3H1J D;  4QMA A;  1KB9 H;  4IFM A;  2KB7 P;  2OGU A;  3L70 J;  4ASW A;  2M0B A;  1FOS F;  1PP9 D;  5BVZ A;  1KYO E;  2FXO A;  3H1H J;  3HE4 B;  3L73 E;  3EFF K;  1BDC A;  3GZY A;  2IYP A;  2FYU K;  2YFI A;  5AVV B;  4EDF A;  1H0T B;  1H8A A;  2NVF A;  1S5L X;  3H1I J;  1IFP A;  2K88 A;  4OVN F;  3MUD C;  3KXD A;  2JO1 A;  1YJW P;  2B24 A;  2NWF A;  5B5E H;  3Q2Y A;  1EDJ A;  1YQ3 C;  1ZME C;  1GW4 A;  1PIX A;  2ZT9 B;  4B86 A;  5KLV J;  2WT7 A;  4JF7 A;  3AE4 C;  1KIL B;  3L74 G;  4XE5 B;  3A3Y B;  3AEC C;  2FYZ A;  4QUQ A;  1VQ8 P;  1AQT A;  1WQL A;  1LTA C;  2P10 A;  3CX5 E;  4PD4 H;  3GLM A;  2NPS A;  4HJG H;  1NTM G;  4RJT A;  1XTG B;  1BCC E;  1W2B O;  5AVQ B;  1M1J A;  3CXH E;  4GKG A;  2K9J B;  3TF5 A;  1BGY J;  1FJP A;  2KP8 A;  3CCL P;  1NVO A;  3NFQ A;  1FQT A;  4HM2 A;  2K37 A;  1Q81 Q;  1VQM P;  4HKZ H;  4RO0 A;  2QA4 P;  2QJK C;  1K9M Q;  1MKM A;  2RMZ A;  4U3F E;  1S72 P;  3L74 D;  2Z4E A;  1G8K B;  1ZR2 A;  1Q86 Q;  3H1L G;  2J58 A;  4JQ0 D;  2DW3 A;  3VMZ A;  1CI6 A;  1WT6 A;  5BOK A;  3EFG A;  2V7Q J;  2XRX A;  1DD4 A;  1NWQ A;  2KIK A;  3VCA A;  3CL3 D;  4W7Z A;  1VQ9 P;  2R44 A;  3D6Y A;  3AE7 C;  5KJ7 D;  1CW5 A;  2FYU J;  1ZRT E;  3A2A A;  2KK7 A;  2YO3 A;  2H88 C;  3C1L A;  3EWK A;  2FXP A;  4Y99 C;  1KFM A;  1YTZ T;  5TIS H;  2B1X A;  2I1J A;  4HM0 A;  4NBF D;  3CME P;  1GK6 A;  5L8R J;  2H89 C;  2E42 A;  1RF1 A;  2YIU B;  4OH8 B;  1Q90 D;  3H1L D;  1RE3 A;  3CLQ A;  1M7L A;  1X22 A;  3M06 A;  2AEM A;  2A06 G;  2K1A A;  4PD4 D;  4HM4 A;  1UIX A;  1BSN A;  1S5L H;  5DJU B;  2OYH A;  2HOD A;  2OQQ A;  5AW1 B;  1FZC C;  3HD7 A;  3CI9 A;  2ZYD A;  2MKV A;  1NTK G;  1BE3 G;  2R3S A;  1NKN A;  1IFJ A;  3M0D C;  3L74 J;  1JEK A;  4H44 D;  1P84 I;  3SFD C;  3CWB E;  4WY4 D;  2FY8 A;  2XDJ A;  5AVT B;  1X8Y A;  1OW7 A;  5KJ7 C;  2WSF H;  1GW3 A;  3B71 A;  1BDD A;  1W5C E;  2YNY A;  1NTM J;  2Q1K A;  2XZR A;  3OAK A;  3RBZ A;  1PPJ G;  2CPS A;  1QVF O;  3O8Z A;  1PGJ A;  3AEF C;  2QIW A;  2A06 D;  2XND H;  2G3A A;  2NVE A;  1L4A B;  1NTK D;  3BRV B;  1BE3 D;  3CCS P;  3N0Q A;  1YYC A;  3TGU E;  2FYN C;  1ZXG A;  5APQ A;  3CC4 P;  1GL2 D;  3F89 A;  3RK2 C;  3BCC E;  4PV1 C;  1SQX E;  3L75 E;  1LTJ A;  1SQB D;  3G4S P;  1USD A;  2IBZ G;  3H1K D;  1PPJ D;  2O1K A;  4H44 C;  4EI2 A;  1LWU A;  3K5B A;  2CK3 H;  2AXT E;  5AVZ B;  1J1D B;  4WY4 C;  5AW2 B;  4I1L A;  1VQ7 P;  5CBO A;  1E79 H;  2BMO A;  5AW3 B;  1NJI Q;  1SQX K;  1HWT C;  1CZQ A;  1L4A D;  3PLN A;  1J2J B;  1YBK A;  4GIF A;  4TT3 H;  1VPC A;  4KHX A;  4I6M C;  1SJG A;  1KQS O;  2BMQ A;  1LT1 A;  2ZJS E;  1H88 A;  1Q2N A;  1L0N G;  2IBZ D;  2XR8 A;  1LTT C;  1EZV G;  4QUP A;  5CBN A;  2RH0 A;  2KZJ A;  2OTK E;  2PP6 A;  2Z5I A;  2LKM A;  5AW5 B;  3RK3 E;  1AFO A;  3TNU B;  2OYO A;  4OWF A;  3JCU E;  3A0B H;  4HKV A;  1GL2 C;  2N1T D;  1LT9 C;  3HTK B;  1NTK J;  4W80 A;  5E79 E;  1EDK A;  1BE3 J;  1IFI A;  3RK3 B;  4DZO A;  1P84 E;  5B66 H;  4NBH D;  2KS1 A;  4NBA D;  1KMI Z;  3LID A;  3I5C A;  1L0L K;  3CCE P;  3B5N A;  4N6J A;  1SFC C;  2R5D A;  1EQ7 A;  1FDM A;  2XNX A;  3D71 A;  2NUM A;  3PRJ A;  1Q82 Q;  4HYT B;  5TJH A;  3E7K A;  1VL2 A;  1PGP A;  1S9K E;  4Y28 J;  1Y8A A;  5AW4 B;  2A45 G;  1L0N D;  1JTH A;  4NBB D;  1N86 A;  1EZV D;  1YJN P;  3WUV A;  3PP5 A;  1W2E A;  2ZAE B;  1YIJ P;  1RE3 C;  2FFD A;  1AA0 A;  4ZNC A;  2P2U A;  1S1C X;  3CPW O;  1KFN A;  3AE2 C;  1OW6 A;  3CCR P;  2AEJ A;  1DX7 A;  1KN7 A;  2HLO A;  3AEB C;  2N1T C;  1M90 Q;  3HUS B;  1SQV E;  3SWK A;  5K5G B;  1FE6 A;  4IL6 E;  2E4Q A;  3A5T A;  1LNQ A;  3H1H E;  3GG2 A;  1TU3 F;  1FU1 A;  3BRT B;  1FAV A;  4XFJ A;  4R4L A;  2IX7 C;  2NZ2 A;  4O9B A;  3KZI H;  2YMK A;  4BRY B;  1KYO I;  2L91 A;  3H1I E;  2BMR A;  3SSU A;  4RKU J;  2WSC H;  1SQV K;  4JYB A;  3GHG A;  3FWL A;  3GB4 A;  3G3Z A;  4IFD K;  1SP4 A;  2JZA A;  1RF0 C;  3L72 J;  1SQP G;  1URQ C;  2KYV A;  2YMY A;  1KZU B;  1FZB A;  5KLV E;  1N73 A;  2GUS A;  3PHL A;  1OMI A;  1L0L J;  5KKZ C;  1LTG C;  2HMJ A;  2W90 A;  4AQR D;  4HM8 A;  1ZN5 A;  1NU1 G;  5AW6 B;  3WU2 H;  4NPD A;  2W8Z A;  2E75 D;  2KSJ A;  2XSO A;  3H1J E;  1NAY A;  1HUC A;  5KLV K;  3CX5 I;  5EFW B;  1BGY E;  1DH3 A;  3A0H H;  4NBC D;  2GM4 A;  4CPG A;  3HE4 A;  1ZV8 A;  1JY2 N;  5GTH E;  5CCH A;  1LP1 B;  3IFM A;  1SQP D;  1IJD B;  1H0T A;  1R8E A;  1FZF A;  4IFF A;  1PP9 G;  4MN4 C;  4ASV A;  1U57 A;  2Q5U A;  3AE5 C;  1R5S A;  4EIJ A;  1EXI A;  1NU1 D;  1JCD A;  4GOD A;  1KD1 Q;  1ZLL A;  2YKP A;  1QX8 A;  3KQG A;  4KT0 J;  1KYO H;  2QJK B;  2WIT A;  1AV1 A;  2WSE J;  2KUB A;  1UUV A;  4YXD C;  2NRG A;  3IAO A;  1HGV A;  1KIL A;  4HM5 A;  1KTM A;  3EQ2 A;  1XTC C;  1JO5 A;  1JM0 A;  3A7O A;  2E75 C;  2JDI H;  1IFN A;  1VCK A;  1SQV J;  1EDI A;  3G6E P;  3L71 D;  1NKZ B;  2QJY C;  3L35 A;  2YXQ B;  4NBE D;  2K9J A;  2CKF A;  4D6T G;  4Y99 B;  4WVZ A;  1PFI A;  4M3L A;  3L36 A;  2OTJ P;  2P67 A;  1GU5 A;  1OFC X;  3CX5 H;  1SQP J;  5H2F E;  2IDB A;  3GMA A;  1KIL E;  3L74 E;  2QSI A;  3II6 A;  1VF5 C;  1N7S D;  1FBM A;  2I8D A;  2KLV A;  4QDF B;  2VRS A;  3CXH H;  4N78 E;  4PJ0 E;  1FZE A;  5AW7 B;  1FZC B;  1GK4 A;  5KAF E;  3C9I A;  1NTM E;  3MP7 B;  2QM7 A;  1ZR4 A;  1EG9 A;  3AED C;  1OZH A;  4D6T D;  5AW9 B;  1M57 D;  2WWW A;  3H1J J;  2J5U A;  2QJP C;  3QWO C;  1NYH A;  4BWN A;  4U7J A;  1JY3 P;  1NAF A;  3Q5P A;  1H89 A;  4EYY Q;  4WB4 A;  1NTM K;  4NPF X;  1PP9 J;  1AVO A;  5APX A;  1JY3 O;  1KB9 D;  4YXW H;  2JP3 A;  1JMB A;  1DIP A;  1CSB A;  2XSH A;  2IPP A;  2XU6 A;  1BCC G;  1K04 A;  2O3J A;  5CJ0 A;  2QPZ A;  1PGO A;  2C0W A;  5CCG C;  3NMD A;  2ZYL A;  1FJK A;  4WBA A;  3H32 B;  4WWI A;  2FYN B;  1PGQ A;  1N7S C;  1KQF B;  5C39 A;  2UWJ E;  2B87 B;  3L4F A;  4A7P A;  1LTI C;  3CCM P;  2KNC B;  1AQ5 A;  3RK2 B;  3D70 A;  4PV1 B;  3UIA A;  2QEX P;  1G1I A;  4KJM A;  3AE3 C;  4U3F G;  1LTB C;  3IN6 A;  1AJY A;  3MTU E;  1MFT A;  4H44 B;  4JYC A;  5AVY B;  5AW0 B;  4WY4 B;  3CCQ P;  3HRN A;  4AIV A;  4DT0 A;  2NVG A;  1BCC D;  3V2R A;  4D6T J;  3CXH D;  2A06 E;  4DOJ A;  1N7L A;  3BAS A;  1L4A A;  4UB8 E;  1N2D C;  1NTK E;  1BE3 E;  3RK2 D;  4PV1 D;  5M1B A;  1OIP A;  1UII A;  2HFE D;  4U3F D;  3GOB A;  5APS A;  4NBD D;  1U7M A;  3VMA A;  5AEW A;  2P7J A;  1GL2 B;  3FX0 A;  3T97 B;  1LT9 B;  3MHV A;  3VP9 A;  1SS1 A;  2JEE A;  1PPJ E;  1NTK K;  1YTZ I;  1SQB G;  3GCE A;  3H1K G;  2E74 D;  4IL6 X;  1SFC B;  3IF4 A;  1BSH A;  4W7Y A;  2C9N Y;  3VMG D;  5GTI E;  3R4Y A;  3N7N A;  1VQP P;  2ZXE B;  1O7N A;  2E43 A;  1PZQ A;  4OGQ C;  2Y0E A;  4HM3 A;  3RL0 D;  2OAR A;  3M9H A;  1NYK A;  1QEX A;  2AXT H;  1T2K C;  1QVG O;  2W6A A;  3AEE C;  3TNU A;  2IBZ E;  3H1L J;  3P8C E;  2B9B A;  3HTK A;  2M5A B;  3JSV C;  2W83 C;  2SPZ A;  1SFC D;  1DEE G;  4QDC A;  1YQ4 C;  3CD6 P;  4AUW A;  1HJB A;  2N1T B;  2QG4 A;  1QGK B;  3VMH D;  2ZVN B;  2BCC G;  1DEB A;  2R5B A;  2NPS C;  3BCC G;  2E74 C;  1T3U A;  4C7N B;  4H13 D;  3L75 G;  1G2C B;  4K3A A;  3FGA D;  3JCU H;  4L73 A;  3L72 E;  1SVF A;  4YPC A;  3LW5 H;  1M1J C;  5E79 H;  3G9R A;  4XA4 A;  1P84 H;  3KPE A;  1RE4 A;  1L0L E;  3PTZ A;  3VMY A;  3CC2 P;  5APU A;  1JOC A;  2K9Y A;  3RL0 C;  2OTL P;  4GOE A;  1GMJ A;  5AVW B;  1NGM B;  2K3R A;  2O01 H;  1KV4 A;  1URQ B;  3HD7 D;  1RQU A;  2YVJ B;  4P1C H;  3HUS A;  5KKZ B;  2BCC D;  1VQ6 P;  3BCC D;  2Q3W A;  3RL0 g;  3OJA B;  3L75 D;  3R2P A;  5KTB A;  1SQB J;  4BRY A;  1MV8 A;  3H1K J;  2I7F A;  3GL0 A;  2WTY A;  3RBX A;  3TK1 A;  1WRG A;  4H13 C;  2WPR A;  3Q5S A;  2BAS A;  1VQK P;  1FZA A;  4TLF A;  1URQ D;  4IL6 H;  4N3Y B;  1RF1 C;  3P8M C;  3V4Q A;  5KAI E;  2OYI B;  1M1K Q;  5CJ4 A;  1PL5 A;  2O1J A;  2CPB A;  2WPV B;  3MUD A;  3JC2 2;  1OXZ A;  4H0L C;  1RHZ B;  1J1E C;  2HYN A;  1GD2 E;  2OYH C;  3HD7 C;  1HTL C;  3F5H A;  1K05 A;  3PH0 A;  1JNM A;  2WSF J;  2ZVO B;  5APV A;  3H6P A;  1GU4 A;  1ULJ A;  3VCP A;  3Q5R A;  1P84 D;  2YO2 A;  2N9B A;  2Y0C A;  3B8E B;  2YKO A;  1IC2 A;  1NO4 A;  2E76 D;  2BCC J;  2E75 B;  1IO4 A;  2YKQ A;  1LP1 A;  5KLI C;  3AEA C;  1SQQ G;  1M8O B;  3O6Q B;  3L70 G;  1GDT A;  4GT1 A;  1KOR A;  1SQP E;  2QJY B;  2B88 A;  2POH A;  2H7H A;  1X79 B;  2E5T A;  2KXP B;  1ZP0 C;  3FWN A;  4EOT A;  1L0N J;  3C8V A;  4DCK A;  2HG5 D;  3AE9 C;  2V4H A;  1YJ9 P;  4LC1 A;  2KOG A;  5BU5 A;  1JB0 J;  4C7R A;  1SQP K;  4YTP C;  3FXD A;  3H25 A;  3KZI E;  1VF5 B;  1MFZ A;  1ULI A;  2DE7 D;  1LTJ C;  4I7Z C;  3HE5 B;  1SQQ D;  4HJL A;  2IYO A;  3B5N D;  1M56 D;  3L70 D;  3S4R A;  1LWU C;  2AXC A;  1QL1 A;  2HMK A;  3WUU A;  1SLQ A;  2V7Q H;  1LGH B;  1PP9 E;  2E76 C;  1NHL A;  2L5G B;  3AE1 C;  3VMX A;  2QJP B;  4RES B;  4UB6 E;  3L71 G;  1JMM A;  2FBW C;  4HM1 A;  1FC2 C;  2HMN A;  1BGY G;  1NTZ G;  2HPC B;  1FZG A;  1VF5 D;  3TDK A;  1UUW A;  1QLE D;  4QDF A;  4PD4 I;  2WVR A;  3FOU A;  1FZC A;  1T8Z A;  3VOP A;  1NOH A;  2QE7 H;  1N7S B;  1JY2 P;  3M0D A;  1NH4 A;  3B5N C;  3AZC A;  3ZDM A;  4D6T E;  2W6J H;  1JY2 O;  3Q3D A;  5H2F H;  2QVA A;  5KJ7 A;  2FYU G;  2KZI A;  1BGY D;  1NTZ D;  1SQQ J;  2LXC B;  4PJ0 H;  3GF3 A;  1VQ5 P;  2MJZ A;  5KAF H;  1Q7Y Q;  1EXJ A;  2C0X A;  1ZOY C;  2E5Y A;  5AW8 B;  5HL4 A;  1KB9 E;  1T6A A;  5CCG D;  4NBG D;  3L73 G;  2JR8 A;  3VN0 A;  5AVU B;  2FFD C;  2Z5H A;  2HML A;  3H32 A;  1JY3 N;  2W27 A;  3KHU A;  2M3B A;  3B4S A;  1OVV A;  2B87 A;  1NU1 J;  2KNC A;  3DQY A;  2Q9I A;  4L76 A;  3GTS A;  2FYU D;  2IZ0 A;  1IK7 A;  1G1J A;  2D2C C;  4R4M A;  1Y9B A;  2ZYA A;  1VQO P;  3MGN A;  1U7J A;  2WSC J;  4WY4 A;  5CCH D;  1KYO D;  2Q3I A;  5B5E E;  1VDF A;  3L73 D;  2DE6 D;  5APW A;  3GHG C;  2GBX A;  3L71 J;  3H1L E;  1ZW0 A;  3EN1 A;  1K8A Q;  1NTZ J;  1HH0 A;  3ABV C;  2KI7 B;  4OGQ B;  4K35 A;  3QH9 A;  3N4X A;  4GDO A;  2IZ1 A;  4GOF A;  4PD4 E;  2JO6 A;  1N73 C;  2ZT9 D;  2IBZ I;  3M9Q A;  2BEQ D;  4AAY B;  2H8P D;  3U1C A;  3E1I A;  1KIL D;  4ZKP A;  2HMO A;  3AEG C;  4Z1M H;  1O7H A;  1GL2 A;  3T97 A;  1S3J A;  1LT9 A;  1GZL A;  4N78 D;  3V2P A;  3OA7 A;  1QL2 A;  2M8R A;  3NTN A;  4UB8 H;  1HVV A;  2WT7 B;  1NTM D;  2FKW B;  1O7P A;  3CX5 D;  1SFC A;  3S9O A;  3USS A;  3MIW A;  2R32 A;  4L75 A;  2PGD A;  2GUV A;  5CCH C;  1KC8 Q;  3E1R A;  3SWY A;  2NPS B;  3I55 P;  3LIE A;  1RIE A;  4OGQ D;  2E74 B;  2PFX A;  2WMM A;  3L37 A;  1JUN A;  2WPQ A;  2Q3E A;  3SWF A;  3P32 A;  1T2K D;  1EZV I;  1M1J B;  3OW2 O;  1A02 F;  2ZXX A;  3AE8 C;  2YFL A;  3L73 J;  4HM7 A;  2RKL A;  1RQV A;  1RFS A;  1OVU A;  3RL0 B;  2H43 A;  5AVS B;  1X9V A;  2M5A A;  2ZT9 C;  5GTI H;  4ZMD A;  3GW6 A;  1SQB E;  5TIS E;  3S1K A;  1KIL C;  3H1K E;  2N1T A;  3W67 A;  1CI6 B;  2NPS D;  3MZW B;  1OX3 A;  1ZRT D;  2A45 I;  1HF9 A;  1USE A;  1HBW A;  5AVX B;  4C7N A;  1G2C A;  4HM6 A;  2J59 M;  3CWB G;  1SQB K;  1OVR A;  1S5L E;  3KYQ A;  2Y9Y A;  4H13 B;  1BCC J;  1RF1 B;  4JBZ A;  1RF0 A;  1URQ A;  1A02 J;  1N8R Q;  4DJG A;  1Q90 C;  5AVR B;  4EMJ B;  1NDO A;  3VYI A;  1LJ2 A;  4H0L B;  2IFM A;  1GTW A;  1J1E B;  1HGZ A;  2WZ7 A;  1JM1 A;  4NB8 D;  2OYH B;  2HOD B;  2BCC E;  3HD7 B;  3TGU G;  1EC5 A;  4U3F J;  5CHX A;  2PRR A;  3CWB D;  2IFN A;  3CC7 P;  1SQX G;  2Q6Q A;  5AEU A; 
#chains in the Genus database with same CATH homology
 2E76 D;  3N0Q A;  5KLV E;  3C0D A;  2E74 D;  3TGU E;  2B24 A;  4QDD A;  1UUW A;  3GKE A;  2NUM A;  2FYN C;  2NWF A;  4QDF A;  5KLI C;  1NTZ E;  2QJY C;  2ZYL A;  5KKZ C;  4NBE D;  2DE5 D;  2YVJ B;  2CKF A;  2DE6 D;  1L0N E;  2HMJ A;  3FOU A;  3VMG D;  2B1X A;  3BCC E;  4P1C H;  1SQP E;  4HM0 A;  1SQB E;  1SQX E;  3D89 A;  1EZV E;  4NBF D;  4HM8 A;  3H1K E;  2GBX A;  2GBW A;  1O7N A;  2YIU C;  4NBB D;  3L75 E;  2Q3W A;  3H1L E;  2HMM A;  4HM3 A;  3EN1 A;  1SQQ E;  2E75 D;  2XSO A;  3H1J E;  4QUR A;  1NYK A;  4QUQ A;  4H0L D;  3L70 E;  3AZC A;  1WQL A;  4D6T E;  3CX5 E;  2I7F A;  1BGY E;  4PD4 E;  3GL0 A;  2JO6 A;  4NBC D;  2ZT9 D;  1O7G A;  4HM6 A;  2IBZ E;  4AAY B;  3L74 E;  2BMO A;  4HM4 A;  1BCC E;  2YFJ A;  4AIV A;  2D2C D;  4QDF B;  1VM9 A;  2HMO A;  2NVG A;  1O7H A;  3CXH E;  1O7W A;  1ULI A;  2DE7 D;  3EQQ A;  5CXM A;  2FYU E;  3GZX A;  4QDC A;  1SQV E;  2A06 E;  1O7M A;  3GTE A;  1SJG A;  4HJL A;  1NTM E;  2E4P A;  1FQT A;  4HM2 A;  2E4Q A;  5HL4 A;  4H44 D;  2BMQ A;  3CWB E;  1KB9 E;  1NU1 E;  1EG9 A;  3H1H E;  4NBG D;  1O7P A;  3VMH D;  2HMK A;  2QJK C;  1NTK E;  2HML A;  1BE3 E;  4U3F E;  4PV1 D;  1PP9 E;  2NUK A;  2XR8 A;  3GL2 A;  1Q90 C;  4QUP A;  2QJP C;  1G8K B;  4P1B H;  3GOB A;  3H1I E;  1KYO E;  4EMJ B;  4H13 D;  1NDO A;  2BMR A;  2QPZ A;  1RIE A;  1G8J B;  4NB9 D;  4OGQ D;  3L73 E;  1UUV A;  3L72 E;  4HKV A;  3GZY A;  3DQY A;  4NBD D;  1JM1 A;  4NB8 D;  2YFI A;  2BCC E;  4HM5 A;  5AEW A;  3GTS A;  4HM1 A;  5BOK A;  1P84 E;  2XRX A;  4NBH D;  3GB4 A;  1L0L E;  4NBA D;  2HMN A;  2NVF A;  4QCK A;  1ULJ A;  3VCP A;  3VCA A;  2JZA A;  1PPJ E;  2YFL A;  2XSH A;  2NVE A;  1VF5 D;  1VCK A;  3VMI D;  3GCE A;  4HM7 A;  1ZRT E;  5AEU A;  1RFS A;  3L71 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...