3L71E

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l71E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l71E02
3GTSA 4HJLA 4HM7A 4U3FE 1G8JB 4H0LD 5BOKA 3CXHE 4NBED 2QPZA 3H1JE 4PV1D 2Q3WA 3D89A 1PP9E 4HM5A 3L71E 3TGUE 4NBAD 4QDCA 2HMMA 4HM4A 4QURA 1O7WA 1NTME 2XSHA 4OGQD 3H1KE 1KB9E 4H13D 1FQTA 5KLVE 3CX5E 1SJGA 1VCKA 4HM1A 3VMGD 3L74E 1NU1E 4AAYB 2YFIA 1SQBE 2YIUC 3VMHD 2DE5D 3CWBE 2A06E 2NWFA 4QCKA 4HM3A 2D2CD 2I7FA 2XRXA 2BCCE 3EN1A 2CKFA 4NBGD 4HKVA 1BGYE 1VM9A 1O7PA 4QDFA 1NDOA 3GB4A 5AEUA 4NBBD 1L0LE 2NUKA 3N0QA 1RIEA 1EG9A 2NVEA 5KLIC 1NTKE 3L75E 2YFJA 4H44D 4P1CH 1UUWA 3H1IE 2BMOA 5AEWA 3EQQA 4NBDD 1ZRTE 3VMID 2HMOA 4P1BH 3BCCE 1P84E 1G8KB 2GBWA 2GBXA 2HMNA 2E74D 1SQPE 1SQQE 3L72E 2DE7D 2NVFA 3AZCA 2YVJB 3DQYA 4AIVA 4EMJB 2QJKC 1O7MA 1UUVA 4NBCD 3GZXA 2NVGA 3GTEA 2HMJA 2YFLA 2DE6D 3L73E 2B24A 2QJPC 4NBHD 4D6TE 3H1HE 2FYNC 1EZVE 1RFSA 1KYOE 2QJYC 2FYUE 3GL0A 1Q90C 2BMQA 2BMRA 2B1XA 4NB8D 2NUMA 2ZT9D 1NTZE 2E76D 2HMKA 3C0DA 2XSOA 4QDFB 4PD4E 4NB9D 1WQLA 3GOBA 4HM2A 1VF5D 3VCAA 1ULJA 4HM8A 2JZAA 4HM0A 2ZYLA 1L0NE 1NYKA 3GL2A 2IBZE 4NBFD 2E75D 3H1LE 1JM1A 4QUPA 3VCPA 4QDDA 1O7HA 2JO6A 3GCEA 3L70E 1PPJE 2XR8A 1SQVE 1SQXE 5KKZC 1ULIA 2E4PA 2E4QA 1O7NA 3GZYA 5CXMA 4QUQA 1BE3E 1O7GA 3FOUA 4HM6A 2HMLA 5HL4A 1BCCE 3GKEA
chains in the Genus database with same CATH superfamily
2N1TB 1SQVD 4RO0A 4I7ZB 1NTZD 1M1JC 2L91A 1H0TB 1BCCG 2ZJSE 1N7SB 1DIPA 1OW6A 4GODA 1JY2N 3A3YB 2M3BA 4HM3A 5BU5A 3RGUA 2KSJA 1FOSE 2K3RA 2PGDA 3CCRP 4I2LC 1BCCD 2LR2A 4PJ0E 2N1TD 3AE7C 1QLED 2WZ7A 1YQ4C 4B86A 3U1AA 2ZYGA 2YMKA 1N7SD 5KJ7A 3GLMA 3BCCG 1RFSA 1SQQK 2QJYC 3TYYA 4U3FJ 1NO4A 1KFMA 3GW6A 2XSOA 3RK3E 3CI9A 1EZVG 3L71J 3VCAA 1Q82Q 3B5NC 2JEEA 3KQGA 3AE6C 1SQBJ 5CJ4A 1RF1C 3CMAP 3BCCD 2Z5HA 1L0NG 5AW0B 1T2KC 2H7HA 1EXJA 1J1EC 2PAJA 2L5GB 1SVFA 1M90Q 5KLIB 4EOTA 1EZVD 3LW5H 2V4HA 4WY4C 3M0AA 4C7NB 3EFGA 1QEXA 1NWQA 1FS0E 2YKQA 3TGUE 2HMMA 1M57D 1L0ND 1VQ8P 4JQ0D 1FZEA 1SQVJ 3A0HH 1NTZJ 5KJ7D 1PFIA 5KLVK 1BE3J 1VQKP 1L2PA 4NPFX 1N7LA 1AFOA 1UUWA 1JY3P 1GDTA 1MV8A 3K5BA 4ZNCA 1FZCC 1NTMJ 2OARA 2QJKC 3V2PA 2AXTH 3O8ZA 2A45H 2IFNA 3H1HE 1SQQG 2BCCJ 5AVVB 1H88A 4W80A 2G3AA 3VTPC 3WU2E 1JTHA 3KDPB 1N73A 4PV1B 2QA4P 1WQLA 4HM2A 1NTKJ 3RL0B 2Q6QA 2OGUA 3CD6P 3AE2C 3LW5J 5APQA 1TU3F 3H1LE 3GF7A 1OFCX 1SQQD 4NPDA 3JCUE 2M8RA 1SP4A 3EWKA 2KNCA 3HE5A 3CCSP 5AVXB 1N73B 1ZOYC 1OVUA 2IFMA 2YXRB 3GG2A 4BWNA 4PD4D 4PV1D 3I56P 3RK2B 3RL0D 4QURA 3AE8C 1HF9A 1JNMA 5KAIH 2LXBA 5KLVG 3L74G 1W2EA 3SWKA 3M9QA 2KNCB 1CSBA 1KQFB 2E74B 1FOSF 3TNUA 1NYHA 3HE4B 3R4YA 2JR8A 3VMYA 2W6AA 3O6QB 1J1DC 1MFTA 1FU1A 3M9BA 4AIVA 4PD4H 1MZ9A 1UUVA 2ZFCA 3RBXA 1H89A 3CWBJ 4KHXA 5KLVD 3WUUA 3L74D 3L72G 2Z4EA 2DW3A 3AEAC 1L4AC 2I1JA 3IF4A 4W7YA 4W7ZA 2ZVNB 4D6TG 4UB8E 1L0LJ 3GOBA 3HUSA 2FYUK 1LJ2A 5CBNA 2WQYC 1LWUC 1G2CA 1ZV8A 2H8PD 3D6ZA 2QIWA 1OVVA 3VP9A 2IBZE 1R5SA 1SQPJ 2YIUB 2OYHA 1LTIC 4DCKA 2JO6A 1G1IA 2XR8A 1MFZA 3L72D 3W67A 1O7NA 4D6TD 5HL4A 4N3YB 4H44B 2CK3H 3SWYA 4U3FE 1S3JA 4LLHA 3HUSB 3UIAA 1G2CB 3L71E 2FY8A 2XSHA 3E1RA 3RL0g 2B87A 2AXCA 2W6BA 3D70A 1SQBE 1SQXJ 1Y8AA 1FDOA 4NBGD 2WPRA 2E5TA 1U57A 2KIKA 1SS1A 4K3AA 1RE4A 3HD7B 1Q7YQ 4H44D 3H1IE 1LTJA 1PGQA 1ZRTE 4XFJA 2GBXA 4R4MA 5KKZB 3G6EP 1VPCA 4UB6H 3GTEA 3B8EB 3SFDC 1OX3A 2FYNC 2O3JA 2XU6A 3GL0A 2KLVA 4O9BA 2XZRA 2BMQA 4QMAA 3D6YA 1DX7A 1UIXA 1GU5A 3L73G 1NTZE 1VQ7P 1RHZB 2IYOA 4ZKUA 4KJMA 2P58A 2FYUG 3CX5H 3L75J 1H8AA 4HM8A 1X0TA 4NPEA 1LTJB 1YTZI 3R2PA 5B5EH 2ZXXA 3MGNA 1P84D 3AEBC 1ULIA 1Q2NA 5CCHA 2GA1A 3L73D 2HMLA 4YTPC 1BCCE 3KZIH 1KYOD 2FYUD 1IC2A 1USDA 2WSCH 4H0LC 2OTKE 4IL6E 3NXSA 1FE6A 3QWOC 2HLOA 3AE3C 4NBED 3GHGC 1CW5A 5GTIH 2H88C 4OGQC 2W83C 4H13C 4I1LA 2IBZG 2IZ1A 3OW2O 4L76A 1PGJA 5CJ0A 1NTMK 2ZT9B 3H1KG 1NOHA 1P84H 3C1LA 3Q5RA 2VRSA 3WUTA 2R3SA 1ZXGA 1NDOA 3PH0A 1M1JA 1LTTC 2A06G 1OW7A 1VQ4P 4Y99B 4U3FG 1KYOH 1ZMEC 4EDFA 3H1JJ 2Q9IA 1E5WA 3BCCE 3CXHD 1T8ZA 3G9RA 4IL6X 2OTLP 3KPEA 1NTKK 2YVJB 4MN4C 2JWAA 1JY3O 2AEJA 2C9LY 5B66H 2HG5D 3H1KD 1RE3C 4IFDK 1EZVE 1KC8Q 5TISH 2B1XA 2RN0A 2A06D 2ZT9D 1OZHA 5CCHD 1M1JB 5DJUB 3CPWO 1PGOA 1OXZA 2YO3A 1L0NE 3H6PA 5AW3B 2QM7A 1K8AQ 5GTHH 1NJIQ 4WVZA 4QUQA 3V2RA 1U7JA 2YKPA 3FXDA 1SQVG 1AA0A 1Y9BA 3B5NA 1ZR4A 2YO2A 2JP3A 1RF1A 1BE3G 3ITKA 5KAFH 3PJSK 1FBMA 3FXEA 2QJYB 1ZW0A 3CC2P 2WTYA 1PZQA 1URQC 3A0BH 1NTMG 2FFDA 4WY4A 4HYTB 1OW8A 3Q5SA 2ZAEB 3B5NB 1BE3D 4EYYQ 2BCCG 1RF1B 5AVRB 5KAIE 1PP9J 1KILC 1AJYA 1L0LK 2WWWA 1SQQE 1NTKG 4GT1A 3GZXA 1J1EB 2IPPA 1NTMD 1JCDA 1NAFA 3TK1A 1HH0A 1SQPK 2BEQD 1RQVA 3AECC 5H2FH 4WY4B 1DD4A 3BRVB 3M0DC 1VQLP 4PD4E 2BCCD 2CPBA 1VF5C 3CCLP 1FZCA 3USSA 4GOFA 3H1KJ 3B5ND 5K5GB 1NTKD 2E75C 2B88A 4QDDA 3GCEA 3AE5C 2HODA 1EC5A 3I5CA 2MJZA 1T2KD 1PGPA 1K05A 3CCJP 3V5BA 1SQXK 5APWA 2JJLA 4WY4D 5APTA 3S9OA 1LT9C 1FZCB 1KB9I 2A45G 2QJKB 3P8CD 4OVNF 4L73A 2LKMA 1FDMA 2WSSH 5KLVE 3A5TA 3L74E 2YFIA 2Q7CA 1EZVI 4QCKA 2FFDC 1HJBA 5AVYB 1GL2A 3CWBG 3Q3DA 3W68A 2KB7P 3B4SA 4JPZB 1KQSO 2Q1KA 1G1JA 1L0LG 2KP8A 4RJTA 2O1KA 3L72E 3FGAD 3V4WA 4AYCA 4XA4A 4NBHD 4D6TE 1VQMP 1N8RQ 4WBAA 1SQPG 2WPSA 1T3JA 1S9KD 3CWBD 1S5LH 1KB9H 5AVSB 4L74A 2JZAA 1L0LD 2ZYLA 1GD2E 3GL2A 3VN0A 3GF3A 2ZVOB 2WITA 1L4AA 1SQPD 3FWLA 1FZAA 1LTAC 4ZKPA 4YXDC 4HM6A 3G71P 1HJ0A 5AVWB 1SQXG 1QVGO 1LP1A 2GUVA 3L70D 1LWUA 1BDCA 3AE1C 3BATA 1J1DB 2POHA 2E5YA 3NMDA 2Y9ZA 4HM4A 3M9HA 1LTBC 1N86A 1Q81Q 3Q2YA 1L4AB 2FXMA 4DT0A 2D2CC 1HGZA 1JTHB 1SQXD 1X79B 1NU1K 5EFWB 1GL2C 1LP1B 3N0QA 1LWUB 1EG9A 4P1CH 1IFDA 2HMOA 1P84E 1IO4A 3L75G 3OA7A 3L73E 5E79H 1EDKA 5C39A 2G8YA 1KYOE 3HE5B 2FYUE 1L4AD 1AVYA 1FZBA 2E76D 3NFQA 4N6JA 2RMZA 5TJHA 1YYCA 5B66E 1U7MA 1K04A 3TDKA 4GKGA 1JY2P 1NYKA 1GU4A 3L75D 1JO5A 4NBFD 1JM1A 3MZWB 1VDFA 2E43A 1OWAA 2ZXEB 1IFIA 1Q86Q 3CL3D 2E76C 1Z56A 1RF0C 2QG4A 4TT3H 4PJ0H 3LIDA 3TNUB 2N9BA 2Q3EA 3CXHE 1KZUB 5M1BA 1KQLA 1SFCC 4Z1MH 4N78D 4HKZH 3CCQP 3RK3C 3D89A 2Q3IA 2JO1A 2WT7A 3H1KE 3L37A 2FYNB 3L70J 1MUUA 3H1JG 1GK4A 2GM4A 4ZMDA 2A06E 1CZQA 4HKVA 1IFNA 3VP8A 5AEUA 3GHGA 1RIEA 2QSIA 2FXPA 3IR9A 5AW2B 2BMOA 1Y47A 3EQQA 5AW5B 3VMZA 2OYHB 1EDLA 3E7KA 2WT7B 3AZCA 3DQYA 2GUSA 3H1JD 1O7MA 4JYBA 4A7PA 3L4FA 3CX5D 3U1CA 4OWFA 1EDIA 1NU1D 3CC7P 3MIWA 2IYPA 1JOCA 2XV5A 4Y28J 3AEEC 3GHGB 1GMJA 3E1IA 1W2BO 4OGQB 3AEGC 4H13B 4HM0A 1S2EA 1AVOA 3KYQA 1ZP0C 2B87B 2IZ0A 2K9JA 3V6IA 1A02F 2CPSA 1RE3A 1ZN5A 3PLNA 3HTKA 1KN7A 2FYZA 1SQVE 1FJKA 3CCEP 1WMKA 2IDBA 3IAOA 1M7LA 2E4QA 1PIXA 4GOEA 1BE3E 1O7GA 3G3ZA 3BRTB 3LIEA 2N9YB 2LXCB 2W6JH 1YIJP 3GTSA 2HYNA 4H0LD 3A7OA 4RKUJ 1QVFO 3PHLA 2KS1A 3QH9A 1PV3A 1O7WA 1NTME 4OGQD 4DOJA 2K9JB 4H13D 1SJGA 1DEBA 2K1AA 1DH3A 1PP9G 2DE5D 2QRXA 3WU2H 2P2UA 1KFNA 2I7FA 2XRXA 1EQ7A 2BCCE 4LC1A 2WMMA 1CI6A 2NUKA 3IFMA 2O1JA 1NTKE 1RH5B 2KI7B 1X22A 2QJPB 3TGUJ 2NVFA 1URQA 1EDJA 2KYVA 1PP9D 1NKZB 2B24A 1JMMA 1M56D 2YKOA 1HTLC 2BMRA 4NB8D 2RH0A 1AV1A 4NB9D 1KILA 3A0HE 1CI6B 1JMBA 3CXHI 3P8CE 2IBZI 3TSIA 2NRGA 5CCGC 1NU1J 1JY3N 5BU8B 1YJNP 1IFMA 1JB0J 1S5LE 1URQB 2B89A 2K37A 1A02J 2QE7H 5APSA 3H1HJ 2KOGA 3M0DA 2E4PA 1NAYA 3L36A 3GZYA 2Y9YA 3C8VA 2AXTE 3CMEP 2BEZF 2HPCA 1J2JB 2QVAA 1KILB 5BOKA 1UIIA 3H25A 2R5BA 3VMAA 1RQUA 4NBAD 3SFEC 3H1LJ 4AAYB 1GK6A 2WPQA 1FDIA 1S9KE 2KUBA 3CWBE 2I1KA 4UB8H 1URQD 1S5LX 5DJTB 3EN1A 1VQOP 2C9NY 4GDOA 1T3UA 2M3EA 1LT9A 1EXIA 5APXA 1L0LE 1Q90D 2HPCB 2NVEA 1BGYG 5AEWA 2E75B 4P1BH 2OYIC 1KILD 2GBWA 1YITP 3M06A 1H0TA 1SQPE 4JYCA 3MD0A 2HMJA 3CC4P 1R8EA 3EFFK 2O01N 2YNYA 2XDJA 5APVA 1FJPA 3AE9C 1KD1Q 1S72P 1Q90C 1BSHA 1JEKA 1LT1A 2HMKA 3C0DA 1BGYD 2OTJP 1VF5D 3S4RA 1YHQP 2FBWC 4IFFA 2E75D 2NPSC 4QUPA 3N4XA 1O7HA 1W5CE 1JY2O 3CCUP 2FFDB 1SQXE 2Q5UA 3FX0A 2H43A 1YBKA 3M91A 3MUDC 1BSNA 5BVZA 4AQRD 2WSEH 4HJLA 4GIFA 3CLQA 1AQTA 2HFED 5L8RJ 1GW4A 3KHUA 4KT0J 1NVOA 3ABVC 1KORA 3VMGD 1E79H 2B9BA 2P10A 3V2NA 5CBOA 1XTCC 3JSVC 5AW6B 4CPGA 1PL5A 3GB4A 4NBBD 3VYIA 1ZR2A 3L75E 1LTSC 1DD3A 2N1TC 3VMID 1VL2A 2Y0DA 4C7NA 4EI2A 4I7ZC 2HMNA 4BRYA 2HODB 1USEA 2UWJE 2C0XA 1N7SC 2YFLA 1KB9D 1RY3A 4ASVA 4IL6H 1HGVA 5AVZB 2SPZA 2NZ2A 2A45I 4N78E 1KMIZ 3C9IA 3ZDMA 1D7MA 3H1IJ 3L35A 2WSEJ 4BRYB 2W8ZA 2PP6A 2D2CB 2KZIA 3N7NA 1BGYJ 1DEEG 2PFXA 1GL2B 2Y0CA 4UB6E 3L70G 3U59A 1VQ9P 1PPJG 3GKEA 3AE4C 2R5DA 1FZGA 1FC2C 5AW7B 1WRGA 2E42A 1IFPA 3F5HA 2QPZA 3H1JE 2K88A 1FQTA 1VCKA 3CX5E 1VQ5P 1NU1E 4C7RA 1HBWA 1RF0A 2NWFA 2ZYAA 5B5EE 1GZLA 3P7KA 5KJ7C 2D2CD 1LNQA 1PPJD 1FZFA 1BCCJ 3CCMP 1SFCA 2W27A 1GL2D 3MHVA 2YXQB 1R5LA 4HB1A 1YI2P 5KLIC 2M5AA 4R4LA 2YFJA 2J5UA 1QGKB 1BDDA 2O01H 3F89A 2FXOA 3KZIE 3G4SP 5CHXA 2DE7D 2M0BA 4JF7A 2E76B 2DE6D 5GTIE 1NGMB 5AVTB 4PD4I 4AUWA 3CCVP 4TLFA 2WVRA 1SFCB 5CMZA 3RK3B 2R44A 2M5AB 3HE4A 4L75A 3BCCJ 2R3CA 4M3LA 3O6QA 3VCPA 1IK7A 1S4XA 1QL2A 3EQ2A 3SWFA 5CXMA 1KV4A 3HRNA 4LGDE 3T97A 1JM0A 3PTZA 1SFCD 3WUVA 4PV1C 2KZJA 5TISE 2Q3WA 3RK3D 1PP9E 1L0NJ 4HM5A 1K73Q 3S1KA 3RL0C 4WB4A 1IK9A 3IN6A 2O01J 3VMHD 3TGUG 2J59M 3RK2D 2P7JA 5APYA 5KTBA 2H89C 1O7PA 1VQNP 5GTHE 2OYOA 1SLQA 2YMYA 3KXDA 3T97B 4NBDD 1N73C 2E74D 2KSEA 4EMJB 2KLUA 3RK2C 3TGUD 1YQ3C 1NU1G 5KAFE 5AVQB 2I8DA 2XNDH 3Q5PA 2NUMA 3H1HG 4U7JA 3P32A 3A0BE 3Q1MA 2P67A 2E74C 2MKVA 1ULJA 2C0WA 3HD7A 1OIPA 1SQQJ 3CX5I 1NHLA 2IX7C 2J58A 2PRRA 3MTUE 4EIJA 1S1CX 4H0LB 1M8OB 1GW3A 3H1LG 3V2QA 3FOUA 1IJDB 3H1HD 3BVHA 1JCCA 1X8YA 4BXLA 5CCGA 1G8JB 1KILE 2BASA 2HR3A 4IOIH 1YJ9P 5H2FE 2WSFH 1KQGB 1NKNA 2KK7A 3RBZA 4HM1A 1VQPP 2JWDA 3D71A 2YIUC 3AEFC 3H1LD 2XNXA 1KTMA 3PP5A 2JDIH 2CKFA 1BGYE 3SSUA 1VM9A 1LTGC 4QDFA 1SQBK 4IFMA 2V7QH 4XE5B 5APUA 1NH4A 1P84I 3V4QA 2Z5IA 4H44C 3OJAB 1VQ6P 1G8KB 5AW4B 3HTKB 3HUSC 1AQ5A 1HVVA 5AW9B 5KLVJ 4NBCD 1KYOI 3L74J 3HD7D 1T6AA 3VMXA 2OYHC 2QEXP 1QX8A 2K9YA 1XTGB 2AEMA 4QDFB 1ZLLA 1FAVA 1M1KQ 2OYIA 2KS1B 1SQVK 3JCUH 4DJGA 3PRJA 1NTZK 3VOPA 3HD7C 2OQQA 5CCGD 3L72J 3GMAA 3H32A 4YPCA 2KXPB 2WSFJ 5KKZC 4D6TJ 4JBZA 2RKLA 3BASA 4C46A 3NTNA 4HM7A 2AEFA 1HUCA 1WT6A 2OYIB 4RESB 2NPSA 3A2AA 4WWIA 4QDCA 1RE4C 2V7QJ 2R32A 1KB9E 1LTJC 2FKWB 3AEDC 3H32B 4DZOA 3L71G 2IBZD 3MUDA 4I6MC 5AW8B 3WMM0 1SQBG 2WPVB 1OMIA 4HH2A 1MKMA 2QM8A 3OAKA 1K9MQ 1HWTC 2ZYDA 1OVRA 2NPSB 4U3FD 3B71A 2P1JA 1IFJA 2NVGA 3L71D 2W90A 3H1IG 2Y0EA 1YJWP 3JC22 2WSCJ 2QJPC 1VF5B 3TF5A 4ASWA 3CXHH 1X9VA 2ITAA 1SQBD 1YTZT 4HJGH 2ZT9C 5CCHC 1LGHB 2N1TA 2XKMA 5AW1B 1IZNB 1N7SA 1NTZG 4Y99C 3P8MC 3FWNA 2NPSD 1N2DC 3H1ID 4K35A 1ZRTD 4YXWH 3L70E 1JUNA 2JKVA 3II6A 1PPJE 3L73J 1QL1A 1L0NK 4OH8B 1LT9B 2FYUJ 3MP7B 1GTWA 3I55P 5E79E 5AVUB
chains in the Genus database with same CATH topology
3GTSA 4HJLA 4HM7A 4U3FE 1G8JB 4H0LD 5BOKA 3CXHE 4NBED 2QPZA 3H1JE 4PV1D 2Q3WA 3D89A 1PP9E 4HM5A 3L71E 3TGUE 4NBAD 4QDCA 2HMMA 4HM4A 4QURA 1O7WA 1NTME 2XSHA 4OGQD 3H1KE 1KB9E 4H13D 1FQTA 5KLVE 3CX5E 1SJGA 1VCKA 4HM1A 3VMGD 3L74E 1NU1E 4AAYB 2YFIA 1SQBE 2YIUC 3VMHD 2DE5D 3CWBE 2A06E 2NWFA 4QCKA 4HM3A 2D2CD 2I7FA 2XRXA 2BCCE 3EN1A 2CKFA 4NBGD 4HKVA 1BGYE 1VM9A 1O7PA 4QDFA 1NDOA 3GB4A 5AEUA 4NBBD 1L0LE 2NUKA 3N0QA 1RIEA 1EG9A 2NVEA 5KLIC 1NTKE 3L75E 2YFJA 4H44D 4P1CH 1UUWA 3H1IE 2BMOA 5AEWA 3EQQA 4NBDD 1ZRTE 3VMID 2HMOA 4P1BH 3BCCE 1P84E 1G8KB 2GBWA 2GBXA 2HMNA 2E74D 1SQPE 1SQQE 3L72E 2DE7D 2NVFA 3AZCA 2YVJB 3DQYA 4AIVA 4EMJB 2QJKC 1O7MA 1UUVA 4NBCD 3GZXA 2NVGA 3GTEA 2HMJA 2YFLA 2DE6D 3L73E 2B24A 2QJPC 4NBHD 4D6TE 3H1HE 2FYNC 1EZVE 1RFSA 1KYOE 2QJYC 2FYUE 3GL0A 1Q90C 2BMQA 2BMRA 2B1XA 4NB8D 2NUMA 2ZT9D 1NTZE 2E76D 2HMKA 3C0DA 2XSOA 4QDFB 4PD4E 4NB9D 1WQLA 3GOBA 4HM2A 1VF5D 3VCAA 1ULJA 4HM8A 2JZAA 4HM0A 2ZYLA 1L0NE 1NYKA 3GL2A 2IBZE 4NBFD 2E75D 3H1LE 1JM1A 4QUPA 3VCPA 4QDDA 1O7HA 2JO6A 3GCEA 3L70E 1PPJE 2XR8A 1SQVE 1SQXE 5KKZC 1ULIA 2E4PA 2E4QA 1O7NA 3GZYA 5CXMA 4QUQA 1BE3E 1O7GA 3FOUA 4HM6A 2HMLA 5HL4A 1BCCE 3GKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTS A;  4HJL A;  4HM7 A;  4U3F E;  1G8J B;  4H0L D;  5BOK A;  3CXH E;  4NBE D;  2QPZ A;  3H1J E;  4PV1 D;  2Q3W A;  3D89 A;  1PP9 E;  4HM5 A;  3L71 E;  3TGU E;  4NBA D;  4QDC A;  2HMM A;  4HM4 A;  4QUR A;  1O7W A;  1NTM E;  2XSH A;  4OGQ D;  3H1K E;  1KB9 E;  4H13 D;  1FQT A;  5KLV E;  3CX5 E;  1SJG A;  1VCK A;  4HM1 A;  3VMG D;  3L74 E;  1NU1 E;  4AAY B;  2YFI A;  1SQB E;  2YIU C;  3VMH D;  2DE5 D;  3CWB E;  2A06 E;  2NWF A;  4QCK A;  4HM3 A;  2D2C D;  2I7F A;  2XRX A;  2BCC E;  3EN1 A;  2CKF A;  4NBG D;  4HKV A;  1BGY E;  1VM9 A;  1O7P A;  4QDF A;  1NDO A;  3GB4 A;  5AEU A;  4NBB D;  1L0L E;  2NUK A;  3N0Q A;  1RIE A;  1EG9 A;  2NVE A;  5KLI C;  1NTK E;  3L75 E;  2YFJ A;  4H44 D;  4P1C H;  1UUW A;  3H1I E;  2BMO A;  5AEW A;  3EQQ A;  4NBD D;  1ZRT E;  3VMI D;  2HMO A;  4P1B H;  3BCC E;  1P84 E;  1G8K B;  2GBW A;  2GBX A;  2HMN A;  2E74 D;  1SQP E;  1SQQ E;  3L72 E;  2DE7 D;  2NVF A;  3AZC A;  2YVJ B;  3DQY A;  4AIV A;  4EMJ B;  2QJK C;  1O7M A;  1UUV A;  4NBC D;  3GZX A;  2NVG A;  3GTE A;  2HMJ A;  2YFL A;  2DE6 D;  3L73 E;  2B24 A;  2QJP C;  4NBH D;  4D6T E;  3H1H E;  2FYN C;  1EZV E;  1RFS A;  1KYO E;  2QJY C;  2FYU E;  3GL0 A;  1Q90 C;  2BMQ A;  2BMR A;  2B1X A;  4NB8 D;  2NUM A;  2ZT9 D;  1NTZ E;  2E76 D;  2HMK A;  3C0D A;  2XSO A;  4QDF B;  4PD4 E;  4NB9 D;  1WQL A;  3GOB A;  4HM2 A;  1VF5 D;  3VCA A;  1ULJ A;  4HM8 A;  2JZA A;  4HM0 A;  2ZYL A;  1L0N E;  1NYK A;  3GL2 A;  2IBZ E;  4NBF D;  2E75 D;  3H1L E;  1JM1 A;  4QUP A;  3VCP A;  4QDD A;  1O7H A;  2JO6 A;  3GCE A;  3L70 E;  1PPJ E;  2XR8 A;  1SQV E;  1SQX E;  5KKZ C;  1ULI A;  2E4P A;  2E4Q A;  1O7N A;  3GZY A;  5CXM A;  4QUQ A;  1BE3 E;  1O7G A;  3FOU A;  4HM6 A;  2HML A;  5HL4 A;  1BCC E;  3GKE A; 
#chains in the Genus database with same CATH topology
 2N1T B;  1SQV D;  4RO0 A;  4I7Z B;  1NTZ D;  1M1J C;  2L91 A;  1H0T B;  1BCC G;  2ZJS E;  1N7S B;  1DIP A;  1OW6 A;  4GOD A;  1JY2 N;  3A3Y B;  2M3B A;  4HM3 A;  5BU5 A;  3RGU A;  2KSJ A;  1FOS E;  2K3R A;  2PGD A;  3CCR P;  4I2L C;  1BCC D;  2LR2 A;  4PJ0 E;  2N1T D;  3AE7 C;  1QLE D;  2WZ7 A;  1YQ4 C;  4B86 A;  3U1A A;  2ZYG A;  2YMK A;  1N7S D;  5KJ7 A;  3GLM A;  3BCC G;  1RFS A;  1SQQ K;  2QJY C;  3TYY A;  4U3F J;  1NO4 A;  1KFM A;  3GW6 A;  2XSO A;  3RK3 E;  3CI9 A;  1EZV G;  3L71 J;  3VCA A;  1Q82 Q;  3B5N C;  2JEE A;  3KQG A;  3AE6 C;  1SQB J;  5CJ4 A;  1RF1 C;  3CMA P;  3BCC D;  2Z5H A;  1L0N G;  5AW0 B;  1T2K C;  2H7H A;  1EXJ A;  1J1E C;  2PAJ A;  2L5G B;  1SVF A;  1M90 Q;  5KLI B;  4EOT A;  1EZV D;  3LW5 H;  2V4H A;  4WY4 C;  3M0A A;  4C7N B;  3EFG A;  1QEX A;  1NWQ A;  1FS0 E;  2YKQ A;  3TGU E;  2HMM A;  1M57 D;  1L0N D;  1VQ8 P;  4JQ0 D;  1FZE A;  1SQV J;  3A0H H;  1NTZ J;  5KJ7 D;  1PFI A;  5KLV K;  1BE3 J;  1VQK P;  1L2P A;  4NPF X;  1N7L A;  1AFO A;  1UUW A;  1JY3 P;  1GDT A;  1MV8 A;  3K5B A;  4ZNC A;  1FZC C;  1NTM J;  2OAR A;  2QJK C;  3V2P A;  2AXT H;  3O8Z A;  2A45 H;  2IFN A;  3H1H E;  1SQQ G;  2BCC J;  5AVV B;  1H88 A;  4W80 A;  2G3A A;  3VTP C;  3WU2 E;  1JTH A;  3KDP B;  1N73 A;  4PV1 B;  2QA4 P;  1WQL A;  4HM2 A;  1NTK J;  3RL0 B;  2Q6Q A;  2OGU A;  3CD6 P;  3AE2 C;  3LW5 J;  5APQ A;  1TU3 F;  3H1L E;  3GF7 A;  1OFC X;  1SQQ D;  4NPD A;  3JCU E;  2M8R A;  1SP4 A;  3EWK A;  2KNC A;  3HE5 A;  3CCS P;  5AVX B;  1N73 B;  1ZOY C;  1OVU A;  2IFM A;  2YXR B;  3GG2 A;  4BWN A;  4PD4 D;  4PV1 D;  3I56 P;  3RK2 B;  3RL0 D;  4QUR A;  3AE8 C;  1HF9 A;  1JNM A;  5KAI H;  2LXB A;  5KLV G;  3L74 G;  1W2E A;  3SWK A;  3M9Q A;  2KNC B;  1CSB A;  1KQF B;  2E74 B;  1FOS F;  3TNU A;  1NYH A;  3HE4 B;  3R4Y A;  2JR8 A;  3VMY A;  2W6A A;  3O6Q B;  1J1D C;  1MFT A;  1FU1 A;  3M9B A;  4AIV A;  4PD4 H;  1MZ9 A;  1UUV A;  2ZFC A;  3RBX A;  1H89 A;  3CWB J;  4KHX A;  5KLV D;  3WUU A;  3L74 D;  3L72 G;  2Z4E A;  2DW3 A;  3AEA C;  1L4A C;  2I1J A;  3IF4 A;  4W7Y A;  4W7Z A;  2ZVN B;  4D6T G;  4UB8 E;  1L0L J;  3GOB A;  3HUS A;  2FYU K;  1LJ2 A;  5CBN A;  2WQY C;  1LWU C;  1G2C A;  1ZV8 A;  2H8P D;  3D6Z A;  2QIW A;  1OVV A;  3VP9 A;  2IBZ E;  1R5S A;  1SQP J;  2YIU B;  2OYH A;  1LTI C;  4DCK A;  2JO6 A;  1G1I A;  2XR8 A;  1MFZ A;  3L72 D;  3W67 A;  1O7N A;  4D6T D;  5HL4 A;  4N3Y B;  4H44 B;  2CK3 H;  3SWY A;  4U3F E;  1S3J A;  4LLH A;  3HUS B;  3UIA A;  1G2C B;  3L71 E;  2FY8 A;  2XSH A;  3E1R A;  3RL0 g;  2B87 A;  2AXC A;  2W6B A;  3D70 A;  1SQB E;  1SQX J;  1Y8A A;  1FDO A;  4NBG D;  2WPR A;  2E5T A;  1U57 A;  2KIK A;  1SS1 A;  4K3A A;  1RE4 A;  3HD7 B;  1Q7Y Q;  4H44 D;  3H1I E;  1LTJ A;  1PGQ A;  1ZRT E;  4XFJ A;  2GBX A;  4R4M A;  5KKZ B;  3G6E P;  1VPC A;  4UB6 H;  3GTE A;  3B8E B;  3SFD C;  1OX3 A;  2FYN C;  2O3J A;  2XU6 A;  3GL0 A;  2KLV A;  4O9B A;  2XZR A;  2BMQ A;  4QMA A;  3D6Y A;  1DX7 A;  1UIX A;  1GU5 A;  3L73 G;  1NTZ E;  1VQ7 P;  1RHZ B;  2IYO A;  4ZKU A;  4KJM A;  2P58 A;  2FYU G;  3CX5 H;  3L75 J;  1H8A A;  4HM8 A;  1X0T A;  4NPE A;  1LTJ B;  1YTZ I;  3R2P A;  5B5E H;  2ZXX A;  3MGN A;  1P84 D;  3AEB C;  1ULI A;  1Q2N A;  5CCH A;  2GA1 A;  3L73 D;  2HML A;  4YTP C;  1BCC E;  3KZI H;  1KYO D;  2FYU D;  1IC2 A;  1USD A;  2WSC H;  4H0L C;  2OTK E;  4IL6 E;  3NXS A;  1FE6 A;  3QWO C;  2HLO A;  3AE3 C;  4NBE D;  3GHG C;  1CW5 A;  5GTI H;  2H88 C;  4OGQ C;  2W83 C;  4H13 C;  4I1L A;  2IBZ G;  2IZ1 A;  3OW2 O;  4L76 A;  1PGJ A;  5CJ0 A;  1NTM K;  2ZT9 B;  3H1K G;  1NOH A;  1P84 H;  3C1L A;  3Q5R A;  2VRS A;  3WUT A;  2R3S A;  1ZXG A;  1NDO A;  3PH0 A;  1M1J A;  1LTT C;  2A06 G;  1OW7 A;  1VQ4 P;  4Y99 B;  4U3F G;  1KYO H;  1ZME C;  4EDF A;  3H1J J;  2Q9I A;  1E5W A;  3BCC E;  3CXH D;  1T8Z A;  3G9R A;  4IL6 X;  2OTL P;  3KPE A;  1NTK K;  2YVJ B;  4MN4 C;  2JWA A;  1JY3 O;  2AEJ A;  2C9L Y;  5B66 H;  2HG5 D;  3H1K D;  1RE3 C;  4IFD K;  1EZV E;  1KC8 Q;  5TIS H;  2B1X A;  2RN0 A;  2A06 D;  2ZT9 D;  1OZH A;  5CCH D;  1M1J B;  5DJU B;  3CPW O;  1PGO A;  1OXZ A;  2YO3 A;  1L0N E;  3H6P A;  5AW3 B;  2QM7 A;  1K8A Q;  5GTH H;  1NJI Q;  4WVZ A;  4QUQ A;  3V2R A;  1U7J A;  2YKP A;  3FXD A;  1SQV G;  1AA0 A;  1Y9B A;  3B5N A;  1ZR4 A;  2YO2 A;  2JP3 A;  1RF1 A;  1BE3 G;  3ITK A;  5KAF H;  3PJS K;  1FBM A;  3FXE A;  2QJY B;  1ZW0 A;  3CC2 P;  2WTY A;  1PZQ A;  1URQ C;  3A0B H;  1NTM G;  2FFD A;  4WY4 A;  4HYT B;  1OW8 A;  3Q5S A;  2ZAE B;  3B5N B;  1BE3 D;  4EYY Q;  2BCC G;  1RF1 B;  5AVR B;  5KAI E;  1PP9 J;  1KIL C;  1AJY A;  1L0L K;  2WWW A;  1SQQ E;  1NTK G;  4GT1 A;  3GZX A;  1J1E B;  2IPP A;  1NTM D;  1JCD A;  1NAF A;  3TK1 A;  1HH0 A;  1SQP K;  2BEQ D;  1RQV A;  3AEC C;  5H2F H;  4WY4 B;  1DD4 A;  3BRV B;  3M0D C;  1VQL P;  4PD4 E;  2BCC D;  2CPB A;  1VF5 C;  3CCL P;  1FZC A;  3USS A;  4GOF A;  3H1K J;  3B5N D;  5K5G B;  1NTK D;  2E75 C;  2B88 A;  4QDD A;  3GCE A;  3AE5 C;  2HOD A;  1EC5 A;  3I5C A;  2MJZ A;  1T2K D;  1PGP A;  1K05 A;  3CCJ P;  3V5B A;  1SQX K;  5APW A;  2JJL A;  4WY4 D;  5APT A;  3S9O A;  1LT9 C;  1FZC B;  1KB9 I;  2A45 G;  2QJK B;  3P8C D;  4OVN F;  4L73 A;  2LKM A;  1FDM A;  2WSS H;  5KLV E;  3A5T A;  3L74 E;  2YFI A;  2Q7C A;  1EZV I;  4QCK A;  2FFD C;  1HJB A;  5AVY B;  1GL2 A;  3CWB G;  3Q3D A;  3W68 A;  2KB7 P;  3B4S A;  4JPZ B;  1KQS O;  2Q1K A;  1G1J A;  1L0L G;  2KP8 A;  4RJT A;  2O1K A;  3L72 E;  3FGA D;  3V4W A;  4AYC A;  4XA4 A;  4NBH D;  4D6T E;  1VQM P;  1N8R Q;  4WBA A;  1SQP G;  2WPS A;  1T3J A;  1S9K D;  3CWB D;  1S5L H;  1KB9 H;  5AVS B;  4L74 A;  2JZA A;  1L0L D;  2ZYL A;  1GD2 E;  3GL2 A;  3VN0 A;  3GF3 A;  2ZVO B;  2WIT A;  1L4A A;  1SQP D;  3FWL A;  1FZA A;  1LTA C;  4ZKP A;  4YXD C;  4HM6 A;  3G71 P;  1HJ0 A;  5AVW B;  1SQX G;  1QVG O;  1LP1 A;  2GUV A;  3L70 D;  1LWU A;  1BDC A;  3AE1 C;  3BAT A;  1J1D B;  2POH A;  2E5Y A;  3NMD A;  2Y9Z A;  4HM4 A;  3M9H A;  1LTB C;  1N86 A;  1Q81 Q;  3Q2Y A;  1L4A B;  2FXM A;  4DT0 A;  2D2C C;  1HGZ A;  1JTH B;  1SQX D;  1X79 B;  1NU1 K;  5EFW B;  1GL2 C;  1LP1 B;  3N0Q A;  1LWU B;  1EG9 A;  4P1C H;  1IFD A;  2HMO A;  1P84 E;  1IO4 A;  3L75 G;  3OA7 A;  3L73 E;  5E79 H;  1EDK A;  5C39 A;  2G8Y A;  1KYO E;  3HE5 B;  2FYU E;  1L4A D;  1AVY A;  1FZB A;  2E76 D;  3NFQ A;  4N6J A;  2RMZ A;  5TJH A;  1YYC A;  5B66 E;  1U7M A;  1K04 A;  3TDK A;  4GKG A;  1JY2 P;  1NYK A;  1GU4 A;  3L75 D;  1JO5 A;  4NBF D;  1JM1 A;  3MZW B;  1VDF A;  2E43 A;  1OWA A;  2ZXE B;  1IFI A;  1Q86 Q;  3CL3 D;  2E76 C;  1Z56 A;  1RF0 C;  2QG4 A;  4TT3 H;  4PJ0 H;  3LID A;  3TNU B;  2N9B A;  2Q3E A;  3CXH E;  1KZU B;  5M1B A;  1KQL A;  1SFC C;  4Z1M H;  4N78 D;  4HKZ H;  3CCQ P;  3RK3 C;  3D89 A;  2Q3I A;  2JO1 A;  2WT7 A;  3H1K E;  3L37 A;  2FYN B;  3L70 J;  1MUU A;  3H1J G;  1GK4 A;  2GM4 A;  4ZMD A;  2A06 E;  1CZQ A;  4HKV A;  1IFN A;  3VP8 A;  5AEU A;  3GHG A;  1RIE A;  2QSI A;  2FXP A;  3IR9 A;  5AW2 B;  2BMO A;  1Y47 A;  3EQQ A;  5AW5 B;  3VMZ A;  2OYH B;  1EDL A;  3E7K A;  2WT7 B;  3AZC A;  3DQY A;  2GUS A;  3H1J D;  1O7M A;  4JYB A;  4A7P A;  3L4F A;  3CX5 D;  3U1C A;  4OWF A;  1EDI A;  1NU1 D;  3CC7 P;  3MIW A;  2IYP A;  1JOC A;  2XV5 A;  4Y28 J;  3AEE C;  3GHG B;  1GMJ A;  3E1I A;  1W2B O;  4OGQ B;  3AEG C;  4H13 B;  4HM0 A;  1S2E A;  1AVO A;  3KYQ A;  1ZP0 C;  2B87 B;  2IZ0 A;  2K9J A;  3V6I A;  1A02 F;  2CPS A;  1RE3 A;  1ZN5 A;  3PLN A;  3HTK A;  1KN7 A;  2FYZ A;  1SQV E;  1FJK A;  3CCE P;  1WMK A;  2IDB A;  3IAO A;  1M7L A;  2E4Q A;  1PIX A;  4GOE A;  1BE3 E;  1O7G A;  3G3Z A;  3BRT B;  3LIE A;  2N9Y B;  2LXC B;  2W6J H;  1YIJ P;  3GTS A;  2HYN A;  4H0L D;  3A7O A;  4RKU J;  1QVF O;  3PHL A;  2KS1 A;  3QH9 A;  1PV3 A;  1O7W A;  1NTM E;  4OGQ D;  4DOJ A;  2K9J B;  4H13 D;  1SJG A;  1DEB A;  2K1A A;  1DH3 A;  1PP9 G;  2DE5 D;  2QRX A;  3WU2 H;  2P2U A;  1KFN A;  2I7F A;  2XRX A;  1EQ7 A;  2BCC E;  4LC1 A;  2WMM A;  1CI6 A;  2NUK A;  3IFM A;  2O1J A;  1NTK E;  1RH5 B;  2KI7 B;  1X22 A;  2QJP B;  3TGU J;  2NVF A;  1URQ A;  1EDJ A;  2KYV A;  1PP9 D;  1NKZ B;  2B24 A;  1JMM A;  1M56 D;  2YKO A;  1HTL C;  2BMR A;  4NB8 D;  2RH0 A;  1AV1 A;  4NB9 D;  1KIL A;  3A0H E;  1CI6 B;  1JMB A;  3CXH I;  3P8C E;  2IBZ I;  3TSI A;  2NRG A;  5CCG C;  1NU1 J;  1JY3 N;  5BU8 B;  1YJN P;  1IFM A;  1JB0 J;  1S5L E;  1URQ B;  2B89 A;  2K37 A;  1A02 J;  2QE7 H;  5APS A;  3H1H J;  2KOG A;  3M0D A;  2E4P A;  1NAY A;  3L36 A;  3GZY A;  2Y9Y A;  3C8V A;  2AXT E;  3CME P;  2BEZ F;  2HPC A;  1J2J B;  2QVA A;  1KIL B;  5BOK A;  1UII A;  3H25 A;  2R5B A;  3VMA A;  1RQU A;  4NBA D;  3SFE C;  3H1L J;  4AAY B;  1GK6 A;  2WPQ A;  1FDI A;  1S9K E;  2KUB A;  3CWB E;  2I1K A;  4UB8 H;  1URQ D;  1S5L X;  5DJT B;  3EN1 A;  1VQO P;  2C9N Y;  4GDO A;  1T3U A;  2M3E A;  1LT9 A;  1EXI A;  5APX A;  1L0L E;  1Q90 D;  2HPC B;  2NVE A;  1BGY G;  5AEW A;  2E75 B;  4P1B H;  2OYI C;  1KIL D;  2GBW A;  1YIT P;  3M06 A;  1H0T A;  1SQP E;  4JYC A;  3MD0 A;  2HMJ A;  3CC4 P;  1R8E A;  3EFF K;  2O01 N;  2YNY A;  2XDJ A;  5APV A;  1FJP A;  3AE9 C;  1KD1 Q;  1S72 P;  1Q90 C;  1BSH A;  1JEK A;  1LT1 A;  2HMK A;  3C0D A;  1BGY D;  2OTJ P;  1VF5 D;  3S4R A;  1YHQ P;  2FBW C;  4IFF A;  2E75 D;  2NPS C;  4QUP A;  3N4X A;  1O7H A;  1W5C E;  1JY2 O;  3CCU P;  2FFD B;  1SQX E;  2Q5U A;  3FX0 A;  2H43 A;  1YBK A;  3M91 A;  3MUD C;  1BSN A;  5BVZ A;  4AQR D;  2WSE H;  4HJL A;  4GIF A;  3CLQ A;  1AQT A;  2HFE D;  5L8R J;  1GW4 A;  3KHU A;  4KT0 J;  1NVO A;  3ABV C;  1KOR A;  3VMG D;  1E79 H;  2B9B A;  2P10 A;  3V2N A;  5CBO A;  1XTC C;  3JSV C;  5AW6 B;  4CPG A;  1PL5 A;  3GB4 A;  4NBB D;  3VYI A;  1ZR2 A;  3L75 E;  1LTS C;  1DD3 A;  2N1T C;  3VMI D;  1VL2 A;  2Y0D A;  4C7N A;  4EI2 A;  4I7Z C;  2HMN A;  4BRY A;  2HOD B;  1USE A;  2UWJ E;  2C0X A;  1N7S C;  2YFL A;  1KB9 D;  1RY3 A;  4ASV A;  4IL6 H;  1HGV A;  5AVZ B;  2SPZ A;  2NZ2 A;  2A45 I;  4N78 E;  1KMI Z;  3C9I A;  3ZDM A;  1D7M A;  3H1I J;  3L35 A;  2WSE J;  4BRY B;  2W8Z A;  2PP6 A;  2D2C B;  2KZI A;  3N7N A;  1BGY J;  1DEE G;  2PFX A;  1GL2 B;  2Y0C A;  4UB6 E;  3L70 G;  3U59 A;  1VQ9 P;  1PPJ G;  3GKE A;  3AE4 C;  2R5D A;  1FZG A;  1FC2 C;  5AW7 B;  1WRG A;  2E42 A;  1IFP A;  3F5H A;  2QPZ A;  3H1J E;  2K88 A;  1FQT A;  1VCK A;  3CX5 E;  1VQ5 P;  1NU1 E;  4C7R A;  1HBW A;  1RF0 A;  2NWF A;  2ZYA A;  5B5E E;  1GZL A;  3P7K A;  5KJ7 C;  2D2C D;  1LNQ A;  1PPJ D;  1FZF A;  1BCC J;  3CCM P;  1SFC A;  2W27 A;  1GL2 D;  3MHV A;  2YXQ B;  1R5L A;  4HB1 A;  1YI2 P;  5KLI C;  2M5A A;  4R4L A;  2YFJ A;  2J5U A;  1QGK B;  1BDD A;  2O01 H;  3F89 A;  2FXO A;  3KZI E;  3G4S P;  5CHX A;  2DE7 D;  2M0B A;  4JF7 A;  2E76 B;  2DE6 D;  5GTI E;  1NGM B;  5AVT B;  4PD4 I;  4AUW A;  3CCV P;  4TLF A;  2WVR A;  1SFC B;  5CMZ A;  3RK3 B;  2R44 A;  2M5A B;  3HE4 A;  4L75 A;  3BCC J;  2R3C A;  4M3L A;  3O6Q A;  3VCP A;  1IK7 A;  1S4X A;  1QL2 A;  3EQ2 A;  3SWF A;  5CXM A;  1KV4 A;  3HRN A;  4LGD E;  3T97 A;  1JM0 A;  3PTZ A;  1SFC D;  3WUV A;  4PV1 C;  2KZJ A;  5TIS E;  2Q3W A;  3RK3 D;  1PP9 E;  1L0N J;  4HM5 A;  1K73 Q;  3S1K A;  3RL0 C;  4WB4 A;  1IK9 A;  3IN6 A;  2O01 J;  3VMH D;  3TGU G;  2J59 M;  3RK2 D;  2P7J A;  5APY A;  5KTB A;  2H89 C;  1O7P A;  1VQN P;  5GTH E;  2OYO A;  1SLQ A;  2YMY A;  3KXD A;  3T97 B;  4NBD D;  1N73 C;  2E74 D;  2KSE A;  4EMJ B;  2KLU A;  3RK2 C;  3TGU D;  1YQ3 C;  1NU1 G;  5KAF E;  5AVQ B;  2I8D A;  2XND H;  3Q5P A;  2NUM A;  3H1H G;  4U7J A;  3P32 A;  3A0B E;  3Q1M A;  2P67 A;  2E74 C;  2MKV A;  1ULJ A;  2C0W A;  3HD7 A;  1OIP A;  1SQQ J;  3CX5 I;  1NHL A;  2IX7 C;  2J58 A;  2PRR A;  3MTU E;  4EIJ A;  1S1C X;  4H0L B;  1M8O B;  1GW3 A;  3H1L G;  3V2Q A;  3FOU A;  1IJD B;  3H1H D;  3BVH A;  1JCC A;  1X8Y A;  4BXL A;  5CCG A;  1G8J B;  1KIL E;  2BAS A;  2HR3 A;  4IOI H;  1YJ9 P;  5H2F E;  2WSF H;  1KQG B;  1NKN A;  2KK7 A;  3RBZ A;  4HM1 A;  1VQP P;  2JWD A;  3D71 A;  2YIU C;  3AEF C;  3H1L D;  2XNX A;  1KTM A;  3PP5 A;  2JDI H;  2CKF A;  1BGY E;  3SSU A;  1VM9 A;  1LTG C;  4QDF A;  1SQB K;  4IFM A;  2V7Q H;  4XE5 B;  5APU A;  1NH4 A;  1P84 I;  3V4Q A;  2Z5I A;  4H44 C;  3OJA B;  1VQ6 P;  1G8K B;  5AW4 B;  3HTK B;  3HUS C;  1AQ5 A;  1HVV A;  5AW9 B;  5KLV J;  4NBC D;  1KYO I;  3L74 J;  3HD7 D;  1T6A A;  3VMX A;  2OYH C;  2QEX P;  1QX8 A;  2K9Y A;  1XTG B;  2AEM A;  4QDF B;  1ZLL A;  1FAV A;  1M1K Q;  2OYI A;  2KS1 B;  1SQV K;  3JCU H;  4DJG A;  3PRJ A;  1NTZ K;  3VOP A;  3HD7 C;  2OQQ A;  5CCG D;  3L72 J;  3GMA A;  3H32 A;  4YPC A;  2KXP B;  2WSF J;  5KKZ C;  4D6T J;  4JBZ A;  2RKL A;  3BAS A;  4C46 A;  3NTN A;  4HM7 A;  2AEF A;  1HUC A;  1WT6 A;  2OYI B;  4RES B;  2NPS A;  3A2A A;  4WWI A;  4QDC A;  1RE4 C;  2V7Q J;  2R32 A;  1KB9 E;  1LTJ C;  2FKW B;  3AED C;  3H32 B;  4DZO A;  3L71 G;  2IBZ D;  3MUD A;  4I6M C;  5AW8 B;  3WMM 0;  1SQB G;  2WPV B;  1OMI A;  4HH2 A;  1MKM A;  2QM8 A;  3OAK A;  1K9M Q;  1HWT C;  2ZYD A;  1OVR A;  2NPS B;  4U3F D;  3B71 A;  2P1J A;  1IFJ A;  2NVG A;  3L71 D;  2W90 A;  3H1I G;  2Y0E A;  1YJW P;  3JC2 2;  2WSC J;  2QJP C;  1VF5 B;  3TF5 A;  4ASW A;  3CXH H;  1X9V A;  2ITA A;  1SQB D;  1YTZ T;  4HJG H;  2ZT9 C;  5CCH C;  1LGH B;  2N1T A;  2XKM A;  5AW1 B;  1IZN B;  1N7S A;  1NTZ G;  4Y99 C;  3P8M C;  3FWN A;  2NPS D;  1N2D C;  3H1I D;  4K35 A;  1ZRT D;  4YXW H;  3L70 E;  1JUN A;  2JKV A;  3II6 A;  1PPJ E;  3L73 J;  1QL1 A;  1L0N K;  4OH8 B;  1LT9 B;  2FYU J;  3MP7 B;  1GTW A;  3I55 P;  5E79 E;  5AVU B; 
#chains in the Genus database with same CATH homology
 3GTS A;  4HJL A;  4HM7 A;  4U3F E;  1G8J B;  4H0L D;  5BOK A;  3CXH E;  4NBE D;  2QPZ A;  3H1J E;  4PV1 D;  2Q3W A;  3D89 A;  1PP9 E;  4HM5 A;  3L71 E;  3TGU E;  4NBA D;  4QDC A;  2HMM A;  4HM4 A;  4QUR A;  1O7W A;  1NTM E;  2XSH A;  4OGQ D;  3H1K E;  1KB9 E;  4H13 D;  1FQT A;  5KLV E;  3CX5 E;  1SJG A;  1VCK A;  4HM1 A;  3VMG D;  3L74 E;  1NU1 E;  4AAY B;  2YFI A;  1SQB E;  2YIU C;  3VMH D;  2DE5 D;  3CWB E;  2A06 E;  2NWF A;  4QCK A;  4HM3 A;  2D2C D;  2I7F A;  2XRX A;  2BCC E;  3EN1 A;  2CKF A;  4NBG D;  4HKV A;  1BGY E;  1VM9 A;  1O7P A;  4QDF A;  1NDO A;  3GB4 A;  5AEU A;  4NBB D;  1L0L E;  2NUK A;  3N0Q A;  1RIE A;  1EG9 A;  2NVE A;  5KLI C;  1NTK E;  3L75 E;  2YFJ A;  4H44 D;  4P1C H;  1UUW A;  3H1I E;  2BMO A;  5AEW A;  3EQQ A;  4NBD D;  1ZRT E;  3VMI D;  2HMO A;  4P1B H;  3BCC E;  1P84 E;  1G8K B;  2GBW A;  2GBX A;  2HMN A;  2E74 D;  1SQP E;  1SQQ E;  3L72 E;  2DE7 D;  2NVF A;  3AZC A;  2YVJ B;  3DQY A;  4AIV A;  4EMJ B;  2QJK C;  1O7M A;  1UUV A;  4NBC D;  3GZX A;  2NVG A;  3GTE A;  2HMJ A;  2YFL A;  2DE6 D;  3L73 E;  2B24 A;  2QJP C;  4NBH D;  4D6T E;  3H1H E;  2FYN C;  1EZV E;  1RFS A;  1KYO E;  2QJY C;  2FYU E;  3GL0 A;  1Q90 C;  2BMQ A;  2BMR A;  2B1X A;  4NB8 D;  2NUM A;  2ZT9 D;  1NTZ E;  2E76 D;  2HMK A;  3C0D A;  2XSO A;  4QDF B;  4PD4 E;  4NB9 D;  1WQL A;  3GOB A;  4HM2 A;  1VF5 D;  3VCA A;  1ULJ A;  4HM8 A;  2JZA A;  4HM0 A;  2ZYL A;  1L0N E;  1NYK A;  3GL2 A;  2IBZ E;  4NBF D;  2E75 D;  3H1L E;  1JM1 A;  4QUP A;  3VCP A;  4QDD A;  1O7H A;  2JO6 A;  3GCE A;  3L70 E;  1PPJ E;  2XR8 A;  1SQV E;  1SQX E;  5KKZ C;  1ULI A;  2E4P A;  2E4Q A;  1O7N A;  3GZY A;  5CXM A;  4QUQ A;  1BE3 E;  1O7G A;  3FOU A;  4HM6 A;  2HML A;  5HL4 A;  1BCC E;  3GKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...