3L71E

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 37
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l71E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l71E02
3BCCE 2BMQA 4OGQD 5HL4A 4NBDD 2YFJA 5KLIC 1SQVE 1NYKA 3AZCA 1EZVE 1O7WA 3GL2A 2NVFA 4NBBD 4QCKA 3L75E 3L73E 4H44D 4U3FE 2XSOA 1ZRTE 1UUWA 2HMOA 2XRXA 2QJKC 4NB8D 4H13D 1VM9A 1EG9A 2HMJA 1SQBE 4NBGD 1ULIA 1L0NE 2YFIA 4HM6A 2YVJB 4HM0A 4H0LD 2E75D 2A06E 2B1XA 1O7PA 2QJPC 2GBWA 4P1BH 2BMOA 3GTEA 3L74E 1ULJA 3EN1A 3VMGD 3VMHD 2YIUC 3GTSA 1SQQE 3H1HE 3L71E 1BGYE 4HM1A 2NVEA 1BE3E 1KYOE 1NTME 4NBCD 4PD4E 4P1CH 1O7HA 3L72E 1Q90C 5BOKA 4NB9D 5AEUA 1UUVA 3VMID 2CKFA 3CWBE 4QUQA 2QPZA 2JZAA 1FQTA 3GZXA 4NBAD 4HKVA 4HM8A 2FYNC 4QUPA 1BCCE 1SJGA 4HM3A 4HM4A 4D6TE 1G8JB 5KLVE 3CXHE 3H1IE 2DE7D 2IBZE 1NTZE 4PV1D 3H1LE 3GL0A 1JM1A 2HMMA 3C0DA 2NVGA 4QDFA 3H1JE 4QDCA 2I7FA 2NUMA 3GOBA 2HMKA 2DE6D 2XR8A 1NDOA 2HMLA 2E76D 1SQXE 2NWFA 2FYUE 3L70E 2E4QA 2HMNA 2JO6A 1RIEA 2E74D 2ZYLA 3TGUE 2XSHA 2YFLA 4QURA 2DE5D 3CX5E 1VF5D 3DQYA 5CXMA 1O7MA 3GKEA 2BMRA 4QDFB 2QJYC 3VCAA 3D89A 4EMJB 1PPJE 1SQPE 1RFSA 1PP9E 1KB9E 2GBXA 4HJLA 4QDDA 3VCPA 4AIVA 1L0LE 1O7GA 4NBHD 2NUKA 2B24A 1NTKE 4HM7A 4HM5A 1O7NA 2ZT9D 3GZYA 3GB4A 1VCKA 4AAYB 1NU1E 5AEWA 3FOUA 2Q3WA 5KKZC 3H1KE 4HM2A 2E4PA 3N0QA 2BCCE 1WQLA 3EQQA 4NBED 4NBFD 2D2CD 1P84E 3GCEA 1G8KB
chains in the Genus database with same CATH superfamily
2BCCG 3CPWO 2W27A 1SQPD 5KLVD 3AZCA 3AEDC 1T8ZA 4PV1C 2B87A 3I56P 5AVUB 1U7MA 4HM0A 2YFIA 1SQBG 4IOIH 2YKOA 1N7SD 1AA0A 1O7PA 4AQRD 2WT7B 3AEFC 2H88C 1RE4C 1L4AB 1FZBA 1PPJD 3H1HG 1RF0A 3L73D 1VQ4P 5KTBA 1BE3G 2KLUA 4PD4E 2AEJA 2J58A 1L4AC 4OGQB 3GZXA 3VN0A 1NKNA 1LTTC 4QUPA 3EQ2A 3B5NB 5AW1B 5KAIE 4OGQC 2G8YA 1BGYD 4D6TG 1JM1A 1FJKA 3TNUB 5GTHE 3GF7A 3H1JG 3B5NC 3L72D 1FDMA 1H89A 1SP4A 1USDA 2I1JA 1JCCA 1GL2D 3B8EB 3VMZA 2V7QH 2B89A 2ZXEB 2GBXA 5H2FH 4OWFA 4NBHD 1ZR2A 5AW5B 1WRGA 3GB4A 2FYUK 1KILD 1J1DB 2FKWB 3EWKA 5AW3B 2GUVA 2WMMA 4OH8B 2IBZD 4C7NB 4M3LA 5CCGA 1J1DC 1NTKD 1VF5B 1NVOA 3HE4B 3HE5B 3M0DA 5APUA 2KNCA 2YMKA 1VF5C 4L76A 3HTKB 1FAVA 5AVWB 3Q5RA 2K88A 1ZLLA 1JOCA 2FYNB 3NXSA 1LT1A 2IDBA 1VQ6P 2N1TD 4LLHA 1W5CE 1L0NK 3TDKA 1S4XA 4ASWA 2FYNC 3OA7A 4BRYA 2B87B 1NTZE 2QRXA 1DIPA 3V2PA 5AW4B 4NPEA 1OWAA 1DEEG 3CCEP 1SFCB 5B5EE 2MJZA 1O7MA 2QVAA 4QDFB 2XDJA 3ABVC 4WY4A 3OW2O 1SFCC 3CCMP 1FZCC 2KI7B 2E5TA 1KILA 3P8CD 2NPSC 1AV1A 2P58A 1AVOA 2M5AB 4KJMA 1G2CA 3KXDA 1KTMA 1OZHA 3CXHE 4WVZA 1SQBJ 2W6AA 3WU2H 2Y9YA 2ITAA 1KFMA 4H44D 3MTUE 1N73B 4ZKUA 5AVXB 4H13D 3H1HJ 2YIUB 4U3FG 3I5CA 3KZIE 1DD3A 1BE3J 3RGUA 3SFEC 2RKLA 1N73C 2ZYAA 2A06G 1P84D 3L74E 4N78E 2YIUC 1LP1A 3H32A 3CI9A 2OYHA 2LXBA 3H1LG 1SVFA 1GZLA 4I1LA 3G9RA 3V4WA 1NTMG 1Q90C 3CLQA 4W80A 2HFED 2R44A 2BASA 3H1JJ 3N7NA 1PZQA 3A5TA 1NO4A 2P10A 1G1JA 3IF4A 1G8JB 3H1LE 4JBZA 4PJ0H 3S1KA 5TISH 1S9KE 2WPVB 1N7SB 5GTIE 4PD4D 3G3ZA 3WUVA 1HVVA 3AE8C 3VYIA 4C46A 2KNCB 1EXJA 1SQBD 3L70G 2H43A 1N7SC 2IZ0A 2DW3A 2Y0EA 3GKEA 2Z5HA 1KN7A 3H1HD 1VQPP 3VMXA 2VRSA 5KJ7A 3AEEC 1BE3D 1SQPG 3V2RA 3FXDA 2KZIA 4Y28J 1VCKA 3G71P 3JCUE 2M0BA 2R5BA 3H1KE 1WQLA 1HTLC 2RMZA 3PLNA 1D7MA 3E1IA 1JMBA 4A7PA 1JY2P 1LGHB 1GW4A 3O6QA 1O7WA 3H1JD 3PP5A 4NB8D 3L73G 4BWNA 1GL2B 1ULIA 2Q3IA 1ZR4A 3MGNA 2BMOA 3FWLA 3M91A 2QJKB 3GHGA 3RBXA 1GL2C 3A0BH 1SQVK 1KILB 1USEA 1BGYG 2Q9IA 4JYBA 1JCDA 1S72P 2HYNA 2K37A 3LIEA 3L72G 1KV4A 3L36A 1LT9A 1BCCE 4UB8E 1GMJA 1KD1Q 1JY3P 2DE7D 4JPZB 5AVYB 2ZYDA 2Y0DA 2NUMA 2XR8A 1T3JA 1BDCA 2PFXA 4ZKPA 2WSEJ 2QE7H 1LP1B 3H32B 4ZNCA 1NKZB 3DQYA 4DCKA 3RL0g 3ZDMA 1NTZD 2N1TB 2O01H 4HJLA 3VCPA 4AIVA 4QDDA 3E7KA 3L74J 1PP9G 1HGZA 4EDFA 4NPFX 4HM5A 1NTKG 2YKQA 2KIKA 4AUWA 2C9LY 5H2FE 2N1TC 1RQUA 4EYYQ 3U1CA 4U3FJ 3F89A 1RE4A 1QLED 1FZEA 4QCKA 1L0LK 1Q86Q 2PAJA 5AVVB 2KS1A 3KHUA 3H1LJ 1VQKP 1W2BO 1SLQA 1ZV8A 1QL2A 2GBWA 1EQ7A 1NTMJ 3CX5D 1KZUB 1JUNA 2WSCJ 3CXHD 3PJSK 1R8EA 2C0XA 2IX7C 3L71E 3H1IG 1Y9BA 3B5NA 4RO0A 1YIJP 1MFZA 4K3AA 2WSSH 3TYYA 1Q81Q 2CKFA 3TNUA 1NWQA 2WSEH 2KUBA 4HM8A 3O6QB 3L74D 4H44B 3L70J 2IYPA 3PTZA 4ASVA 1OMIA 4H13B 3H1IE 4HJGH 3H1KJ 2YXRB 2HMMA 5CBOA 3CCLP 2IBZI 1X8YA 2NPSD 4H44C 2AXTE 2FYUE 1EDJA 2E4QA 2JO6A 4H13C 1K8AQ 1SQPJ 2E74D 3TGUE 4YXDC 2DE5D 1JEKA 2QG4A 4L75A 4HH2A 1M1JB 3A3YB 5KLVK 3H1LD 2KSEA 3IR9A 5AVRB 5CCHD 5KKZB 2WWWA 1S9KD 1KC8Q 3USSA 1O7NA 1M1JC 3V4QA 1FS0E 4C7NA 3AEAC 3Q3DA 5KKZC 5CHXA 4HM2A 3EQQA 1FZGA 3GMAA 4IL6H 3Q1MA 3BCCE 1SQQG 1J2JB 3FWNA 1PFIA 2YNYA 3L75E 1BCCJ 2JJLA 2SPZA 3WU2E 1YHQP 1EG9A 1OIPA 3L70D 1L0NE 3E1RA 1S5LX 3VTPC 1URQD 2XNDH 3H1KD 1KFNA 1Q82Q 5AVSB 1SQQE 2CPBA 3W68A 1KB9D 3OJAB 1NGMB 4DJGA 3SWYA 2E43A 5AEUA 1UUVA 2POHA 4HKVA 3D71A 1SFCA 1FOSE 1FZCA 4B86A 1ZP0C 2KS1B 4QDFA 2NPSA 3GOBA 2HMKA 2I1KA 3CMEP 1NDOA 2E76D 1PIXA 2W8ZA 1AFOA 1NH4A 3LW5J 2HMNA 1N86A 4PJ0E 1PP9J 5TISE 2WPSA 2YFLA 2R3CA 1NTKJ 2M5AA 1VQ5P 2WTYA 1BCCD 1QVGO 3D89A 1N7LA 2WSFH 5CBNA 1P84I 1JB0J 2HLOA 3Q5PA 1FOSF 2I8DA 4TT3H 1SQXK 2ZT9D 2ZJSE 3L71J 5AW6B 2Z4EA 1KQFB 3EFFK 1N73A 3HD7D 3FOUA 4I6MC 2A45I 2P2UA 2WITA 5APQA 1S5LE 3NTNA 1XTGB 5KAFE 3R4YA 3SWFA 1L2PA 2YFJA 1ZRTE 3H1IJ 1JM0A 2AEFA 4PD4I 3AEGC 1QX8A 2FYUJ 1QEXA 5CJ4A 5EFWB 2OGUA 1KMIZ 1PP9D 3CCQP 1VQLP 1KYOE 3D6ZA 1Q7YQ 4NB9D 2M8RA 3CWBE 3TK1A 1N7SA 2QPZA 2KLVA 3A0HE 3H25A 1NOHA 1FU1A 4LC1A 1XTCC 3CCSP 2CPSA 1HUCA 3L71D 2QIWA 1GU5A 3TSIA 2C9NY 1CW5A 1NTZG 2NWFA 1RH5B 4YPCA 2CK3H 3L75J 5DJUB 1ZMEC 3VCAA 1L0NJ 3H1ID 1CZQA 1E79H 2MKVA 3QH9A 1SQQJ 3GZYA 3MHVA 2FYUD 3UIAA 1RF1B 4AAYB 5AEWA 4W7YA 2O1JA 4N3YB 1FZCB 4NBED 1GL2A 2JWDA 1VQOP 3H6PA 1RF1C 5HL4A 1NJIQ 2NPSB 3V2NA 1YJ9P 1H8AA 1SQVE 2WPQA 2E74B 2ZVOB 3V2QA 1LNQA 2JEEA 1HJ0A 1UUWA 2XRXA 3VP9A 2HODA 1NU1K 2E74C 4GOFA 1IJDB 4IFMA 2Y9ZA 3GTSA 3L37A 3L74G 4IL6X 4HKZH 2Q7CA 2ZVNB 3HUSC 3L75D 1FJPA 2QSIA 5CCHC 2OYIA 1FDOA 3FX0A 1LTBC 4RKUJ 1SQBK 1L0ND 4CPGA 3VMID 1Y47A 4QUQA 1SQQD 2M3BA 1ZOYC 1VDFA 1URQB 5CJ0A 3T97B 1CI6B 1K9MQ 2ZFCA 2N1TA 1P84H 3IN6A 3A2AA 1LTSC 2ZYLA 1URQC 3ITKA 3CX5I 5APVA 2YO2A 3B4SA 1JY2N 2J59M 3CXHI 2A45H 2XKMA 2XU6A 1L0LE 1O7GA 2E42A 2P1JA 4GT1A 3KPEA 3CCJP 3Q2YA 3AE3C 3N0QA 3CL3D 3H1KG 1PGQA 4PD4H 2E76B 1EDKA 1RQVA 1YQ4C 3I55P 4WWIA 2NZ2A 2W83C 1K04A 2QJPB 4IL6E 3M9QA 1H0TA 2E76C 2JDIH 1QVFO 2YVJB 1OVRA 2QJPC 1KQLA 3C9IA 3P7KA 5B66H 2FYZA 2OARA 2ZT9B 1JY3N 3GF3A 3HD7B 5M1BA 3CD6P 1ZRTD 3P8MC 5APYA 1RY3A 2ZT9C 1NTZJ 3GG2A 3HD7C 1GU4A 1LTGC 1SJGA 2KP8A 4KT0J 2HPCB 4WB4A 5KLVE 1BCCG 2KB7P 1KYOD 3MUDC 3AEBC 1M1JA 1QGKB 2HODB 1R5SA 1VQMP 1N2DC 2LKMA 1LTJB 1U7JA 2BMRA 2KZJA 4EIJA 3BRTB 1PPJE 2OYIB 1RFSA 1HH0A 3NMDA 1EZVG 1LTJC 1EDIA 1KB9I 4EOTA 2OYIC 2Q3WA 1RE3C 3KQGA 3AE4C 5AW7B 3K5BA 3GCEA 4NBDD 1FE6A 3FGAD 1EZVE 4NBBD 4GODA 2HR3A 4HM6A 2E75D 2Q6QA 2GA1A 2N9BA 3W67A 5DJTB 3V5BA 1W2EA 3RBZA 3P32A 4UB6H 3RK2C 4HM1A 3L71G 5B5EH 2ZYGA 2P7JA 4L74A 1KILE 1L0LJ 4R4MA 3JC22 4U7JA 1VPCA 2KYVA 1BSHA 2IBZE 4K35A 1H0TB 1OFCX 1DH3A 2I7FA 1YYCA 1NTMK 2C0WA 3CX5H 1SQXE 3CXHH 3RK3E 1HJBA 2FYUG 3MD0A 3SSUA 2FBWC 2WZ7A 3TGUG 3VMYA 1CSBA 4N78D 1NHLA 2QM8A 3KZIH 4DZOA 5TJHA 1T6AA 2YO3A 1U57A 2AEMA 5KLIB 4YTPC 1QL1A 2W6BA 2YKPA 2OTKE 5APTA 2D2CD 4TLFA 4LGDE 2PRRA 2H7HA 5KLIC 1SQPK 3BCCG 2NVFA 1EXIA 1L0LD 2HMOA 3L75G 1PGPA 4NBGD 4GDOA 1OW8A 4H0LD 2RN0A 1TU3F 4N6JA 5AVQB 1L0NG 1OVVA 3GTEA 2FFDB 5GTIH 1MKMA 2LR2A 2WSCH 4EI2A 1J1EB 2P67A 3O8ZA 1EC5A 2B88A 2FXPA 1KQGB 2FFDC 1VQNP 4P1CH 5AW9B 1IK9A 1J1EC 2Q3EA 1MZ9A 2O3JA 1FDIA 4JYCA 1LWUB 1IFJA 4NPDA 1X0TA 1T2KD 3JCUH 1Z56A 5APXA 3CC2P 1YTZT 2QJYB 1ZW0A 5AVZB 1LWUC 1IFIA 1Y8AA 2N9YB 4JF7A 1IK7A 1NU1G 1RF1A 1BSNA 1YTZI 1KB9H 1M57D 2V7QJ 2QJYC 4KHXA 1VQ9P 1IFPA 1S3JA 4JQ0D 1VQ7P 3MP7B 5CCGD 3CCUP 2B24A 1GDTA 2J5UA 1NU1E 2OTLP 1LTIC 2BCCE 2V4HA 3HUSA 2JWAA 5CCHA 4XA4A 1OVUA 3AE9C 1NTKK 3L35A 1VM9A 1JTHB 1SQBE 4UB8H 5AW8B 1OX3A 2K9YA 1SQXJ 2GM4A 1M56D 3H1HE 3G6EP 2Y0CA 2W6JH 3VOPA 1EZVD 2KXPB 5L8RJ 1BE3E 5B66E 1AJYA 1DEBA 1UIXA 1MFTA 3V6IA 4RESB 1URQA 3T97A 1CI6A 3CWBG 1AVYA 4D6TE 4YXWH 3TGUJ 2OQQA 3GW6A 4WY4D 3C0DA 3H1JE 2E75B 1E5WA 4RJTA 2R32A 3A0BE 2QEXP 3G4SP 3LW5H 2K9JB 2E75C 1Q2NA 2PP6A 2ZAEB 1HF9A 1A02F 1X9VA 1PL5A 2XZRA 1SQXD 1HBWA 3BCCJ 5E79H 3RK3D 1IO4A 2QA4P 4NBFD 3MIWA 3F5HA 1G8KB 3RK2D 3SWKA 1SQVG 3WMM0 5APWA 1KYOI 2M3EA 3HD7A 3FXEA 1DX7A 3TGUD 5APSA 3NFQA 3EN1A 1K73Q 1SQQK 2AXTH 3MUDA 2XNXA 4DOJA 2IPPA 5CMZA 2HPCA 4NBCD 2HG5D 3MZWB 2D2CB 1OW7A 4UB6E 1SS1A 2GUSA 3S9OA 1IFDA 1OXZA 1X22A 4NBAD 3HUSB 3TF5A 2D2CC 3BCCD 1NU1J 4WBAA 1LTJA 1VQ8P 5KJ7D 1IFMA 4QDCA 2BCCJ 1YJNP 1MUUA 4H0LB 2WQYC 1RF0C 2KOGA 4Z1MH 2NRGA 2IFMA 2QM7A 1RE3A 1EDLA 3CX5E 4H0LC 1IFNA 3M06A 2FXOA 3SFDC 1HWTC 2B9BA 3CCVP 2JKVA 3RL0D 1FC2C 4GOEA 3JSVC 4HM7A 1L0LG 3M0AA 2L5GB 4AYCA 2E4PA 1N8RQ 5AW0B 2XV5A 3BVHA 1FZAA 2WVRA 2K1AA 3AE6C 1A02J 4BXLA 1T2KC 4U3FE 3PH0A 2FY8A 4D6TJ 4OVNF 3KDPB 1NU1D 1R5LA 2A06E 3AE1C 2B1XA 4L73A 2BCCD 3IFMA 1ULJA 3VMGD 3L4FA 3CWBJ 2BEQD 2IFNA 1NTME 2FXMA 1OW6A 4QMAA 5AVTB 5CCGC 2JP3A 2JZAA 5KAIH 3U59A 3M0DC 1WMKA 3AE2C 1FBMA 3U1AA 1MV8A 4HM3A 5GTHH 2WPRA 1DD4A 5K5GB 4PV1D 5BU5A 1ZXGA 3CCRP 5KLVG 2DE6D 2HMLA 1S5LH 3QWOC 5KAFH 3L70E 4W7ZA 1NYHA 1G1IA 3BRVB 4BRYB 2XSHA 4QURA 2ZXXA 1JY2O 2OTJP 1YI2P 3Q5SA 1M1KQ 4D6TD 1S2EA 2O01J 2KSJA 1SQPE 1NTZK 1KB9E 3PHLA 1PPJG 1L4AD 3AECC 2R5DA 1SQVJ 2H89C 3CWBD 2G3AA 2K3RA 4WY4B 2KK7A 3N4XA 1KYOH 2BEZF 2Q1KA 4OGQD 2O01N 3BATA 3GL2A 3BASA 2FFDA 3L73E 4WY4C 5BVZA 3B5ND 1G2CB 2QJKC 3A0HH 2HMJA 1KILC 4I2LC 3R2PA 3CMAP 1JY3O 1H88A 1HGVA 3II6A 3VMHD 3CC4P 2IZ1A 4HB1A 1BGYE 3RK3B 5BU8B 4MN4C 1BDDA 1LWUA 1K05A 1M8OB 1O7HA 3L72E 1GK4A 1KQSO 1JMMA 3C8VA 3RK3C 3WUTA 1IZNB 2OYHB 3RK2B 1X79B 1PGOA 2E5YA 3VMAA 4HM4A 1JO5A 3EFGA 1SQVD 2Z5IA 2OYHC 1M7LA 1GK6A 2IBZG 1PGJA 4GKGA 1YQ3C 1RIEA 1SQXG 1NAFA 1VF5D 4C7RA 2R3SA 2YMYA 1GD2E 1PP9E 2WT7A 1FZFA 3LIDA 4I7ZB 2L91A 1YBKA 4DT0A 1L4AA 2YXQB 2NUKA 1EZVI 1NTKE 1NAYA 3S4RA 3C1LA 4I7ZC 1T3UA 1JTHA 1AQTA 3OAKA 5E79E 2BMQA 1NYKA 3AE7C 5KJ7C 2O1KA 2XSOA 1S1CX 3KYQA 3A7OA 4P1BH 3RL0B 1GTWA 1SFCD 1LJ2A 4XE5B 2NVEA 5C39A 5AW2B 4IFFA 4U3FD 1UIIA 3HRNA 2W90A 3RL0C 1IC2A 3GLMA 5BOKA 5KLVJ 4Y99B 2RH0A 4HYTB 1AQ5A 1FQTA 3IAOA 2A06D 3GHGB 4XFJA 3WUUA 1YITP 2K9JA 4Y99C 1JNMA 1VL2A 1ZN5A 3GL0A 1YJWP 2PGDA 3GHGC 1M90Q 2NVGA 1NTMD 3CC7P 2JO1A 3P8CE 4IFDK 4GIFA 1LT9B 3L73J 3HE4A 3HE5A 4R4LA 2WSFJ 1GW3A 5CXMA 1RHZB 3B71A 4EMJB 3M9BA 1LT9C 4O9BA 2IYOA 3PRJA 2JR8A 3HTKA 3D6YA 1WT6A 1Q90D 1KORA 1LTAC 2OYOA 2LXCB 3AE5C 2Q5UA 1BGYJ 2A45G 3D70A 4PV1B 3M9HA 1PV3A 4ZMDA 2H8PD 3VP8A 2UWJE 1P84E 3L72J 2AXCA
chains in the Genus database with same CATH topology
3BCCE 2BMQA 4OGQD 5HL4A 4NBDD 2YFJA 5KLIC 1SQVE 1NYKA 3AZCA 1EZVE 1O7WA 3GL2A 2NVFA 4NBBD 4QCKA 3L75E 3L73E 4H44D 4U3FE 2XSOA 1ZRTE 1UUWA 2HMOA 2XRXA 2QJKC 4NB8D 4H13D 1VM9A 1EG9A 2HMJA 1SQBE 4NBGD 1ULIA 1L0NE 2YFIA 4HM6A 2YVJB 4HM0A 4H0LD 2E75D 2A06E 2B1XA 1O7PA 2QJPC 2GBWA 4P1BH 2BMOA 3GTEA 3L74E 1ULJA 3EN1A 3VMGD 3VMHD 2YIUC 3GTSA 1SQQE 3H1HE 3L71E 1BGYE 4HM1A 2NVEA 1BE3E 1KYOE 1NTME 4NBCD 4PD4E 4P1CH 1O7HA 3L72E 1Q90C 5BOKA 4NB9D 5AEUA 1UUVA 3VMID 2CKFA 3CWBE 4QUQA 2QPZA 2JZAA 1FQTA 3GZXA 4NBAD 4HKVA 4HM8A 2FYNC 4QUPA 1BCCE 1SJGA 4HM3A 4HM4A 4D6TE 1G8JB 5KLVE 3CXHE 3H1IE 2DE7D 2IBZE 1NTZE 4PV1D 3H1LE 3GL0A 1JM1A 2HMMA 3C0DA 2NVGA 4QDFA 3H1JE 4QDCA 2I7FA 2NUMA 3GOBA 2HMKA 2DE6D 2XR8A 1NDOA 2HMLA 2E76D 1SQXE 2NWFA 2FYUE 3L70E 2E4QA 2HMNA 2JO6A 1RIEA 2E74D 2ZYLA 3TGUE 2XSHA 2YFLA 4QURA 2DE5D 3CX5E 1VF5D 3DQYA 5CXMA 1O7MA 3GKEA 2BMRA 4QDFB 2QJYC 3VCAA 3D89A 4EMJB 1PPJE 1SQPE 1RFSA 1PP9E 1KB9E 2GBXA 4HJLA 4QDDA 3VCPA 4AIVA 1L0LE 1O7GA 4NBHD 2NUKA 2B24A 1NTKE 4HM7A 4HM5A 1O7NA 2ZT9D 3GZYA 3GB4A 1VCKA 4AAYB 1NU1E 5AEWA 3FOUA 2Q3WA 5KKZC 3H1KE 4HM2A 2E4PA 3N0QA 2BCCE 1WQLA 3EQQA 4NBED 4NBFD 2D2CD 1P84E 3GCEA 1G8KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC E;  2BMQ A;  4OGQ D;  5HL4 A;  4NBD D;  2YFJ A;  5KLI C;  1SQV E;  1NYK A;  3AZC A;  1EZV E;  1O7W A;  3GL2 A;  2NVF A;  4NBB D;  4QCK A;  3L75 E;  3L73 E;  4H44 D;  4U3F E;  2XSO A;  1ZRT E;  1UUW A;  2HMO A;  2XRX A;  2QJK C;  4NB8 D;  4H13 D;  1VM9 A;  1EG9 A;  2HMJ A;  1SQB E;  4NBG D;  1ULI A;  1L0N E;  2YFI A;  4HM6 A;  2YVJ B;  4HM0 A;  4H0L D;  2E75 D;  2A06 E;  2B1X A;  1O7P A;  2QJP C;  2GBW A;  4P1B H;  2BMO A;  3GTE A;  3L74 E;  1ULJ A;  3EN1 A;  3VMG D;  3VMH D;  2YIU C;  3GTS A;  1SQQ E;  3H1H E;  3L71 E;  1BGY E;  4HM1 A;  2NVE A;  1BE3 E;  1KYO E;  1NTM E;  4NBC D;  4PD4 E;  4P1C H;  1O7H A;  3L72 E;  1Q90 C;  5BOK A;  4NB9 D;  5AEU A;  1UUV A;  3VMI D;  2CKF A;  3CWB E;  4QUQ A;  2QPZ A;  2JZA A;  1FQT A;  3GZX A;  4NBA D;  4HKV A;  4HM8 A;  2FYN C;  4QUP A;  1BCC E;  1SJG A;  4HM3 A;  4HM4 A;  4D6T E;  1G8J B;  5KLV E;  3CXH E;  3H1I E;  2DE7 D;  2IBZ E;  1NTZ E;  4PV1 D;  3H1L E;  3GL0 A;  1JM1 A;  2HMM A;  3C0D A;  2NVG A;  4QDF A;  3H1J E;  4QDC A;  2I7F A;  2NUM A;  3GOB A;  2HMK A;  2DE6 D;  2XR8 A;  1NDO A;  2HML A;  2E76 D;  1SQX E;  2NWF A;  2FYU E;  3L70 E;  2E4Q A;  2HMN A;  2JO6 A;  1RIE A;  2E74 D;  2ZYL A;  3TGU E;  2XSH A;  2YFL A;  4QUR A;  2DE5 D;  3CX5 E;  1VF5 D;  3DQY A;  5CXM A;  1O7M A;  3GKE A;  2BMR A;  4QDF B;  2QJY C;  3VCA A;  3D89 A;  4EMJ B;  1PPJ E;  1SQP E;  1RFS A;  1PP9 E;  1KB9 E;  2GBX A;  4HJL A;  4QDD A;  3VCP A;  4AIV A;  1L0L E;  1O7G A;  4NBH D;  2NUK A;  2B24 A;  1NTK E;  4HM7 A;  4HM5 A;  1O7N A;  2ZT9 D;  3GZY A;  3GB4 A;  1VCK A;  4AAY B;  1NU1 E;  5AEW A;  3FOU A;  2Q3W A;  5KKZ C;  3H1K E;  4HM2 A;  2E4P A;  3N0Q A;  2BCC E;  1WQL A;  3EQQ A;  4NBE D;  4NBF D;  2D2C D;  1P84 E;  3GCE A;  1G8K B; 
#chains in the Genus database with same CATH topology
 2BCC G;  3CPW O;  2W27 A;  1SQP D;  5KLV D;  3AZC A;  3AED C;  1T8Z A;  4PV1 C;  2B87 A;  3I56 P;  5AVU B;  1U7M A;  4HM0 A;  2YFI A;  1SQB G;  4IOI H;  2YKO A;  1N7S D;  1AA0 A;  1O7P A;  4AQR D;  2WT7 B;  3AEF C;  2H88 C;  1RE4 C;  1L4A B;  1FZB A;  1PPJ D;  3H1H G;  1RF0 A;  3L73 D;  1VQ4 P;  5KTB A;  1BE3 G;  2KLU A;  4PD4 E;  2AEJ A;  2J58 A;  1L4A C;  4OGQ B;  3GZX A;  3VN0 A;  1NKN A;  1LTT C;  4QUP A;  3EQ2 A;  3B5N B;  5AW1 B;  5KAI E;  4OGQ C;  2G8Y A;  1BGY D;  4D6T G;  1JM1 A;  1FJK A;  3TNU B;  5GTH E;  3GF7 A;  3H1J G;  3B5N C;  3L72 D;  1FDM A;  1H89 A;  1SP4 A;  1USD A;  2I1J A;  1JCC A;  1GL2 D;  3B8E B;  3VMZ A;  2V7Q H;  2B89 A;  2ZXE B;  2GBX A;  5H2F H;  4OWF A;  4NBH D;  1ZR2 A;  5AW5 B;  1WRG A;  3GB4 A;  2FYU K;  1KIL D;  1J1D B;  2FKW B;  3EWK A;  5AW3 B;  2GUV A;  2WMM A;  4OH8 B;  2IBZ D;  4C7N B;  4M3L A;  5CCG A;  1J1D C;  1NTK D;  1VF5 B;  1NVO A;  3HE4 B;  3HE5 B;  3M0D A;  5APU A;  2KNC A;  2YMK A;  1VF5 C;  4L76 A;  3HTK B;  1FAV A;  5AVW B;  3Q5R A;  2K88 A;  1ZLL A;  1JOC A;  2FYN B;  3NXS A;  1LT1 A;  2IDB A;  1VQ6 P;  2N1T D;  4LLH A;  1W5C E;  1L0N K;  3TDK A;  1S4X A;  4ASW A;  2FYN C;  3OA7 A;  4BRY A;  2B87 B;  1NTZ E;  2QRX A;  1DIP A;  3V2P A;  5AW4 B;  4NPE A;  1OWA A;  1DEE G;  3CCE P;  1SFC B;  5B5E E;  2MJZ A;  1O7M A;  2QVA A;  4QDF B;  2XDJ A;  3ABV C;  4WY4 A;  3OW2 O;  1SFC C;  3CCM P;  1FZC C;  2KI7 B;  2E5T A;  1KIL A;  3P8C D;  2NPS C;  1AV1 A;  2P58 A;  1AVO A;  2M5A B;  4KJM A;  1G2C A;  3KXD A;  1KTM A;  1OZH A;  3CXH E;  4WVZ A;  1SQB J;  2W6A A;  3WU2 H;  2Y9Y A;  2ITA A;  1KFM A;  4H44 D;  3MTU E;  1N73 B;  4ZKU A;  5AVX B;  4H13 D;  3H1H J;  2YIU B;  4U3F G;  3I5C A;  3KZI E;  1DD3 A;  1BE3 J;  3RGU A;  3SFE C;  2RKL A;  1N73 C;  2ZYA A;  2A06 G;  1P84 D;  3L74 E;  4N78 E;  2YIU C;  1LP1 A;  3H32 A;  3CI9 A;  2OYH A;  2LXB A;  3H1L G;  1SVF A;  1GZL A;  4I1L A;  3G9R A;  3V4W A;  1NTM G;  1Q90 C;  3CLQ A;  4W80 A;  2HFE D;  2R44 A;  2BAS A;  3H1J J;  3N7N A;  1PZQ A;  3A5T A;  1NO4 A;  2P10 A;  1G1J A;  3IF4 A;  1G8J B;  3H1L E;  4JBZ A;  4PJ0 H;  3S1K A;  5TIS H;  1S9K E;  2WPV B;  1N7S B;  5GTI E;  4PD4 D;  3G3Z A;  3WUV A;  1HVV A;  3AE8 C;  3VYI A;  4C46 A;  2KNC B;  1EXJ A;  1SQB D;  3L70 G;  2H43 A;  1N7S C;  2IZ0 A;  2DW3 A;  2Y0E A;  3GKE A;  2Z5H A;  1KN7 A;  3H1H D;  1VQP P;  3VMX A;  2VRS A;  5KJ7 A;  3AEE C;  1BE3 D;  1SQP G;  3V2R A;  3FXD A;  2KZI A;  4Y28 J;  1VCK A;  3G71 P;  3JCU E;  2M0B A;  2R5B A;  3H1K E;  1WQL A;  1HTL C;  2RMZ A;  3PLN A;  1D7M A;  3E1I A;  1JMB A;  4A7P A;  1JY2 P;  1LGH B;  1GW4 A;  3O6Q A;  1O7W A;  3H1J D;  3PP5 A;  4NB8 D;  3L73 G;  4BWN A;  1GL2 B;  1ULI A;  2Q3I A;  1ZR4 A;  3MGN A;  2BMO A;  3FWL A;  3M91 A;  2QJK B;  3GHG A;  3RBX A;  1GL2 C;  3A0B H;  1SQV K;  1KIL B;  1USE A;  1BGY G;  2Q9I A;  4JYB A;  1JCD A;  1S72 P;  2HYN A;  2K37 A;  3LIE A;  3L72 G;  1KV4 A;  3L36 A;  1LT9 A;  1BCC E;  4UB8 E;  1GMJ A;  1KD1 Q;  1JY3 P;  2DE7 D;  4JPZ B;  5AVY B;  2ZYD A;  2Y0D A;  2NUM A;  2XR8 A;  1T3J A;  1BDC A;  2PFX A;  4ZKP A;  2WSE J;  2QE7 H;  1LP1 B;  3H32 B;  4ZNC A;  1NKZ B;  3DQY A;  4DCK A;  3RL0 g;  3ZDM A;  1NTZ D;  2N1T B;  2O01 H;  4HJL A;  3VCP A;  4AIV A;  4QDD A;  3E7K A;  3L74 J;  1PP9 G;  1HGZ A;  4EDF A;  4NPF X;  4HM5 A;  1NTK G;  2YKQ A;  2KIK A;  4AUW A;  2C9L Y;  5H2F E;  2N1T C;  1RQU A;  4EYY Q;  3U1C A;  4U3F J;  3F89 A;  1RE4 A;  1QLE D;  1FZE A;  4QCK A;  1L0L K;  1Q86 Q;  2PAJ A;  5AVV B;  2KS1 A;  3KHU A;  3H1L J;  1VQK P;  1W2B O;  1SLQ A;  1ZV8 A;  1QL2 A;  2GBW A;  1EQ7 A;  1NTM J;  3CX5 D;  1KZU B;  1JUN A;  2WSC J;  3CXH D;  3PJS K;  1R8E A;  2C0X A;  2IX7 C;  3L71 E;  3H1I G;  1Y9B A;  3B5N A;  4RO0 A;  1YIJ P;  1MFZ A;  4K3A A;  2WSS H;  3TYY A;  1Q81 Q;  2CKF A;  3TNU A;  1NWQ A;  2WSE H;  2KUB A;  4HM8 A;  3O6Q B;  3L74 D;  4H44 B;  3L70 J;  2IYP A;  3PTZ A;  4ASV A;  1OMI A;  4H13 B;  3H1I E;  4HJG H;  3H1K J;  2YXR B;  2HMM A;  5CBO A;  3CCL P;  2IBZ I;  1X8Y A;  2NPS D;  4H44 C;  2AXT E;  2FYU E;  1EDJ A;  2E4Q A;  2JO6 A;  4H13 C;  1K8A Q;  1SQP J;  2E74 D;  3TGU E;  4YXD C;  2DE5 D;  1JEK A;  2QG4 A;  4L75 A;  4HH2 A;  1M1J B;  3A3Y B;  5KLV K;  3H1L D;  2KSE A;  3IR9 A;  5AVR B;  5CCH D;  5KKZ B;  2WWW A;  1S9K D;  1KC8 Q;  3USS A;  1O7N A;  1M1J C;  3V4Q A;  1FS0 E;  4C7N A;  3AEA C;  3Q3D A;  5KKZ C;  5CHX A;  4HM2 A;  3EQQ A;  1FZG A;  3GMA A;  4IL6 H;  3Q1M A;  3BCC E;  1SQQ G;  1J2J B;  3FWN A;  1PFI A;  2YNY A;  3L75 E;  1BCC J;  2JJL A;  2SPZ A;  3WU2 E;  1YHQ P;  1EG9 A;  1OIP A;  3L70 D;  1L0N E;  3E1R A;  1S5L X;  3VTP C;  1URQ D;  2XND H;  3H1K D;  1KFN A;  1Q82 Q;  5AVS B;  1SQQ E;  2CPB A;  3W68 A;  1KB9 D;  3OJA B;  1NGM B;  4DJG A;  3SWY A;  2E43 A;  5AEU A;  1UUV A;  2POH A;  4HKV A;  3D71 A;  1SFC A;  1FOS E;  1FZC A;  4B86 A;  1ZP0 C;  2KS1 B;  4QDF A;  2NPS A;  3GOB A;  2HMK A;  2I1K A;  3CME P;  1NDO A;  2E76 D;  1PIX A;  2W8Z A;  1AFO A;  1NH4 A;  3LW5 J;  2HMN A;  1N86 A;  4PJ0 E;  1PP9 J;  5TIS E;  2WPS A;  2YFL A;  2R3C A;  1NTK J;  2M5A A;  1VQ5 P;  2WTY A;  1BCC D;  1QVG O;  3D89 A;  1N7L A;  2WSF H;  5CBN A;  1P84 I;  1JB0 J;  2HLO A;  3Q5P A;  1FOS F;  2I8D A;  4TT3 H;  1SQX K;  2ZT9 D;  2ZJS E;  3L71 J;  5AW6 B;  2Z4E A;  1KQF B;  3EFF K;  1N73 A;  3HD7 D;  3FOU A;  4I6M C;  2A45 I;  2P2U A;  2WIT A;  5APQ A;  1S5L E;  3NTN A;  1XTG B;  5KAF E;  3R4Y A;  3SWF A;  1L2P A;  2YFJ A;  1ZRT E;  3H1I J;  1JM0 A;  2AEF A;  4PD4 I;  3AEG C;  1QX8 A;  2FYU J;  1QEX A;  5CJ4 A;  5EFW B;  2OGU A;  1KMI Z;  1PP9 D;  3CCQ P;  1VQL P;  1KYO E;  3D6Z A;  1Q7Y Q;  4NB9 D;  2M8R A;  3CWB E;  3TK1 A;  1N7S A;  2QPZ A;  2KLV A;  3A0H E;  3H25 A;  1NOH A;  1FU1 A;  4LC1 A;  1XTC C;  3CCS P;  2CPS A;  1HUC A;  3L71 D;  2QIW A;  1GU5 A;  3TSI A;  2C9N Y;  1CW5 A;  1NTZ G;  2NWF A;  1RH5 B;  4YPC A;  2CK3 H;  3L75 J;  5DJU B;  1ZME C;  3VCA A;  1L0N J;  3H1I D;  1CZQ A;  1E79 H;  2MKV A;  3QH9 A;  1SQQ J;  3GZY A;  3MHV A;  2FYU D;  3UIA A;  1RF1 B;  4AAY B;  5AEW A;  4W7Y A;  2O1J A;  4N3Y B;  1FZC B;  4NBE D;  1GL2 A;  2JWD A;  1VQO P;  3H6P A;  1RF1 C;  5HL4 A;  1NJI Q;  2NPS B;  3V2N A;  1YJ9 P;  1H8A A;  1SQV E;  2WPQ A;  2E74 B;  2ZVO B;  3V2Q A;  1LNQ A;  2JEE A;  1HJ0 A;  1UUW A;  2XRX A;  3VP9 A;  2HOD A;  1NU1 K;  2E74 C;  4GOF A;  1IJD B;  4IFM A;  2Y9Z A;  3GTS A;  3L37 A;  3L74 G;  4IL6 X;  4HKZ H;  2Q7C A;  2ZVN B;  3HUS C;  3L75 D;  1FJP A;  2QSI A;  5CCH C;  2OYI A;  1FDO A;  3FX0 A;  1LTB C;  4RKU J;  1SQB K;  1L0N D;  4CPG A;  3VMI D;  1Y47 A;  4QUQ A;  1SQQ D;  2M3B A;  1ZOY C;  1VDF A;  1URQ B;  5CJ0 A;  3T97 B;  1CI6 B;  1K9M Q;  2ZFC A;  2N1T A;  1P84 H;  3IN6 A;  3A2A A;  1LTS C;  2ZYL A;  1URQ C;  3ITK A;  3CX5 I;  5APV A;  2YO2 A;  3B4S A;  1JY2 N;  2J59 M;  3CXH I;  2A45 H;  2XKM A;  2XU6 A;  1L0L E;  1O7G A;  2E42 A;  2P1J A;  4GT1 A;  3KPE A;  3CCJ P;  3Q2Y A;  3AE3 C;  3N0Q A;  3CL3 D;  3H1K G;  1PGQ A;  4PD4 H;  2E76 B;  1EDK A;  1RQV A;  1YQ4 C;  3I55 P;  4WWI A;  2NZ2 A;  2W83 C;  1K04 A;  2QJP B;  4IL6 E;  3M9Q A;  1H0T A;  2E76 C;  2JDI H;  1QVF O;  2YVJ B;  1OVR A;  2QJP C;  1KQL A;  3C9I A;  3P7K A;  5B66 H;  2FYZ A;  2OAR A;  2ZT9 B;  1JY3 N;  3GF3 A;  3HD7 B;  5M1B A;  3CD6 P;  1ZRT D;  3P8M C;  5APY A;  1RY3 A;  2ZT9 C;  1NTZ J;  3GG2 A;  3HD7 C;  1GU4 A;  1LTG C;  1SJG A;  2KP8 A;  4KT0 J;  2HPC B;  4WB4 A;  5KLV E;  1BCC G;  2KB7 P;  1KYO D;  3MUD C;  3AEB C;  1M1J A;  1QGK B;  2HOD B;  1R5S A;  1VQM P;  1N2D C;  2LKM A;  1LTJ B;  1U7J A;  2BMR A;  2KZJ A;  4EIJ A;  3BRT B;  1PPJ E;  2OYI B;  1RFS A;  1HH0 A;  3NMD A;  1EZV G;  1LTJ C;  1EDI A;  1KB9 I;  4EOT A;  2OYI C;  2Q3W A;  1RE3 C;  3KQG A;  3AE4 C;  5AW7 B;  3K5B A;  3GCE A;  4NBD D;  1FE6 A;  3FGA D;  1EZV E;  4NBB D;  4GOD A;  2HR3 A;  4HM6 A;  2E75 D;  2Q6Q A;  2GA1 A;  2N9B A;  3W67 A;  5DJT B;  3V5B A;  1W2E A;  3RBZ A;  3P32 A;  4UB6 H;  3RK2 C;  4HM1 A;  3L71 G;  5B5E H;  2ZYG A;  2P7J A;  4L74 A;  1KIL E;  1L0L J;  4R4M A;  3JC2 2;  4U7J A;  1VPC A;  2KYV A;  1BSH A;  2IBZ E;  4K35 A;  1H0T B;  1OFC X;  1DH3 A;  2I7F A;  1YYC A;  1NTM K;  2C0W A;  3CX5 H;  1SQX E;  3CXH H;  3RK3 E;  1HJB A;  2FYU G;  3MD0 A;  3SSU A;  2FBW C;  2WZ7 A;  3TGU G;  3VMY A;  1CSB A;  4N78 D;  1NHL A;  2QM8 A;  3KZI H;  4DZO A;  5TJH A;  1T6A A;  2YO3 A;  1U57 A;  2AEM A;  5KLI B;  4YTP C;  1QL1 A;  2W6B A;  2YKP A;  2OTK E;  5APT A;  2D2C D;  4TLF A;  4LGD E;  2PRR A;  2H7H A;  5KLI C;  1SQP K;  3BCC G;  2NVF A;  1EXI A;  1L0L D;  2HMO A;  3L75 G;  1PGP A;  4NBG D;  4GDO A;  1OW8 A;  4H0L D;  2RN0 A;  1TU3 F;  4N6J A;  5AVQ B;  1L0N G;  1OVV A;  3GTE A;  2FFD B;  5GTI H;  1MKM A;  2LR2 A;  2WSC H;  4EI2 A;  1J1E B;  2P67 A;  3O8Z A;  1EC5 A;  2B88 A;  2FXP A;  1KQG B;  2FFD C;  1VQN P;  4P1C H;  5AW9 B;  1IK9 A;  1J1E C;  2Q3E A;  1MZ9 A;  2O3J A;  1FDI A;  4JYC A;  1LWU B;  1IFJ A;  4NPD A;  1X0T A;  1T2K D;  3JCU H;  1Z56 A;  5APX A;  3CC2 P;  1YTZ T;  2QJY B;  1ZW0 A;  5AVZ B;  1LWU C;  1IFI A;  1Y8A A;  2N9Y B;  4JF7 A;  1IK7 A;  1NU1 G;  1RF1 A;  1BSN A;  1YTZ I;  1KB9 H;  1M57 D;  2V7Q J;  2QJY C;  4KHX A;  1VQ9 P;  1IFP A;  1S3J A;  4JQ0 D;  1VQ7 P;  3MP7 B;  5CCG D;  3CCU P;  2B24 A;  1GDT A;  2J5U A;  1NU1 E;  2OTL P;  1LTI C;  2BCC E;  2V4H A;  3HUS A;  2JWA A;  5CCH A;  4XA4 A;  1OVU A;  3AE9 C;  1NTK K;  3L35 A;  1VM9 A;  1JTH B;  1SQB E;  4UB8 H;  5AW8 B;  1OX3 A;  2K9Y A;  1SQX J;  2GM4 A;  1M56 D;  3H1H E;  3G6E P;  2Y0C A;  2W6J H;  3VOP A;  1EZV D;  2KXP B;  5L8R J;  1BE3 E;  5B66 E;  1AJY A;  1DEB A;  1UIX A;  1MFT A;  3V6I A;  4RES B;  1URQ A;  3T97 A;  1CI6 A;  3CWB G;  1AVY A;  4D6T E;  4YXW H;  3TGU J;  2OQQ A;  3GW6 A;  4WY4 D;  3C0D A;  3H1J E;  2E75 B;  1E5W A;  4RJT A;  2R32 A;  3A0B E;  2QEX P;  3G4S P;  3LW5 H;  2K9J B;  2E75 C;  1Q2N A;  2PP6 A;  2ZAE B;  1HF9 A;  1A02 F;  1X9V A;  1PL5 A;  2XZR A;  1SQX D;  1HBW A;  3BCC J;  5E79 H;  3RK3 D;  1IO4 A;  2QA4 P;  4NBF D;  3MIW A;  3F5H A;  1G8K B;  3RK2 D;  3SWK A;  1SQV G;  3WMM 0;  5APW A;  1KYO I;  2M3E A;  3HD7 A;  3FXE A;  1DX7 A;  3TGU D;  5APS A;  3NFQ A;  3EN1 A;  1K73 Q;  1SQQ K;  2AXT H;  3MUD A;  2XNX A;  4DOJ A;  2IPP A;  5CMZ A;  2HPC A;  4NBC D;  2HG5 D;  3MZW B;  2D2C B;  1OW7 A;  4UB6 E;  1SS1 A;  2GUS A;  3S9O A;  1IFD A;  1OXZ A;  1X22 A;  4NBA D;  3HUS B;  3TF5 A;  2D2C C;  3BCC D;  1NU1 J;  4WBA A;  1LTJ A;  1VQ8 P;  5KJ7 D;  1IFM A;  4QDC A;  2BCC J;  1YJN P;  1MUU A;  4H0L B;  2WQY C;  1RF0 C;  2KOG A;  4Z1M H;  2NRG A;  2IFM A;  2QM7 A;  1RE3 A;  1EDL A;  3CX5 E;  4H0L C;  1IFN A;  3M06 A;  2FXO A;  3SFD C;  1HWT C;  2B9B A;  3CCV P;  2JKV A;  3RL0 D;  1FC2 C;  4GOE A;  3JSV C;  4HM7 A;  1L0L G;  3M0A A;  2L5G B;  4AYC A;  2E4P A;  1N8R Q;  5AW0 B;  2XV5 A;  3BVH A;  1FZA A;  2WVR A;  2K1A A;  3AE6 C;  1A02 J;  4BXL A;  1T2K C;  4U3F E;  3PH0 A;  2FY8 A;  4D6T J;  4OVN F;  3KDP B;  1NU1 D;  1R5L A;  2A06 E;  3AE1 C;  2B1X A;  4L73 A;  2BCC D;  3IFM A;  1ULJ A;  3VMG D;  3L4F A;  3CWB J;  2BEQ D;  2IFN A;  1NTM E;  2FXM A;  1OW6 A;  4QMA A;  5AVT B;  5CCG C;  2JP3 A;  2JZA A;  5KAI H;  3U59 A;  3M0D C;  1WMK A;  3AE2 C;  1FBM A;  3U1A A;  1MV8 A;  4HM3 A;  5GTH H;  2WPR A;  1DD4 A;  5K5G B;  4PV1 D;  5BU5 A;  1ZXG A;  3CCR P;  5KLV G;  2DE6 D;  2HML A;  1S5L H;  3QWO C;  5KAF H;  3L70 E;  4W7Z A;  1NYH A;  1G1I A;  3BRV B;  4BRY B;  2XSH A;  4QUR A;  2ZXX A;  1JY2 O;  2OTJ P;  1YI2 P;  3Q5S A;  1M1K Q;  4D6T D;  1S2E A;  2O01 J;  2KSJ A;  1SQP E;  1NTZ K;  1KB9 E;  3PHL A;  1PPJ G;  1L4A D;  3AEC C;  2R5D A;  1SQV J;  2H89 C;  3CWB D;  2G3A A;  2K3R A;  4WY4 B;  2KK7 A;  3N4X A;  1KYO H;  2BEZ F;  2Q1K A;  4OGQ D;  2O01 N;  3BAT A;  3GL2 A;  3BAS A;  2FFD A;  3L73 E;  4WY4 C;  5BVZ A;  3B5N D;  1G2C B;  2QJK C;  3A0H H;  2HMJ A;  1KIL C;  4I2L C;  3R2P A;  3CMA P;  1JY3 O;  1H88 A;  1HGV A;  3II6 A;  3VMH D;  3CC4 P;  2IZ1 A;  4HB1 A;  1BGY E;  3RK3 B;  5BU8 B;  4MN4 C;  1BDD A;  1LWU A;  1K05 A;  1M8O B;  1O7H A;  3L72 E;  1GK4 A;  1KQS O;  1JMM A;  3C8V A;  3RK3 C;  3WUT A;  1IZN B;  2OYH B;  3RK2 B;  1X79 B;  1PGO A;  2E5Y A;  3VMA A;  4HM4 A;  1JO5 A;  3EFG A;  1SQV D;  2Z5I A;  2OYH C;  1M7L A;  1GK6 A;  2IBZ G;  1PGJ A;  4GKG A;  1YQ3 C;  1RIE A;  1SQX G;  1NAF A;  1VF5 D;  4C7R A;  2R3S A;  2YMY A;  1GD2 E;  1PP9 E;  2WT7 A;  1FZF A;  3LID A;  4I7Z B;  2L91 A;  1YBK A;  4DT0 A;  1L4A A;  2YXQ B;  2NUK A;  1EZV I;  1NTK E;  1NAY A;  3S4R A;  3C1L A;  4I7Z C;  1T3U A;  1JTH A;  1AQT A;  3OAK A;  5E79 E;  2BMQ A;  1NYK A;  3AE7 C;  5KJ7 C;  2O1K A;  2XSO A;  1S1C X;  3KYQ A;  3A7O A;  4P1B H;  3RL0 B;  1GTW A;  1SFC D;  1LJ2 A;  4XE5 B;  2NVE A;  5C39 A;  5AW2 B;  4IFF A;  4U3F D;  1UII A;  3HRN A;  2W90 A;  3RL0 C;  1IC2 A;  3GLM A;  5BOK A;  5KLV J;  4Y99 B;  2RH0 A;  4HYT B;  1AQ5 A;  1FQT A;  3IAO A;  2A06 D;  3GHG B;  4XFJ A;  3WUU A;  1YIT P;  2K9J A;  4Y99 C;  1JNM A;  1VL2 A;  1ZN5 A;  3GL0 A;  1YJW P;  2PGD A;  3GHG C;  1M90 Q;  2NVG A;  1NTM D;  3CC7 P;  2JO1 A;  3P8C E;  4IFD K;  4GIF A;  1LT9 B;  3L73 J;  3HE4 A;  3HE5 A;  4R4L A;  2WSF J;  1GW3 A;  5CXM A;  1RHZ B;  3B71 A;  4EMJ B;  3M9B A;  1LT9 C;  4O9B A;  2IYO A;  3PRJ A;  2JR8 A;  3HTK A;  3D6Y A;  1WT6 A;  1Q90 D;  1KOR A;  1LTA C;  2OYO A;  2LXC B;  3AE5 C;  2Q5U A;  1BGY J;  2A45 G;  3D70 A;  4PV1 B;  3M9H A;  1PV3 A;  4ZMD A;  2H8P D;  3VP8 A;  2UWJ E;  1P84 E;  3L72 J;  2AXC A; 
#chains in the Genus database with same CATH homology
 3BCC E;  2BMQ A;  4OGQ D;  5HL4 A;  4NBD D;  2YFJ A;  5KLI C;  1SQV E;  1NYK A;  3AZC A;  1EZV E;  1O7W A;  3GL2 A;  2NVF A;  4NBB D;  4QCK A;  3L75 E;  3L73 E;  4H44 D;  4U3F E;  2XSO A;  1ZRT E;  1UUW A;  2HMO A;  2XRX A;  2QJK C;  4NB8 D;  4H13 D;  1VM9 A;  1EG9 A;  2HMJ A;  1SQB E;  4NBG D;  1ULI A;  1L0N E;  2YFI A;  4HM6 A;  2YVJ B;  4HM0 A;  4H0L D;  2E75 D;  2A06 E;  2B1X A;  1O7P A;  2QJP C;  2GBW A;  4P1B H;  2BMO A;  3GTE A;  3L74 E;  1ULJ A;  3EN1 A;  3VMG D;  3VMH D;  2YIU C;  3GTS A;  1SQQ E;  3H1H E;  3L71 E;  1BGY E;  4HM1 A;  2NVE A;  1BE3 E;  1KYO E;  1NTM E;  4NBC D;  4PD4 E;  4P1C H;  1O7H A;  3L72 E;  1Q90 C;  5BOK A;  4NB9 D;  5AEU A;  1UUV A;  3VMI D;  2CKF A;  3CWB E;  4QUQ A;  2QPZ A;  2JZA A;  1FQT A;  3GZX A;  4NBA D;  4HKV A;  4HM8 A;  2FYN C;  4QUP A;  1BCC E;  1SJG A;  4HM3 A;  4HM4 A;  4D6T E;  1G8J B;  5KLV E;  3CXH E;  3H1I E;  2DE7 D;  2IBZ E;  1NTZ E;  4PV1 D;  3H1L E;  3GL0 A;  1JM1 A;  2HMM A;  3C0D A;  2NVG A;  4QDF A;  3H1J E;  4QDC A;  2I7F A;  2NUM A;  3GOB A;  2HMK A;  2DE6 D;  2XR8 A;  1NDO A;  2HML A;  2E76 D;  1SQX E;  2NWF A;  2FYU E;  3L70 E;  2E4Q A;  2HMN A;  2JO6 A;  1RIE A;  2E74 D;  2ZYL A;  3TGU E;  2XSH A;  2YFL A;  4QUR A;  2DE5 D;  3CX5 E;  1VF5 D;  3DQY A;  5CXM A;  1O7M A;  3GKE A;  2BMR A;  4QDF B;  2QJY C;  3VCA A;  3D89 A;  4EMJ B;  1PPJ E;  1SQP E;  1RFS A;  1PP9 E;  1KB9 E;  2GBX A;  4HJL A;  4QDD A;  3VCP A;  4AIV A;  1L0L E;  1O7G A;  4NBH D;  2NUK A;  2B24 A;  1NTK E;  4HM7 A;  4HM5 A;  1O7N A;  2ZT9 D;  3GZY A;  3GB4 A;  1VCK A;  4AAY B;  1NU1 E;  5AEW A;  3FOU A;  2Q3W A;  5KKZ C;  3H1K E;  4HM2 A;  2E4P A;  3N0Q A;  2BCC E;  1WQL A;  3EQQ A;  4NBE D;  4NBF D;  2D2C D;  1P84 E;  3GCE A;  1G8K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...