3AZCA

Crystal structure of the soluble part of cytochrome b6f complex iron-sulfur subunit from thermosynechococcus elongatus bp-1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
HHIEGRAVAKDALGNDIKVSEYLAKHLPGDRSLAQGIKGDPTYVIVTEDHQIANYGLNAVCTHLGCVVPWNVSENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRTGKEPWWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6-f complex iron-sulfur subunit
publication title Structure of a thermophilic cyanobacterial b(6)f-type Rieske protein
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
total genus 31
structure length 133
sequence length 133
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3azcA00
4OGQD 3VCPA 1FQTA 2E4QA 4QUQA 2E74D 4HM5A 4QDCA 2NWFA 4NBED 2D2CD 2HMKA 3L75E 4NBCD 1P84E 1UUVA 4P1BH 1JM1A 2JO6A 4HJLA 3VMID 4NB8D 4HM4A 2E75D 1NTKE 2A06E 3D89A 1PPJE 2BMOA 2HMLA 2YFJA 3L72E 2QPZA 1VF5D 5KLIC 2BCCE 1NDOA 1ULIA 4HM6A 3H1KE 2NUMA 4NBAD 3CWBE 1O7WA 2QJYC 2YFIA 2GBWA 1EZVE 4H0LD 2HMMA 3H1IE 1SJGA 3EN1A 3L70E 1NTZE 2QJPC 2YIUC 3EQQA 3C0DA 2HMNA 4U3FE 4EMJB 4HM7A 4HM2A 1PP9E 4HM8A 3GKEA 4NBHD 1O7PA 1O7NA 4HM3A 3VMHD 1G8JB 1ULJA 1SQVE 3FOUA 3L71E 5BOKA 5HL4A 4HM1A 1O7GA 1NTME 5AEUA 2NVEA 2IBZE 2NVFA 3GTEA 2YFLA 4QDFA 4NBGD 4P1CH 2GBXA 3GTSA 1O7MA 2I7FA 1L0LE 1O7HA 3BCCE 3GZYA 4AIVA 1WQLA 4H13D 4QURA 2B1XA 1SQQE 1UUWA 5KLVE 1Q90C 2XRXA 1SQPE 3CX5E 4NB9D 3L73E 3H1HE 1KYOE 5KKZC 1G8KB 3VMGD 1NU1E 2ZYLA 3GL2A 4QDDA 1BE3E 2B24A 3GB4A 1SQXE 1VCKA 2NUKA 4PD4E 3AZCA 4NBFD 3H1JE 2FYUE 2DE6D 3N0QA 1RFSA 2DE5D 3GCEA 2ZT9D 2XSHA 3H1LE 1RIEA 4HKVA 3VCAA 1NYKA 1ZRTE 4QDFB 3CXHE 1BCCE 2JZAA 4QUPA 4NBDD 4HM0A 2XR8A 4AAYB 4PV1D 4NBBD 3DQYA 2BMRA 2DE7D 4QCKA 5AEWA 2QJKC 2BMQA 1VM9A 2YVJB 3TGUE 2NVGA 3GL0A 2XSOA 3GOBA 5CXMA 1SQBE 3GZXA 4H44D 3L74E 2E4PA 2Q3WA 2FYNC 1L0NE 1KB9E 2HMJA 2E76D 2HMOA 2CKFA 1EG9A
chains in the Genus database with same CATH superfamily
4OGQD 3VCPA 1FQTA 2E4QA 4QUQA 2E74D 4HM5A 4QDCA 2NWFA 4NBED 2D2CD 2HMKA 3L75E 4NBCD 1P84E 1UUVA 4P1BH 1JM1A 2JO6A 4HJLA 3VMID 4NB8D 4HM4A 2E75D 1NTKE 2A06E 3D89A 1PPJE 2BMOA 2HMLA 2YFJA 3L72E 2QPZA 1VF5D 5KLIC 2BCCE 1NDOA 1ULIA 4HM6A 3H1KE 2NUMA 4NBAD 3CWBE 1O7WA 2QJYC 2YFIA 2GBWA 1EZVE 4H0LD 2HMMA 3H1IE 1SJGA 3EN1A 3L70E 1NTZE 2QJPC 2YIUC 3EQQA 3C0DA 2HMNA 4U3FE 4EMJB 4HM7A 4HM2A 1PP9E 4HM8A 3GKEA 4NBHD 1O7PA 1O7NA 4HM3A 3VMHD 1G8JB 1ULJA 1SQVE 3FOUA 3L71E 5BOKA 5HL4A 4HM1A 1O7GA 1NTME 5AEUA 2NVEA 2IBZE 2NVFA 3GTEA 2YFLA 4QDFA 4NBGD 4P1CH 2GBXA 3GTSA 1O7MA 2I7FA 1L0LE 1O7HA 3BCCE 3GZYA 4AIVA 1WQLA 4H13D 4QURA 2B1XA 1SQQE 1UUWA 5KLVE 1Q90C 2XRXA 1SQPE 3CX5E 4NB9D 3L73E 3H1HE 1KYOE 5KKZC 1G8KB 3VMGD 1NU1E 2ZYLA 3GL2A 4QDDA 1BE3E 2B24A 3GB4A 1SQXE 1VCKA 2NUKA 4PD4E 3AZCA 4NBFD 3H1JE 2FYUE 2DE6D 3N0QA 1RFSA 2DE5D 3GCEA 2ZT9D 2XSHA 3H1LE 1RIEA 4HKVA 3VCAA 1NYKA 1ZRTE 4QDFB 3CXHE 1BCCE 2JZAA 4QUPA 4NBDD 4HM0A 2XR8A 4AAYB 4PV1D 4NBBD 3DQYA 2BMRA 2DE7D 4QCKA 5AEWA 2QJKC 2BMQA 1VM9A 2YVJB 3TGUE 2NVGA 3GL0A 2XSOA 3GOBA 5CXMA 1SQBE 3GZXA 4H44D 3L74E 2E4PA 2Q3WA 2FYNC 1L0NE 1KB9E 2HMJA 2E76D 2HMOA 2CKFA 1EG9A
chains in the Genus database with same CATH topology
4OGQD 3VCPA 1FQTA 2E4QA 4QUQA 2E74D 4HM5A 4QDCA 2NWFA 4NBED 2D2CD 2HMKA 3L75E 4NBCD 1P84E 1UUVA 4P1BH 1JM1A 2JO6A 4HJLA 3VMID 4NB8D 4HM4A 2E75D 1NTKE 2A06E 3D89A 1PPJE 2BMOA 2HMLA 2YFJA 3L72E 2QPZA 1VF5D 5KLIC 2BCCE 1NDOA 1ULIA 4HM6A 3H1KE 2NUMA 4NBAD 3CWBE 1O7WA 2QJYC 2YFIA 2GBWA 1EZVE 4H0LD 2HMMA 3H1IE 1SJGA 3EN1A 3L70E 1NTZE 2QJPC 2YIUC 3EQQA 3C0DA 2HMNA 4U3FE 4EMJB 4HM7A 4HM2A 1PP9E 4HM8A 3GKEA 4NBHD 1O7PA 1O7NA 4HM3A 3VMHD 1G8JB 1ULJA 1SQVE 3FOUA 3L71E 5BOKA 5HL4A 4HM1A 1O7GA 1NTME 5AEUA 2NVEA 2IBZE 2NVFA 3GTEA 2YFLA 4QDFA 4NBGD 4P1CH 2GBXA 3GTSA 1O7MA 2I7FA 1L0LE 1O7HA 3BCCE 3GZYA 4AIVA 1WQLA 4H13D 4QURA 2B1XA 1SQQE 1UUWA 5KLVE 1Q90C 2XRXA 1SQPE 3CX5E 4NB9D 3L73E 3H1HE 1KYOE 5KKZC 1G8KB 3VMGD 1NU1E 2ZYLA 3GL2A 4QDDA 1BE3E 2B24A 3GB4A 1SQXE 1VCKA 2NUKA 4PD4E 3AZCA 4NBFD 3H1JE 2FYUE 2DE6D 3N0QA 1RFSA 2DE5D 3GCEA 2ZT9D 2XSHA 3H1LE 1RIEA 4HKVA 3VCAA 1NYKA 1ZRTE 4QDFB 3CXHE 1BCCE 2JZAA 4QUPA 4NBDD 4HM0A 2XR8A 4AAYB 4PV1D 4NBBD 3DQYA 2BMRA 2DE7D 4QCKA 5AEWA 2QJKC 2BMQA 1VM9A 2YVJB 3TGUE 2NVGA 3GL0A 2XSOA 3GOBA 5CXMA 1SQBE 3GZXA 4H44D 3L74E 2E4PA 2Q3WA 2FYNC 1L0NE 1KB9E 2HMJA 2E76D 2HMOA 2CKFA 1EG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OGQ D;  3VCP A;  1FQT A;  2E4Q A;  4QUQ A;  2E74 D;  4HM5 A;  4QDC A;  2NWF A;  4NBE D;  2D2C D;  2HMK A;  3L75 E;  4NBC D;  1P84 E;  1UUV A;  4P1B H;  1JM1 A;  2JO6 A;  4HJL A;  3VMI D;  4NB8 D;  4HM4 A;  2E75 D;  1NTK E;  2A06 E;  3D89 A;  1PPJ E;  2BMO A;  2HML A;  2YFJ A;  3L72 E;  2QPZ A;  1VF5 D;  5KLI C;  2BCC E;  1NDO A;  1ULI A;  4HM6 A;  3H1K E;  2NUM A;  4NBA D;  3CWB E;  1O7W A;  2QJY C;  2YFI A;  2GBW A;  1EZV E;  4H0L D;  2HMM A;  3H1I E;  1SJG A;  3EN1 A;  3L70 E;  1NTZ E;  2QJP C;  2YIU C;  3EQQ A;  3C0D A;  2HMN A;  4U3F E;  4EMJ B;  4HM7 A;  4HM2 A;  1PP9 E;  4HM8 A;  3GKE A;  4NBH D;  1O7P A;  1O7N A;  4HM3 A;  3VMH D;  1G8J B;  1ULJ A;  1SQV E;  3FOU A;  3L71 E;  5BOK A;  5HL4 A;  4HM1 A;  1O7G A;  1NTM E;  5AEU A;  2NVE A;  2IBZ E;  2NVF A;  3GTE A;  2YFL A;  4QDF A;  4NBG D;  4P1C H;  2GBX A;  3GTS A;  1O7M A;  2I7F A;  1L0L E;  1O7H A;  3BCC E;  3GZY A;  4AIV A;  1WQL A;  4H13 D;  4QUR A;  2B1X A;  1SQQ E;  1UUW A;  5KLV E;  1Q90 C;  2XRX A;  1SQP E;  3CX5 E;  4NB9 D;  3L73 E;  3H1H E;  1KYO E;  5KKZ C;  1G8K B;  3VMG D;  1NU1 E;  2ZYL A;  3GL2 A;  4QDD A;  1BE3 E;  2B24 A;  3GB4 A;  1SQX E;  1VCK A;  2NUK A;  4PD4 E;  3AZC A;  4NBF D;  3H1J E;  2FYU E;  2DE6 D;  3N0Q A;  1RFS A;  2DE5 D;  3GCE A;  2ZT9 D;  2XSH A;  3H1L E;  1RIE A;  4HKV A;  3VCA A;  1NYK A;  1ZRT E;  4QDF B;  3CXH E;  1BCC E;  2JZA A;  4QUP A;  4NBD D;  4HM0 A;  2XR8 A;  4AAY B;  4PV1 D;  4NBB D;  3DQY A;  2BMR A;  2DE7 D;  4QCK A;  5AEW A;  2QJK C;  2BMQ A;  1VM9 A;  2YVJ B;  3TGU E;  2NVG A;  3GL0 A;  2XSO A;  3GOB A;  5CXM A;  1SQB E;  3GZX A;  4H44 D;  3L74 E;  2E4P A;  2Q3W A;  2FYN C;  1L0N E;  1KB9 E;  2HMJ A;  2E76 D;  2HMO A;  2CKF A;  1EG9 A; 
#chains in the Genus database with same CATH topology
 4OGQ D;  3VCP A;  1FQT A;  2E4Q A;  4QUQ A;  2E74 D;  4HM5 A;  4QDC A;  2NWF A;  4NBE D;  2D2C D;  2HMK A;  3L75 E;  4NBC D;  1P84 E;  1UUV A;  4P1B H;  1JM1 A;  2JO6 A;  4HJL A;  3VMI D;  4NB8 D;  4HM4 A;  2E75 D;  1NTK E;  2A06 E;  3D89 A;  1PPJ E;  2BMO A;  2HML A;  2YFJ A;  3L72 E;  2QPZ A;  1VF5 D;  5KLI C;  2BCC E;  1NDO A;  1ULI A;  4HM6 A;  3H1K E;  2NUM A;  4NBA D;  3CWB E;  1O7W A;  2QJY C;  2YFI A;  2GBW A;  1EZV E;  4H0L D;  2HMM A;  3H1I E;  1SJG A;  3EN1 A;  3L70 E;  1NTZ E;  2QJP C;  2YIU C;  3EQQ A;  3C0D A;  2HMN A;  4U3F E;  4EMJ B;  4HM7 A;  4HM2 A;  1PP9 E;  4HM8 A;  3GKE A;  4NBH D;  1O7P A;  1O7N A;  4HM3 A;  3VMH D;  1G8J B;  1ULJ A;  1SQV E;  3FOU A;  3L71 E;  5BOK A;  5HL4 A;  4HM1 A;  1O7G A;  1NTM E;  5AEU A;  2NVE A;  2IBZ E;  2NVF A;  3GTE A;  2YFL A;  4QDF A;  4NBG D;  4P1C H;  2GBX A;  3GTS A;  1O7M A;  2I7F A;  1L0L E;  1O7H A;  3BCC E;  3GZY A;  4AIV A;  1WQL A;  4H13 D;  4QUR A;  2B1X A;  1SQQ E;  1UUW A;  5KLV E;  1Q90 C;  2XRX A;  1SQP E;  3CX5 E;  4NB9 D;  3L73 E;  3H1H E;  1KYO E;  5KKZ C;  1G8K B;  3VMG D;  1NU1 E;  2ZYL A;  3GL2 A;  4QDD A;  1BE3 E;  2B24 A;  3GB4 A;  1SQX E;  1VCK A;  2NUK A;  4PD4 E;  3AZC A;  4NBF D;  3H1J E;  2FYU E;  2DE6 D;  3N0Q A;  1RFS A;  2DE5 D;  3GCE A;  2ZT9 D;  2XSH A;  3H1L E;  1RIE A;  4HKV A;  3VCA A;  1NYK A;  1ZRT E;  4QDF B;  3CXH E;  1BCC E;  2JZA A;  4QUP A;  4NBD D;  4HM0 A;  2XR8 A;  4AAY B;  4PV1 D;  4NBB D;  3DQY A;  2BMR A;  2DE7 D;  4QCK A;  5AEW A;  2QJK C;  2BMQ A;  1VM9 A;  2YVJ B;  3TGU E;  2NVG A;  3GL0 A;  2XSO A;  3GOB A;  5CXM A;  1SQB E;  3GZX A;  4H44 D;  3L74 E;  2E4P A;  2Q3W A;  2FYN C;  1L0N E;  1KB9 E;  2HMJ A;  2E76 D;  2HMO A;  2CKF A;  1EG9 A; 
#chains in the Genus database with same CATH homology
 4OGQ D;  3VCP A;  1FQT A;  2E4Q A;  4QUQ A;  2E74 D;  4HM5 A;  4QDC A;  2NWF A;  4NBE D;  2D2C D;  2HMK A;  3L75 E;  4NBC D;  1P84 E;  1UUV A;  4P1B H;  1JM1 A;  2JO6 A;  4HJL A;  3VMI D;  4NB8 D;  4HM4 A;  2E75 D;  1NTK E;  2A06 E;  3D89 A;  1PPJ E;  2BMO A;  2HML A;  2YFJ A;  3L72 E;  2QPZ A;  1VF5 D;  5KLI C;  2BCC E;  1NDO A;  1ULI A;  4HM6 A;  3H1K E;  2NUM A;  4NBA D;  3CWB E;  1O7W A;  2QJY C;  2YFI A;  2GBW A;  1EZV E;  4H0L D;  2HMM A;  3H1I E;  1SJG A;  3EN1 A;  3L70 E;  1NTZ E;  2QJP C;  2YIU C;  3EQQ A;  3C0D A;  2HMN A;  4U3F E;  4EMJ B;  4HM7 A;  4HM2 A;  1PP9 E;  4HM8 A;  3GKE A;  4NBH D;  1O7P A;  1O7N A;  4HM3 A;  3VMH D;  1G8J B;  1ULJ A;  1SQV E;  3FOU A;  3L71 E;  5BOK A;  5HL4 A;  4HM1 A;  1O7G A;  1NTM E;  5AEU A;  2NVE A;  2IBZ E;  2NVF A;  3GTE A;  2YFL A;  4QDF A;  4NBG D;  4P1C H;  2GBX A;  3GTS A;  1O7M A;  2I7F A;  1L0L E;  1O7H A;  3BCC E;  3GZY A;  4AIV A;  1WQL A;  4H13 D;  4QUR A;  2B1X A;  1SQQ E;  1UUW A;  5KLV E;  1Q90 C;  2XRX A;  1SQP E;  3CX5 E;  4NB9 D;  3L73 E;  3H1H E;  1KYO E;  5KKZ C;  1G8K B;  3VMG D;  1NU1 E;  2ZYL A;  3GL2 A;  4QDD A;  1BE3 E;  2B24 A;  3GB4 A;  1SQX E;  1VCK A;  2NUK A;  4PD4 E;  3AZC A;  4NBF D;  3H1J E;  2FYU E;  2DE6 D;  3N0Q A;  1RFS A;  2DE5 D;  3GCE A;  2ZT9 D;  2XSH A;  3H1L E;  1RIE A;  4HKV A;  3VCA A;  1NYK A;  1ZRT E;  4QDF B;  3CXH E;  1BCC E;  2JZA A;  4QUP A;  4NBD D;  4HM0 A;  2XR8 A;  4AAY B;  4PV1 D;  4NBB D;  3DQY A;  2BMR A;  2DE7 D;  4QCK A;  5AEW A;  2QJK C;  2BMQ A;  1VM9 A;  2YVJ B;  3TGU E;  2NVG A;  3GL0 A;  2XSO A;  3GOB A;  5CXM A;  1SQB E;  3GZX A;  4H44 D;  3L74 E;  2E4P A;  2Q3W A;  2FYN C;  1L0N E;  1KB9 E;  2HMJ A;  2E76 D;  2HMO A;  2CKF A;  1EG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...