3AZCA

Crystal structure of the soluble part of cytochrome b6f complex iron-sulfur subunit from thermosynechococcus elongatus bp-1
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
HHIEGRAVAKDALGNDIKVSEYLAKHLPGDRSLAQGIKGDPTYVIVTEDHQIANYGLNAVCTHLGCVVPWNVSENKFICPCHGSQYDSTGKVVRGPAPLSLALVKATVTEDDKLVFTPWTEIDFRTGKEPWWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a thermophilic cyanobacterial b(6)f-type Rieske protein
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Oxidoreductase
molecule keywords Cytochrome b6-f complex iron-sulfur subunit
total genus 31
structure length 133
sequence length 133
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3azcA00
3VMGD 4HM8A 3CWBE 1PP9E 3VMHD 2E74D 4QUQA 4AAYB 3GTSA 3CXHE 1UUVA 2FYNC 2NUMA 2ZYLA 1RIEA 2HMKA 3GL2A 4H44D 4PV1D 3VMID 4P1CH 1NU1E 2NVFA 1NTME 2I7FA 1O7NA 1L0LE 3L70E 5KLIC 4NB8D 5AEUA 4OGQD 3D89A 4HM7A 1FQTA 1EZVE 3GOBA 4U3FE 2QJPC 5BOKA 3H1LE 2E4PA 3VCAA 4NBAD 2BMQA 2XR8A 4NBDD 4NBED 4QDCA 2NWFA 3GCEA 2NVGA 2YIUC 1Q90C 3EN1A 3H1IE 1G8JB 4HM3A 2A06E 1SQPE 3L74E 4QUPA 2XSHA 1KB9E 2E76D 1SQBE 3H1JE 4HM6A 3N0QA 3AZCA 2ZT9D 3GTEA 4NBHD 4QCKA 1P84E 4HM4A 2YVJB 2BMOA 3TGUE 1O7PA 2HMOA 3GZXA 2E75D 3L75E 1VM9A 3L73E 2XSOA 1ZRTE 1WQLA 5CXMA 1JM1A 4HM2A 1KYOE 3FOUA 4NBBD 1O7HA 4QURA 4AIVA 4NBGD 3GZYA 1ULIA 4QDDA 2XRXA 2D2CD 3GL0A 2Q3WA 2B24A 3BCCE 2HMNA 2NVEA 4NB9D 2YFIA 1O7WA 3H1KE 1NYKA 5KLVE 2GBWA 4EMJB 2YFLA 4H13D 4NBFD 1O7GA 2B1XA 4HM5A 4QDFA 3C0DA 3VCPA 1VF5D 2NUKA 2YFJA 2QJKC 4PD4E 1PPJE 2HMLA 1BCCE 1RFSA 3GKEA 4P1BH 5AEWA 1O7MA 1EG9A 1SQQE 2DE7D 1BE3E 1SQXE 2QJYC 2GBXA 1UUWA 4H0LD 3CX5E 3EQQA 2CKFA 4NBCD 2DE6D 2IBZE 3GB4A 1NTZE 2JZAA 2HMJA 1L0NE 3L71E 1SQVE 4HM1A 2BCCE 2HMMA 4HKVA 1ULJA 1VCKA 2E4QA 3DQYA 5KKZC 1NDOA 2DE5D 2QPZA 1NTKE 1G8KB 4HJLA 4HM0A 2BMRA 1SJGA 3H1HE 4QDFB 2JO6A 3L72E 5HL4A 2FYUE
chains in the Genus database with same CATH superfamily
3VMGD 4HM8A 3CWBE 1PP9E 3VMHD 2E74D 4QUQA 4AAYB 3GTSA 3CXHE 1UUVA 2FYNC 2NUMA 2ZYLA 1RIEA 2HMKA 3GL2A 4H44D 4PV1D 3VMID 4P1CH 1NU1E 2NVFA 1NTME 2I7FA 1O7NA 1L0LE 3L70E 5KLIC 4NB8D 5AEUA 4OGQD 3D89A 4HM7A 1FQTA 1EZVE 3GOBA 4U3FE 2QJPC 5BOKA 3H1LE 2E4PA 3VCAA 4NBAD 2BMQA 2XR8A 4NBDD 4NBED 4QDCA 2NWFA 3GCEA 2NVGA 2YIUC 1Q90C 3EN1A 3H1IE 1G8JB 4HM3A 2A06E 1SQPE 3L74E 4QUPA 2XSHA 1KB9E 2E76D 1SQBE 3H1JE 4HM6A 3N0QA 3AZCA 2ZT9D 3GTEA 4NBHD 4QCKA 1P84E 4HM4A 2YVJB 2BMOA 3TGUE 1O7PA 2HMOA 3GZXA 2E75D 3L75E 1VM9A 3L73E 2XSOA 1ZRTE 1WQLA 5CXMA 1JM1A 4HM2A 1KYOE 3FOUA 4NBBD 1O7HA 4QURA 4AIVA 4NBGD 3GZYA 1ULIA 4QDDA 2XRXA 2D2CD 3GL0A 2Q3WA 2B24A 3BCCE 2HMNA 2NVEA 4NB9D 2YFIA 1O7WA 3H1KE 1NYKA 5KLVE 2GBWA 4EMJB 2YFLA 4H13D 4NBFD 1O7GA 2B1XA 4HM5A 4QDFA 3C0DA 3VCPA 1VF5D 2NUKA 2YFJA 2QJKC 4PD4E 1PPJE 2HMLA 1BCCE 1RFSA 3GKEA 4P1BH 5AEWA 1O7MA 1EG9A 1SQQE 2DE7D 1BE3E 1SQXE 2QJYC 2GBXA 1UUWA 4H0LD 3CX5E 3EQQA 2CKFA 4NBCD 2DE6D 2IBZE 3GB4A 1NTZE 2JZAA 2HMJA 1L0NE 3L71E 1SQVE 4HM1A 2BCCE 2HMMA 4HKVA 1ULJA 1VCKA 2E4QA 3DQYA 5KKZC 1NDOA 2DE5D 2QPZA 1NTKE 1G8KB 4HJLA 4HM0A 2BMRA 1SJGA 3H1HE 4QDFB 2JO6A 3L72E 5HL4A 2FYUE
chains in the Genus database with same CATH topology
3VMGD 4HM8A 3CWBE 1PP9E 3VMHD 2E74D 4QUQA 4AAYB 3GTSA 3CXHE 1UUVA 2FYNC 2NUMA 2ZYLA 1RIEA 2HMKA 3GL2A 4H44D 4PV1D 3VMID 4P1CH 1NU1E 2NVFA 1NTME 2I7FA 1O7NA 1L0LE 3L70E 5KLIC 4NB8D 5AEUA 4OGQD 3D89A 4HM7A 1FQTA 1EZVE 3GOBA 4U3FE 2QJPC 5BOKA 3H1LE 2E4PA 3VCAA 4NBAD 2BMQA 2XR8A 4NBDD 4NBED 4QDCA 2NWFA 3GCEA 2NVGA 2YIUC 1Q90C 3EN1A 3H1IE 1G8JB 4HM3A 2A06E 1SQPE 3L74E 4QUPA 2XSHA 1KB9E 2E76D 1SQBE 3H1JE 4HM6A 3N0QA 3AZCA 2ZT9D 3GTEA 4NBHD 4QCKA 1P84E 4HM4A 2YVJB 2BMOA 3TGUE 1O7PA 2HMOA 3GZXA 2E75D 3L75E 1VM9A 3L73E 2XSOA 1ZRTE 1WQLA 5CXMA 1JM1A 4HM2A 1KYOE 3FOUA 4NBBD 1O7HA 4QURA 4AIVA 4NBGD 3GZYA 1ULIA 4QDDA 2XRXA 2D2CD 3GL0A 2Q3WA 2B24A 3BCCE 2HMNA 2NVEA 4NB9D 2YFIA 1O7WA 3H1KE 1NYKA 5KLVE 2GBWA 4EMJB 2YFLA 4H13D 4NBFD 1O7GA 2B1XA 4HM5A 4QDFA 3C0DA 3VCPA 1VF5D 2NUKA 2YFJA 2QJKC 4PD4E 1PPJE 2HMLA 1BCCE 1RFSA 3GKEA 4P1BH 5AEWA 1O7MA 1EG9A 1SQQE 2DE7D 1BE3E 1SQXE 2QJYC 2GBXA 1UUWA 4H0LD 3CX5E 3EQQA 2CKFA 4NBCD 2DE6D 2IBZE 3GB4A 1NTZE 2JZAA 2HMJA 1L0NE 3L71E 1SQVE 4HM1A 2BCCE 2HMMA 4HKVA 1ULJA 1VCKA 2E4QA 3DQYA 5KKZC 1NDOA 2DE5D 2QPZA 1NTKE 1G8KB 4HJLA 4HM0A 2BMRA 1SJGA 3H1HE 4QDFB 2JO6A 3L72E 5HL4A 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMG D;  4HM8 A;  3CWB E;  1PP9 E;  3VMH D;  2E74 D;  4QUQ A;  4AAY B;  3GTS A;  3CXH E;  1UUV A;  2FYN C;  2NUM A;  2ZYL A;  1RIE A;  2HMK A;  3GL2 A;  4H44 D;  4PV1 D;  3VMI D;  4P1C H;  1NU1 E;  2NVF A;  1NTM E;  2I7F A;  1O7N A;  1L0L E;  3L70 E;  5KLI C;  4NB8 D;  5AEU A;  4OGQ D;  3D89 A;  4HM7 A;  1FQT A;  1EZV E;  3GOB A;  4U3F E;  2QJP C;  5BOK A;  3H1L E;  2E4P A;  3VCA A;  4NBA D;  2BMQ A;  2XR8 A;  4NBD D;  4NBE D;  4QDC A;  2NWF A;  3GCE A;  2NVG A;  2YIU C;  1Q90 C;  3EN1 A;  3H1I E;  1G8J B;  4HM3 A;  2A06 E;  1SQP E;  3L74 E;  4QUP A;  2XSH A;  1KB9 E;  2E76 D;  1SQB E;  3H1J E;  4HM6 A;  3N0Q A;  3AZC A;  2ZT9 D;  3GTE A;  4NBH D;  4QCK A;  1P84 E;  4HM4 A;  2YVJ B;  2BMO A;  3TGU E;  1O7P A;  2HMO A;  3GZX A;  2E75 D;  3L75 E;  1VM9 A;  3L73 E;  2XSO A;  1ZRT E;  1WQL A;  5CXM A;  1JM1 A;  4HM2 A;  1KYO E;  3FOU A;  4NBB D;  1O7H A;  4QUR A;  4AIV A;  4NBG D;  3GZY A;  1ULI A;  4QDD A;  2XRX A;  2D2C D;  3GL0 A;  2Q3W A;  2B24 A;  3BCC E;  2HMN A;  2NVE A;  4NB9 D;  2YFI A;  1O7W A;  3H1K E;  1NYK A;  5KLV E;  2GBW A;  4EMJ B;  2YFL A;  4H13 D;  4NBF D;  1O7G A;  2B1X A;  4HM5 A;  4QDF A;  3C0D A;  3VCP A;  1VF5 D;  2NUK A;  2YFJ A;  2QJK C;  4PD4 E;  1PPJ E;  2HML A;  1BCC E;  1RFS A;  3GKE A;  4P1B H;  5AEW A;  1O7M A;  1EG9 A;  1SQQ E;  2DE7 D;  1BE3 E;  1SQX E;  2QJY C;  2GBX A;  1UUW A;  4H0L D;  3CX5 E;  3EQQ A;  2CKF A;  4NBC D;  2DE6 D;  2IBZ E;  3GB4 A;  1NTZ E;  2JZA A;  2HMJ A;  1L0N E;  3L71 E;  1SQV E;  4HM1 A;  2BCC E;  2HMM A;  4HKV A;  1ULJ A;  1VCK A;  2E4Q A;  3DQY A;  5KKZ C;  1NDO A;  2DE5 D;  2QPZ A;  1NTK E;  1G8K B;  4HJL A;  4HM0 A;  2BMR A;  1SJG A;  3H1H E;  4QDF B;  2JO6 A;  3L72 E;  5HL4 A;  2FYU E; 
#chains in the Genus database with same CATH topology
 3VMG D;  4HM8 A;  3CWB E;  1PP9 E;  3VMH D;  2E74 D;  4QUQ A;  4AAY B;  3GTS A;  3CXH E;  1UUV A;  2FYN C;  2NUM A;  2ZYL A;  1RIE A;  2HMK A;  3GL2 A;  4H44 D;  4PV1 D;  3VMI D;  4P1C H;  1NU1 E;  2NVF A;  1NTM E;  2I7F A;  1O7N A;  1L0L E;  3L70 E;  5KLI C;  4NB8 D;  5AEU A;  4OGQ D;  3D89 A;  4HM7 A;  1FQT A;  1EZV E;  3GOB A;  4U3F E;  2QJP C;  5BOK A;  3H1L E;  2E4P A;  3VCA A;  4NBA D;  2BMQ A;  2XR8 A;  4NBD D;  4NBE D;  4QDC A;  2NWF A;  3GCE A;  2NVG A;  2YIU C;  1Q90 C;  3EN1 A;  3H1I E;  1G8J B;  4HM3 A;  2A06 E;  1SQP E;  3L74 E;  4QUP A;  2XSH A;  1KB9 E;  2E76 D;  1SQB E;  3H1J E;  4HM6 A;  3N0Q A;  3AZC A;  2ZT9 D;  3GTE A;  4NBH D;  4QCK A;  1P84 E;  4HM4 A;  2YVJ B;  2BMO A;  3TGU E;  1O7P A;  2HMO A;  3GZX A;  2E75 D;  3L75 E;  1VM9 A;  3L73 E;  2XSO A;  1ZRT E;  1WQL A;  5CXM A;  1JM1 A;  4HM2 A;  1KYO E;  3FOU A;  4NBB D;  1O7H A;  4QUR A;  4AIV A;  4NBG D;  3GZY A;  1ULI A;  4QDD A;  2XRX A;  2D2C D;  3GL0 A;  2Q3W A;  2B24 A;  3BCC E;  2HMN A;  2NVE A;  4NB9 D;  2YFI A;  1O7W A;  3H1K E;  1NYK A;  5KLV E;  2GBW A;  4EMJ B;  2YFL A;  4H13 D;  4NBF D;  1O7G A;  2B1X A;  4HM5 A;  4QDF A;  3C0D A;  3VCP A;  1VF5 D;  2NUK A;  2YFJ A;  2QJK C;  4PD4 E;  1PPJ E;  2HML A;  1BCC E;  1RFS A;  3GKE A;  4P1B H;  5AEW A;  1O7M A;  1EG9 A;  1SQQ E;  2DE7 D;  1BE3 E;  1SQX E;  2QJY C;  2GBX A;  1UUW A;  4H0L D;  3CX5 E;  3EQQ A;  2CKF A;  4NBC D;  2DE6 D;  2IBZ E;  3GB4 A;  1NTZ E;  2JZA A;  2HMJ A;  1L0N E;  3L71 E;  1SQV E;  4HM1 A;  2BCC E;  2HMM A;  4HKV A;  1ULJ A;  1VCK A;  2E4Q A;  3DQY A;  5KKZ C;  1NDO A;  2DE5 D;  2QPZ A;  1NTK E;  1G8K B;  4HJL A;  4HM0 A;  2BMR A;  1SJG A;  3H1H E;  4QDF B;  2JO6 A;  3L72 E;  5HL4 A;  2FYU E; 
#chains in the Genus database with same CATH homology
 3VMG D;  4HM8 A;  3CWB E;  1PP9 E;  3VMH D;  2E74 D;  4QUQ A;  4AAY B;  3GTS A;  3CXH E;  1UUV A;  2FYN C;  2NUM A;  2ZYL A;  1RIE A;  2HMK A;  3GL2 A;  4H44 D;  4PV1 D;  3VMI D;  4P1C H;  1NU1 E;  2NVF A;  1NTM E;  2I7F A;  1O7N A;  1L0L E;  3L70 E;  5KLI C;  4NB8 D;  5AEU A;  4OGQ D;  3D89 A;  4HM7 A;  1FQT A;  1EZV E;  3GOB A;  4U3F E;  2QJP C;  5BOK A;  3H1L E;  2E4P A;  3VCA A;  4NBA D;  2BMQ A;  2XR8 A;  4NBD D;  4NBE D;  4QDC A;  2NWF A;  3GCE A;  2NVG A;  2YIU C;  1Q90 C;  3EN1 A;  3H1I E;  1G8J B;  4HM3 A;  2A06 E;  1SQP E;  3L74 E;  4QUP A;  2XSH A;  1KB9 E;  2E76 D;  1SQB E;  3H1J E;  4HM6 A;  3N0Q A;  3AZC A;  2ZT9 D;  3GTE A;  4NBH D;  4QCK A;  1P84 E;  4HM4 A;  2YVJ B;  2BMO A;  3TGU E;  1O7P A;  2HMO A;  3GZX A;  2E75 D;  3L75 E;  1VM9 A;  3L73 E;  2XSO A;  1ZRT E;  1WQL A;  5CXM A;  1JM1 A;  4HM2 A;  1KYO E;  3FOU A;  4NBB D;  1O7H A;  4QUR A;  4AIV A;  4NBG D;  3GZY A;  1ULI A;  4QDD A;  2XRX A;  2D2C D;  3GL0 A;  2Q3W A;  2B24 A;  3BCC E;  2HMN A;  2NVE A;  4NB9 D;  2YFI A;  1O7W A;  3H1K E;  1NYK A;  5KLV E;  2GBW A;  4EMJ B;  2YFL A;  4H13 D;  4NBF D;  1O7G A;  2B1X A;  4HM5 A;  4QDF A;  3C0D A;  3VCP A;  1VF5 D;  2NUK A;  2YFJ A;  2QJK C;  4PD4 E;  1PPJ E;  2HML A;  1BCC E;  1RFS A;  3GKE A;  4P1B H;  5AEW A;  1O7M A;  1EG9 A;  1SQQ E;  2DE7 D;  1BE3 E;  1SQX E;  2QJY C;  2GBX A;  1UUW A;  4H0L D;  3CX5 E;  3EQQ A;  2CKF A;  4NBC D;  2DE6 D;  2IBZ E;  3GB4 A;  1NTZ E;  2JZA A;  2HMJ A;  1L0N E;  3L71 E;  1SQV E;  4HM1 A;  2BCC E;  2HMM A;  4HKV A;  1ULJ A;  1VCK A;  2E4Q A;  3DQY A;  5KKZ C;  1NDO A;  2DE5 D;  2QPZ A;  1NTK E;  1G8K B;  4HJL A;  4HM0 A;  2BMR A;  1SJG A;  3H1H E;  4QDF B;  2JO6 A;  3L72 E;  5HL4 A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...