3GCEA

Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
STPVRVATLDQLKPGVPTAFDVDGDEVMVVRDGDSVYAISNLCSHAEAYLDMGVFHAESLEIECPLHVGRFDVRTGAPTALPCVLPVRAYDVVVDGTEILVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin component of carbazole 1,9a-dioxygenase
publication title Specific Interactions between the ferredoxin and terminal oxygenase components of a class IIB Rieske nonheme iron oxygenase, carbazole 1,9a-dioxygenase.
pubmed doi rcsb
source organism Nocardioides aromaticivorans
molecule tags Oxidoreductase
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3gceA00
2DE7D 2NUKA 3CX5E 2HMKA 3GOBA 1KB9E 4P1BH 4QUPA 3AZCA 2YFJA 4NBFD 3VMID 1NU1E 2E4PA 4HM5A 4QUQA 3EQQA 3N0QA 4NBGD 2QJYC 4OGQD 5AEWA 3L75E 1VM9A 2Q3WA 1NTME 2HMLA 2YVJB 3BCCE 4NBBD 3L71E 1G8KB 4NBHD 2IBZE 1SQXE 1SJGA 3GL2A 1BE3E 2BMQA 4QDCA 2JZAA 5HL4A 1SQBE 1SQPE 3H1HE 4HM0A 4QDDA 1EZVE 1O7PA 3GB4A 1UUWA 1ZRTE 4PV1D 3VMGD 5KKZC 2DE6D 2B1XA 1NYKA 4NBDD 3L73E 1WQLA 2XRXA 1P84E 4HKVA 2XSHA 2CKFA 1ULJA 2A06E 2BMOA 1KYOE 1VF5D 4NB9D 2E76D 2NVEA 4QDFB 3GCEA 4HM8A 2ZT9D 2YFIA 2YFLA 2HMJA 3C0DA 3D89A 3H1IE 3GZXA 3CWBE 2HMNA 4AAYB 2QJKC 2GBXA 3L72E 1ULIA 4U3FE 4PD4E 2BMRA 5KLVE 1SQQE 2HMMA 2NUMA 3GTSA 3TGUE 2GBWA 1RIEA 2E75D 2XSOA 3EN1A 1O7GA 2NWFA 3H1JE 4P1CH 4H0LD 1SQVE 2QJPC 4HM7A 3L74E 5AEUA 1BCCE 4HM4A 1O7NA 4EMJB 1PPJE 2FYNC 1NTKE 1O7MA 4NBCD 1L0LE 2ZYLA 4HM1A 5CXMA 3VCAA 4HM2A 3GL0A 1O7HA 2HMOA 2D2CD 1RFSA 2YIUC 3DQYA 1Q90C 1EG9A 1VCKA 2E74D 5KLIC 2QPZA 2I7FA 3H1KE 2JO6A 4QDFA 2E4QA 2FYUE 2BCCE 1G8JB 3FOUA 1NDOA 4H44D 3CXHE 4NBAD 5BOKA 4QCKA 3VCPA 1UUVA 3VMHD 1O7WA 2NVGA 4HM6A 2DE5D 2XR8A 4HM3A 4QURA 1NTZE 3GTEA 4HJLA 2NVFA 1FQTA 1L0NE 2B24A 4AIVA 1PP9E 3GZYA 1JM1A 3H1LE 4NBED 4NB8D 3L70E 3GKEA 4H13D
chains in the Genus database with same CATH superfamily
2DE7D 2NUKA 3CX5E 2HMKA 3GOBA 1KB9E 4P1BH 4QUPA 3AZCA 2YFJA 4NBFD 3VMID 1NU1E 2E4PA 4HM5A 4QUQA 3EQQA 3N0QA 4NBGD 2QJYC 4OGQD 5AEWA 3L75E 1VM9A 2Q3WA 1NTME 2HMLA 2YVJB 3BCCE 4NBBD 3L71E 1G8KB 4NBHD 2IBZE 1SQXE 1SJGA 3GL2A 1BE3E 2BMQA 4QDCA 2JZAA 5HL4A 1SQBE 1SQPE 3H1HE 4HM0A 4QDDA 1EZVE 1O7PA 3GB4A 1UUWA 1ZRTE 4PV1D 3VMGD 5KKZC 2DE6D 2B1XA 1NYKA 4NBDD 3L73E 1WQLA 2XRXA 1P84E 4HKVA 2XSHA 2CKFA 1ULJA 2A06E 2BMOA 1KYOE 1VF5D 4NB9D 2E76D 2NVEA 4QDFB 3GCEA 4HM8A 2ZT9D 2YFIA 2YFLA 2HMJA 3C0DA 3D89A 3H1IE 3GZXA 3CWBE 2HMNA 4AAYB 2QJKC 2GBXA 3L72E 1ULIA 4U3FE 4PD4E 2BMRA 5KLVE 1SQQE 2HMMA 2NUMA 3GTSA 3TGUE 2GBWA 1RIEA 2E75D 2XSOA 3EN1A 1O7GA 2NWFA 3H1JE 4P1CH 4H0LD 1SQVE 2QJPC 4HM7A 3L74E 5AEUA 1BCCE 4HM4A 1O7NA 4EMJB 1PPJE 2FYNC 1NTKE 1O7MA 4NBCD 1L0LE 2ZYLA 4HM1A 5CXMA 3VCAA 4HM2A 3GL0A 1O7HA 2HMOA 2D2CD 1RFSA 2YIUC 3DQYA 1Q90C 1EG9A 1VCKA 2E74D 5KLIC 2QPZA 2I7FA 3H1KE 2JO6A 4QDFA 2E4QA 2FYUE 2BCCE 1G8JB 3FOUA 1NDOA 4H44D 3CXHE 4NBAD 5BOKA 4QCKA 3VCPA 1UUVA 3VMHD 1O7WA 2NVGA 4HM6A 2DE5D 2XR8A 4HM3A 4QURA 1NTZE 3GTEA 4HJLA 2NVFA 1FQTA 1L0NE 2B24A 4AIVA 1PP9E 3GZYA 1JM1A 3H1LE 4NBED 4NB8D 3L70E 3GKEA 4H13D
chains in the Genus database with same CATH topology
2DE7D 2NUKA 3CX5E 2HMKA 3GOBA 1KB9E 4P1BH 4QUPA 3AZCA 2YFJA 4NBFD 3VMID 1NU1E 2E4PA 4HM5A 4QUQA 3EQQA 3N0QA 4NBGD 2QJYC 4OGQD 5AEWA 3L75E 1VM9A 2Q3WA 1NTME 2HMLA 2YVJB 3BCCE 4NBBD 3L71E 1G8KB 4NBHD 2IBZE 1SQXE 1SJGA 3GL2A 1BE3E 2BMQA 4QDCA 2JZAA 5HL4A 1SQBE 1SQPE 3H1HE 4HM0A 4QDDA 1EZVE 1O7PA 3GB4A 1UUWA 1ZRTE 4PV1D 3VMGD 5KKZC 2DE6D 2B1XA 1NYKA 4NBDD 3L73E 1WQLA 2XRXA 1P84E 4HKVA 2XSHA 2CKFA 1ULJA 2A06E 2BMOA 1KYOE 1VF5D 4NB9D 2E76D 2NVEA 4QDFB 3GCEA 4HM8A 2ZT9D 2YFIA 2YFLA 2HMJA 3C0DA 3D89A 3H1IE 3GZXA 3CWBE 2HMNA 4AAYB 2QJKC 2GBXA 3L72E 1ULIA 4U3FE 4PD4E 2BMRA 5KLVE 1SQQE 2HMMA 2NUMA 3GTSA 3TGUE 2GBWA 1RIEA 2E75D 2XSOA 3EN1A 1O7GA 2NWFA 3H1JE 4P1CH 4H0LD 1SQVE 2QJPC 4HM7A 3L74E 5AEUA 1BCCE 4HM4A 1O7NA 4EMJB 1PPJE 2FYNC 1NTKE 1O7MA 4NBCD 1L0LE 2ZYLA 4HM1A 5CXMA 3VCAA 4HM2A 3GL0A 1O7HA 2HMOA 2D2CD 1RFSA 2YIUC 3DQYA 1Q90C 1EG9A 1VCKA 2E74D 5KLIC 2QPZA 2I7FA 3H1KE 2JO6A 4QDFA 2E4QA 2FYUE 2BCCE 1G8JB 3FOUA 1NDOA 4H44D 3CXHE 4NBAD 5BOKA 4QCKA 3VCPA 1UUVA 3VMHD 1O7WA 2NVGA 4HM6A 2DE5D 2XR8A 4HM3A 4QURA 1NTZE 3GTEA 4HJLA 2NVFA 1FQTA 1L0NE 2B24A 4AIVA 1PP9E 3GZYA 1JM1A 3H1LE 4NBED 4NB8D 3L70E 3GKEA 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 D;  2NUK A;  3CX5 E;  2HMK A;  3GOB A;  1KB9 E;  4P1B H;  4QUP A;  3AZC A;  2YFJ A;  4NBF D;  3VMI D;  1NU1 E;  2E4P A;  4HM5 A;  4QUQ A;  3EQQ A;  3N0Q A;  4NBG D;  2QJY C;  4OGQ D;  5AEW A;  3L75 E;  1VM9 A;  2Q3W A;  1NTM E;  2HML A;  2YVJ B;  3BCC E;  4NBB D;  3L71 E;  1G8K B;  4NBH D;  2IBZ E;  1SQX E;  1SJG A;  3GL2 A;  1BE3 E;  2BMQ A;  4QDC A;  2JZA A;  5HL4 A;  1SQB E;  1SQP E;  3H1H E;  4HM0 A;  4QDD A;  1EZV E;  1O7P A;  3GB4 A;  1UUW A;  1ZRT E;  4PV1 D;  3VMG D;  5KKZ C;  2DE6 D;  2B1X A;  1NYK A;  4NBD D;  3L73 E;  1WQL A;  2XRX A;  1P84 E;  4HKV A;  2XSH A;  2CKF A;  1ULJ A;  2A06 E;  2BMO A;  1KYO E;  1VF5 D;  4NB9 D;  2E76 D;  2NVE A;  4QDF B;  3GCE A;  4HM8 A;  2ZT9 D;  2YFI A;  2YFL A;  2HMJ A;  3C0D A;  3D89 A;  3H1I E;  3GZX A;  3CWB E;  2HMN A;  4AAY B;  2QJK C;  2GBX A;  3L72 E;  1ULI A;  4U3F E;  4PD4 E;  2BMR A;  5KLV E;  1SQQ E;  2HMM A;  2NUM A;  3GTS A;  3TGU E;  2GBW A;  1RIE A;  2E75 D;  2XSO A;  3EN1 A;  1O7G A;  2NWF A;  3H1J E;  4P1C H;  4H0L D;  1SQV E;  2QJP C;  4HM7 A;  3L74 E;  5AEU A;  1BCC E;  4HM4 A;  1O7N A;  4EMJ B;  1PPJ E;  2FYN C;  1NTK E;  1O7M A;  4NBC D;  1L0L E;  2ZYL A;  4HM1 A;  5CXM A;  3VCA A;  4HM2 A;  3GL0 A;  1O7H A;  2HMO A;  2D2C D;  1RFS A;  2YIU C;  3DQY A;  1Q90 C;  1EG9 A;  1VCK A;  2E74 D;  5KLI C;  2QPZ A;  2I7F A;  3H1K E;  2JO6 A;  4QDF A;  2E4Q A;  2FYU E;  2BCC E;  1G8J B;  3FOU A;  1NDO A;  4H44 D;  3CXH E;  4NBA D;  5BOK A;  4QCK A;  3VCP A;  1UUV A;  3VMH D;  1O7W A;  2NVG A;  4HM6 A;  2DE5 D;  2XR8 A;  4HM3 A;  4QUR A;  1NTZ E;  3GTE A;  4HJL A;  2NVF A;  1FQT A;  1L0N E;  2B24 A;  4AIV A;  1PP9 E;  3GZY A;  1JM1 A;  3H1L E;  4NBE D;  4NB8 D;  3L70 E;  3GKE A;  4H13 D; 
#chains in the Genus database with same CATH topology
 2DE7 D;  2NUK A;  3CX5 E;  2HMK A;  3GOB A;  1KB9 E;  4P1B H;  4QUP A;  3AZC A;  2YFJ A;  4NBF D;  3VMI D;  1NU1 E;  2E4P A;  4HM5 A;  4QUQ A;  3EQQ A;  3N0Q A;  4NBG D;  2QJY C;  4OGQ D;  5AEW A;  3L75 E;  1VM9 A;  2Q3W A;  1NTM E;  2HML A;  2YVJ B;  3BCC E;  4NBB D;  3L71 E;  1G8K B;  4NBH D;  2IBZ E;  1SQX E;  1SJG A;  3GL2 A;  1BE3 E;  2BMQ A;  4QDC A;  2JZA A;  5HL4 A;  1SQB E;  1SQP E;  3H1H E;  4HM0 A;  4QDD A;  1EZV E;  1O7P A;  3GB4 A;  1UUW A;  1ZRT E;  4PV1 D;  3VMG D;  5KKZ C;  2DE6 D;  2B1X A;  1NYK A;  4NBD D;  3L73 E;  1WQL A;  2XRX A;  1P84 E;  4HKV A;  2XSH A;  2CKF A;  1ULJ A;  2A06 E;  2BMO A;  1KYO E;  1VF5 D;  4NB9 D;  2E76 D;  2NVE A;  4QDF B;  3GCE A;  4HM8 A;  2ZT9 D;  2YFI A;  2YFL A;  2HMJ A;  3C0D A;  3D89 A;  3H1I E;  3GZX A;  3CWB E;  2HMN A;  4AAY B;  2QJK C;  2GBX A;  3L72 E;  1ULI A;  4U3F E;  4PD4 E;  2BMR A;  5KLV E;  1SQQ E;  2HMM A;  2NUM A;  3GTS A;  3TGU E;  2GBW A;  1RIE A;  2E75 D;  2XSO A;  3EN1 A;  1O7G A;  2NWF A;  3H1J E;  4P1C H;  4H0L D;  1SQV E;  2QJP C;  4HM7 A;  3L74 E;  5AEU A;  1BCC E;  4HM4 A;  1O7N A;  4EMJ B;  1PPJ E;  2FYN C;  1NTK E;  1O7M A;  4NBC D;  1L0L E;  2ZYL A;  4HM1 A;  5CXM A;  3VCA A;  4HM2 A;  3GL0 A;  1O7H A;  2HMO A;  2D2C D;  1RFS A;  2YIU C;  3DQY A;  1Q90 C;  1EG9 A;  1VCK A;  2E74 D;  5KLI C;  2QPZ A;  2I7F A;  3H1K E;  2JO6 A;  4QDF A;  2E4Q A;  2FYU E;  2BCC E;  1G8J B;  3FOU A;  1NDO A;  4H44 D;  3CXH E;  4NBA D;  5BOK A;  4QCK A;  3VCP A;  1UUV A;  3VMH D;  1O7W A;  2NVG A;  4HM6 A;  2DE5 D;  2XR8 A;  4HM3 A;  4QUR A;  1NTZ E;  3GTE A;  4HJL A;  2NVF A;  1FQT A;  1L0N E;  2B24 A;  4AIV A;  1PP9 E;  3GZY A;  1JM1 A;  3H1L E;  4NBE D;  4NB8 D;  3L70 E;  3GKE A;  4H13 D; 
#chains in the Genus database with same CATH homology
 2DE7 D;  2NUK A;  3CX5 E;  2HMK A;  3GOB A;  1KB9 E;  4P1B H;  4QUP A;  3AZC A;  2YFJ A;  4NBF D;  3VMI D;  1NU1 E;  2E4P A;  4HM5 A;  4QUQ A;  3EQQ A;  3N0Q A;  4NBG D;  2QJY C;  4OGQ D;  5AEW A;  3L75 E;  1VM9 A;  2Q3W A;  1NTM E;  2HML A;  2YVJ B;  3BCC E;  4NBB D;  3L71 E;  1G8K B;  4NBH D;  2IBZ E;  1SQX E;  1SJG A;  3GL2 A;  1BE3 E;  2BMQ A;  4QDC A;  2JZA A;  5HL4 A;  1SQB E;  1SQP E;  3H1H E;  4HM0 A;  4QDD A;  1EZV E;  1O7P A;  3GB4 A;  1UUW A;  1ZRT E;  4PV1 D;  3VMG D;  5KKZ C;  2DE6 D;  2B1X A;  1NYK A;  4NBD D;  3L73 E;  1WQL A;  2XRX A;  1P84 E;  4HKV A;  2XSH A;  2CKF A;  1ULJ A;  2A06 E;  2BMO A;  1KYO E;  1VF5 D;  4NB9 D;  2E76 D;  2NVE A;  4QDF B;  3GCE A;  4HM8 A;  2ZT9 D;  2YFI A;  2YFL A;  2HMJ A;  3C0D A;  3D89 A;  3H1I E;  3GZX A;  3CWB E;  2HMN A;  4AAY B;  2QJK C;  2GBX A;  3L72 E;  1ULI A;  4U3F E;  4PD4 E;  2BMR A;  5KLV E;  1SQQ E;  2HMM A;  2NUM A;  3GTS A;  3TGU E;  2GBW A;  1RIE A;  2E75 D;  2XSO A;  3EN1 A;  1O7G A;  2NWF A;  3H1J E;  4P1C H;  4H0L D;  1SQV E;  2QJP C;  4HM7 A;  3L74 E;  5AEU A;  1BCC E;  4HM4 A;  1O7N A;  4EMJ B;  1PPJ E;  2FYN C;  1NTK E;  1O7M A;  4NBC D;  1L0L E;  2ZYL A;  4HM1 A;  5CXM A;  3VCA A;  4HM2 A;  3GL0 A;  1O7H A;  2HMO A;  2D2C D;  1RFS A;  2YIU C;  3DQY A;  1Q90 C;  1EG9 A;  1VCK A;  2E74 D;  5KLI C;  2QPZ A;  2I7F A;  3H1K E;  2JO6 A;  4QDF A;  2E4Q A;  2FYU E;  2BCC E;  1G8J B;  3FOU A;  1NDO A;  4H44 D;  3CXH E;  4NBA D;  5BOK A;  4QCK A;  3VCP A;  1UUV A;  3VMH D;  1O7W A;  2NVG A;  4HM6 A;  2DE5 D;  2XR8 A;  4HM3 A;  4QUR A;  1NTZ E;  3GTE A;  4HJL A;  2NVF A;  1FQT A;  1L0N E;  2B24 A;  4AIV A;  1PP9 E;  3GZY A;  1JM1 A;  3H1L E;  4NBE D;  4NB8 D;  3L70 E;  3GKE A;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...