3GCEA

Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
STPVRVATLDQLKPGVPTAFDVDGDEVMVVRDGDSVYAISNLCSHAEAYLDMGVFHAESLEIECPLHVGRFDVRTGAPTALPCVLPVRAYDVVVDGTEILVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specific Interactions between the ferredoxin and terminal oxygenase components of a class IIB Rieske nonheme iron oxygenase, carbazole 1,9a-dioxygenase.
pubmed doi rcsb
source organism Nocardioides aromaticivorans
molecule tags Oxidoreductase
molecule keywords Ferredoxin component of carbazole 1,9a-dioxygenase
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3gceA00
2HMNA 4P1BH 3VMID 1KB9E 2HMMA 4QUQA 1O7WA 3GL2A 2QJKC 4HM3A 2QJPC 3DQYA 2A06E 2XSHA 4HM5A 2ZT9D 4NB8D 2YFLA 1SQXE 3FOUA 4HM6A 4P1CH 1EZVE 1Q90C 4QCKA 3H1JE 4H44D 2HMJA 2YIUC 2E76D 4QUPA 2BCCE 1UUWA 1VCKA 2BMRA 2NUKA 1JM1A 1BE3E 1SJGA 1VF5D 5BOKA 1NTME 4AIVA 2GBWA 1L0NE 5CXMA 1EG9A 2E74D 4PV1D 4HM4A 2D2CD 1WQLA 2E4PA 3L71E 4HKVA 1ZRTE 2E75D 2JZAA 2XSOA 3L73E 2BMOA 5KKZC 3GTEA 1ULIA 2YVJB 4QURA 2YFJA 1SQQE 4NBGD 3L72E 3EQQA 4H0LD 2B24A 4HM2A 1SQPE 1ULJA 2NVGA 2DE6D 2XRXA 3CXHE 1O7HA 4U3FE 1BCCE 5AEWA 2BMQA 2NUMA 4HM7A 3VCAA 3GZXA 4NBDD 1NU1E 3H1LE 4PD4E 4NBFD 2QJYC 4QDFA 4QDCA 2FYUE 3L70E 1O7PA 1PP9E 3VCPA 2I7FA 1RIEA 1SQBE 2Q3WA 1NYKA 3H1IE 1NTZE 2NVEA 4NBCD 2NWFA 1O7MA 3GOBA 3N0QA 4H13D 4HM0A 3GTSA 4QDDA 1G8KB 3C0DA 4NB9D 4OGQD 2NVFA 3D89A 2ZYLA 2E4QA 3TGUE 2GBXA 2B1XA 4NBED 3GCEA 3H1KE 5AEUA 2HMLA 2CKFA 1SQVE 3VMHD 3GL0A 3L75E 1FQTA 4EMJB 1NDOA 3VMGD 3GKEA 3BCCE 3CWBE 3CX5E 4HM1A 1L0LE 2IBZE 3EN1A 1O7GA 4HM8A 2DE7D 1P84E 2XR8A 3AZCA 3GB4A 1O7NA 2YFIA 2QPZA 5KLVE 1NTKE 2HMOA 2JO6A 1VM9A 3L74E 1RFSA 2HMKA 4QDFB 1KYOE 1PPJE 5KLIC 3H1HE 4AAYB 1G8JB 4HJLA 4NBAD 2DE5D 5HL4A 3GZYA 4NBHD 2FYNC 4NBBD 1UUVA
chains in the Genus database with same CATH superfamily
2HMNA 4P1BH 3VMID 1KB9E 2HMMA 4QUQA 1O7WA 3GL2A 2QJKC 4HM3A 2QJPC 3DQYA 2A06E 2XSHA 4HM5A 2ZT9D 4NB8D 2YFLA 1SQXE 3FOUA 4HM6A 4P1CH 1EZVE 1Q90C 4QCKA 3H1JE 4H44D 2HMJA 2YIUC 2E76D 4QUPA 2BCCE 1UUWA 1VCKA 2BMRA 2NUKA 1JM1A 1BE3E 1SJGA 1VF5D 5BOKA 1NTME 4AIVA 2GBWA 1L0NE 5CXMA 1EG9A 2E74D 4PV1D 4HM4A 2D2CD 1WQLA 2E4PA 3L71E 4HKVA 1ZRTE 2E75D 2JZAA 2XSOA 3L73E 2BMOA 5KKZC 3GTEA 1ULIA 2YVJB 4QURA 2YFJA 1SQQE 4NBGD 3L72E 3EQQA 4H0LD 2B24A 4HM2A 1SQPE 1ULJA 2NVGA 2DE6D 2XRXA 3CXHE 1O7HA 4U3FE 1BCCE 5AEWA 2BMQA 2NUMA 4HM7A 3VCAA 3GZXA 4NBDD 1NU1E 3H1LE 4PD4E 4NBFD 2QJYC 4QDFA 4QDCA 2FYUE 3L70E 1O7PA 1PP9E 3VCPA 2I7FA 1RIEA 1SQBE 2Q3WA 1NYKA 3H1IE 1NTZE 2NVEA 4NBCD 2NWFA 1O7MA 3GOBA 3N0QA 4H13D 4HM0A 3GTSA 4QDDA 1G8KB 3C0DA 4NB9D 4OGQD 2NVFA 3D89A 2ZYLA 2E4QA 3TGUE 2GBXA 2B1XA 4NBED 3GCEA 3H1KE 5AEUA 2HMLA 2CKFA 1SQVE 3VMHD 3GL0A 3L75E 1FQTA 4EMJB 1NDOA 3VMGD 3GKEA 3BCCE 3CWBE 3CX5E 4HM1A 1L0LE 2IBZE 3EN1A 1O7GA 4HM8A 2DE7D 1P84E 2XR8A 3AZCA 3GB4A 1O7NA 2YFIA 2QPZA 5KLVE 1NTKE 2HMOA 2JO6A 1VM9A 3L74E 1RFSA 2HMKA 4QDFB 1KYOE 1PPJE 5KLIC 3H1HE 4AAYB 1G8JB 4HJLA 4NBAD 2DE5D 5HL4A 3GZYA 4NBHD 2FYNC 4NBBD 1UUVA
chains in the Genus database with same CATH topology
2HMNA 4P1BH 3VMID 1KB9E 2HMMA 4QUQA 1O7WA 3GL2A 2QJKC 4HM3A 2QJPC 3DQYA 2A06E 2XSHA 4HM5A 2ZT9D 4NB8D 2YFLA 1SQXE 3FOUA 4HM6A 4P1CH 1EZVE 1Q90C 4QCKA 3H1JE 4H44D 2HMJA 2YIUC 2E76D 4QUPA 2BCCE 1UUWA 1VCKA 2BMRA 2NUKA 1JM1A 1BE3E 1SJGA 1VF5D 5BOKA 1NTME 4AIVA 2GBWA 1L0NE 5CXMA 1EG9A 2E74D 4PV1D 4HM4A 2D2CD 1WQLA 2E4PA 3L71E 4HKVA 1ZRTE 2E75D 2JZAA 2XSOA 3L73E 2BMOA 5KKZC 3GTEA 1ULIA 2YVJB 4QURA 2YFJA 1SQQE 4NBGD 3L72E 3EQQA 4H0LD 2B24A 4HM2A 1SQPE 1ULJA 2NVGA 2DE6D 2XRXA 3CXHE 1O7HA 4U3FE 1BCCE 5AEWA 2BMQA 2NUMA 4HM7A 3VCAA 3GZXA 4NBDD 1NU1E 3H1LE 4PD4E 4NBFD 2QJYC 4QDFA 4QDCA 2FYUE 3L70E 1O7PA 1PP9E 3VCPA 2I7FA 1RIEA 1SQBE 2Q3WA 1NYKA 3H1IE 1NTZE 2NVEA 4NBCD 2NWFA 1O7MA 3GOBA 3N0QA 4H13D 4HM0A 3GTSA 4QDDA 1G8KB 3C0DA 4NB9D 4OGQD 2NVFA 3D89A 2ZYLA 2E4QA 3TGUE 2GBXA 2B1XA 4NBED 3GCEA 3H1KE 5AEUA 2HMLA 2CKFA 1SQVE 3VMHD 3GL0A 3L75E 1FQTA 4EMJB 1NDOA 3VMGD 3GKEA 3BCCE 3CWBE 3CX5E 4HM1A 1L0LE 2IBZE 3EN1A 1O7GA 4HM8A 2DE7D 1P84E 2XR8A 3AZCA 3GB4A 1O7NA 2YFIA 2QPZA 5KLVE 1NTKE 2HMOA 2JO6A 1VM9A 3L74E 1RFSA 2HMKA 4QDFB 1KYOE 1PPJE 5KLIC 3H1HE 4AAYB 1G8JB 4HJLA 4NBAD 2DE5D 5HL4A 3GZYA 4NBHD 2FYNC 4NBBD 1UUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN A;  4P1B H;  3VMI D;  1KB9 E;  2HMM A;  4QUQ A;  1O7W A;  3GL2 A;  2QJK C;  4HM3 A;  2QJP C;  3DQY A;  2A06 E;  2XSH A;  4HM5 A;  2ZT9 D;  4NB8 D;  2YFL A;  1SQX E;  3FOU A;  4HM6 A;  4P1C H;  1EZV E;  1Q90 C;  4QCK A;  3H1J E;  4H44 D;  2HMJ A;  2YIU C;  2E76 D;  4QUP A;  2BCC E;  1UUW A;  1VCK A;  2BMR A;  2NUK A;  1JM1 A;  1BE3 E;  1SJG A;  1VF5 D;  5BOK A;  1NTM E;  4AIV A;  2GBW A;  1L0N E;  5CXM A;  1EG9 A;  2E74 D;  4PV1 D;  4HM4 A;  2D2C D;  1WQL A;  2E4P A;  3L71 E;  4HKV A;  1ZRT E;  2E75 D;  2JZA A;  2XSO A;  3L73 E;  2BMO A;  5KKZ C;  3GTE A;  1ULI A;  2YVJ B;  4QUR A;  2YFJ A;  1SQQ E;  4NBG D;  3L72 E;  3EQQ A;  4H0L D;  2B24 A;  4HM2 A;  1SQP E;  1ULJ A;  2NVG A;  2DE6 D;  2XRX A;  3CXH E;  1O7H A;  4U3F E;  1BCC E;  5AEW A;  2BMQ A;  2NUM A;  4HM7 A;  3VCA A;  3GZX A;  4NBD D;  1NU1 E;  3H1L E;  4PD4 E;  4NBF D;  2QJY C;  4QDF A;  4QDC A;  2FYU E;  3L70 E;  1O7P A;  1PP9 E;  3VCP A;  2I7F A;  1RIE A;  1SQB E;  2Q3W A;  1NYK A;  3H1I E;  1NTZ E;  2NVE A;  4NBC D;  2NWF A;  1O7M A;  3GOB A;  3N0Q A;  4H13 D;  4HM0 A;  3GTS A;  4QDD A;  1G8K B;  3C0D A;  4NB9 D;  4OGQ D;  2NVF A;  3D89 A;  2ZYL A;  2E4Q A;  3TGU E;  2GBX A;  2B1X A;  4NBE D;  3GCE A;  3H1K E;  5AEU A;  2HML A;  2CKF A;  1SQV E;  3VMH D;  3GL0 A;  3L75 E;  1FQT A;  4EMJ B;  1NDO A;  3VMG D;  3GKE A;  3BCC E;  3CWB E;  3CX5 E;  4HM1 A;  1L0L E;  2IBZ E;  3EN1 A;  1O7G A;  4HM8 A;  2DE7 D;  1P84 E;  2XR8 A;  3AZC A;  3GB4 A;  1O7N A;  2YFI A;  2QPZ A;  5KLV E;  1NTK E;  2HMO A;  2JO6 A;  1VM9 A;  3L74 E;  1RFS A;  2HMK A;  4QDF B;  1KYO E;  1PPJ E;  5KLI C;  3H1H E;  4AAY B;  1G8J B;  4HJL A;  4NBA D;  2DE5 D;  5HL4 A;  3GZY A;  4NBH D;  2FYN C;  4NBB D;  1UUV A; 
#chains in the Genus database with same CATH topology
 2HMN A;  4P1B H;  3VMI D;  1KB9 E;  2HMM A;  4QUQ A;  1O7W A;  3GL2 A;  2QJK C;  4HM3 A;  2QJP C;  3DQY A;  2A06 E;  2XSH A;  4HM5 A;  2ZT9 D;  4NB8 D;  2YFL A;  1SQX E;  3FOU A;  4HM6 A;  4P1C H;  1EZV E;  1Q90 C;  4QCK A;  3H1J E;  4H44 D;  2HMJ A;  2YIU C;  2E76 D;  4QUP A;  2BCC E;  1UUW A;  1VCK A;  2BMR A;  2NUK A;  1JM1 A;  1BE3 E;  1SJG A;  1VF5 D;  5BOK A;  1NTM E;  4AIV A;  2GBW A;  1L0N E;  5CXM A;  1EG9 A;  2E74 D;  4PV1 D;  4HM4 A;  2D2C D;  1WQL A;  2E4P A;  3L71 E;  4HKV A;  1ZRT E;  2E75 D;  2JZA A;  2XSO A;  3L73 E;  2BMO A;  5KKZ C;  3GTE A;  1ULI A;  2YVJ B;  4QUR A;  2YFJ A;  1SQQ E;  4NBG D;  3L72 E;  3EQQ A;  4H0L D;  2B24 A;  4HM2 A;  1SQP E;  1ULJ A;  2NVG A;  2DE6 D;  2XRX A;  3CXH E;  1O7H A;  4U3F E;  1BCC E;  5AEW A;  2BMQ A;  2NUM A;  4HM7 A;  3VCA A;  3GZX A;  4NBD D;  1NU1 E;  3H1L E;  4PD4 E;  4NBF D;  2QJY C;  4QDF A;  4QDC A;  2FYU E;  3L70 E;  1O7P A;  1PP9 E;  3VCP A;  2I7F A;  1RIE A;  1SQB E;  2Q3W A;  1NYK A;  3H1I E;  1NTZ E;  2NVE A;  4NBC D;  2NWF A;  1O7M A;  3GOB A;  3N0Q A;  4H13 D;  4HM0 A;  3GTS A;  4QDD A;  1G8K B;  3C0D A;  4NB9 D;  4OGQ D;  2NVF A;  3D89 A;  2ZYL A;  2E4Q A;  3TGU E;  2GBX A;  2B1X A;  4NBE D;  3GCE A;  3H1K E;  5AEU A;  2HML A;  2CKF A;  1SQV E;  3VMH D;  3GL0 A;  3L75 E;  1FQT A;  4EMJ B;  1NDO A;  3VMG D;  3GKE A;  3BCC E;  3CWB E;  3CX5 E;  4HM1 A;  1L0L E;  2IBZ E;  3EN1 A;  1O7G A;  4HM8 A;  2DE7 D;  1P84 E;  2XR8 A;  3AZC A;  3GB4 A;  1O7N A;  2YFI A;  2QPZ A;  5KLV E;  1NTK E;  2HMO A;  2JO6 A;  1VM9 A;  3L74 E;  1RFS A;  2HMK A;  4QDF B;  1KYO E;  1PPJ E;  5KLI C;  3H1H E;  4AAY B;  1G8J B;  4HJL A;  4NBA D;  2DE5 D;  5HL4 A;  3GZY A;  4NBH D;  2FYN C;  4NBB D;  1UUV A; 
#chains in the Genus database with same CATH homology
 2HMN A;  4P1B H;  3VMI D;  1KB9 E;  2HMM A;  4QUQ A;  1O7W A;  3GL2 A;  2QJK C;  4HM3 A;  2QJP C;  3DQY A;  2A06 E;  2XSH A;  4HM5 A;  2ZT9 D;  4NB8 D;  2YFL A;  1SQX E;  3FOU A;  4HM6 A;  4P1C H;  1EZV E;  1Q90 C;  4QCK A;  3H1J E;  4H44 D;  2HMJ A;  2YIU C;  2E76 D;  4QUP A;  2BCC E;  1UUW A;  1VCK A;  2BMR A;  2NUK A;  1JM1 A;  1BE3 E;  1SJG A;  1VF5 D;  5BOK A;  1NTM E;  4AIV A;  2GBW A;  1L0N E;  5CXM A;  1EG9 A;  2E74 D;  4PV1 D;  4HM4 A;  2D2C D;  1WQL A;  2E4P A;  3L71 E;  4HKV A;  1ZRT E;  2E75 D;  2JZA A;  2XSO A;  3L73 E;  2BMO A;  5KKZ C;  3GTE A;  1ULI A;  2YVJ B;  4QUR A;  2YFJ A;  1SQQ E;  4NBG D;  3L72 E;  3EQQ A;  4H0L D;  2B24 A;  4HM2 A;  1SQP E;  1ULJ A;  2NVG A;  2DE6 D;  2XRX A;  3CXH E;  1O7H A;  4U3F E;  1BCC E;  5AEW A;  2BMQ A;  2NUM A;  4HM7 A;  3VCA A;  3GZX A;  4NBD D;  1NU1 E;  3H1L E;  4PD4 E;  4NBF D;  2QJY C;  4QDF A;  4QDC A;  2FYU E;  3L70 E;  1O7P A;  1PP9 E;  3VCP A;  2I7F A;  1RIE A;  1SQB E;  2Q3W A;  1NYK A;  3H1I E;  1NTZ E;  2NVE A;  4NBC D;  2NWF A;  1O7M A;  3GOB A;  3N0Q A;  4H13 D;  4HM0 A;  3GTS A;  4QDD A;  1G8K B;  3C0D A;  4NB9 D;  4OGQ D;  2NVF A;  3D89 A;  2ZYL A;  2E4Q A;  3TGU E;  2GBX A;  2B1X A;  4NBE D;  3GCE A;  3H1K E;  5AEU A;  2HML A;  2CKF A;  1SQV E;  3VMH D;  3GL0 A;  3L75 E;  1FQT A;  4EMJ B;  1NDO A;  3VMG D;  3GKE A;  3BCC E;  3CWB E;  3CX5 E;  4HM1 A;  1L0L E;  2IBZ E;  3EN1 A;  1O7G A;  4HM8 A;  2DE7 D;  1P84 E;  2XR8 A;  3AZC A;  3GB4 A;  1O7N A;  2YFI A;  2QPZ A;  5KLV E;  1NTK E;  2HMO A;  2JO6 A;  1VM9 A;  3L74 E;  1RFS A;  2HMK A;  4QDF B;  1KYO E;  1PPJ E;  5KLI C;  3H1H E;  4AAY B;  1G8J B;  4HJL A;  4NBA D;  2DE5 D;  5HL4 A;  3GZY A;  4NBH D;  2FYN C;  4NBB D;  1UUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...