3GCEA

Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
104
structure length
104
Chain Sequence
STPVRVATLDQLKPGVPTAFDVDGDEVMVVRDGDSVYAISNLCSHAEAYLDMGVFHAESLEIECPLHVGRFDVRTGAPTALPCVLPVRAYDVVVDGTEILVAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin component of carbazole 1,9a-dioxygenase
publication title Specific Interactions between the ferredoxin and terminal oxygenase components of a class IIB Rieske nonheme iron oxygenase, carbazole 1,9a-dioxygenase.
pubmed doi rcsb
source organism Nocardioides aromaticivorans
total genus 22
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3gceA00
5AEWA 2YFIA 1SQVE 1L0NE 2ZT9D 2XSOA 5KLVE 1PPJE 2A06E 4QDFA 3GOBA 4HM8A 4P1BH 1UUVA 2HMKA 5BOKA 1O7HA 4PD4E 4U3FE 2JZAA 5CXMA 1KYOE 2ZYLA 3TGUE 2HMMA 2XRXA 4HM3A 2Q3WA 1PP9E 2FYUE 4QUQA 1SQQE 4EMJB 1EZVE 5HL4A 4P1CH 3H1JE 3VMGD 2NUKA 3L71E 3L73E 1RIEA 2BMRA 2YVJB 2NVFA 2NVGA 2I7FA 1NYKA 1KB9E 1SQBE 4HM6A 3L72E 2QJPC 4AIVA 4PV1D 1G8KB 4OGQD 1ULIA 3GZXA 2HMJA 4HKVA 4H44D 2YFLA 3AZCA 3GCEA 1L0LE 2NVEA 4NB9D 4QDCA 4HM7A 2GBXA 1RFSA 1NTME 4QDDA 4NB8D 2QJYC 3H1HE 2QPZA 4HJLA 3VMHD 1NU1E 2IBZE 2XSHA 3VCPA 4NBGD 3EQQA 1O7MA 1O7WA 2CKFA 3GTEA 4H0LD 1NDOA 3L74E 4HM5A 3VMID 2DE7D 3FOUA 2E75D 1EG9A 1FQTA 4NBBD 5KKZC 2E4PA 1O7NA 1VCKA 3EN1A 1ZRTE 2NUMA 2FYNC 1NTKE 2HMOA 3CX5E 2GBWA 1SJGA 1WQLA 1O7PA 4QCKA 3GTSA 2BMQA 4AAYB 3H1LE 4H13D 1O7GA 2BMOA 2QJKC 1BE3E 1VM9A 1VF5D 5AEUA 2NWFA 1ULJA 2JO6A 4QUPA 2HMNA 2E4QA 3BCCE 4NBAD 4NBDD 4HM2A 2D2CD 1Q90C 4NBFD 4HM1A 2BCCE 2XR8A 2HMLA 2YFJA 3VCAA 3GKEA 1NTZE 1SQXE 4NBHD 3L70E 2E74D 3C0DA 3GB4A 4HM0A 3D89A 4QDFB 3H1KE 3GL2A 3CXHE 3N0QA 1P84E 1SQPE 1UUWA 4NBCD 2DE5D 3L75E 3H1IE 4NBED 2DE6D 5KLIC 3GL0A 1BCCE 2E76D 1JM1A 4QURA 2B1XA 2YIUC 3CWBE 2B24A 3DQYA 1G8JB 3GZYA 4HM4A
chains in the Genus database with same CATH superfamily
5AEWA 2YFIA 1SQVE 1L0NE 2ZT9D 2XSOA 5KLVE 1PPJE 2A06E 4QDFA 3GOBA 4HM8A 4P1BH 1UUVA 2HMKA 5BOKA 1O7HA 4PD4E 4U3FE 2JZAA 5CXMA 1KYOE 2ZYLA 3TGUE 2HMMA 2XRXA 4HM3A 2Q3WA 1PP9E 2FYUE 4QUQA 1SQQE 4EMJB 1EZVE 5HL4A 4P1CH 3H1JE 3VMGD 2NUKA 3L71E 3L73E 1RIEA 2BMRA 2YVJB 2NVFA 2NVGA 2I7FA 1NYKA 1KB9E 1SQBE 4HM6A 3L72E 2QJPC 4AIVA 4PV1D 1G8KB 4OGQD 1ULIA 3GZXA 2HMJA 4HKVA 4H44D 2YFLA 3AZCA 3GCEA 1L0LE 2NVEA 4NB9D 4QDCA 4HM7A 2GBXA 1RFSA 1NTME 4QDDA 4NB8D 2QJYC 3H1HE 2QPZA 4HJLA 3VMHD 1NU1E 2IBZE 2XSHA 3VCPA 4NBGD 3EQQA 1O7MA 1O7WA 2CKFA 3GTEA 4H0LD 1NDOA 3L74E 4HM5A 3VMID 2DE7D 3FOUA 2E75D 1EG9A 1FQTA 4NBBD 5KKZC 2E4PA 1O7NA 1VCKA 3EN1A 1ZRTE 2NUMA 2FYNC 1NTKE 2HMOA 3CX5E 2GBWA 1SJGA 1WQLA 1O7PA 4QCKA 3GTSA 2BMQA 4AAYB 3H1LE 4H13D 1O7GA 2BMOA 2QJKC 1BE3E 1VM9A 1VF5D 5AEUA 2NWFA 1ULJA 2JO6A 4QUPA 2HMNA 2E4QA 3BCCE 4NBAD 4NBDD 4HM2A 2D2CD 1Q90C 4NBFD 4HM1A 2BCCE 2XR8A 2HMLA 2YFJA 3VCAA 3GKEA 1NTZE 1SQXE 4NBHD 3L70E 2E74D 3C0DA 3GB4A 4HM0A 3D89A 4QDFB 3H1KE 3GL2A 3CXHE 3N0QA 1P84E 1SQPE 1UUWA 4NBCD 2DE5D 3L75E 3H1IE 4NBED 2DE6D 5KLIC 3GL0A 1BCCE 2E76D 1JM1A 4QURA 2B1XA 2YIUC 3CWBE 2B24A 3DQYA 1G8JB 3GZYA 4HM4A
chains in the Genus database with same CATH topology
5AEWA 2YFIA 1SQVE 1L0NE 2ZT9D 2XSOA 5KLVE 1PPJE 2A06E 4QDFA 3GOBA 4HM8A 4P1BH 1UUVA 2HMKA 5BOKA 1O7HA 4PD4E 4U3FE 2JZAA 5CXMA 1KYOE 2ZYLA 3TGUE 2HMMA 2XRXA 4HM3A 2Q3WA 1PP9E 2FYUE 4QUQA 1SQQE 4EMJB 1EZVE 5HL4A 4P1CH 3H1JE 3VMGD 2NUKA 3L71E 3L73E 1RIEA 2BMRA 2YVJB 2NVFA 2NVGA 2I7FA 1NYKA 1KB9E 1SQBE 4HM6A 3L72E 2QJPC 4AIVA 4PV1D 1G8KB 4OGQD 1ULIA 3GZXA 2HMJA 4HKVA 4H44D 2YFLA 3AZCA 3GCEA 1L0LE 2NVEA 4NB9D 4QDCA 4HM7A 2GBXA 1RFSA 1NTME 4QDDA 4NB8D 2QJYC 3H1HE 2QPZA 4HJLA 3VMHD 1NU1E 2IBZE 2XSHA 3VCPA 4NBGD 3EQQA 1O7MA 1O7WA 2CKFA 3GTEA 4H0LD 1NDOA 3L74E 4HM5A 3VMID 2DE7D 3FOUA 2E75D 1EG9A 1FQTA 4NBBD 5KKZC 2E4PA 1O7NA 1VCKA 3EN1A 1ZRTE 2NUMA 2FYNC 1NTKE 2HMOA 3CX5E 2GBWA 1SJGA 1WQLA 1O7PA 4QCKA 3GTSA 2BMQA 4AAYB 3H1LE 4H13D 1O7GA 2BMOA 2QJKC 1BE3E 1VM9A 1VF5D 5AEUA 2NWFA 1ULJA 2JO6A 4QUPA 2HMNA 2E4QA 3BCCE 4NBAD 4NBDD 4HM2A 2D2CD 1Q90C 4NBFD 4HM1A 2BCCE 2XR8A 2HMLA 2YFJA 3VCAA 3GKEA 1NTZE 1SQXE 4NBHD 3L70E 2E74D 3C0DA 3GB4A 4HM0A 3D89A 4QDFB 3H1KE 3GL2A 3CXHE 3N0QA 1P84E 1SQPE 1UUWA 4NBCD 2DE5D 3L75E 3H1IE 4NBED 2DE6D 5KLIC 3GL0A 1BCCE 2E76D 1JM1A 4QURA 2B1XA 2YIUC 3CWBE 2B24A 3DQYA 1G8JB 3GZYA 4HM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AEW A;  2YFI A;  1SQV E;  1L0N E;  2ZT9 D;  2XSO A;  5KLV E;  1PPJ E;  2A06 E;  4QDF A;  3GOB A;  4HM8 A;  4P1B H;  1UUV A;  2HMK A;  5BOK A;  1O7H A;  4PD4 E;  4U3F E;  2JZA A;  5CXM A;  1KYO E;  2ZYL A;  3TGU E;  2HMM A;  2XRX A;  4HM3 A;  2Q3W A;  1PP9 E;  2FYU E;  4QUQ A;  1SQQ E;  4EMJ B;  1EZV E;  5HL4 A;  4P1C H;  3H1J E;  3VMG D;  2NUK A;  3L71 E;  3L73 E;  1RIE A;  2BMR A;  2YVJ B;  2NVF A;  2NVG A;  2I7F A;  1NYK A;  1KB9 E;  1SQB E;  4HM6 A;  3L72 E;  2QJP C;  4AIV A;  4PV1 D;  1G8K B;  4OGQ D;  1ULI A;  3GZX A;  2HMJ A;  4HKV A;  4H44 D;  2YFL A;  3AZC A;  3GCE A;  1L0L E;  2NVE A;  4NB9 D;  4QDC A;  4HM7 A;  2GBX A;  1RFS A;  1NTM E;  4QDD A;  4NB8 D;  2QJY C;  3H1H E;  2QPZ A;  4HJL A;  3VMH D;  1NU1 E;  2IBZ E;  2XSH A;  3VCP A;  4NBG D;  3EQQ A;  1O7M A;  1O7W A;  2CKF A;  3GTE A;  4H0L D;  1NDO A;  3L74 E;  4HM5 A;  3VMI D;  2DE7 D;  3FOU A;  2E75 D;  1EG9 A;  1FQT A;  4NBB D;  5KKZ C;  2E4P A;  1O7N A;  1VCK A;  3EN1 A;  1ZRT E;  2NUM A;  2FYN C;  1NTK E;  2HMO A;  3CX5 E;  2GBW A;  1SJG A;  1WQL A;  1O7P A;  4QCK A;  3GTS A;  2BMQ A;  4AAY B;  3H1L E;  4H13 D;  1O7G A;  2BMO A;  2QJK C;  1BE3 E;  1VM9 A;  1VF5 D;  5AEU A;  2NWF A;  1ULJ A;  2JO6 A;  4QUP A;  2HMN A;  2E4Q A;  3BCC E;  4NBA D;  4NBD D;  4HM2 A;  2D2C D;  1Q90 C;  4NBF D;  4HM1 A;  2BCC E;  2XR8 A;  2HML A;  2YFJ A;  3VCA A;  3GKE A;  1NTZ E;  1SQX E;  4NBH D;  3L70 E;  2E74 D;  3C0D A;  3GB4 A;  4HM0 A;  3D89 A;  4QDF B;  3H1K E;  3GL2 A;  3CXH E;  3N0Q A;  1P84 E;  1SQP E;  1UUW A;  4NBC D;  2DE5 D;  3L75 E;  3H1I E;  4NBE D;  2DE6 D;  5KLI C;  3GL0 A;  1BCC E;  2E76 D;  1JM1 A;  4QUR A;  2B1X A;  2YIU C;  3CWB E;  2B24 A;  3DQY A;  1G8J B;  3GZY A;  4HM4 A; 
#chains in the Genus database with same CATH topology
 5AEW A;  2YFI A;  1SQV E;  1L0N E;  2ZT9 D;  2XSO A;  5KLV E;  1PPJ E;  2A06 E;  4QDF A;  3GOB A;  4HM8 A;  4P1B H;  1UUV A;  2HMK A;  5BOK A;  1O7H A;  4PD4 E;  4U3F E;  2JZA A;  5CXM A;  1KYO E;  2ZYL A;  3TGU E;  2HMM A;  2XRX A;  4HM3 A;  2Q3W A;  1PP9 E;  2FYU E;  4QUQ A;  1SQQ E;  4EMJ B;  1EZV E;  5HL4 A;  4P1C H;  3H1J E;  3VMG D;  2NUK A;  3L71 E;  3L73 E;  1RIE A;  2BMR A;  2YVJ B;  2NVF A;  2NVG A;  2I7F A;  1NYK A;  1KB9 E;  1SQB E;  4HM6 A;  3L72 E;  2QJP C;  4AIV A;  4PV1 D;  1G8K B;  4OGQ D;  1ULI A;  3GZX A;  2HMJ A;  4HKV A;  4H44 D;  2YFL A;  3AZC A;  3GCE A;  1L0L E;  2NVE A;  4NB9 D;  4QDC A;  4HM7 A;  2GBX A;  1RFS A;  1NTM E;  4QDD A;  4NB8 D;  2QJY C;  3H1H E;  2QPZ A;  4HJL A;  3VMH D;  1NU1 E;  2IBZ E;  2XSH A;  3VCP A;  4NBG D;  3EQQ A;  1O7M A;  1O7W A;  2CKF A;  3GTE A;  4H0L D;  1NDO A;  3L74 E;  4HM5 A;  3VMI D;  2DE7 D;  3FOU A;  2E75 D;  1EG9 A;  1FQT A;  4NBB D;  5KKZ C;  2E4P A;  1O7N A;  1VCK A;  3EN1 A;  1ZRT E;  2NUM A;  2FYN C;  1NTK E;  2HMO A;  3CX5 E;  2GBW A;  1SJG A;  1WQL A;  1O7P A;  4QCK A;  3GTS A;  2BMQ A;  4AAY B;  3H1L E;  4H13 D;  1O7G A;  2BMO A;  2QJK C;  1BE3 E;  1VM9 A;  1VF5 D;  5AEU A;  2NWF A;  1ULJ A;  2JO6 A;  4QUP A;  2HMN A;  2E4Q A;  3BCC E;  4NBA D;  4NBD D;  4HM2 A;  2D2C D;  1Q90 C;  4NBF D;  4HM1 A;  2BCC E;  2XR8 A;  2HML A;  2YFJ A;  3VCA A;  3GKE A;  1NTZ E;  1SQX E;  4NBH D;  3L70 E;  2E74 D;  3C0D A;  3GB4 A;  4HM0 A;  3D89 A;  4QDF B;  3H1K E;  3GL2 A;  3CXH E;  3N0Q A;  1P84 E;  1SQP E;  1UUW A;  4NBC D;  2DE5 D;  3L75 E;  3H1I E;  4NBE D;  2DE6 D;  5KLI C;  3GL0 A;  1BCC E;  2E76 D;  1JM1 A;  4QUR A;  2B1X A;  2YIU C;  3CWB E;  2B24 A;  3DQY A;  1G8J B;  3GZY A;  4HM4 A; 
#chains in the Genus database with same CATH homology
 5AEW A;  2YFI A;  1SQV E;  1L0N E;  2ZT9 D;  2XSO A;  5KLV E;  1PPJ E;  2A06 E;  4QDF A;  3GOB A;  4HM8 A;  4P1B H;  1UUV A;  2HMK A;  5BOK A;  1O7H A;  4PD4 E;  4U3F E;  2JZA A;  5CXM A;  1KYO E;  2ZYL A;  3TGU E;  2HMM A;  2XRX A;  4HM3 A;  2Q3W A;  1PP9 E;  2FYU E;  4QUQ A;  1SQQ E;  4EMJ B;  1EZV E;  5HL4 A;  4P1C H;  3H1J E;  3VMG D;  2NUK A;  3L71 E;  3L73 E;  1RIE A;  2BMR A;  2YVJ B;  2NVF A;  2NVG A;  2I7F A;  1NYK A;  1KB9 E;  1SQB E;  4HM6 A;  3L72 E;  2QJP C;  4AIV A;  4PV1 D;  1G8K B;  4OGQ D;  1ULI A;  3GZX A;  2HMJ A;  4HKV A;  4H44 D;  2YFL A;  3AZC A;  3GCE A;  1L0L E;  2NVE A;  4NB9 D;  4QDC A;  4HM7 A;  2GBX A;  1RFS A;  1NTM E;  4QDD A;  4NB8 D;  2QJY C;  3H1H E;  2QPZ A;  4HJL A;  3VMH D;  1NU1 E;  2IBZ E;  2XSH A;  3VCP A;  4NBG D;  3EQQ A;  1O7M A;  1O7W A;  2CKF A;  3GTE A;  4H0L D;  1NDO A;  3L74 E;  4HM5 A;  3VMI D;  2DE7 D;  3FOU A;  2E75 D;  1EG9 A;  1FQT A;  4NBB D;  5KKZ C;  2E4P A;  1O7N A;  1VCK A;  3EN1 A;  1ZRT E;  2NUM A;  2FYN C;  1NTK E;  2HMO A;  3CX5 E;  2GBW A;  1SJG A;  1WQL A;  1O7P A;  4QCK A;  3GTS A;  2BMQ A;  4AAY B;  3H1L E;  4H13 D;  1O7G A;  2BMO A;  2QJK C;  1BE3 E;  1VM9 A;  1VF5 D;  5AEU A;  2NWF A;  1ULJ A;  2JO6 A;  4QUP A;  2HMN A;  2E4Q A;  3BCC E;  4NBA D;  4NBD D;  4HM2 A;  2D2C D;  1Q90 C;  4NBF D;  4HM1 A;  2BCC E;  2XR8 A;  2HML A;  2YFJ A;  3VCA A;  3GKE A;  1NTZ E;  1SQX E;  4NBH D;  3L70 E;  2E74 D;  3C0D A;  3GB4 A;  4HM0 A;  3D89 A;  4QDF B;  3H1K E;  3GL2 A;  3CXH E;  3N0Q A;  1P84 E;  1SQP E;  1UUW A;  4NBC D;  2DE5 D;  3L75 E;  3H1I E;  4NBE D;  2DE6 D;  5KLI C;  3GL0 A;  1BCC E;  2E76 D;  1JM1 A;  4QUR A;  2B1X A;  2YIU C;  3CWB E;  2B24 A;  3DQY A;  1G8J B;  3GZY A;  4HM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...