5KLIC

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 52
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kliC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kliC02
1FQTA 3GL2A 1S5LX 2D2CB 3D89A 4NBBD 2YFJA 4HKVA 5HL4A 3C0DA 4H0LB 3H1KE 3L75E 4QDFB 1O7PA 2FYNC 3H1LE 2ZT9D 2XR8A 2NVEA 4OGQB 1SQBE 2NVGA 3CXHE 3C8VA 2E74B 1O7HA 3L73E 4PV1D 3BCCE 4QDDA 1O7GA 1ULIA 2HMKA 1VF5B 2K9YA 1EZVE 1RFSA 4HM2A 1SJGA 2QSIA 4I7ZB 1O7MA 2ZYLA 2B1XA 2A06E 5AEUA 2WSFJ 3GTSA 4QUPA 3H1JE 3L72E 2BMQA 4H13B 4PD4E 4P1CH 1SQPE 4QDFA 4QURA 1UUWA 2IBZE 3GZYA 3L71E 1Q90D 2B24A 5KLIC 2E76D 2HMJA 3VCAA 3EQQA 4NB8D 4HJLA 4QDCA 1KB9E 2BMRA 3GB4A 3VMID 2I7FA 2CKFA 1EG9A 2YFLA 1VM9A 2WSCJ 2HMNA 2JO6A 2HMLA 4AIVA 5BOKA 3FOUA 4H44D 2YFIA 2ZT9B 4P1BH 1NYKA 2JZAA 2NUMA 2XSOA 1Q90C 2Q3WA 2XSHA 2E75D 2GBXA 4PV1B 4NBHD 2QJKC 4Y28J 1KYOE 1ZRTE 3VMHD 4KT0J 4NBGD 4NBDD 1WQLA 4HM4A 3AZCA 2E4PA 4HM8A 5AEWA 3GCEA 4HM1A 2D2CD 3H1IE 1UUVA 2WPVB 2QJPC 4NBED 5KLVE 2YVJB 1NU1E 2DE7D 1NTZE 4H0LD 3VMGD 5L8RJ 1RIEA 4NBCD 1G8JB 3GTEA 2GBWA 3L74E 2WSEJ 2QJYC 1PPJE 2QIWA 3TGUE 2E76B 4OGQD 2NUKA 2XRXA 3VCPA 1P84E 3N0QA 4HM0A 2E4QA 2O01J 1L0NE 2E74D 3L70E 2QPZA 4HM3A 2HMMA 3H1HE 3GL0A 4HM7A 1VF5D 1BE3E 4NB9D 4RKUJ 2BCCE 4HM6A 3GZXA 1PP9E 2HMOA 1BCCE 1SQQE 1O7NA 4H44B 2YIUC 4NBAD 4QUQA 3LW5J 1O7WA 1NTME 3GKEA 5KKZC 4H13D 4EMJB 2BMOA 3DQYA 2E75B 3GOBA 4QCKA 1L0LE 4U3FE 1G8KB 1JM1A 1NDOA 1JB0J 1ULJA 1VCKA 2DE6D 4IL6X 2FYUE 4NBFD 3CWBE 4HM5A 1NTKE 5CXMA 2NWFA 3CX5E 4AAYB 1SQXE 3EN1A 2DE5D 1SQVE 2NVFA
chains in the Genus database with same CATH superfamily
1FQTA 4NBBD 5HL4A 2GM4A 1GW3A 1K73Q 2YIUB 3V2PA 3FWNA 1VQMP 2BASA 3R2PA 1BGYE 1ZMEC 3E1IA 1M1JC 4PV1D 1LWUB 1HBWA 1JY3O 1IK9A 3KZIH 2K3RA 5APVA 1OVRA 4DOJA 3SFDC 4QURA 4P1CH 1L0LJ 4HB1A 5AVQB 4U3FD 2I8DA 1K8AQ 1SQXD 2A45H 2IYPA 1SQVK 1L4AD 2BCCD 1ZLLA 3CCVP 1JMBA 5AW6B 3RL0g 1QL1A 1WQLA 4HM8A 3CX5D 2QJPC 4XA4A 3CXHI 4NBCD 3L72D 3CCSP 4IOIH 1JY3N 1EZVI 1FU1A 2IX7C 2QPZA 3MTUE 4HM7A 3ITKA 1BE3E 3KZIE 2M0BA 1KFNA 1LP1B 1OW8A 1S5LE 1LTIC 4PJ0H 4NBAD 2YMKA 5K5GB 1L0NG 1N73A 4ZKUA 2E74C 3T97A 1FDIA 3RBZA 1LTTC 2HYNA 1JTHB 1VQ9P 5KJ7A 4U3FG 1D7MA 5KLVD 1SQXG 2JR8A 5AW5B 1IFPA 2YMYA 3MZWB 1GK6A 1JY2P 3TGUD 2FYUK 2C0XA 4N3YB 1O7GA 1PGJA 1Y8AA 3EFGA 4WY4C 3RK2C 1PP9D 3H1JE 2M3BA 1FDMA 1SVFA 2CPBA 1QX8A 3CPWO 1SQBK 1YI2P 2HG5D 1U57A 4N78D 1SQVJ 2FXPA 3V4QA 3L72G 4QDCA 1U7MA 2CK3H 4N6JA 3S4RA 3L70D 2B9BA 1DEEG 3H1KD 4PJ0E 1VQPP 1YITP 4BRYB 2XSHA 1BGYJ 2RKLA 2WITA 2KSJA 1ZRTE 5TISH 2OYIB 3KXDA 4HM1A 4IFFA 1G1IA 1NU1E 2GBWA 1SQPD 1NHLA 5CCGD 3TF5A 5KLVG 2KNCA 1KB9H 1KFMA 1PGOA 3NFQA 3RL0B 3SWFA 3TGUG 4D6TD 2OTLP 1URQA 5KKZC 2P7JA 2PRRA 4MN4C 2QJYB 1DX7A 2O1JA 1PP9G 2W6AA 1DD3A 3L71D 4NPFX 3CCRP 3NMDA 1N86A 1J1EC 1KQSO 1NTKG 2ZYAA 3SWYA 3KYQA 1GZLA 2H8PD 3HE5A 1NKZB 1PPJD 1NU1K 5CCHA 3BCCE 3H1KG 2ZXXA 4QDDA 5TISE 2RN0A 1BE3J 2G3AA 1IFNA 4W7ZA 2H88C 2XKMA 2N9BA 2WPRA 4W80A 2IBZE 1YTZI 1U7JA 4NPEA 4PV1C 1HTLC 1LT9B 3KQGA 5KLIC 2HMJA 1IFDA 1KQGB 5BU8B 1SQPG 1OXZA 1KB9E 2BMRA 3GB4A 4IL6H 1N7LA 2CKFA 1R5LA 1NWQA 3RL0D 3H1HD 3GLMA 2HR3A 2JJLA 1YJ9P 4XFJA 2QJKC 3II6A 4D6TG 2A45I 4AYCA 3M9QA 3QH9A 1M1JB 3K5BA 4KHXA 3JC22 3H1IE 5AVWB 2YVJB 1FC2C 1L4AC 3CLQA 2WSEH 1FDOA 3AE5C 4JF7A 4L74A 2NUKA 2O01H 3AE1C 3F5HA 4EDFA 1RQUA 3QWOC 1IC2A 3G3ZA 1PPJG 1SQQE 4EYYQ 1JM0A 1GK4A 2YIUC 1MV8A 2P1JA 1ULJA 2QA4P 1LWUC 3B71A 4GOEA 1BCCG 3E7KA 2LKMA 1EDLA 4W7YA 1FAVA 3MP7B 3CL3D 1GW4A 1RF1A 3C0DA 1NU1J 1X0TA 4U7JA 3U1CA 3L75E 5CJ4A 2FYZA 3C1LA 5B5EH 3D70A 1LGHB 2HMKA 1FZCB 3H1LJ 2JWDA 3GTSA 1M1KQ 4GT1A 1CI6B 4C7NB 3CMAP 2Q9IA 4H13B 1WMKA 1FE6A 1XTCC 2B87A 4KJMA 1KILA 1H89A 1J2JB 2KS1A 4CPGA 4EIJA 4TT3H 3HD7A 2WQYC 5CHXA 5AVTB 1FZBA 3PLNA 1LTJC 4HJGH 3IN6A 3HE4A 2K9JA 3BCCJ 1NGMB 3V5BA 2Q7CA 1AFOA 4PD4H 2Q5UA 3I55P 1H88A 2H7HA 1KC8Q 1HWTC 3RK2B 2W8ZA 3N0QA 3O8ZA 3V2RA 1NVOA 1AJYA 1JY2O 1KZUB 1MZ9A 3G71P 1OMIA 2IBZI 3LW5J 3O6QA 3SSUA 4H13D 5CCGC 3MUDA 1KB9I 3M0DA 4R4LA 3EN1A 3JCUE 3CCJP 1L0LG 3H1IJ 1IFJA 2O01N 2YXQB 4GOFA 1NJIQ 2KOGA 1NTMK 1NYHA 2M5AA 3L73E 1OVVA 3S9OA 2I1JA 1K9MQ 4EOTA 2HPCA 4ZMDA 1GU4A 1PFIA 1QVGO 1SQQJ 3HUSB 1YTZT 4PD4E 2OYHA 1CW5A 1EZVG 1R5SA 2XNXA 3RK2D 3CCUP 2OYIC 1FBMA 3HRNA 1JY2N 3VMID 2HLOA 2I7FA 1DEBA 4I2LC 3L4FA 2YKPA 3L75J 3AECC 2XSOA 1W2BO 3V2NA 1HJ0A 4Y99B 1NH4A 3RL0C 2M3EA 2P58A 3G6EP 4Z1MH 2IZ1A 1NTZE 3AE3C 2WSEJ 2QJYC 1Z56A 1N2DC 2O01J 1G2CB 4HH2A 3GF7A 1FS0E 2WZ7A 5KLIB 1EDKA 2ZAEB 1Y9BA 3RGUA 5M1BA 1S3JA 1SFCA 3H32A 2ITAA 2P10A 1T3UA 1ZN5A 1DH3A 1IFIA 2D2CB 1YJWP 3A2AA 2WT7A 1OWAA 1RE4A 2NPSA 1VQOP 1PV3A 2ZJSE 1SP4A 2AXTH 1SQVG 4OH8B 3MIWA 1P84H 1LT9C 1KQLA 1L4AB 1NTZK 1FZAA 1CZQA 2J59M 3VTPC 1RFSA 1QEXA 1BE3D 3CCEP 1BGYG 3GMAA 1RE3A 2PP6A 2JDIH 2YO2A 2E5YA 1SLQA 3CMEP 1VQNP 1QVFO 3EQQA 1LTGC 1M7LA 4NB8D 2RMZA 1L0ND 2O1KA 5BOKA 2N1TA 3NXSA 1LTAC 1S5LH 2R3CA 1HF9A 3L73J 3A5TA 3F89A 2D2CD 5L8RJ 1N73B 3H1JD 1N8RQ 1VQ7P 1G8JB 3L74E 3BATA 2AXTE 1ZOYC 3P7KA 3T97B 4O9BA 1P84E 1EQ7A 3AEBC 3GL0A 4R4MA 3CD6P 3VMAA 1JCCA 2KI7B 4PD4I 2QG4A 1YQ3C 3TDKA 3N7NA 2MJZA 1BE3G 2FYUE 1J1DB 2O3JA 1LTJB 5DJTB 2OYOA 1FZCC 2NZ2A 1YYCA 1GL2A 1NTZJ 4H13C 4OGQB 2A45G 3GF3A 1SQBE 5CBOA 3RK3E 3CI9A 3GG2A 1E79H 1UUWA 3P8MC 3CX5H 2B24A 1HGVA 3UIAA 3H1JG 4I1LA 1KTMA 5KJ7D 5AW2B 1HUCA 4JPZB 2Y9YA 3L35A 4I6MC 2ZT9B 2Z4EA 4LC1A 3AEEC 4B86A 2KNCB 2KIKA 3BCCD 5GTHH 1PGQA 5GTIH 1AQ5A 4HM4A 4NBDD 4DZOA 4LGDE 1Q81Q 5AW3B 1NTKD 5KAFH 3VYIA 1URQB 5AVYB 3A0BH 2QIWA 5H2FH 4OGQD 1ZXGA 2IBZD 2L5GB 2FFDC 1NU1G 2HMMA 3CCQP 2BCCE 3GZXA 1KB9D 2HMOA 3TSIA 1PGPA 1RF0C 3CCMP 5C39A 3AEDC 1S9KE 1Y47A 1VCKA 5CXMA 3CX5E 2FY8A 3M91A 3GL2A 1IK7A 1K04A 3HUSC 1N7SA 1VQ5P 4M3LA 3L74J 3H1LE 2ZT9D 2E42A 2W27A 3LW5H 3BRVB 1SQXK 1NKNA 1JO5A 5GTHE 5GTIE 1GD2E 1PZQA 5AW8B 2ZYLA 2B1XA 4EI2A 5KAFE 1AQTA 3BCCG 1P84I 1URQD 2FYNB 2FYUJ 3GZYA 3G9RA 3A0BE 5H2FE 3U59A 4Y99C 5APTA 1CSBA 1FJPA 2IBZG 2IDBA 4BRYA 1EXIA 2HMLA 5APYA 1LJ2A 2J58A 3A7OA 3L75D 1ZR2A 1FOSF 2Q3WA 3GHGA 1BCCD 1SQBJ 1IJDB 5AVSB 3LIDA 5CCHD 5B66H 5AW0B 3AZCA 1AA0A 2WPVB 3P32A 4N78E 3LIEA 1XTGB 2E76B 1A02F 1A02J 3H1IG 3L70E 3AE4C 1LT1A 2D2CC 4A7PA 1EDIA 4NB9D 1PL5A 2LXCB 1VL2A 3P8CD 2GUSA 5KLVK 5AVUB 1MFZA 4EMJB 1SQVE 1YJNP 4HM5A 1SQQG 1X22A 2E5TA 3M9BA 5AW4B 3TNUA 4U3FJ 2QVAA 2I1KA 1FJKA 1ZR4A 3VMZA 2XR8A 2NVEA 1EXJA 2B87B 2IZ0A 1KILB 3M0AA 2KS1B 1NTKK 2YNYA 5AW9B 2FXMA 3L75G 5B66E 2HODB 3HD7B 2BCCJ 4I7ZB 1O7MA 1JY3P 3A0HH 3CCLP 2DW3A 4L75A 3AEGC 2WTYA 1UIIA 3HE4B 1YIJP 3L71E 1EDJA 2E76D 1HGZA 3Q1MA 2ZYDA 4HJLA 3CC4P 3L72J 3B5NA 4GIFA 3JSVC 1EG9A 2HMNA 3B4SA 2K1AA 1N73C 4L76A 3D6YA 3SFEC 1NYKA 1SQPK 3CX5I 2JZAA 4GKGA 4ASVA 3HTKB 1OVUA 1M1JA 4DT0A 3D71A 1L0LD 1QLED 5KJ7C 3JCUH 1QGKB 1RY3A 5CJ0A 2Q3IA 3VMGD 3O6QB 1RIEA 4PD4D 1J1DC 1KILD 2KZIA 1BDCA 1LTBC 2YO3A 3H1HE 4YXDC 5KLVJ 5KTBA 3HD7D 4RKUJ 3CXHD 4JYBA 1IZNB 5APXA 3TGUJ 3A0HE 1HJBA 1EZVD 1NTME 2VRSA 4OGQC 2A06D 2DE6D 1JB0J 1MKMA 4BWNA 1BSHA 3CWBE 1PP9J 2DE5D 1GMJA 3FXEA 3L36A 4JYCA 2OYHB 2M8RA 2XU6A 2HFED 4AQRD 1R8EA 3CC2P 3L70J 1VF5B 2V7QH 1CI6A 4C7NA 1YHQP 3G4SP 1M57D 2Q1KA 2FFDB 3V6IA 3L73G 2ZT9C 4QDFA 1K05A 3IR9A 2AEMA 4C46A 2E43A 2SPZA 2H43A 1GU5A 1DIPA 2YFLA 1URQC 2QM8A 3V2QA 1X8YA 2Q3EA 4Y28J 3S1KA 2OARA 4D6TJ 2WPSA 2A06G 4WY4A 3WUTA 1SQVD 1FZEA 3KDPB 4JQ0D 4YTPC 3BVHA 3L71J 5CCHC 1YQ4C 2R5DA 3H32B 1AVOA 1NTZG 1VF5D 1BGYD 4OVNF 4HM6A 3PRJA 2WT7B 2NPSB 3IAOA 3GKEA 4RJTA 3GOBA 1GTWA 1OZHA 2GUVA 1VQLP 1ZW0A 1RHZB 1AVYA 3V4WA 2Y0CA 2FYNC 5BVZA 1L0LK 3H25A 2NVGA 3H1HJ 2NRGA 2QRXA 4RO0A 3FGAD 2P2UA 1UIXA 2N1TB 3L37A 2C9LY 1NTMJ 1OFCX 2K37A 3MHVA 2QE7H 3OJAB 5AW1B 3CWBJ 4JBZA 4TLFA 1S1CX 2Q6QA 3PTZA 1JEKA 3W67A 2NPSD 3C9IA 2XDJA 1H0TA 1MFTA 2E76C 4NBHD 1M8OB 1SQBD 3VOPA 3USSA 1W2EA 5KAIH 1RF1C 2JEEA 2DE7D 2UWJE 1LNQA 2JKVA 2R44A 2XRXA 1PIXA 2OTJP 4HM3A 3VMXA 1Q82Q 3L74G 3R4YA 1T3JA 1GL2B 3Q2YA 3MGNA 4YXWH 2N1TD 2WSSH 2R3SA 2E75B 1KYOH 1KILC 1NDOA 4NBFD 5CBNA 3HD7C 5DJUB 4I7ZC 4HKVA 2FYUG 3Q5RA 2R5BA 2BEQD 1L4AA 4OWFA 1NOHA 2R32A 2V4HA 3C8VA 2K88A 1BSNA 1NAYA 2K9YA 3EFFK 2C9NY 2V7QJ 2W83C 2JO1A 1VQKP 1ZRTD 1SQBG 5KAIE 4RESB 2AEJA 3TYYA 2J5UA 1Q7YQ 3Q5PA 4K3AA 1Q90D 3ABVC 1NU1D 1S9KD 1LWUA 1FOSE 3VCAA 4H44C 4GDOA 1VM9A 1HVVA 2WSCJ 4ZNCA 1GL2D 4AIVA 4P1BH 3MUDC 2E75D 3H1LD 2GBXA 3M0DC 1KYOE 2KP8A 3EQ2A 4HM0A 1L0NE 2KB7P 2YKOA 4NPDA 4UB6H 3AEFC 3FWLA 1Q86Q 1DD4A 2JWAA 1N7SB 4QUQA 2OYHC 1LTJA 2QM7A 1IFMA 3DQYA 4QCKA 4U3FE 2BEZF 2BCCG 2B88A 1HH0A 4IL6X 1SQXE 1VF5C 3PHLA 1AV1A 5TJHA 1E5WA 2N9YB 1FZGA 1G1JA 1LP1A 4H0LB 2KZJA 1VDFA 4XE5B 1QL2A 3HE5B 1T2KD 1M56D 1JTHA 2ZFCA 3H1LG 3WMM0 2POHA 1L0NK 1W5CE 3L72E 3AE7C 2BMQA 3GHGB 2IFNA 3H1ID 5CCGA 5AW7B 3AE8C 1ZP0C 3IFMA 2MKVA 3N4XA 4DCKA 5AVZB 4UB6E 1JMMA 2JO6A 3FOUA 1N7SD 2IFMA 3OAKA 2KLVA 2LXBA 4C7RA 1VPCA 1SQQD 1SFCC 3VMYA 3VMHD 2E4PA 3VP9A 1RE4C 2NPSC 1OW7A 1UUVA 5KLVE 4H0LD 4YPCA 4L73A 3TGUE 3FX0A 2E4QA 1BDDA 4WB4A 3RK3C 2OYIA 2JP3A 3TNUB 1RE3C 1PP9E 4AUWA 5AVRB 1OX3A 2KLUA 2IYOA 3L70G 3PJSK 2KXPB 1KMIZ 1NTKE 3WUUA 4ZKPA 1KQFB 2OQQA 2FXOA 2N1TC 3H1KE 2XZRA 1KYOI 3EWKA 1RF1B 2C0WA 4GODA 1YBKA 1L0NJ 2PGDA 3AEAC 3B5NB 4HM2A 1SJGA 2WSFH 3M9HA 2WMMA 2FBWC 5AEUA 1SQPE 3TK1A 2ZYGA 3SWKA 1NTMD 1OIPA 3M06A 2RH0A 1M90Q 1SQXJ 2B89A 2KUBA 3CWBD 2KSEA 4WVZA 3H1JJ 1VQ8P 2KYVA 4D6TE 3L71G 3ZDMA 2H89C 1Q90C 1LT9A 1USDA 1JOCA 1EC5A 2WVRA 2K9JB 3NTNA 3OA7A 5AEWA 3W68A 1GL2C 4IFMA 1IO4A 3D6ZA 1SS1A 1WRGA 1KV4A 3GW6A 2E75C 2Z5HA 1PPJE 4IL6E 5APUA 5APQA 3B5ND 3VP8A 3L73D 1BCCE 2OGUA 2QJPB 4H44B 3H1HG 3AE2C 1G8KB 1JM1A 1H8AA 4AAYB 1S2EA 2W90A 1VQ4P 1USEA 3AE9C 1NTMG 1TU3F 1ZV8A 5BU5A 2YFJA 4QMAA 4WWIA 3PH0A 3CWBG 1SQQK 4QDFB 1O7PA 3E1RA 2HODA 1O7HA 2E74B 3P8CE 1ULIA 2M5AB 2FKWB 2HPCB 1WT6A 2OTKE 4LLHA 3AE6C 2WWWA 1NTKJ 1NTZD 1T2KC 1JNMA 1L2PA 2ZVOB 1FZCA 1MUUA 2XNDH 1RH5B 4WY4B 2WPQA 3H1KJ 2LR2A 3HTKA 3IF4A 4H44D 5AVXB 3BRTB 3CXHH 2ZXEB 5B5EE 1NAFA 5APSA 4NBGD 3CC7P 1T8ZA 3GCEA 1X79B 4DJGA 2XV5A 4NBED 1N7SC 1SQPJ 3Q3DA 2WSCH 1NO4A 1VQ6P 3VCPA 2E74D 2L91A 5EFWB 4UB8H 2YXRB 3I5CA 4IFDK 2Y9ZA 4H0LC 2G8YA 1O7NA 1JUNA 2Y0EA 2W6BA 3A3YB 3WU2H 3WUVA 1O7WA 1L0LE 1JCDA 1KN7A 2NVFA 3OW2O 1S5LX 4WBAA 1SFCB 2PFXA 2Y0DA 3D89A 4WY4D 5E79H 1KILE 2Z5IA 3GHGC 5KKZB 4HKZH 3MD0A 1T6AA 2W6JH 3KPEA 3CXHE 1S72P 2FFDA 2PAJA 1EZVE 2QSIA 3KHUA 3RBXA 1BCCJ 2A06E 3RK3B 1J1EB 2WSFJ 4ASWA 4QUPA 1RF0A 2YKQA 1H0TB 2AEFA 2QEXP 1S4XA 4HYTB 3L74D 1RQVA 4UB8E 3VN0A 1P84D 4K35A 5AVVB 3PP5A 3HUSA 2YFIA 5CMZA 2NUMA 1LTSC 3WU2E 3H6PA 3I56P 4PV1B 1Q2NA 1KORA 3Q5SA 4KT0J 3U1AA 2FYUD 1KD1Q 3B8EB 1SFCD 5E79E 3GTEA 3FXDA 2AXCA 2QJKB 2KK7A 1FZFA 2IPPA 2GA1A 2P67A 2CPSA 3BASA 3RK3D 4BXLA 1OW6A 2BMOA 5APWA 2ZVNB 1X9VA 2NWFA 1KYOD 1GDTA 1G2CA 3B5NC
chains in the Genus database with same CATH topology
1FQTA 4NBBD 5HL4A 4H0LB 2XR8A 2NVEA 1NYHA 1EXJA 1ZMEC 4PV1D 3L73E 3S9OA 4I7ZB 1O7MA 3SFDC 3AEGC 3L72E 3AE7C 2BMQA 4PD4E 4P1CH 4QURA 3L71E 2E76D 3AE8C 3Q1MA 1ZP0C 4HJLA 2MKVA 3VMID 2I7FA 1EG9A 2JO6A 2HMNA 3AECC 3FOUA 3D6YA 3SFEC 1NYKA 2JZAA 2XSOA 1HJ0A 3D71A 3VMHD 3RL0g 1WQLA 4HM8A 2E4PA 1OW7A 1UUVA 2QJPC 5KLVE 4Z1MH 1NTZE 4H0LD 3VMGD 1RIEA 3AE3C 4NBCD 2WSEJ 2QJYC 3TGUE 2E4QA 2O01J 2QPZA 4YXDC 3H1HE 3GF7A 2JP3A 4HM7A 1BE3E 4RKUJ 1PP9E 1OW8A 4NBAD 2YMKA 1NTME 1Y9BA 4OGQC 5M1BA 2DE6D 1JB0J 1KMIZ 1MKMA 2E74C 3CWBE 1FDIA 1NTKE 2DE5D 1KQFB 2P10A 2OQQA 2D2CB 1GMJA 3H1KE 1PV3A 3EWKA 1R8EA 1O7GA 3AEAC 1VF5B 1RFSA 4HM2A 1SJGA 3GMAA 2FBWC 5AEUA 3H1JE 2ZT9C 4QDFA 1K05A 1SQPE 1U57A 2FXPA 3EQQA 4NB8D 4QDCA 1DIPA 2YFLA 5BOKA 1HF9A 2H89C 1Q90C 2XSHA 4Y28J 1ZRTE 5AEWA 4HM1A 2D2CD 3D6ZA 1NU1E 5L8RJ 2E75C 1G8JB 2GBWA 3L74E 1PPJE 4YTPC 1ZOYC 3T97B 1YQ4C 1P84E 3AEBC 3GL0A 4R4MA 1VF5D 4HM6A 1BCCE 3IAOA 4H44B 1YQ3C 3GKEA 5KKZC 3AE2C 3GOBA 1G8KB 1JM1A 2FYUE 4AAYB 1DD3A 2NZ2A 3AE9C 1TU3F 2YFJA 4H13C 4QDFB 1O7PA 2FYNC 4OGQB 3GF3A 3H25A 1SQBE 2NVGA 1O7HA 2E74B 3BCCE 4QDDA 1ULIA 3RK3E 2G3AA 3FGAD 1UIXA 2H88C 3AE6C 1VF5C 1UUWA 2IBZE 4PV1C 2B24A 5KLIC 2HMJA 1S1CX 1KQGB 1KTMA 1KB9E 2BMRA 3GB4A 2CKFA 3GLMA 4H44D 2ZT9B 2E76C 4XFJA 4NBHD 2QJKC 3AEEC 4NBGD 4NBDD 4HM4A 3GCEA 3H1IE 4NBED 2YVJB 2DE7D 3Q3DA 1FDOA 3AE5C 2QIWA 4OGQD 2NUKA 2XRXA 3AE1C 3VCPA 2E74D 1PIXA 4HM3A 2HMMA 1RQUA 2BCCE 3GZXA 3R4YA 2HMOA 4H0LC 2G8YA 3Q2YA 1O7NA 1SQQE 2YIUC 1O7WA 2E75B 1L0LE 3AEDC 1NDOA 1ULJA 1VCKA 4NBFD 3B71A 5CXMA 3CX5E 2NVFA 3GL2A 1S5LX 4I7ZC 3D89A 1IK7A 4HKVA 1K04A 3C0DA 3Q5RA 1KILE 4U7JA 3L75E 2BEQD 3H1LE 2ZT9D 3CXHE 3C8VA 3D70A 2HMKA 2K9YA 1EZVE 2V7QJ 2QSIA 2ZYLA 2JO1A 2B1XA 2A06E 2WSFJ 3GTSA 4QUPA 4H13B 2J5UA 1WMKA 3Q5PA 3GZYA 3G9RA 1Q90D 3ABVC 3VCAA 4TT3H 4H44C 1RQVA 2WQYC 2IDBA 4GDOA 1EXIA 1VM9A 2WSCJ 4AIVA 2HMLA 2YFIA 4P1BH 2NUMA 2Q3WA 2E75D 3IN6A 2GBXA 4PV1B 1KORA 1KYOE 1NGMB 3Q5SA 4KT0J 3AZCA 2WPVB 3GTEA 2E76B 3N0QA 4HM0A 3L70E 1L0NE 3AE4C 2D2CC 3AEFC 4NB9D 1PL5A 1AJYA 1DD4A 1VL2A 1OMIA 4QUQA 3LW5J 3O6QA 1OW6A 4EMJB 4H13D 2BMOA 3DQYA 4QCKA 4U3FE 2BEZF 4IL6X 4HM5A 2NWFA 4R4LA 1SQXE 3EN1A 1SQVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQT A;  3GL2 A;  1S5L X;  2D2C B;  3D89 A;  4NBB D;  2YFJ A;  4HKV A;  5HL4 A;  3C0D A;  4H0L B;  3H1K E;  3L75 E;  4QDF B;  1O7P A;  2FYN C;  3H1L E;  2ZT9 D;  2XR8 A;  2NVE A;  4OGQ B;  1SQB E;  2NVG A;  3CXH E;  3C8V A;  2E74 B;  1O7H A;  3L73 E;  4PV1 D;  3BCC E;  4QDD A;  1O7G A;  1ULI A;  2HMK A;  1VF5 B;  2K9Y A;  1EZV E;  1RFS A;  4HM2 A;  1SJG A;  2QSI A;  4I7Z B;  1O7M A;  2ZYL A;  2B1X A;  2A06 E;  5AEU A;  2WSF J;  3GTS A;  4QUP A;  3H1J E;  3L72 E;  2BMQ A;  4H13 B;  4PD4 E;  4P1C H;  1SQP E;  4QDF A;  4QUR A;  1UUW A;  2IBZ E;  3GZY A;  3L71 E;  1Q90 D;  2B24 A;  5KLI C;  2E76 D;  2HMJ A;  3VCA A;  3EQQ A;  4NB8 D;  4HJL A;  4QDC A;  1KB9 E;  2BMR A;  3GB4 A;  3VMI D;  2I7F A;  2CKF A;  1EG9 A;  2YFL A;  1VM9 A;  2WSC J;  2HMN A;  2JO6 A;  2HML A;  4AIV A;  5BOK A;  3FOU A;  4H44 D;  2YFI A;  2ZT9 B;  4P1B H;  1NYK A;  2JZA A;  2NUM A;  2XSO A;  1Q90 C;  2Q3W A;  2XSH A;  2E75 D;  2GBX A;  4PV1 B;  4NBH D;  2QJK C;  4Y28 J;  1KYO E;  1ZRT E;  3VMH D;  4KT0 J;  4NBG D;  4NBD D;  1WQL A;  4HM4 A;  3AZC A;  2E4P A;  4HM8 A;  5AEW A;  3GCE A;  4HM1 A;  2D2C D;  3H1I E;  1UUV A;  2WPV B;  2QJP C;  4NBE D;  5KLV E;  2YVJ B;  1NU1 E;  2DE7 D;  1NTZ E;  4H0L D;  3VMG D;  5L8R J;  1RIE A;  4NBC D;  1G8J B;  3GTE A;  2GBW A;  3L74 E;  2WSE J;  2QJY C;  1PPJ E;  2QIW A;  3TGU E;  2E76 B;  4OGQ D;  2NUK A;  2XRX A;  3VCP A;  1P84 E;  3N0Q A;  4HM0 A;  2E4Q A;  2O01 J;  1L0N E;  2E74 D;  3L70 E;  2QPZ A;  4HM3 A;  2HMM A;  3H1H E;  3GL0 A;  4HM7 A;  1VF5 D;  1BE3 E;  4NB9 D;  4RKU J;  2BCC E;  4HM6 A;  3GZX A;  1PP9 E;  2HMO A;  1BCC E;  1SQQ E;  1O7N A;  4H44 B;  2YIU C;  4NBA D;  4QUQ A;  3LW5 J;  1O7W A;  1NTM E;  3GKE A;  5KKZ C;  4H13 D;  4EMJ B;  2BMO A;  3DQY A;  2E75 B;  3GOB A;  4QCK A;  1L0L E;  4U3F E;  1G8K B;  1JM1 A;  1NDO A;  1JB0 J;  1ULJ A;  1VCK A;  2DE6 D;  4IL6 X;  2FYU E;  4NBF D;  3CWB E;  4HM5 A;  1NTK E;  5CXM A;  2NWF A;  3CX5 E;  4AAY B;  1SQX E;  3EN1 A;  2DE5 D;  1SQV E;  2NVF A; 
#chains in the Genus database with same CATH topology
 1FQT A;  4NBB D;  5HL4 A;  2GM4 A;  1GW3 A;  1K73 Q;  2YIU B;  3V2P A;  3FWN A;  1VQM P;  2BAS A;  3R2P A;  1BGY E;  1ZME C;  3E1I A;  1M1J C;  4PV1 D;  1LWU B;  1HBW A;  1JY3 O;  1IK9 A;  3KZI H;  2K3R A;  5APV A;  1OVR A;  4DOJ A;  3SFD C;  4QUR A;  4P1C H;  1L0L J;  4HB1 A;  5AVQ B;  4U3F D;  2I8D A;  1K8A Q;  1SQX D;  2A45 H;  2IYP A;  1SQV K;  1L4A D;  2BCC D;  1ZLL A;  3CCV P;  1JMB A;  5AW6 B;  3RL0 g;  1QL1 A;  1WQL A;  4HM8 A;  3CX5 D;  2QJP C;  4XA4 A;  3CXH I;  4NBC D;  3L72 D;  3CCS P;  4IOI H;  1JY3 N;  1EZV I;  1FU1 A;  2IX7 C;  2QPZ A;  3MTU E;  4HM7 A;  3ITK A;  1BE3 E;  3KZI E;  2M0B A;  1KFN A;  1LP1 B;  1OW8 A;  1S5L E;  1LTI C;  4PJ0 H;  4NBA D;  2YMK A;  5K5G B;  1L0N G;  1N73 A;  4ZKU A;  2E74 C;  3T97 A;  1FDI A;  3RBZ A;  1LTT C;  2HYN A;  1JTH B;  1VQ9 P;  5KJ7 A;  4U3F G;  1D7M A;  5KLV D;  1SQX G;  2JR8 A;  5AW5 B;  1IFP A;  2YMY A;  3MZW B;  1GK6 A;  1JY2 P;  3TGU D;  2FYU K;  2C0X A;  4N3Y B;  1O7G A;  1PGJ A;  1Y8A A;  3EFG A;  4WY4 C;  3RK2 C;  1PP9 D;  3H1J E;  2M3B A;  1FDM A;  1SVF A;  2CPB A;  1QX8 A;  3CPW O;  1SQB K;  1YI2 P;  2HG5 D;  1U57 A;  4N78 D;  1SQV J;  2FXP A;  3V4Q A;  3L72 G;  4QDC A;  1U7M A;  2CK3 H;  4N6J A;  3S4R A;  3L70 D;  2B9B A;  1DEE G;  3H1K D;  4PJ0 E;  1VQP P;  1YIT P;  4BRY B;  2XSH A;  1BGY J;  2RKL A;  2WIT A;  2KSJ A;  1ZRT E;  5TIS H;  2OYI B;  3KXD A;  4HM1 A;  4IFF A;  1G1I A;  1NU1 E;  2GBW A;  1SQP D;  1NHL A;  5CCG D;  3TF5 A;  5KLV G;  2KNC A;  1KB9 H;  1KFM A;  1PGO A;  3NFQ A;  3RL0 B;  3SWF A;  3TGU G;  4D6T D;  2OTL P;  1URQ A;  5KKZ C;  2P7J A;  2PRR A;  4MN4 C;  2QJY B;  1DX7 A;  2O1J A;  1PP9 G;  2W6A A;  1DD3 A;  3L71 D;  4NPF X;  3CCR P;  3NMD A;  1N86 A;  1J1E C;  1KQS O;  1NTK G;  2ZYA A;  3SWY A;  3KYQ A;  1GZL A;  2H8P D;  3HE5 A;  1NKZ B;  1PPJ D;  1NU1 K;  5CCH A;  3BCC E;  3H1K G;  2ZXX A;  4QDD A;  5TIS E;  2RN0 A;  1BE3 J;  2G3A A;  1IFN A;  4W7Z A;  2H88 C;  2XKM A;  2N9B A;  2WPR A;  4W80 A;  2IBZ E;  1YTZ I;  1U7J A;  4NPE A;  4PV1 C;  1HTL C;  1LT9 B;  3KQG A;  5KLI C;  2HMJ A;  1IFD A;  1KQG B;  5BU8 B;  1SQP G;  1OXZ A;  1KB9 E;  2BMR A;  3GB4 A;  4IL6 H;  1N7L A;  2CKF A;  1R5L A;  1NWQ A;  3RL0 D;  3H1H D;  3GLM A;  2HR3 A;  2JJL A;  1YJ9 P;  4XFJ A;  2QJK C;  3II6 A;  4D6T G;  2A45 I;  4AYC A;  3M9Q A;  3QH9 A;  1M1J B;  3K5B A;  4KHX A;  3JC2 2;  3H1I E;  5AVW B;  2YVJ B;  1FC2 C;  1L4A C;  3CLQ A;  2WSE H;  1FDO A;  3AE5 C;  4JF7 A;  4L74 A;  2NUK A;  2O01 H;  3AE1 C;  3F5H A;  4EDF A;  1RQU A;  3QWO C;  1IC2 A;  3G3Z A;  1PPJ G;  1SQQ E;  4EYY Q;  1JM0 A;  1GK4 A;  2YIU C;  1MV8 A;  2P1J A;  1ULJ A;  2QA4 P;  1LWU C;  3B71 A;  4GOE A;  1BCC G;  3E7K A;  2LKM A;  1EDL A;  4W7Y A;  1FAV A;  3MP7 B;  3CL3 D;  1GW4 A;  1RF1 A;  3C0D A;  1NU1 J;  1X0T A;  4U7J A;  3U1C A;  3L75 E;  5CJ4 A;  2FYZ A;  3C1L A;  5B5E H;  3D70 A;  1LGH B;  2HMK A;  1FZC B;  3H1L J;  2JWD A;  3GTS A;  1M1K Q;  4GT1 A;  1CI6 B;  4C7N B;  3CMA P;  2Q9I A;  4H13 B;  1WMK A;  1FE6 A;  1XTC C;  2B87 A;  4KJM A;  1KIL A;  1H89 A;  1J2J B;  2KS1 A;  4CPG A;  4EIJ A;  4TT3 H;  3HD7 A;  2WQY C;  5CHX A;  5AVT B;  1FZB A;  3PLN A;  1LTJ C;  4HJG H;  3IN6 A;  3HE4 A;  2K9J A;  3BCC J;  1NGM B;  3V5B A;  2Q7C A;  1AFO A;  4PD4 H;  2Q5U A;  3I55 P;  1H88 A;  2H7H A;  1KC8 Q;  1HWT C;  3RK2 B;  2W8Z A;  3N0Q A;  3O8Z A;  3V2R A;  1NVO A;  1AJY A;  1JY2 O;  1KZU B;  1MZ9 A;  3G71 P;  1OMI A;  2IBZ I;  3LW5 J;  3O6Q A;  3SSU A;  4H13 D;  5CCG C;  3MUD A;  1KB9 I;  3M0D A;  4R4L A;  3EN1 A;  3JCU E;  3CCJ P;  1L0L G;  3H1I J;  1IFJ A;  2O01 N;  2YXQ B;  4GOF A;  1NJI Q;  2KOG A;  1NTM K;  1NYH A;  2M5A A;  3L73 E;  1OVV A;  3S9O A;  2I1J A;  1K9M Q;  4EOT A;  2HPC A;  4ZMD A;  1GU4 A;  1PFI A;  1QVG O;  1SQQ J;  3HUS B;  1YTZ T;  4PD4 E;  2OYH A;  1CW5 A;  1EZV G;  1R5S A;  2XNX A;  3RK2 D;  3CCU P;  2OYI C;  1FBM A;  3HRN A;  1JY2 N;  3VMI D;  2HLO A;  2I7F A;  1DEB A;  4I2L C;  3L4F A;  2YKP A;  3L75 J;  3AEC C;  2XSO A;  1W2B O;  3V2N A;  1HJ0 A;  4Y99 B;  1NH4 A;  3RL0 C;  2M3E A;  2P58 A;  3G6E P;  4Z1M H;  2IZ1 A;  1NTZ E;  3AE3 C;  2WSE J;  2QJY C;  1Z56 A;  1N2D C;  2O01 J;  1G2C B;  4HH2 A;  3GF7 A;  1FS0 E;  2WZ7 A;  5KLI B;  1EDK A;  2ZAE B;  1Y9B A;  3RGU A;  5M1B A;  1S3J A;  1SFC A;  3H32 A;  2ITA A;  2P10 A;  1T3U A;  1ZN5 A;  1DH3 A;  1IFI A;  2D2C B;  1YJW P;  3A2A A;  2WT7 A;  1OWA A;  1RE4 A;  2NPS A;  1VQO P;  1PV3 A;  2ZJS E;  1SP4 A;  2AXT H;  1SQV G;  4OH8 B;  3MIW A;  1P84 H;  1LT9 C;  1KQL A;  1L4A B;  1NTZ K;  1FZA A;  1CZQ A;  2J59 M;  3VTP C;  1RFS A;  1QEX A;  1BE3 D;  3CCE P;  1BGY G;  3GMA A;  1RE3 A;  2PP6 A;  2JDI H;  2YO2 A;  2E5Y A;  1SLQ A;  3CME P;  1VQN P;  1QVF O;  3EQQ A;  1LTG C;  1M7L A;  4NB8 D;  2RMZ A;  1L0N D;  2O1K A;  5BOK A;  2N1T A;  3NXS A;  1LTA C;  1S5L H;  2R3C A;  1HF9 A;  3L73 J;  3A5T A;  3F89 A;  2D2C D;  5L8R J;  1N73 B;  3H1J D;  1N8R Q;  1VQ7 P;  1G8J B;  3L74 E;  3BAT A;  2AXT E;  1ZOY C;  3P7K A;  3T97 B;  4O9B A;  1P84 E;  1EQ7 A;  3AEB C;  3GL0 A;  4R4M A;  3CD6 P;  3VMA A;  1JCC A;  2KI7 B;  4PD4 I;  2QG4 A;  1YQ3 C;  3TDK A;  3N7N A;  2MJZ A;  1BE3 G;  2FYU E;  1J1D B;  2O3J A;  1LTJ B;  5DJT B;  2OYO A;  1FZC C;  2NZ2 A;  1YYC A;  1GL2 A;  1NTZ J;  4H13 C;  4OGQ B;  2A45 G;  3GF3 A;  1SQB E;  5CBO A;  3RK3 E;  3CI9 A;  3GG2 A;  1E79 H;  1UUW A;  3P8M C;  3CX5 H;  2B24 A;  1HGV A;  3UIA A;  3H1J G;  4I1L A;  1KTM A;  5KJ7 D;  5AW2 B;  1HUC A;  4JPZ B;  2Y9Y A;  3L35 A;  4I6M C;  2ZT9 B;  2Z4E A;  4LC1 A;  3AEE C;  4B86 A;  2KNC B;  2KIK A;  3BCC D;  5GTH H;  1PGQ A;  5GTI H;  1AQ5 A;  4HM4 A;  4NBD D;  4DZO A;  4LGD E;  1Q81 Q;  5AW3 B;  1NTK D;  5KAF H;  3VYI A;  1URQ B;  5AVY B;  3A0B H;  2QIW A;  5H2F H;  4OGQ D;  1ZXG A;  2IBZ D;  2L5G B;  2FFD C;  1NU1 G;  2HMM A;  3CCQ P;  2BCC E;  3GZX A;  1KB9 D;  2HMO A;  3TSI A;  1PGP A;  1RF0 C;  3CCM P;  5C39 A;  3AED C;  1S9K E;  1Y47 A;  1VCK A;  5CXM A;  3CX5 E;  2FY8 A;  3M91 A;  3GL2 A;  1IK7 A;  1K04 A;  3HUS C;  1N7S A;  1VQ5 P;  4M3L A;  3L74 J;  3H1L E;  2ZT9 D;  2E42 A;  2W27 A;  3LW5 H;  3BRV B;  1SQX K;  1NKN A;  1JO5 A;  5GTH E;  5GTI E;  1GD2 E;  1PZQ A;  5AW8 B;  2ZYL A;  2B1X A;  4EI2 A;  5KAF E;  1AQT A;  3BCC G;  1P84 I;  1URQ D;  2FYN B;  2FYU J;  3GZY A;  3G9R A;  3A0B E;  5H2F E;  3U59 A;  4Y99 C;  5APT A;  1CSB A;  1FJP A;  2IBZ G;  2IDB A;  4BRY A;  1EXI A;  2HML A;  5APY A;  1LJ2 A;  2J58 A;  3A7O A;  3L75 D;  1ZR2 A;  1FOS F;  2Q3W A;  3GHG A;  1BCC D;  1SQB J;  1IJD B;  5AVS B;  3LID A;  5CCH D;  5B66 H;  5AW0 B;  3AZC A;  1AA0 A;  2WPV B;  3P32 A;  4N78 E;  3LIE A;  1XTG B;  2E76 B;  1A02 F;  1A02 J;  3H1I G;  3L70 E;  3AE4 C;  1LT1 A;  2D2C C;  4A7P A;  1EDI A;  4NB9 D;  1PL5 A;  2LXC B;  1VL2 A;  3P8C D;  2GUS A;  5KLV K;  5AVU B;  1MFZ A;  4EMJ B;  1SQV E;  1YJN P;  4HM5 A;  1SQQ G;  1X22 A;  2E5T A;  3M9B A;  5AW4 B;  3TNU A;  4U3F J;  2QVA A;  2I1K A;  1FJK A;  1ZR4 A;  3VMZ A;  2XR8 A;  2NVE A;  1EXJ A;  2B87 B;  2IZ0 A;  1KIL B;  3M0A A;  2KS1 B;  1NTK K;  2YNY A;  5AW9 B;  2FXM A;  3L75 G;  5B66 E;  2HOD B;  3HD7 B;  2BCC J;  4I7Z B;  1O7M A;  1JY3 P;  3A0H H;  3CCL P;  2DW3 A;  4L75 A;  3AEG C;  2WTY A;  1UII A;  3HE4 B;  1YIJ P;  3L71 E;  1EDJ A;  2E76 D;  1HGZ A;  3Q1M A;  2ZYD A;  4HJL A;  3CC4 P;  3L72 J;  3B5N A;  4GIF A;  3JSV C;  1EG9 A;  2HMN A;  3B4S A;  2K1A A;  1N73 C;  4L76 A;  3D6Y A;  3SFE C;  1NYK A;  1SQP K;  3CX5 I;  2JZA A;  4GKG A;  4ASV A;  3HTK B;  1OVU A;  1M1J A;  4DT0 A;  3D71 A;  1L0L D;  1QLE D;  5KJ7 C;  3JCU H;  1QGK B;  1RY3 A;  5CJ0 A;  2Q3I A;  3VMG D;  3O6Q B;  1RIE A;  4PD4 D;  1J1D C;  1KIL D;  2KZI A;  1BDC A;  1LTB C;  2YO3 A;  3H1H E;  4YXD C;  5KLV J;  5KTB A;  3HD7 D;  4RKU J;  3CXH D;  4JYB A;  1IZN B;  5APX A;  3TGU J;  3A0H E;  1HJB A;  1EZV D;  1NTM E;  2VRS A;  4OGQ C;  2A06 D;  2DE6 D;  1JB0 J;  1MKM A;  4BWN A;  1BSH A;  3CWB E;  1PP9 J;  2DE5 D;  1GMJ A;  3FXE A;  3L36 A;  4JYC A;  2OYH B;  2M8R A;  2XU6 A;  2HFE D;  4AQR D;  1R8E A;  3CC2 P;  3L70 J;  1VF5 B;  2V7Q H;  1CI6 A;  4C7N A;  1YHQ P;  3G4S P;  1M57 D;  2Q1K A;  2FFD B;  3V6I A;  3L73 G;  2ZT9 C;  4QDF A;  1K05 A;  3IR9 A;  2AEM A;  4C46 A;  2E43 A;  2SPZ A;  2H43 A;  1GU5 A;  1DIP A;  2YFL A;  1URQ C;  2QM8 A;  3V2Q A;  1X8Y A;  2Q3E A;  4Y28 J;  3S1K A;  2OAR A;  4D6T J;  2WPS A;  2A06 G;  4WY4 A;  3WUT A;  1SQV D;  1FZE A;  3KDP B;  4JQ0 D;  4YTP C;  3BVH A;  3L71 J;  5CCH C;  1YQ4 C;  2R5D A;  3H32 B;  1AVO A;  1NTZ G;  1VF5 D;  1BGY D;  4OVN F;  4HM6 A;  3PRJ A;  2WT7 B;  2NPS B;  3IAO A;  3GKE A;  4RJT A;  3GOB A;  1GTW A;  1OZH A;  2GUV A;  1VQL P;  1ZW0 A;  1RHZ B;  1AVY A;  3V4W A;  2Y0C A;  2FYN C;  5BVZ A;  1L0L K;  3H25 A;  2NVG A;  3H1H J;  2NRG A;  2QRX A;  4RO0 A;  3FGA D;  2P2U A;  1UIX A;  2N1T B;  3L37 A;  2C9L Y;  1NTM J;  1OFC X;  2K37 A;  3MHV A;  2QE7 H;  3OJA B;  5AW1 B;  3CWB J;  4JBZ A;  4TLF A;  1S1C X;  2Q6Q A;  3PTZ A;  1JEK A;  3W67 A;  2NPS D;  3C9I A;  2XDJ A;  1H0T A;  1MFT A;  2E76 C;  4NBH D;  1M8O B;  1SQB D;  3VOP A;  3USS A;  1W2E A;  5KAI H;  1RF1 C;  2JEE A;  2DE7 D;  2UWJ E;  1LNQ A;  2JKV A;  2R44 A;  2XRX A;  1PIX A;  2OTJ P;  4HM3 A;  3VMX A;  1Q82 Q;  3L74 G;  3R4Y A;  1T3J A;  1GL2 B;  3Q2Y A;  3MGN A;  4YXW H;  2N1T D;  2WSS H;  2R3S A;  2E75 B;  1KYO H;  1KIL C;  1NDO A;  4NBF D;  5CBN A;  3HD7 C;  5DJU B;  4I7Z C;  4HKV A;  2FYU G;  3Q5R A;  2R5B A;  2BEQ D;  1L4A A;  4OWF A;  1NOH A;  2R32 A;  2V4H A;  3C8V A;  2K88 A;  1BSN A;  1NAY A;  2K9Y A;  3EFF K;  2C9N Y;  2V7Q J;  2W83 C;  2JO1 A;  1VQK P;  1ZRT D;  1SQB G;  5KAI E;  4RES B;  2AEJ A;  3TYY A;  2J5U A;  1Q7Y Q;  3Q5P A;  4K3A A;  1Q90 D;  3ABV C;  1NU1 D;  1S9K D;  1LWU A;  1FOS E;  3VCA A;  4H44 C;  4GDO A;  1VM9 A;  1HVV A;  2WSC J;  4ZNC A;  1GL2 D;  4AIV A;  4P1B H;  3MUD C;  2E75 D;  3H1L D;  2GBX A;  3M0D C;  1KYO E;  2KP8 A;  3EQ2 A;  4HM0 A;  1L0N E;  2KB7 P;  2YKO A;  4NPD A;  4UB6 H;  3AEF C;  3FWL A;  1Q86 Q;  1DD4 A;  2JWA A;  1N7S B;  4QUQ A;  2OYH C;  1LTJ A;  2QM7 A;  1IFM A;  3DQY A;  4QCK A;  4U3F E;  2BEZ F;  2BCC G;  2B88 A;  1HH0 A;  4IL6 X;  1SQX E;  1VF5 C;  3PHL A;  1AV1 A;  5TJH A;  1E5W A;  2N9Y B;  1FZG A;  1G1J A;  1LP1 A;  4H0L B;  2KZJ A;  1VDF A;  4XE5 B;  1QL2 A;  3HE5 B;  1T2K D;  1M56 D;  1JTH A;  2ZFC A;  3H1L G;  3WMM 0;  2POH A;  1L0N K;  1W5C E;  3L72 E;  3AE7 C;  2BMQ A;  3GHG B;  2IFN A;  3H1I D;  5CCG A;  5AW7 B;  3AE8 C;  1ZP0 C;  3IFM A;  2MKV A;  3N4X A;  4DCK A;  5AVZ B;  4UB6 E;  1JMM A;  2JO6 A;  3FOU A;  1N7S D;  2IFM A;  3OAK A;  2KLV A;  2LXB A;  4C7R A;  1VPC A;  1SQQ D;  1SFC C;  3VMY A;  3VMH D;  2E4P A;  3VP9 A;  1RE4 C;  2NPS C;  1OW7 A;  1UUV A;  5KLV E;  4H0L D;  4YPC A;  4L73 A;  3TGU E;  3FX0 A;  2E4Q A;  1BDD A;  4WB4 A;  3RK3 C;  2OYI A;  2JP3 A;  3TNU B;  1RE3 C;  1PP9 E;  4AUW A;  5AVR B;  1OX3 A;  2KLU A;  2IYO A;  3L70 G;  3PJS K;  2KXP B;  1KMI Z;  1NTK E;  3WUU A;  4ZKP A;  1KQF B;  2OQQ A;  2FXO A;  2N1T C;  3H1K E;  2XZR A;  1KYO I;  3EWK A;  1RF1 B;  2C0W A;  4GOD A;  1YBK A;  1L0N J;  2PGD A;  3AEA C;  3B5N B;  4HM2 A;  1SJG A;  2WSF H;  3M9H A;  2WMM A;  2FBW C;  5AEU A;  1SQP E;  3TK1 A;  2ZYG A;  3SWK A;  1NTM D;  1OIP A;  3M06 A;  2RH0 A;  1M90 Q;  1SQX J;  2B89 A;  2KUB A;  3CWB D;  2KSE A;  4WVZ A;  3H1J J;  1VQ8 P;  2KYV A;  4D6T E;  3L71 G;  3ZDM A;  2H89 C;  1Q90 C;  1LT9 A;  1USD A;  1JOC A;  1EC5 A;  2WVR A;  2K9J B;  3NTN A;  3OA7 A;  5AEW A;  3W68 A;  1GL2 C;  4IFM A;  1IO4 A;  3D6Z A;  1SS1 A;  1WRG A;  1KV4 A;  3GW6 A;  2E75 C;  2Z5H A;  1PPJ E;  4IL6 E;  5APU A;  5APQ A;  3B5N D;  3VP8 A;  3L73 D;  1BCC E;  2OGU A;  2QJP B;  4H44 B;  3H1H G;  3AE2 C;  1G8K B;  1JM1 A;  1H8A A;  4AAY B;  1S2E A;  2W90 A;  1VQ4 P;  1USE A;  3AE9 C;  1NTM G;  1TU3 F;  1ZV8 A;  5BU5 A;  2YFJ A;  4QMA A;  4WWI A;  3PH0 A;  3CWB G;  1SQQ K;  4QDF B;  1O7P A;  3E1R A;  2HOD A;  1O7H A;  2E74 B;  3P8C E;  1ULI A;  2M5A B;  2FKW B;  2HPC B;  1WT6 A;  2OTK E;  4LLH A;  3AE6 C;  2WWW A;  1NTK J;  1NTZ D;  1T2K C;  1JNM A;  1L2P A;  2ZVO B;  1FZC A;  1MUU A;  2XND H;  1RH5 B;  4WY4 B;  2WPQ A;  3H1K J;  2LR2 A;  3HTK A;  3IF4 A;  4H44 D;  5AVX B;  3BRT B;  3CXH H;  2ZXE B;  5B5E E;  1NAF A;  5APS A;  4NBG D;  3CC7 P;  1T8Z A;  3GCE A;  1X79 B;  4DJG A;  2XV5 A;  4NBE D;  1N7S C;  1SQP J;  3Q3D A;  2WSC H;  1NO4 A;  1VQ6 P;  3VCP A;  2E74 D;  2L91 A;  5EFW B;  4UB8 H;  2YXR B;  3I5C A;  4IFD K;  2Y9Z A;  4H0L C;  2G8Y A;  1O7N A;  1JUN A;  2Y0E A;  2W6B A;  3A3Y B;  3WU2 H;  3WUV A;  1O7W A;  1L0L E;  1JCD A;  1KN7 A;  2NVF A;  3OW2 O;  1S5L X;  4WBA A;  1SFC B;  2PFX A;  2Y0D A;  3D89 A;  4WY4 D;  5E79 H;  1KIL E;  2Z5I A;  3GHG C;  5KKZ B;  4HKZ H;  3MD0 A;  1T6A A;  2W6J H;  3KPE A;  3CXH E;  1S72 P;  2FFD A;  2PAJ A;  1EZV E;  2QSI A;  3KHU A;  3RBX A;  1BCC J;  2A06 E;  3RK3 B;  1J1E B;  2WSF J;  4ASW A;  4QUP A;  1RF0 A;  2YKQ A;  1H0T B;  2AEF A;  2QEX P;  1S4X A;  4HYT B;  3L74 D;  1RQV A;  4UB8 E;  3VN0 A;  1P84 D;  4K35 A;  5AVV B;  3PP5 A;  3HUS A;  2YFI A;  5CMZ A;  2NUM A;  1LTS C;  3WU2 E;  3H6P A;  3I56 P;  4PV1 B;  1Q2N A;  1KOR A;  3Q5S A;  4KT0 J;  3U1A A;  2FYU D;  1KD1 Q;  3B8E B;  1SFC D;  5E79 E;  3GTE A;  3FXD A;  2AXC A;  2QJK B;  2KK7 A;  1FZF A;  2IPP A;  2GA1 A;  2P67 A;  2CPS A;  3BAS A;  3RK3 D;  4BXL A;  1OW6 A;  2BMO A;  5APW A;  2ZVN B;  1X9V A;  2NWF A;  1KYO D;  1GDT A;  1G2C A;  3B5N C; 
#chains in the Genus database with same CATH homology
 1FQT A;  4NBB D;  5HL4 A;  4H0L B;  2XR8 A;  2NVE A;  1NYH A;  1EXJ A;  1ZME C;  4PV1 D;  3L73 E;  3S9O A;  4I7Z B;  1O7M A;  3SFD C;  3AEG C;  3L72 E;  3AE7 C;  2BMQ A;  4PD4 E;  4P1C H;  4QUR A;  3L71 E;  2E76 D;  3AE8 C;  3Q1M A;  1ZP0 C;  4HJL A;  2MKV A;  3VMI D;  2I7F A;  1EG9 A;  2JO6 A;  2HMN A;  3AEC C;  3FOU A;  3D6Y A;  3SFE C;  1NYK A;  2JZA A;  2XSO A;  1HJ0 A;  3D71 A;  3VMH D;  3RL0 g;  1WQL A;  4HM8 A;  2E4P A;  1OW7 A;  1UUV A;  2QJP C;  5KLV E;  4Z1M H;  1NTZ E;  4H0L D;  3VMG D;  1RIE A;  3AE3 C;  4NBC D;  2WSE J;  2QJY C;  3TGU E;  2E4Q A;  2O01 J;  2QPZ A;  4YXD C;  3H1H E;  3GF7 A;  2JP3 A;  4HM7 A;  1BE3 E;  4RKU J;  1PP9 E;  1OW8 A;  4NBA D;  2YMK A;  1NTM E;  1Y9B A;  4OGQ C;  5M1B A;  2DE6 D;  1JB0 J;  1KMI Z;  1MKM A;  2E74 C;  3CWB E;  1FDI A;  1NTK E;  2DE5 D;  1KQF B;  2P10 A;  2OQQ A;  2D2C B;  1GMJ A;  3H1K E;  1PV3 A;  3EWK A;  1R8E A;  1O7G A;  3AEA C;  1VF5 B;  1RFS A;  4HM2 A;  1SJG A;  3GMA A;  2FBW C;  5AEU A;  3H1J E;  2ZT9 C;  4QDF A;  1K05 A;  1SQP E;  1U57 A;  2FXP A;  3EQQ A;  4NB8 D;  4QDC A;  1DIP A;  2YFL A;  5BOK A;  1HF9 A;  2H89 C;  1Q90 C;  2XSH A;  4Y28 J;  1ZRT E;  5AEW A;  4HM1 A;  2D2C D;  3D6Z A;  1NU1 E;  5L8R J;  2E75 C;  1G8J B;  2GBW A;  3L74 E;  1PPJ E;  4YTP C;  1ZOY C;  3T97 B;  1YQ4 C;  1P84 E;  3AEB C;  3GL0 A;  4R4M A;  1VF5 D;  4HM6 A;  1BCC E;  3IAO A;  4H44 B;  1YQ3 C;  3GKE A;  5KKZ C;  3AE2 C;  3GOB A;  1G8K B;  1JM1 A;  2FYU E;  4AAY B;  1DD3 A;  2NZ2 A;  3AE9 C;  1TU3 F;  2YFJ A;  4H13 C;  4QDF B;  1O7P A;  2FYN C;  4OGQ B;  3GF3 A;  3H25 A;  1SQB E;  2NVG A;  1O7H A;  2E74 B;  3BCC E;  4QDD A;  1ULI A;  3RK3 E;  2G3A A;  3FGA D;  1UIX A;  2H88 C;  3AE6 C;  1VF5 C;  1UUW A;  2IBZ E;  4PV1 C;  2B24 A;  5KLI C;  2HMJ A;  1S1C X;  1KQG B;  1KTM A;  1KB9 E;  2BMR A;  3GB4 A;  2CKF A;  3GLM A;  4H44 D;  2ZT9 B;  2E76 C;  4XFJ A;  4NBH D;  2QJK C;  3AEE C;  4NBG D;  4NBD D;  4HM4 A;  3GCE A;  3H1I E;  4NBE D;  2YVJ B;  2DE7 D;  3Q3D A;  1FDO A;  3AE5 C;  2QIW A;  4OGQ D;  2NUK A;  2XRX A;  3AE1 C;  3VCP A;  2E74 D;  1PIX A;  4HM3 A;  2HMM A;  1RQU A;  2BCC E;  3GZX A;  3R4Y A;  2HMO A;  4H0L C;  2G8Y A;  3Q2Y A;  1O7N A;  1SQQ E;  2YIU C;  1O7W A;  2E75 B;  1L0L E;  3AED C;  1NDO A;  1ULJ A;  1VCK A;  4NBF D;  3B71 A;  5CXM A;  3CX5 E;  2NVF A;  3GL2 A;  1S5L X;  4I7Z C;  3D89 A;  1IK7 A;  4HKV A;  1K04 A;  3C0D A;  3Q5R A;  1KIL E;  4U7J A;  3L75 E;  2BEQ D;  3H1L E;  2ZT9 D;  3CXH E;  3C8V A;  3D70 A;  2HMK A;  2K9Y A;  1EZV E;  2V7Q J;  2QSI A;  2ZYL A;  2JO1 A;  2B1X A;  2A06 E;  2WSF J;  3GTS A;  4QUP A;  4H13 B;  2J5U A;  1WMK A;  3Q5P A;  3GZY A;  3G9R A;  1Q90 D;  3ABV C;  3VCA A;  4TT3 H;  4H44 C;  1RQV A;  2WQY C;  2IDB A;  4GDO A;  1EXI A;  1VM9 A;  2WSC J;  4AIV A;  2HML A;  2YFI A;  4P1B H;  2NUM A;  2Q3W A;  2E75 D;  3IN6 A;  2GBX A;  4PV1 B;  1KOR A;  1KYO E;  1NGM B;  3Q5S A;  4KT0 J;  3AZC A;  2WPV B;  3GTE A;  2E76 B;  3N0Q A;  4HM0 A;  3L70 E;  1L0N E;  3AE4 C;  2D2C C;  3AEF C;  4NB9 D;  1PL5 A;  1AJY A;  1DD4 A;  1VL2 A;  1OMI A;  4QUQ A;  3LW5 J;  3O6Q A;  1OW6 A;  4EMJ B;  4H13 D;  2BMO A;  3DQY A;  4QCK A;  4U3F E;  2BEZ F;  4IL6 X;  4HM5 A;  2NWF A;  4R4L A;  1SQX E;  3EN1 A;  1SQV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...