5KLIC

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 52
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kliC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kliC02
2E4PA 1FQTA 4PV1D 2YFLA 3GCEA 2D2CD 2WSFJ 4AIVA 1VF5B 3GB4A 1NU1E 3L73E 2A06E 4NB9D 1JM1A 2O01J 4H44D 4NBED 1P84E 1Q90D 3GKEA 4U3FE 3N0QA 2E76D 3GOBA 1EZVE 1PPJE 1O7NA 2BMOA 1WQLA 2BMQA 3AZCA 2GBWA 2QPZA 2JO6A 2NUKA 2YFIA 4HM6A 4AAYB 4P1BH 2QJKC 1VF5D 2NUMA 2GBXA 1SQQE 2IBZE 2HMLA 3GL2A 4QDFB 1SQBE 1G8JB 3VMGD 2FYUE 4HJLA 3VMID 1ULIA 3VMHD 1BE3E 1RIEA 2WSEJ 5AEWA 4Y28J 4IL6X 1SJGA 3C0DA 3L70E 2HMOA 3L72E 3CXHE 4QCKA 1O7PA 2WSCJ 5L8RJ 1O7HA 4KT0J 2NVGA 3FOUA 4H13B 3GL0A 3DQYA 2CKFA 2Q3WA 1ZRTE 4RKUJ 2B24A 3GTEA 4QDDA 4I7ZB 3C8VA 2ZT9B 3TGUE 1O7MA 2DE6D 4QUQA 3EQQA 2YIUC 2B1XA 4NBGD 4OGQB 3D89A 2E75B 2XSOA 3L71E 4HM8A 1O7WA 1L0LE 4HM5A 4H13D 1PP9E 2DE5D 4QDCA 5AEUA 2QIWA 2QSIA 1VCKA 4H0LB 2NVEA 4HM4A 2HMJA 3LW5J 2NVFA 2ZT9D 2E74B 2ZYLA 4PD4E 1G8KB 4HKVA 5KKZC 1L0NE 1NTME 1ULJA 1O7GA 2DE7D 1Q90C 3L75E 1BCCE 4HM3A 4OGQD 2E75D 1EG9A 2XRXA 2K9YA 3VCPA 2XSHA 5HL4A 2E4QA 1SQPE 4NB8D 4H0LD 1KYOE 3CWBE 3L74E 4HM7A 1NTKE 3EN1A 4NBBD 3GZYA 4EMJB 2YFJA 5KLIC 3BCCE 3H1IE 1RFSA 2BCCE 2E74D 4NBDD 1JB0J 1NDOA 2QJYC 4HM0A 2I7FA 1UUVA 2HMKA 4QURA 2BMRA 5KLVE 1SQXE 2YVJB 3H1LE 1SQVE 1NTZE 3H1JE 1VM9A 4QDFA 3GZXA 4NBHD 2XR8A 5BOKA 3CX5E 3H1HE 2HMMA 4QUPA 4PV1B 3GTSA 2WPVB 2D2CB 2NWFA 4HM2A 1NYKA 4H44B 2QJPC 1KB9E 4NBCD 2E76B 3VCAA 4NBFD 1UUWA 3H1KE 5CXMA 2FYNC 1S5LX 4HM1A 4NBAD 2JZAA 2HMNA 4P1CH
chains in the Genus database with same CATH superfamily
1EZVD 4GT1A 3WUTA 5CMZA 1FE6A 1S9KD 4IFDK 1O7NA 4ZKPA 1YJNP 2JO6A 2XV5A 1SFCB 1NKNA 1S4XA 1SQQE 3A0BH 4H0LC 1T6AA 4IL6X 1BCCG 1NH4A 5KJ7D 2MJZA 1O7HA 2OARA 1YITP 3BATA 1NTKG 3JSVC 4BRYA 4I1LA 1ZMEC 2B88A 1KV4A 1PZQA 1SS1A 2Z5IA 3H1HG 2QIWA 3FXDA 2I8DA 5APVA 1A02F 1HUCA 1LTJC 1M1KQ 2FYUK 5AVXB 2FFDC 1OZHA 2FKWB 1ZLLA 4JF7A 4A7PA 3CD6P 5KLVD 3AE6C 2KS1A 3H1LD 1CZQA 1YJWP 2HMKA 1FJPA 4BRYB 4IL6E 1YHQP 1FZGA 1JY3P 3GZXA 3VMAA 1RF1A 4YXWH 4QUPA 2NPSC 4RESB 1ZW0A 2FYUG 2WSEH 1KQFB 1VL2A 2V7QJ 2JWDA 2KNCA 5AVSB 1YTZT 3A2AA 1P84D 3KZIE 4P1CH 3AECC 5APYA 1PPJD 4PV1D 2HPCA 2Z4EA 1NAFA 2NPSA 2O01N 2KS1B 4NPEA 1IJDB 3CC2P 3L71G 2NUKA 4HM6A 2E75C 3AE7C 4DZOA 4P1BH 2K1AA 3I56P 1FZCA 1ZN5A 1GK4A 1EDLA 1W5CE 1RF1B 4Y28J 3L75G 2PRRA 4AUWA 3MUDC 1N73C 1KB9H 3P8CE 3CWBG 3L74G 1USEA 2WT7A 4D6TD 1M56D 2KK7A 2NPSB 1ZV8A 1VQ7P 1CSBA 4W7YA 1E79H 2R32A 4UB8E 3CC4P 3MHVA 4JYCA 1S3JA 3NFQA 5APSA 4CPGA 3L71D 4H0LD 1KYOE 1U7MA 5APQA 2I7FA 1K05A 1FS0E 2KUBA 2XNXA 1L0ND 1R8EA 1KYOI 3L75D 2WT7B 3CX5E 1SQXJ 3CWBD 3L74D 3H25A 1SQBG 2ZXXA 2CK3H 2KP8A 1GL2A 3CX5I 1S5LX 1NO4A 2HMNA 3L35A 4M3LA 3D6ZA 1VF5B 1J1EB 4H44D 1BSHA 3SFEC 3AE3C 3N0QA 2XDJA 3L70J 3BVHA 3GL2A 1Q82Q 1LWUC 3EFGA 3HRNA 1VQKP 1GL2B 3IR9A 3FWNA 4H13B 2PAJA 2I1JA 2E5TA 1DEEG 2A45G 2R3CA 1GU4A 3TF5A 4ZKUA 3H6PA 3H1JG 1S5LE 4WBAA 2QSIA 4EI2A 3CL3D 1PP9J 2M8RA 3QH9A 2E74B 2OYHC 2DE7D 1EQ7A 1OVRA 1LTSC 5CJ4A 2E75D 2NZ2A 2G8YA 1LTIC 1N7LA 2RH0A 4OH8B 2B9BA 3R4YA 4BWNA 2VRSA 3CXHH 1AVYA 3CCJP 3NTNA 3KQGA 1KFMA 3AE1C 2LR2A 2XR8A 3T97A 1T3UA 3GTSA 1GW3A 1WT6A 1FZFA 3AE9C 3QWOC 3EWKA 1NU1D 2YXRB 1H8AA 2WSCH 2HG5D 3H1JD 1X22A 5AW9B 1FQTA 2E4PA 4HKZH 1U7JA 4N6JA 3TK1A 1ZXGA 2RKLA 2IX7C 1FDIA 2OYHB 1URQC 1PGOA 1GDTA 1RQUA 3VMGD 3T97B 3B5NC 1SQQJ 2WSEJ 3A0HH 2OTKE 2FYNB 5APXA 3EFFK 1FJKA 2C0WA 1YI2P 2J5UA 2R44A 3HUSA 3B5NA 2H43A 1O7MA 2DE6D 4RJTA 2H88C 1QLED 1M90Q 2N1TD 1HJBA 1M7LA 2O3JA 3AE2C 1VCKA 2KOGA 1J1DC 3H32A 2GUSA 1NTZJ 2BCCD 2P1JA 1BGYJ 4HYTB 2YKPA 1Q86Q 3M9HA 1JCCA 1SQXD 3L73G 1RFSA 4NBDD 1GU5A 3K5BA 1NDOA 4PD4D 1Y8AA 3HUSB 1GZLA 3B5NB 1H88A 1GD2E 1BSNA 2W83C 2YKQA 5CJ0A 2M5AA 5KKZB 3GLMA 4NBCD 1S2EA 1YQ3C 3FWLA 3H32B 5AVZB 5AVVB 3L72G 1D7MA 2FXPA 1W2EA 2WPSA 4UB6E 2N9BA 3IFMA 1AQ5A 1FZAA 1RE4C 3TGUG 4EIJA 2H7HA 1L0LK 1K8AQ 2GBWA 1R5LA 3MTUE 2A45H 3U1AA 3CCVP 1RIEA 1VQ9P 3L70E 2M5AB 5TISE 3HE4A 1SQPG 3VN0A 1VQ4P 1DIPA 3GL0A 1ZR2A 1A02J 2JJLA 1S72P 1PP9D 1BCCJ 3C8VA 3VOPA 5AW0B 1SQVK 1ZP0C 1G2CA 4HM8A 4OWFA 2QE7H 3VMYA 1JM0A 2D2CC 2QEXP 3D70A 5KAFH 3TGUD 3Q3DA 4HM3A 2HLOA 2OQQA 5AW6B 1URQD 2K37A 3PJSK 3PLNA 1W2BO 5K5GB 2YMKA 1IK9A 3H1IE 2V4HA 3HE4B 4EDFA 1EZVG 3A0BE 1NOHA 1VQNP 4IFFA 3N4XA 2W6BA 3L36A 1LTAC 1FDMA 1SQPD 3OJAB 4HB1A 1SFCC 1G2CB 3FGAD 4OGQC 1J2JB 3H1KE 4NBAD 4XA4A 1OVUA 4PD4H 2FYUJ 2M3EA 2A06E 2QJYB 4U3FE 2HFED 2OYIA 5EFWB 3JC22 3L37A 5KLVK 1LJ2A 2B89A 1N7SC 1FOSE 3CC7P 4EOTA 2CPBA 4GKGA 2Y0EA 3RBZA 1PIXA 4GDOA 3KYQA 3V2NA 1VQLP 1NTKK 2WSCJ 3E1RA 1N7SA 3PP5A 1X79B 4N78E 5APWA 3BCCG 3HD7D 1T3JA 1KTMA 5TJHA 1AFOA 4QDDA 2ZT9B 3Q5PA 1LT1A 3CCSP 5KLVG 3RK2C 3H1LG 4OGQB 1RE3A 1L0LE 1AJYA 1WMKA 5APTA 1R5SA 5KAIH 2JDIH 3KPEA 3IF4A 1NTME 1HGZA 1O7GA 4Y99C 2O01H 4HM7A 2KSEA 2OYOA 1N7SB 1PPJG 2ZYGA 3E7KA 1L2PA 1SQVE 1NTZE 3CLQA 1BGYE 1KILD 1S9KE 3BCCD 1KB9E 1BE3G 1IFMA 3LW5H 2E76B 1RF1C 3FX0A 5CBNA 3RK3B 3SWKA 2R5DA 1KB9I 2D2CD 4AIVA 3RL0C 3RK2B 4GODA 3LIEA 4C7RA 3G71P 2QG4A 2P10A 2QPZA 4D6TG 2GBXA 2IBZE 3IAOA 1L0NK 4HJLA 4YTPC 2O1KA 4Y99B 3P8CD 3JCUH 3VYIA 2IBZI 2B87A 1JO5A 2HMOA 1FZCC 1SFCD 5AVYB 1JMBA 1BE3D 2HODA 1WRGA 3TDKA 3HTKA 2WWWA 2IYPA 2W90A 1JY3O 1L0NG 5AVRB 4HJGH 1U57A 1G8KB 3RL0B 3D71A 1KYOD 2KNCB 3S9OA 1BCCE 3AE4C 2RMZA 2HR3A 2AXTH 4DT0A 4I6MC 2HPCB 2W8ZA 2B87B 1NTKE 5HL4A 1VF5C 1J1EC 3CX5D 4GOEA 1VM9A 2HODB 3H1HE 1SQBK 3MZWB 1FZCB 4HM2A 3RK2D 2C0XA 3AEBC 1E5WA 4HM1A 3MGNA 3W68A 4XFJA 1LTBC 2YFLA 5KLIB 1GL2C 2L5GB 4H13C 3C9IA 4K35A 2P2UA 5DJUB 2BMQA 3KXDA 3RK3E 4K3AA 3B71A 1PGPA 1DD3A 2FYUE 1LTGC 5AW5B 3CPWO 2E74C 3G9RA 1RF0A 3VTPC 1VQPP 3CXHE 4QCKA 4JQ0D 3A7OA 4R4LA 3DQYA 1NU1K 5GTHH 3CXHI 2FXOA 1VQ5P 2B1XA 3D89A 1RQVA 3L71E 3RL0D 3G6EP 1P84H 1JY2N 4YXDC 4HM4A 2XU6A 2BASA 2WMMA 2KYVA 1EDJA 2NPSD 3I55P 1L0NE 3L75E 2ZXEB 4L76A 5CCGA 3CWBE 3L74E 1NU1G 1NJIQ 1JCDA 1AV1A 1L4AA 1DH3A 1OW6A 3H1IJ 3G3ZA 1OMIA 3NMDA 3A0HE 3L73J 3V2QA 1Q7YQ 2NWFA 3RL0g 2FYZA 1NYKA 3HE5A 1OW8A 3WMM0 1VQOP 1K04A 4NBFD 3M0DC 2FYNC 2H89C 2JZAA 1FZBA 4GIFA 3H1KJ 2KIKA 2O01J 1EDIA 3PRJA 4DCKA 1OW7A 3M0DA 4U3FJ 3V4WA 1L4AB 1VF5D 1FZEA 3S1KA 1N86A 1SQBE 3A3YB 4O9BA 1S1CX 4WY4A 3HE5B 3WU2H 2ITAA 1MKMA 5L8RJ 4AYCA 1IFDA 3WUUA 1KN7A 2CKFA 1UIXA 2BCCG 1FU1A 2POHA 2Q3EA 3CCRP 4TT3H 4I2LC 1SQXG 1CW5A 4ASVA 1Y9BA 1GL2D 3HUSC 3V4QA 1O7WA 4H13D 2NVEA 1QL1A 1L0LJ 3M91A 1FAVA 4BXLA 5KKZC 5BU8B 2AEFA 5CCHA 1NTMJ 4WY4B 3CCMP 3GMAA 5C39A 2YXQB 1IFNA 2E74D 3SWYA 1LGHB 1KQSO 1NYHA 2GA1A 3H1JE 5CBOA 1EXIA 4JBZA 4R4MA 2WPVB 1Y47A 3Q2YA 1SQVJ 3VMXA 2A45I 1EXJA 2QJPC 2ZVNB 2W27A 1DX7A 3GHGA 3SSUA 3II6A 1KD1Q 3GB4A 1NAYA 1T2KC 3S4RA 1IFIA 4NBED 3ABVC 1QVGO 2C9LY 4PJ0H 2QRXA 3U1CA 5KAFE 1PP9G 3Q5RA 2KZIA 1TU3F 3L70D 1AVOA 4B86A 1FDOA 1G1IA 3BRTB 2ZVOB 2V7QH 4EYYQ 1SQPK 1HF9A 3GHGB 1ZRTE 1KQLA 3BASA 1OVVA 5AVWB 3KDPB 2QA4P 1IZNB 2J58A 2QJPB 2XSOA 4HM5A 4YPCA 4ASWA 1OFCX 3TYYA 1Q81Q 3PTZA 3CI9A 5KJ7C 3LIDA 2ZYLA 4PD4E 1PGQA 1ULJA 5CHXA 5AW3B 3H1ID 4L73A 1FOSF 3CCEP 2IYOA 2QJYC 5KJ7A 1UUVA 1NTKJ 4OVNF 2Y9ZA 1X9VA 3MD0A 4QDFA 3CMAP 1NHLA 3P8MC 2HMMA 1JY3N 1SQQG 3ZDMA 3H1KD 3H1HJ 1JUNA 3CMEP 1KQGB 4HH2A 2A06D 3B5ND 5CXMA 2BEZF 4U3FD 3O6QA 3L73E 1JM1A 3PHLA 2ZJSE 1ZR4A 3GOBA 2ZT9C 5KAIE 2Q9IA 5AVTB 3GW6A 1HVVA 1LTTC 5AVUB 5B5EH 2QJKC 3OW2O 4KHXA 2OYIC 1LNQA 3AEEC 4QDFB 1G8JB 1K9MQ 1LT9A 3VMID 2KI7B 5H2FH 5AEWA 4N78D 4PV1C 2Q5UA 2P67A 3L72E 2JKVA 2NVGA 1SQQD 2FY8A 1SLQA 1VQ8P 2B24A 2M0BA 1L0LD 3A5TA 3GTEA 4I7ZB 3O6QB 4WWIA 1K73Q 3SFDC 3TGUE 2WPQA 1T2KD 1NTMD 4QDCA 3OA7A 1UIIA 1YYCA 3L71J 3SWFA 1RE3C 1X0TA 1JOCA 1RH5B 4HKVA 1Q90C 3GF3A 1HH0A 5APUA 3NXSA 2E76C 1LT9B 1FBMA 1RY3A 2WSFH 1L0NJ 3RK3C 1PV3A 3VP8A 1SQPE 4LGDE 3L75J 3EN1A 2YFJA 1SQVD 1NTZD 2JO1A 4HM0A 2QJKB 3CWBJ 3L74J 1BGYD 2OYIB 1DD4A 1IK7A 2YVJB 1VDFA 1JMMA 1KB9D 4NBHD 1X8YA 3JCUE 4PV1B 1HGVA 4LLHA 3AEDC 3O8ZA 1FC2C 3VCAA 2E42A 2NRGA 2E5YA 2IFMA 2QM8A 1PL5A 3B4SA 5E79H 3GKEA 1EZVE 2IBZD 2BMOA 1WQLA 1Z56A 1OWAA 3USSA 3AZCA 4C46A 1EZVI 2RN0A 1ULIA 2AXTE 1IO4A 1SQBJ 2H8PD 1MV8A 4H44C 2BEQD 1HTLC 2K88A 4RKUJ 5KTBA 2WVRA 1KC8Q 2Y0CA 1LTJA 2FFDA 1T8ZA 1MFZA 1BCCD 4H0LB 1GTWA 2NVFA 2ZT9D 4IFMA 1VQMP 1NTKD 5M1BA 4OGQD 2IDBA 2ZAEB 3VCPA 3I5CA 4DJGA 2E4QA 2CPSA 1KILE 3BCCE 5KLIC 1QL2A 1NKZB 1SVFA 2WQYC 3H1HD 5KLVE 3VP9A 3H1LE 1CI6A 1NU1J 3H1JJ 5B66E 4NPDA 1LTJB 1N7SD 3EQ2A 4H44B 2FFDB 3VMZA 3D6YA 1G1JA 3Q5SA 1UUWA 5BVZA 2Y0DA 5GTHE 2YO3A 2AXCA 2R5BA 1N2DC 1P84E 2YNYA 1Q90D 2PFXA 2E76D 1PPJE 4LC1A 3HTKB 1MUUA 3RK3D 2FYUD 1YTZI 2YFIA 1P84I 4AAYB 2NUMA 5BU5A 1YJ9P 1CI6B 3MUDA 2KB7P 4IL6H 3CXHD 1N73A 1BE3E 1QGKB 1JTHA 2HYNA 2P7JA 1PGJA 1M1JC 1AA0A 2IZ1A 1RF0C 3RGUA 3KZIH 1MFTA 2ZYAA 2IPPA 2Q3IA 5GTIE 3PH0A 2E75B 5AEUA 4D6TE 1M1JA 2BCCJ 2HMJA 2YKOA 5B66H 1XTGB 2WITA 1H0TA 1N73B 2XSHA 1JTHB 4EMJB 3AE8C 3F5HA 2XNDH 2PGDA 5CCGC 2N1TC 2FBWC 2KZJA 2Z5HA 2KLUA 2SPZA 2K3RA 3OAKA 3E1IA 5BOKA 1L4AC 2XZRA 5AW7B 3W67A 3AE5C 2LXBA 2Q7CA 2KLVA 3WU2E 1KFNA 4W80A 4UB8H 1M1JB 2N1TA 3C1LA 1KZUB 1H0TB 2QVAA 2WSFJ 1HJ0A 2MKVA 3U59A 1KORA 1GMJA 2GM4A 3MP7B 1KYOH 2M3BA 1SQBD 1VQ6P 2G3AA 1LWUA 3UIAA 5GTIH 1QX8A 2HMLA 4XE5B 3GG2A 2Y9YA 1KMIZ 3CX5H 1SJGA 1MZ9A 2IZ0A 3F89A 2N1TB 3FOUA 3CCUP 4WY4C 3L72J 2Q1KA 2WTYA 2N9YB 2Q3WA 1HBWA 1SQXK 4ZNCA 4NPFX 2WPRA 2W6JH 3WUVA 3P7KA 3AEGC 1IFPA 1VPCA 2R3SA 3TGUJ 2OYHA 2KSJA 2ZFCA 3AEFC 4WB4A 1NVOA 1LWUB 3LW5J 3TNUA 2IFNA 3B8EB 3L4FA 3GF7A 2K9YA 4WVZA 1OXZA 1OX3A 4NB8D 5AVQB 4PJ0E 1JEKA 1USDA 5AW1B 1QEXA 1SQPJ 5CCHC 2BMRA 3MIWA 1NWQA 3M0AA 2E43A 3CCLP 1IC2A 1S5LH 1BDDA 3L70G 3AEAC 3TNUB 4RO0A 3GCEA 2YMYA 1NU1E 4NB9D 2LKMA 3GHGC 4DOJA 1URQA 3N7NA 4JYBA 3V2PA 5CCGD 1OIPA 3G4SP 4MN4C 1ZRTD 2W6AA 1YIJP 1L4AD 1Q2NA 4KT0J 3H1IG 4QUQA 3IN6A 3EQQA 2YIUC 3FXEA 4NBGD 1SP4A 3CCQP 3V5BA 1EDKA 1URQB 5DJTB 1JY2P 4Z1MH 4IOIH 2JP3A 4U7JA 2DW3A 1RHZB 3H1KG 4ZMDA 3HD7C 2OTLP 2AEJA 3GZYA 2A06G 1BDCA 2BCCE 3M9QA 1QVFO 4U3FG 2K9JA 4AQRD 5B5EE 4QURA 3BCCJ 1GK6A 1NGMB 2J59M 1SQXE 2UWJE 4WY4D 5H2FE 1SQQK 3HD7A 5KLVJ 1J1DB 4C7NA 3H1LJ 1ZOYC 3RBXA 1IFJA 1JY2O 3L73D 4PD4I 2JR8A 1NTMK 1RE4A 1PFIA 3R2PA 2L91A 2YIUB 3P32A 3KHUA 2KXPB 2AEMA 4W7ZA 2LXCB 3TSIA 4I7ZC 3BRVB 2K9JB 1XTCC 1KILC 1L0LG 1NTZK 2QM7A 5CCHD 1HWTC 2OTJP 3L72D 4QMAA 3HD7B 2XKMA 2I1KA 3VMHD 2O1JA 4C7NB 1AQTA 1NTMG 3C0DA 1BE3J 1YBKA 1KILA 1LT9C 1O7PA 4N3YB 2FXMA 3V6IA 2YO2A 4KJMA 2GUVA 3Q1MA 1LP1A 1JNMA 3V2RA 1EC5A 4UB6H 2JWAA 1SQVG 1NTZG 5AW2B 1PP9E 2DE5D 1BGYG 4TLFA 2OGUA 2C9NY 4D6TJ 5AW4B 5E79E 1EG9A 1DEBA 2XRXA 5AW8B 2Q6QA 3ITKA 1GW4A 4NBBD 2PP6A 1KILB 1JB0J 3M06A 2WZ7A 4L74A 5TISH 2JEEA 1SFCA 2P58A 4JPZB 1LP1B 2WSSH 2IBZG 4L75A 2D2CB 1M8OB 2ZYDA 1YQ4C 1N8RQ 4GOFA 1M57D 1H89A 3M9BA
chains in the Genus database with same CATH topology
2O01J 1P84E 1Q90D 2E76D 1PPJE 1O7NA 1OW7A 2GBWA 2JO6A 2YFIA 4AAYB 2NUMA 1VF5D 1SQQE 4H0LC 1SQBE 1BE3E 1S1CX 1RIEA 4IL6X 3L70E 1MKMA 5L8RJ 1O7HA 1DIPA 3GL0A 2CKFA 1UIXA 3C8VA 4TT3H 1ZP0C 1ZMEC 1Y9BA 2E75B 4HM8A 1O7WA 4H13D 5AEUA 2QIWA 2NVEA 2HMJA 2D2CC 3D70A 5KKZC 3Q3DA 4HM3A 2OQQA 2XSHA 3GMAA 4EMJB 3AE6C 2YMKA 3H1IE 2E74D 3AE8C 2HMKA 2FBWC 1NYHA 3H1JE 3GZXA 1EXIA 5BOKA 4R4MA 4QUPA 2WPVB 3AE5C 3Q2YA 3FGAD 1KQFB 1VL2A 4OGQC 1EXJA 2QJPC 2V7QJ 3H1KE 4NBAD 4P1CH 3AECC 4PV1D 2WSFJ 1HJ0A 3GB4A 2A06E 2MKVA 4NBED 4U3FE 3ABVC 1KORA 1GMJA 2G3AA 2NUKA 3Q5RA 4HM6A 2E75C 3AE7C 4P1BH 1TU3F 2HMLA 1FDOA 4Y28J 1KMIZ 1SJGA 1PIXA 4GDOA 2WSCJ 3FOUA 1HF9A 2Q3WA 1ZRTE 1KTMA 4QDDA 2ZT9B 3Q5PA 3AEGC 4OGQB 2XSOA 1L0LE 4HM5A 1AJYA 1WMKA 3AEFC 3LW5J 2ZYLA 4PD4E 1NTME 1O7GA 1ULJA 3GF7A 2K9YA 4NB8D 4H0LD 1KYOE 4HM7A 2QJYC 2I7FA 1UUVA 1K05A 2BMRA 1R8EA 1SQVE 1NTZE 4QDFA 3CX5E 2HMMA 3H25A 1KB9E 2E76B 1KQGB 5CXMA 2BEZF 1S5LX 3AEAC 2HMNA 3D6ZA 3GCEA 3O6QA 2D2CD 4AIVA 1VF5B 1NU1E 3L73E 4NB9D 1JM1A 4H44D 3SFEC 3AE3C 3N0QA 3GOBA 2ZT9C 2P10A 2QPZA 2QJKC 2GBXA 2IBZE 3GL2A 3AEEC 4QDFB 3IAOA 1G8JB 4HJLA 3VMID 4YTPC 5AEWA 4PV1C 2HMOA 3L72E 4KT0J 2NVGA 4H13B 2B24A 3GTEA 4I7ZB 3SFDC 3TGUE 4QUQA 3IN6A 3EQQA 2YIUC 4NBGD 4QDCA 4Z1MH 2QSIA 2JP3A 2E74B 1U57A 1G8KB 4HKVA 3D71A 4U7JA 2DE7D 1Q90C 3GF3A 3S9OA 1BCCE 3AE4C 2E75D 2E76C 2NZ2A 2G8YA 1PV3A 1SQPE 5HL4A 1NTKE 3EN1A 3GZYA 2YFJA 3R4YA 1VF5C 2BCCE 2JO1A 4HM0A 4QURA 1DD4A 1NGMB 1IK7A 1SQXE 2YVJB 3AE1C 1VM9A 4NBHD 2XR8A 3H1HE 4PV1B 3GTSA 3AE9C 4HM2A 3AEDC 1ZOYC 3VCAA 3EWKA 3AEBC 4HM1A 4XFJA 2E4PA 1FQTA 2YFLA 1PL5A 4H13C 3GKEA 1EZVE 4I7ZC 2BMOA 1WQLA 2BMQA 1FDIA 3AZCA 1RQUA 3RK3E 3B71A 1DD3A 3VMGD 2FYUE 3T97B 1ULIA 3VMHD 2WSEJ 2E74C 3G9RA 3C0DA 3CXHE 4QCKA 1O7PA 4H44C 2BEQD 3Q1MA 4R4LA 3DQYA 2J5UA 4RKUJ 1O7MA 2DE6D 2H88C 2B1XA 3D89A 1RQVA 3L71E 1PP9E 2DE5D 3AE2C 1VCKA 4H0LB 4YXDC 4HM4A 2NVFA 2ZT9D 1L0NE 5M1BA 3L75E 4OGQD 2IDBA 1EG9A 2XRXA 3VCPA 2E4QA 3CWBE 4NBBD 3L74E 1KILE 3BCCE 5KLIC 1RFSA 4NBDD 1JB0J 1NDOA 2WQYC 1OW6A 5KLVE 1OMIA 3H1LE 2D2CB 2NWFA 3RL0g 1NYKA 1OW8A 4H44B 3GLMA 1YQ4C 4NBCD 3D6YA 1YQ3C 1K04A 3Q5SA 4NBFD 1UUWA 2FYNC 2H89C 2JZAA 2FXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4P A;  1FQT A;  4PV1 D;  2YFL A;  3GCE A;  2D2C D;  2WSF J;  4AIV A;  1VF5 B;  3GB4 A;  1NU1 E;  3L73 E;  2A06 E;  4NB9 D;  1JM1 A;  2O01 J;  4H44 D;  4NBE D;  1P84 E;  1Q90 D;  3GKE A;  4U3F E;  3N0Q A;  2E76 D;  3GOB A;  1EZV E;  1PPJ E;  1O7N A;  2BMO A;  1WQL A;  2BMQ A;  3AZC A;  2GBW A;  2QPZ A;  2JO6 A;  2NUK A;  2YFI A;  4HM6 A;  4AAY B;  4P1B H;  2QJK C;  1VF5 D;  2NUM A;  2GBX A;  1SQQ E;  2IBZ E;  2HML A;  3GL2 A;  4QDF B;  1SQB E;  1G8J B;  3VMG D;  2FYU E;  4HJL A;  3VMI D;  1ULI A;  3VMH D;  1BE3 E;  1RIE A;  2WSE J;  5AEW A;  4Y28 J;  4IL6 X;  1SJG A;  3C0D A;  3L70 E;  2HMO A;  3L72 E;  3CXH E;  4QCK A;  1O7P A;  2WSC J;  5L8R J;  1O7H A;  4KT0 J;  2NVG A;  3FOU A;  4H13 B;  3GL0 A;  3DQY A;  2CKF A;  2Q3W A;  1ZRT E;  4RKU J;  2B24 A;  3GTE A;  4QDD A;  4I7Z B;  3C8V A;  2ZT9 B;  3TGU E;  1O7M A;  2DE6 D;  4QUQ A;  3EQQ A;  2YIU C;  2B1X A;  4NBG D;  4OGQ B;  3D89 A;  2E75 B;  2XSO A;  3L71 E;  4HM8 A;  1O7W A;  1L0L E;  4HM5 A;  4H13 D;  1PP9 E;  2DE5 D;  4QDC A;  5AEU A;  2QIW A;  2QSI A;  1VCK A;  4H0L B;  2NVE A;  4HM4 A;  2HMJ A;  3LW5 J;  2NVF A;  2ZT9 D;  2E74 B;  2ZYL A;  4PD4 E;  1G8K B;  4HKV A;  5KKZ C;  1L0N E;  1NTM E;  1ULJ A;  1O7G A;  2DE7 D;  1Q90 C;  3L75 E;  1BCC E;  4HM3 A;  4OGQ D;  2E75 D;  1EG9 A;  2XRX A;  2K9Y A;  3VCP A;  2XSH A;  5HL4 A;  2E4Q A;  1SQP E;  4NB8 D;  4H0L D;  1KYO E;  3CWB E;  3L74 E;  4HM7 A;  1NTK E;  3EN1 A;  4NBB D;  3GZY A;  4EMJ B;  2YFJ A;  5KLI C;  3BCC E;  3H1I E;  1RFS A;  2BCC E;  2E74 D;  4NBD D;  1JB0 J;  1NDO A;  2QJY C;  4HM0 A;  2I7F A;  1UUV A;  2HMK A;  4QUR A;  2BMR A;  5KLV E;  1SQX E;  2YVJ B;  3H1L E;  1SQV E;  1NTZ E;  3H1J E;  1VM9 A;  4QDF A;  3GZX A;  4NBH D;  2XR8 A;  5BOK A;  3CX5 E;  3H1H E;  2HMM A;  4QUP A;  4PV1 B;  3GTS A;  2WPV B;  2D2C B;  2NWF A;  4HM2 A;  1NYK A;  4H44 B;  2QJP C;  1KB9 E;  4NBC D;  2E76 B;  3VCA A;  4NBF D;  1UUW A;  3H1K E;  5CXM A;  2FYN C;  1S5L X;  4HM1 A;  4NBA D;  2JZA A;  2HMN A;  4P1C H; 
#chains in the Genus database with same CATH topology
 1EZV D;  4GT1 A;  3WUT A;  5CMZ A;  1FE6 A;  1S9K D;  4IFD K;  1O7N A;  4ZKP A;  1YJN P;  2JO6 A;  2XV5 A;  1SFC B;  1NKN A;  1S4X A;  1SQQ E;  3A0B H;  4H0L C;  1T6A A;  4IL6 X;  1BCC G;  1NH4 A;  5KJ7 D;  2MJZ A;  1O7H A;  2OAR A;  1YIT P;  3BAT A;  1NTK G;  3JSV C;  4BRY A;  4I1L A;  1ZME C;  2B88 A;  1KV4 A;  1PZQ A;  1SS1 A;  2Z5I A;  3H1H G;  2QIW A;  3FXD A;  2I8D A;  5APV A;  1A02 F;  1HUC A;  1LTJ C;  1M1K Q;  2FYU K;  5AVX B;  2FFD C;  1OZH A;  2FKW B;  1ZLL A;  4JF7 A;  4A7P A;  3CD6 P;  5KLV D;  3AE6 C;  2KS1 A;  3H1L D;  1CZQ A;  1YJW P;  2HMK A;  1FJP A;  4BRY B;  4IL6 E;  1YHQ P;  1FZG A;  1JY3 P;  3GZX A;  3VMA A;  1RF1 A;  4YXW H;  4QUP A;  2NPS C;  4RES B;  1ZW0 A;  2FYU G;  2WSE H;  1KQF B;  1VL2 A;  2V7Q J;  2JWD A;  2KNC A;  5AVS B;  1YTZ T;  3A2A A;  1P84 D;  3KZI E;  4P1C H;  3AEC C;  5APY A;  1PPJ D;  4PV1 D;  2HPC A;  2Z4E A;  1NAF A;  2NPS A;  2O01 N;  2KS1 B;  4NPE A;  1IJD B;  3CC2 P;  3L71 G;  2NUK A;  4HM6 A;  2E75 C;  3AE7 C;  4DZO A;  4P1B H;  2K1A A;  3I56 P;  1FZC A;  1ZN5 A;  1GK4 A;  1EDL A;  1W5C E;  1RF1 B;  4Y28 J;  3L75 G;  2PRR A;  4AUW A;  3MUD C;  1N73 C;  1KB9 H;  3P8C E;  3CWB G;  3L74 G;  1USE A;  2WT7 A;  4D6T D;  1M56 D;  2KK7 A;  2NPS B;  1ZV8 A;  1VQ7 P;  1CSB A;  4W7Y A;  1E79 H;  2R32 A;  4UB8 E;  3CC4 P;  3MHV A;  4JYC A;  1S3J A;  3NFQ A;  5APS A;  4CPG A;  3L71 D;  4H0L D;  1KYO E;  1U7M A;  5APQ A;  2I7F A;  1K05 A;  1FS0 E;  2KUB A;  2XNX A;  1L0N D;  1R8E A;  1KYO I;  3L75 D;  2WT7 B;  3CX5 E;  1SQX J;  3CWB D;  3L74 D;  3H25 A;  1SQB G;  2ZXX A;  2CK3 H;  2KP8 A;  1GL2 A;  3CX5 I;  1S5L X;  1NO4 A;  2HMN A;  3L35 A;  4M3L A;  3D6Z A;  1VF5 B;  1J1E B;  4H44 D;  1BSH A;  3SFE C;  3AE3 C;  3N0Q A;  2XDJ A;  3L70 J;  3BVH A;  3GL2 A;  1Q82 Q;  1LWU C;  3EFG A;  3HRN A;  1VQK P;  1GL2 B;  3IR9 A;  3FWN A;  4H13 B;  2PAJ A;  2I1J A;  2E5T A;  1DEE G;  2A45 G;  2R3C A;  1GU4 A;  3TF5 A;  4ZKU A;  3H6P A;  3H1J G;  1S5L E;  4WBA A;  2QSI A;  4EI2 A;  3CL3 D;  1PP9 J;  2M8R A;  3QH9 A;  2E74 B;  2OYH C;  2DE7 D;  1EQ7 A;  1OVR A;  1LTS C;  5CJ4 A;  2E75 D;  2NZ2 A;  2G8Y A;  1LTI C;  1N7L A;  2RH0 A;  4OH8 B;  2B9B A;  3R4Y A;  4BWN A;  2VRS A;  3CXH H;  1AVY A;  3CCJ P;  3NTN A;  3KQG A;  1KFM A;  3AE1 C;  2LR2 A;  2XR8 A;  3T97 A;  1T3U A;  3GTS A;  1GW3 A;  1WT6 A;  1FZF A;  3AE9 C;  3QWO C;  3EWK A;  1NU1 D;  2YXR B;  1H8A A;  2WSC H;  2HG5 D;  3H1J D;  1X22 A;  5AW9 B;  1FQT A;  2E4P A;  4HKZ H;  1U7J A;  4N6J A;  3TK1 A;  1ZXG A;  2RKL A;  2IX7 C;  1FDI A;  2OYH B;  1URQ C;  1PGO A;  1GDT A;  1RQU A;  3VMG D;  3T97 B;  3B5N C;  1SQQ J;  2WSE J;  3A0H H;  2OTK E;  2FYN B;  5APX A;  3EFF K;  1FJK A;  2C0W A;  1YI2 P;  2J5U A;  2R44 A;  3HUS A;  3B5N A;  2H43 A;  1O7M A;  2DE6 D;  4RJT A;  2H88 C;  1QLE D;  1M90 Q;  2N1T D;  1HJB A;  1M7L A;  2O3J A;  3AE2 C;  1VCK A;  2KOG A;  1J1D C;  3H32 A;  2GUS A;  1NTZ J;  2BCC D;  2P1J A;  1BGY J;  4HYT B;  2YKP A;  1Q86 Q;  3M9H A;  1JCC A;  1SQX D;  3L73 G;  1RFS A;  4NBD D;  1GU5 A;  3K5B A;  1NDO A;  4PD4 D;  1Y8A A;  3HUS B;  1GZL A;  3B5N B;  1H88 A;  1GD2 E;  1BSN A;  2W83 C;  2YKQ A;  5CJ0 A;  2M5A A;  5KKZ B;  3GLM A;  4NBC D;  1S2E A;  1YQ3 C;  3FWL A;  3H32 B;  5AVZ B;  5AVV B;  3L72 G;  1D7M A;  2FXP A;  1W2E A;  2WPS A;  4UB6 E;  2N9B A;  3IFM A;  1AQ5 A;  1FZA A;  1RE4 C;  3TGU G;  4EIJ A;  2H7H A;  1L0L K;  1K8A Q;  2GBW A;  1R5L A;  3MTU E;  2A45 H;  3U1A A;  3CCV P;  1RIE A;  1VQ9 P;  3L70 E;  2M5A B;  5TIS E;  3HE4 A;  1SQP G;  3VN0 A;  1VQ4 P;  1DIP A;  3GL0 A;  1ZR2 A;  1A02 J;  2JJL A;  1S72 P;  1PP9 D;  1BCC J;  3C8V A;  3VOP A;  5AW0 B;  1SQV K;  1ZP0 C;  1G2C A;  4HM8 A;  4OWF A;  2QE7 H;  3VMY A;  1JM0 A;  2D2C C;  2QEX P;  3D70 A;  5KAF H;  3TGU D;  3Q3D A;  4HM3 A;  2HLO A;  2OQQ A;  5AW6 B;  1URQ D;  2K37 A;  3PJS K;  3PLN A;  1W2B O;  5K5G B;  2YMK A;  1IK9 A;  3H1I E;  2V4H A;  3HE4 B;  4EDF A;  1EZV G;  3A0B E;  1NOH A;  1VQN P;  4IFF A;  3N4X A;  2W6B A;  3L36 A;  1LTA C;  1FDM A;  1SQP D;  3OJA B;  4HB1 A;  1SFC C;  1G2C B;  3FGA D;  4OGQ C;  1J2J B;  3H1K E;  4NBA D;  4XA4 A;  1OVU A;  4PD4 H;  2FYU J;  2M3E A;  2A06 E;  2QJY B;  4U3F E;  2HFE D;  2OYI A;  5EFW B;  3JC2 2;  3L37 A;  5KLV K;  1LJ2 A;  2B89 A;  1N7S C;  1FOS E;  3CC7 P;  4EOT A;  2CPB A;  4GKG A;  2Y0E A;  3RBZ A;  1PIX A;  4GDO A;  3KYQ A;  3V2N A;  1VQL P;  1NTK K;  2WSC J;  3E1R A;  1N7S A;  3PP5 A;  1X79 B;  4N78 E;  5APW A;  3BCC G;  3HD7 D;  1T3J A;  1KTM A;  5TJH A;  1AFO A;  4QDD A;  2ZT9 B;  3Q5P A;  1LT1 A;  3CCS P;  5KLV G;  3RK2 C;  3H1L G;  4OGQ B;  1RE3 A;  1L0L E;  1AJY A;  1WMK A;  5APT A;  1R5S A;  5KAI H;  2JDI H;  3KPE A;  3IF4 A;  1NTM E;  1HGZ A;  1O7G A;  4Y99 C;  2O01 H;  4HM7 A;  2KSE A;  2OYO A;  1N7S B;  1PPJ G;  2ZYG A;  3E7K A;  1L2P A;  1SQV E;  1NTZ E;  3CLQ A;  1BGY E;  1KIL D;  1S9K E;  3BCC D;  1KB9 E;  1BE3 G;  1IFM A;  3LW5 H;  2E76 B;  1RF1 C;  3FX0 A;  5CBN A;  3RK3 B;  3SWK A;  2R5D A;  1KB9 I;  2D2C D;  4AIV A;  3RL0 C;  3RK2 B;  4GOD A;  3LIE A;  4C7R A;  3G71 P;  2QG4 A;  2P10 A;  2QPZ A;  4D6T G;  2GBX A;  2IBZ E;  3IAO A;  1L0N K;  4HJL A;  4YTP C;  2O1K A;  4Y99 B;  3P8C D;  3JCU H;  3VYI A;  2IBZ I;  2B87 A;  1JO5 A;  2HMO A;  1FZC C;  1SFC D;  5AVY B;  1JMB A;  1BE3 D;  2HOD A;  1WRG A;  3TDK A;  3HTK A;  2WWW A;  2IYP A;  2W90 A;  1JY3 O;  1L0N G;  5AVR B;  4HJG H;  1U57 A;  1G8K B;  3RL0 B;  3D71 A;  1KYO D;  2KNC B;  3S9O A;  1BCC E;  3AE4 C;  2RMZ A;  2HR3 A;  2AXT H;  4DT0 A;  4I6M C;  2HPC B;  2W8Z A;  2B87 B;  1NTK E;  5HL4 A;  1VF5 C;  1J1E C;  3CX5 D;  4GOE A;  1VM9 A;  2HOD B;  3H1H E;  1SQB K;  3MZW B;  1FZC B;  4HM2 A;  3RK2 D;  2C0X A;  3AEB C;  1E5W A;  4HM1 A;  3MGN A;  3W68 A;  4XFJ A;  1LTB C;  2YFL A;  5KLI B;  1GL2 C;  2L5G B;  4H13 C;  3C9I A;  4K35 A;  2P2U A;  5DJU B;  2BMQ A;  3KXD A;  3RK3 E;  4K3A A;  3B71 A;  1PGP A;  1DD3 A;  2FYU E;  1LTG C;  5AW5 B;  3CPW O;  2E74 C;  3G9R A;  1RF0 A;  3VTP C;  1VQP P;  3CXH E;  4QCK A;  4JQ0 D;  3A7O A;  4R4L A;  3DQY A;  1NU1 K;  5GTH H;  3CXH I;  2FXO A;  1VQ5 P;  2B1X A;  3D89 A;  1RQV A;  3L71 E;  3RL0 D;  3G6E P;  1P84 H;  1JY2 N;  4YXD C;  4HM4 A;  2XU6 A;  2BAS A;  2WMM A;  2KYV A;  1EDJ A;  2NPS D;  3I55 P;  1L0N E;  3L75 E;  2ZXE B;  4L76 A;  5CCG A;  3CWB E;  3L74 E;  1NU1 G;  1NJI Q;  1JCD A;  1AV1 A;  1L4A A;  1DH3 A;  1OW6 A;  3H1I J;  3G3Z A;  1OMI A;  3NMD A;  3A0H E;  3L73 J;  3V2Q A;  1Q7Y Q;  2NWF A;  3RL0 g;  2FYZ A;  1NYK A;  3HE5 A;  1OW8 A;  3WMM 0;  1VQO P;  1K04 A;  4NBF D;  3M0D C;  2FYN C;  2H89 C;  2JZA A;  1FZB A;  4GIF A;  3H1K J;  2KIK A;  2O01 J;  1EDI A;  3PRJ A;  4DCK A;  1OW7 A;  3M0D A;  4U3F J;  3V4W A;  1L4A B;  1VF5 D;  1FZE A;  3S1K A;  1N86 A;  1SQB E;  3A3Y B;  4O9B A;  1S1C X;  4WY4 A;  3HE5 B;  3WU2 H;  2ITA A;  1MKM A;  5L8R J;  4AYC A;  1IFD A;  3WUU A;  1KN7 A;  2CKF A;  1UIX A;  2BCC G;  1FU1 A;  2POH A;  2Q3E A;  3CCR P;  4TT3 H;  4I2L C;  1SQX G;  1CW5 A;  4ASV A;  1Y9B A;  1GL2 D;  3HUS C;  3V4Q A;  1O7W A;  4H13 D;  2NVE A;  1QL1 A;  1L0L J;  3M91 A;  1FAV A;  4BXL A;  5KKZ C;  5BU8 B;  2AEF A;  5CCH A;  1NTM J;  4WY4 B;  3CCM P;  3GMA A;  5C39 A;  2YXQ B;  1IFN A;  2E74 D;  3SWY A;  1LGH B;  1KQS O;  1NYH A;  2GA1 A;  3H1J E;  5CBO A;  1EXI A;  4JBZ A;  4R4M A;  2WPV B;  1Y47 A;  3Q2Y A;  1SQV J;  3VMX A;  2A45 I;  1EXJ A;  2QJP C;  2ZVN B;  2W27 A;  1DX7 A;  3GHG A;  3SSU A;  3II6 A;  1KD1 Q;  3GB4 A;  1NAY A;  1T2K C;  3S4R A;  1IFI A;  4NBE D;  3ABV C;  1QVG O;  2C9L Y;  4PJ0 H;  2QRX A;  3U1C A;  5KAF E;  1PP9 G;  3Q5R A;  2KZI A;  1TU3 F;  3L70 D;  1AVO A;  4B86 A;  1FDO A;  1G1I A;  3BRT B;  2ZVO B;  2V7Q H;  4EYY Q;  1SQP K;  1HF9 A;  3GHG B;  1ZRT E;  1KQL A;  3BAS A;  1OVV A;  5AVW B;  3KDP B;  2QA4 P;  1IZN B;  2J58 A;  2QJP B;  2XSO A;  4HM5 A;  4YPC A;  4ASW A;  1OFC X;  3TYY A;  1Q81 Q;  3PTZ A;  3CI9 A;  5KJ7 C;  3LID A;  2ZYL A;  4PD4 E;  1PGQ A;  1ULJ A;  5CHX A;  5AW3 B;  3H1I D;  4L73 A;  1FOS F;  3CCE P;  2IYO A;  2QJY C;  5KJ7 A;  1UUV A;  1NTK J;  4OVN F;  2Y9Z A;  1X9V A;  3MD0 A;  4QDF A;  3CMA P;  1NHL A;  3P8M C;  2HMM A;  1JY3 N;  1SQQ G;  3ZDM A;  3H1K D;  3H1H J;  1JUN A;  3CME P;  1KQG B;  4HH2 A;  2A06 D;  3B5N D;  5CXM A;  2BEZ F;  4U3F D;  3O6Q A;  3L73 E;  1JM1 A;  3PHL A;  2ZJS E;  1ZR4 A;  3GOB A;  2ZT9 C;  5KAI E;  2Q9I A;  5AVT B;  3GW6 A;  1HVV A;  1LTT C;  5AVU B;  5B5E H;  2QJK C;  3OW2 O;  4KHX A;  2OYI C;  1LNQ A;  3AEE C;  4QDF B;  1G8J B;  1K9M Q;  1LT9 A;  3VMI D;  2KI7 B;  5H2F H;  5AEW A;  4N78 D;  4PV1 C;  2Q5U A;  2P67 A;  3L72 E;  2JKV A;  2NVG A;  1SQQ D;  2FY8 A;  1SLQ A;  1VQ8 P;  2B24 A;  2M0B A;  1L0L D;  3A5T A;  3GTE A;  4I7Z B;  3O6Q B;  4WWI A;  1K73 Q;  3SFD C;  3TGU E;  2WPQ A;  1T2K D;  1NTM D;  4QDC A;  3OA7 A;  1UII A;  1YYC A;  3L71 J;  3SWF A;  1RE3 C;  1X0T A;  1JOC A;  1RH5 B;  4HKV A;  1Q90 C;  3GF3 A;  1HH0 A;  5APU A;  3NXS A;  2E76 C;  1LT9 B;  1FBM A;  1RY3 A;  2WSF H;  1L0N J;  3RK3 C;  1PV3 A;  3VP8 A;  1SQP E;  4LGD E;  3L75 J;  3EN1 A;  2YFJ A;  1SQV D;  1NTZ D;  2JO1 A;  4HM0 A;  2QJK B;  3CWB J;  3L74 J;  1BGY D;  2OYI B;  1DD4 A;  1IK7 A;  2YVJ B;  1VDF A;  1JMM A;  1KB9 D;  4NBH D;  1X8Y A;  3JCU E;  4PV1 B;  1HGV A;  4LLH A;  3AED C;  3O8Z A;  1FC2 C;  3VCA A;  2E42 A;  2NRG A;  2E5Y A;  2IFM A;  2QM8 A;  1PL5 A;  3B4S A;  5E79 H;  3GKE A;  1EZV E;  2IBZ D;  2BMO A;  1WQL A;  1Z56 A;  1OWA A;  3USS A;  3AZC A;  4C46 A;  1EZV I;  2RN0 A;  1ULI A;  2AXT E;  1IO4 A;  1SQB J;  2H8P D;  1MV8 A;  4H44 C;  2BEQ D;  1HTL C;  2K88 A;  4RKU J;  5KTB A;  2WVR A;  1KC8 Q;  2Y0C A;  1LTJ A;  2FFD A;  1T8Z A;  1MFZ A;  1BCC D;  4H0L B;  1GTW A;  2NVF A;  2ZT9 D;  4IFM A;  1VQM P;  1NTK D;  5M1B A;  4OGQ D;  2IDB A;  2ZAE B;  3VCP A;  3I5C A;  4DJG A;  2E4Q A;  2CPS A;  1KIL E;  3BCC E;  5KLI C;  1QL2 A;  1NKZ B;  1SVF A;  2WQY C;  3H1H D;  5KLV E;  3VP9 A;  3H1L E;  1CI6 A;  1NU1 J;  3H1J J;  5B66 E;  4NPD A;  1LTJ B;  1N7S D;  3EQ2 A;  4H44 B;  2FFD B;  3VMZ A;  3D6Y A;  1G1J A;  3Q5S A;  1UUW A;  5BVZ A;  2Y0D A;  5GTH E;  2YO3 A;  2AXC A;  2R5B A;  1N2D C;  1P84 E;  2YNY A;  1Q90 D;  2PFX A;  2E76 D;  1PPJ E;  4LC1 A;  3HTK B;  1MUU A;  3RK3 D;  2FYU D;  1YTZ I;  2YFI A;  1P84 I;  4AAY B;  2NUM A;  5BU5 A;  1YJ9 P;  1CI6 B;  3MUD A;  2KB7 P;  4IL6 H;  3CXH D;  1N73 A;  1BE3 E;  1QGK B;  1JTH A;  2HYN A;  2P7J A;  1PGJ A;  1M1J C;  1AA0 A;  2IZ1 A;  1RF0 C;  3RGU A;  3KZI H;  1MFT A;  2ZYA A;  2IPP A;  2Q3I A;  5GTI E;  3PH0 A;  2E75 B;  5AEU A;  4D6T E;  1M1J A;  2BCC J;  2HMJ A;  2YKO A;  5B66 H;  1XTG B;  2WIT A;  1H0T A;  1N73 B;  2XSH A;  1JTH B;  4EMJ B;  3AE8 C;  3F5H A;  2XND H;  2PGD A;  5CCG C;  2N1T C;  2FBW C;  2KZJ A;  2Z5H A;  2KLU A;  2SPZ A;  2K3R A;  3OAK A;  3E1I A;  5BOK A;  1L4A C;  2XZR A;  5AW7 B;  3W67 A;  3AE5 C;  2LXB A;  2Q7C A;  2KLV A;  3WU2 E;  1KFN A;  4W80 A;  4UB8 H;  1M1J B;  2N1T A;  3C1L A;  1KZU B;  1H0T B;  2QVA A;  2WSF J;  1HJ0 A;  2MKV A;  3U59 A;  1KOR A;  1GMJ A;  2GM4 A;  3MP7 B;  1KYO H;  2M3B A;  1SQB D;  1VQ6 P;  2G3A A;  1LWU A;  3UIA A;  5GTI H;  1QX8 A;  2HML A;  4XE5 B;  3GG2 A;  2Y9Y A;  1KMI Z;  3CX5 H;  1SJG A;  1MZ9 A;  2IZ0 A;  3F89 A;  2N1T B;  3FOU A;  3CCU P;  4WY4 C;  3L72 J;  2Q1K A;  2WTY A;  2N9Y B;  2Q3W A;  1HBW A;  1SQX K;  4ZNC A;  4NPF X;  2WPR A;  2W6J H;  3WUV A;  3P7K A;  3AEG C;  1IFP A;  1VPC A;  2R3S A;  3TGU J;  2OYH A;  2KSJ A;  2ZFC A;  3AEF C;  4WB4 A;  1NVO A;  1LWU B;  3LW5 J;  3TNU A;  2IFN A;  3B8E B;  3L4F A;  3GF7 A;  2K9Y A;  4WVZ A;  1OXZ A;  1OX3 A;  4NB8 D;  5AVQ B;  4PJ0 E;  1JEK A;  1USD A;  5AW1 B;  1QEX A;  1SQP J;  5CCH C;  2BMR A;  3MIW A;  1NWQ A;  3M0A A;  2E43 A;  3CCL P;  1IC2 A;  1S5L H;  1BDD A;  3L70 G;  3AEA C;  3TNU B;  4RO0 A;  3GCE A;  2YMY A;  1NU1 E;  4NB9 D;  2LKM A;  3GHG C;  4DOJ A;  1URQ A;  3N7N A;  4JYB A;  3V2P A;  5CCG D;  1OIP A;  3G4S P;  4MN4 C;  1ZRT D;  2W6A A;  1YIJ P;  1L4A D;  1Q2N A;  4KT0 J;  3H1I G;  4QUQ A;  3IN6 A;  3EQQ A;  2YIU C;  3FXE A;  4NBG D;  1SP4 A;  3CCQ P;  3V5B A;  1EDK A;  1URQ B;  5DJT B;  1JY2 P;  4Z1M H;  4IOI H;  2JP3 A;  4U7J A;  2DW3 A;  1RHZ B;  3H1K G;  4ZMD A;  3HD7 C;  2OTL P;  2AEJ A;  3GZY A;  2A06 G;  1BDC A;  2BCC E;  3M9Q A;  1QVF O;  4U3F G;  2K9J A;  4AQR D;  5B5E E;  4QUR A;  3BCC J;  1GK6 A;  1NGM B;  2J59 M;  1SQX E;  2UWJ E;  4WY4 D;  5H2F E;  1SQQ K;  3HD7 A;  5KLV J;  1J1D B;  4C7N A;  3H1L J;  1ZOY C;  3RBX A;  1IFJ A;  1JY2 O;  3L73 D;  4PD4 I;  2JR8 A;  1NTM K;  1RE4 A;  1PFI A;  3R2P A;  2L91 A;  2YIU B;  3P32 A;  3KHU A;  2KXP B;  2AEM A;  4W7Z A;  2LXC B;  3TSI A;  4I7Z C;  3BRV B;  2K9J B;  1XTC C;  1KIL C;  1L0L G;  1NTZ K;  2QM7 A;  5CCH D;  1HWT C;  2OTJ P;  3L72 D;  4QMA A;  3HD7 B;  2XKM A;  2I1K A;  3VMH D;  2O1J A;  4C7N B;  1AQT A;  1NTM G;  3C0D A;  1BE3 J;  1YBK A;  1KIL A;  1LT9 C;  1O7P A;  4N3Y B;  2FXM A;  3V6I A;  2YO2 A;  4KJM A;  2GUV A;  3Q1M A;  1LP1 A;  1JNM A;  3V2R A;  1EC5 A;  4UB6 H;  2JWA A;  1SQV G;  1NTZ G;  5AW2 B;  1PP9 E;  2DE5 D;  1BGY G;  4TLF A;  2OGU A;  2C9N Y;  4D6T J;  5AW4 B;  5E79 E;  1EG9 A;  1DEB A;  2XRX A;  5AW8 B;  2Q6Q A;  3ITK A;  1GW4 A;  4NBB D;  2PP6 A;  1KIL B;  1JB0 J;  3M06 A;  2WZ7 A;  4L74 A;  5TIS H;  2JEE A;  1SFC A;  2P58 A;  4JPZ B;  1LP1 B;  2WSS H;  2IBZ G;  4L75 A;  2D2C B;  1M8O B;  2ZYD A;  1YQ4 C;  1N8R Q;  4GOF A;  1M57 D;  1H89 A;  3M9B A; 
#chains in the Genus database with same CATH homology
 2O01 J;  1P84 E;  1Q90 D;  2E76 D;  1PPJ E;  1O7N A;  1OW7 A;  2GBW A;  2JO6 A;  2YFI A;  4AAY B;  2NUM A;  1VF5 D;  1SQQ E;  4H0L C;  1SQB E;  1BE3 E;  1S1C X;  1RIE A;  4IL6 X;  3L70 E;  1MKM A;  5L8R J;  1O7H A;  1DIP A;  3GL0 A;  2CKF A;  1UIX A;  3C8V A;  4TT3 H;  1ZP0 C;  1ZME C;  1Y9B A;  2E75 B;  4HM8 A;  1O7W A;  4H13 D;  5AEU A;  2QIW A;  2NVE A;  2HMJ A;  2D2C C;  3D70 A;  5KKZ C;  3Q3D A;  4HM3 A;  2OQQ A;  2XSH A;  3GMA A;  4EMJ B;  3AE6 C;  2YMK A;  3H1I E;  2E74 D;  3AE8 C;  2HMK A;  2FBW C;  1NYH A;  3H1J E;  3GZX A;  1EXI A;  5BOK A;  4R4M A;  4QUP A;  2WPV B;  3AE5 C;  3Q2Y A;  3FGA D;  1KQF B;  1VL2 A;  4OGQ C;  1EXJ A;  2QJP C;  2V7Q J;  3H1K E;  4NBA D;  4P1C H;  3AEC C;  4PV1 D;  2WSF J;  1HJ0 A;  3GB4 A;  2A06 E;  2MKV A;  4NBE D;  4U3F E;  3ABV C;  1KOR A;  1GMJ A;  2G3A A;  2NUK A;  3Q5R A;  4HM6 A;  2E75 C;  3AE7 C;  4P1B H;  1TU3 F;  2HML A;  1FDO A;  4Y28 J;  1KMI Z;  1SJG A;  1PIX A;  4GDO A;  2WSC J;  3FOU A;  1HF9 A;  2Q3W A;  1ZRT E;  1KTM A;  4QDD A;  2ZT9 B;  3Q5P A;  3AEG C;  4OGQ B;  2XSO A;  1L0L E;  4HM5 A;  1AJY A;  1WMK A;  3AEF C;  3LW5 J;  2ZYL A;  4PD4 E;  1NTM E;  1O7G A;  1ULJ A;  3GF7 A;  2K9Y A;  4NB8 D;  4H0L D;  1KYO E;  4HM7 A;  2QJY C;  2I7F A;  1UUV A;  1K05 A;  2BMR A;  1R8E A;  1SQV E;  1NTZ E;  4QDF A;  3CX5 E;  2HMM A;  3H25 A;  1KB9 E;  2E76 B;  1KQG B;  5CXM A;  2BEZ F;  1S5L X;  3AEA C;  2HMN A;  3D6Z A;  3GCE A;  3O6Q A;  2D2C D;  4AIV A;  1VF5 B;  1NU1 E;  3L73 E;  4NB9 D;  1JM1 A;  4H44 D;  3SFE C;  3AE3 C;  3N0Q A;  3GOB A;  2ZT9 C;  2P10 A;  2QPZ A;  2QJK C;  2GBX A;  2IBZ E;  3GL2 A;  3AEE C;  4QDF B;  3IAO A;  1G8J B;  4HJL A;  3VMI D;  4YTP C;  5AEW A;  4PV1 C;  2HMO A;  3L72 E;  4KT0 J;  2NVG A;  4H13 B;  2B24 A;  3GTE A;  4I7Z B;  3SFD C;  3TGU E;  4QUQ A;  3IN6 A;  3EQQ A;  2YIU C;  4NBG D;  4QDC A;  4Z1M H;  2QSI A;  2JP3 A;  2E74 B;  1U57 A;  1G8K B;  4HKV A;  3D71 A;  4U7J A;  2DE7 D;  1Q90 C;  3GF3 A;  3S9O A;  1BCC E;  3AE4 C;  2E75 D;  2E76 C;  2NZ2 A;  2G8Y A;  1PV3 A;  1SQP E;  5HL4 A;  1NTK E;  3EN1 A;  3GZY A;  2YFJ A;  3R4Y A;  1VF5 C;  2BCC E;  2JO1 A;  4HM0 A;  4QUR A;  1DD4 A;  1NGM B;  1IK7 A;  1SQX E;  2YVJ B;  3AE1 C;  1VM9 A;  4NBH D;  2XR8 A;  3H1H E;  4PV1 B;  3GTS A;  3AE9 C;  4HM2 A;  3AED C;  1ZOY C;  3VCA A;  3EWK A;  3AEB C;  4HM1 A;  4XFJ A;  2E4P A;  1FQT A;  2YFL A;  1PL5 A;  4H13 C;  3GKE A;  1EZV E;  4I7Z C;  2BMO A;  1WQL A;  2BMQ A;  1FDI A;  3AZC A;  1RQU A;  3RK3 E;  3B71 A;  1DD3 A;  3VMG D;  2FYU E;  3T97 B;  1ULI A;  3VMH D;  2WSE J;  2E74 C;  3G9R A;  3C0D A;  3CXH E;  4QCK A;  1O7P A;  4H44 C;  2BEQ D;  3Q1M A;  4R4L A;  3DQY A;  2J5U A;  4RKU J;  1O7M A;  2DE6 D;  2H88 C;  2B1X A;  3D89 A;  1RQV A;  3L71 E;  1PP9 E;  2DE5 D;  3AE2 C;  1VCK A;  4H0L B;  4YXD C;  4HM4 A;  2NVF A;  2ZT9 D;  1L0N E;  5M1B A;  3L75 E;  4OGQ D;  2IDB A;  1EG9 A;  2XRX A;  3VCP A;  2E4Q A;  3CWB E;  4NBB D;  3L74 E;  1KIL E;  3BCC E;  5KLI C;  1RFS A;  4NBD D;  1JB0 J;  1NDO A;  2WQY C;  1OW6 A;  5KLV E;  1OMI A;  3H1L E;  2D2C B;  2NWF A;  3RL0 g;  1NYK A;  1OW8 A;  4H44 B;  3GLM A;  1YQ4 C;  4NBC D;  3D6Y A;  1YQ3 C;  1K04 A;  3Q5S A;  4NBF D;  1UUW A;  2FYN C;  2H89 C;  2JZA A;  2FXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...