5KLIC

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 52
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kliC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kliC02
5KLVE 5BOKA 2K9YA 1NTKE 3VCPA 3VMID 4EMJB 2E76D 1FQTA 1Q90C 4HM6A 4HM2A 4NBED 1VM9A 2HMLA 3L70E 3L73E 3L75E 4H13D 4NBGD 2A06E 2DE7D 2DE5D 2ZT9B 4NBHD 2WSFJ 2YIUC 1PPJE 1L0LE 3GKEA 1SQBE 2HMMA 2QJKC 3GZYA 4HM7A 2NVFA 2HMJA 1G8KB 3EN1A 4H0LD 4QURA 2NVEA 4NBFD 1RFSA 1SQPE 4HM1A 2NWFA 2XSHA 2NUMA 4NB8D 2ZYLA 1O7NA 2E74B 4QDCA 2WPVB 5KKZC 2YFLA 4HM5A 2QSIA 3GTEA 4P1CH 1G8JB 5AEWA 1JM1A 3L74E 1VCKA 4U3FE 1O7MA 4AAYB 1VF5D 3AZCA 3GZXA 1O7GA 1RIEA 2HMKA 3H1KE 2ZT9D 2D2CB 3VMGD 2DE6D 2QJYC 4NBCD 1L0NE 1NYKA 2FYUE 1SQVE 4KT0J 4PV1B 4HM0A 4QCKA 2B24A 2GBXA 3C8VA 3FOUA 1UUVA 1EZVE 2QPZA 4QUQA 2FYNC 2XRXA 4HKVA 4QDDA 3CXHE 1Q90D 2QJPC 1ULJA 3H1LE 3TGUE 1PP9E 2YVJB 2BCCE 1UUWA 2WSEJ 4QDFA 3L72E 1ZRTE 2E75B 3H1IE 2B1XA 3D89A 1NTME 3VCAA 1O7WA 2IBZE 3GTSA 5L8RJ 3CX5E 4OGQB 2BMQA 3VMHD 2D2CD 1S5LX 4HM4A 4H44D 4HJLA 4OGQD 5CXMA 1SQXE 4QDFB 4QUPA 1KB9E 5AEUA 4PD4E 2QIWA 1JB0J 2E75D 3L71E 4IL6X 1SJGA 2NVGA 1VF5B 2HMOA 4NBAD 4HM3A 4H13B 2BMRA 3H1JE 4Y28J 1O7HA 2BMOA 2GBWA 2JZAA 3GL2A 4AIVA 4RKUJ 3CWBE 1KYOE 3GCEA 1WQLA 1P84E 4NB9D 4NBDD 4PV1D 2O01J 3GL0A 4NBBD 3BCCE 1NTZE 2YFIA 1ULIA 1NU1E 4HM8A 3EQQA 4I7ZB 2Q3WA 4H0LB 2YFJA 5KLIC 3GOBA 5HL4A 2XR8A 2CKFA 2XSOA 3H1HE 1EG9A 4P1BH 2I7FA 1O7PA 1SQQE 2E4QA 1BE3E 2WSCJ 2E76B 1BCCE 2NUKA 2HMNA 3DQYA 2JO6A 1NDOA 3N0QA 3LW5J 2E4PA 3GB4A 3C0DA 4H44B 2E74D
chains in the Genus database with same CATH superfamily
1K04A 3B71A 1GU4A 4JQ0D 2Z5IA 3M06A 1EZVD 2E76C 3MTUE 3L73D 4K35A 1YIJP 1GL2B 4NBFD 4JBZA 2P58A 2R3CA 3L71G 3T97B 1EXJA 1JY2O 2FY8A 4GT1A 2JR8A 1FDMA 1M7LA 1O7MA 1QVFO 2WZ7A 3A0BE 1M56D 3B5ND 1KD1Q 1PGPA 1NYKA 4HYTB 1MFTA 4YPCA 2WITA 2IFMA 2Y0CA 2RH0A 1FOSE 4L74A 2E75B 2R32A 4ZKUA 3G6EP 1D7MA 1S5LX 3H1IG 3PHLA 3P32A 3BASA 5CCHD 5GTHE 1X79B 3KXDA 1H0TA 3EQ2A 1DIPA 3Q5SA 1LTJB 3AE4C 2XSOA 1SP4A 4I1LA 4YXWH 3NXSA 1JCDA 2R3SA 1LT9B 1W2EA 3GHGA 1UIXA 3OA7A 3KHUA 3QH9A 4IL6E 2AEFA 5AW0B 2XZRA 1R8EA 3HE5A 3SWFA 2WVRA 1SFCB 2LKMA 1N7SC 2IZ0A 4D6TE 1G1JA 2DE7D 2IBZI 1OW7A 1PP9J 1WT6A 1S9KE 1IK9A 1A02J 5BVZA 3GF3A 4DCKA 1BCCJ 1VQ8P 1BGYG 1J1EB 4PV1C 3KZIE 4C7NB 4HKZH 2Y9ZA 2ZT9D 1GW3A 1NTZG 2M3EA 1X0TA 2MJZA 1N7LA 2O1JA 1S72P 1X22A 1Z56A 4WY4A 2QPZA 3CI9A 1KFNA 5AVVB 1HBWA 3TGUE 3FX0A 3CC7P 2WSEJ 5APSA 3L72E 1N73C 1URQD 3V4QA 4H44C 3L71D 5KAIH 1EXIA 3V2NA 1ZMEC 3R4YA 5KJ7A 2HMOA 3D71A 1HJBA 1FZAA 3H1HD 4RKUJ 1SFCC 4NBDD 2XV5A 2Q3WA 2JP3A 1GTWA 4P1BH 2NZ2A 1KC8Q 4U3FD 1M1JC 1Y47A 4PD4I 2JO1A 1ZR2A 1A02F 3CX5I 1FZGA 1RF1B 5APYA 1EC5A 3LW5J 1J1DC 3V2QA 3RL0g 1S9KD 4U3FJ 4L76A 4NBED 1OZHA 2OYHA 3L75G 1KILA 3H1HG 2E74C 4XE5B 1SQXJ 1JTHA 2YO2A 3ZDMA 4Z1MH 1OMIA 1KILB 2YFLA 1DX7A 3NFQA 2PRRA 2IFNA 1EDKA 2KS1B 1KORA 3F5HA 1IK7A 1IFIA 2NPSB 1L0NG 2HMKA 2FFDB 4PV1B 1PPJD 2NPSA 1GW4A 1SQBG 4QDDA 2BCCJ 3EFGA 3Q2YA 1E79H 1KFMA 3Q5PA 4WWIA 2J59M 3A7OA 2Q5UA 1NKZB 2KI7B 1N7SD 3TK1A 2WSSH 3L4FA 2E75D 2W6BA 1T2KD 2DW3A 1BE3D 5B5EE 3L74D 2YFIA 3I55P 1LGHB 1HVVA 1NU1D 4OH8B 1BCCE 3CMEP 1KILC 4IL6H 1TU3F 3RBZA 3FXDA 1NTMG 1FZBA 3W68A 3E1RA 5TISH 1OW6A 1FZCC 1VM9A 4H13D 2A45H 5BU8B 4EYYQ 2H43A 3L36A 4QMAA 2ZXXA 1YBKA 5CBNA 2NVFA 1KB9I 3RL0D 3V5BA 1YYCA 1NWQA 3CCVP 3FGAD 3L37A 2FYUD 2QSIA 4HM5A 2CK3H 4TT3H 3PLNA 3IF4A 2KUBA 1IJDB 3PJSK 2YXRB 5TJHA 1T3JA 2KLVA 4W7YA 1IFJA 2OYIA 1NTKJ 4GOEA 1LP1A 5L8RJ 5KLVJ 1W5CE 3B5NC 3VMXA 5H2FE 3N4XA 2WWWA 4UB6E 3D70A 1HGZA 4WY4D 4HM3A 4RJTA 4AIVA 2YMKA 4HJGH 2O01J 4NBBD 2KB7P 1NTZE 1NO4A 3I5CA 2HLOA 2XNDH 2E5YA 3L74J 2WSCJ 2E76B 1KYOH 1PP9G 1X8YA 5KJ7D 5B5EH 4EI2A 5CCGA 2OYOA 1AV1A 2KNCA 2E74D 3VCPA 5TISE 1DH3A 1SQQG 4HM2A 1BCCG 1T3UA 1M1KQ 2GA1A 2KNCB 3M0DC 2WQYC 1PPJE 3GZYA 4H0LD 1ZR4A 1NU1J 3PH0A 4NPDA 2XSHA 2QG4A 4QDCA 3GTEA 1NTMK 1VQ4P 2IYPA 1VF5D 3GMAA 1KYOD 2P1JA 2GUVA 3M91A 1IC2A 3KYQA 1E5WA 1SS1A 3AEGC 2K9JA 3WUTA 4HH2A 1HTLC 2QJPC 1M1JB 3U1AA 3M0AA 4KHXA 2B88A 1GZLA 3E1IA 4L75A 1KN7A 4UB8E 4H13C 1FDIA 1OXZA 1SQQK 3Q1MA 4D6TG 3CX5H 1KB9H 1JY3O 3M9HA 4IL6X 1SVFA 4YXDC 3Q3DA 3ITKA 3RK2D 1J2JB 2BMOA 2FFDC 2WPSA 1HF9A 2IPPA 5BU5A 5KLIC 3H1HE 1EG9A 3CCQP 1O7PA 1NKNA 3L70G 2NUKA 1K73Q 1H89A 2QVAA 2HODB 1G2CB 1SQXG 2QRXA 2E4PA 3G71P 4WBAA 1VQOP 1NTKE 5GTIH 2HODA 1G2CA 1NTMD 2A06E 3WUUA 2C0XA 5AVUB 2ITAA 5CCGC 1SQBE 1QEXA 3AE9C 2HPCB 4HM7A 1HUCA 2NUMA 1HJ0A 2ZYGA 2OYHB 2E43A 2Q1KA 1VQMP 4GODA 1HWTC 4N6JA 2YKQA 1K8AQ 2XNXA 2FXOA 2FYNC 4HB1A 1L0LJ 1ULJA 5AW9B 4LLHA 1MUUA 3Q5RA 1ZRTE 2J5UA 1Y9BA 2M5AA 2K3RA 3D89A 3RK2C 1NAFA 2QJPB 1M90Q 1BDCA 1KB9E 2P67A 1U7MA 1JOCA 2Z4EA 2BMRA 3HD7A 2YKPA 1WQLA 1Q7YQ 2PAJA 3G9RA 3MP7B 1AQTA 2B9BA 3B4SA 3HD7B 3WU2H 1VQLP 3MD0A 1NTZD 2Y0DA 1FOSF 2HMNA 1FC2C 2W90A 1PGOA 3SWKA 1VQNP 3H1JG 2E76D 2OYHC 4BWNA 3L75E 3L72G 2B87B 4DZOA 1S5LH 3L73G 3MIWA 1NTKD 2WPQA 3HTKA 5AVZB 1PP9D 3AEBC 1H88A 2NPSC 3HUSC 3AE8C 4N3YB 3JCUH 4GKGA 3AZCA 1JNMA 3GZXA 1FE6A 2XDJA 4NBCD 2YXQB 2RN0A 5KLVG 1P84I 4JYCA 4DT0A 3FOUA 1EZVE 2KK7A 3RBXA 1EQ7A 3JSVC 1KQSO 1PGQA 3MGNA 3TDKA 2UWJE 5KKZB 1VQ5P 2A45I 2N1TA 1O7WA 3GTSA 4OGQB 1VL2A 1LT9C 3VYIA 4LC1A 4QUPA 1SQVD 2XU6A 1NU1K 4PD4E 1JY2N 3L71J 1CSBA 2N1TB 2NVGA 3BATA 4ASVA 1CI6B 1KYOE 1JMMA 1P84E 3MZWB 1LNQA 3CC4P 1URQA 2K88A 3EQQA 2OARA 3D6YA 2XR8A 3A5TA 1SQQJ 3AEEC 1S3JA 3BCCD 3B8EB 1BE3E 2J58A 2V7QJ 3GB4A 3IAOA 3CL3D 5KJ7C 3VMID 4EMJB 3FWNA 2M0BA 2JWDA 3RL0B 2FYUK 3H1IJ 2GM4A 2ZT9B 1N73A 3GKEA 2Q6QA 1FZCA 2C9LY 1SQPK 3CCEP 4R4MA 3H1ID 4WY4C 1IFMA 3E7KA 4RO0A 1LWUA 1NOHA 1JM1A 1AFOA 3WUVA 1IFPA 1BDDA 5KLVK 1QL2A 1UIIA 1AQ5A 2BASA 4GDOA 4OGQC 5DJUB 2WSCH 2E75C 1MV8A 3VP9A 4D6TJ 2XRXA 1BE3G 1Q90D 3OJAB 2ZYDA 4QDFA 3U59A 2BCCD 3H1IE 1H8AA 1RY3A 2LXBA 1RE4A 2AXTE 1L0NK 1PIXA 4OGQD 4QDFB 4PD4H 2WPRA 4DJGA 1SJGA 1SQXK 2HR3A 2OTLP 3K5BA 1QVGO 3S4RA 3GF7A 2R5DA 1X9VA 2YNYA 3RL0C 1SQVJ 1YHQP 3AECC 1SQPJ 1LT9A 3GHGB 2C0WA 2N9BA 5M1BA 1BSNA 4A7PA 3G3ZA 2HG5D 3UIAA 2FYUG 1KILD 4W80A 3CCMP 2K1AA 5CBOA 3P8CD 1WMKA 3LW5H 3IFMA 2HMLA 3CLQA 5AVTB 2FYZA 4I6MC 2JWAA 1OVRA 1SQQD 3HRNA 3MUDA 1YTZT 5C39A 3AE6C 4C7NA 3GG2A 3C1LA 1PL5A 2WPVB 1RE3A 2BEZF 1HH0A 1L0LG 4ASWA 4U3FE 1S4XA 3H1KE 4WY4B 5DJTB 2WT7B 2AEJA 3AE2C 2AEMA 5GTHH 4HKVA 2WT7A 2FFDA 1J1EC 5AW6B 2BCCE 1VPCA 3I56P 1L4AA 3L75J 2W6AA 4D6TD 3VCAA 2G8YA 2OQQA 4DOJA 2PGDA 1EDIA 2W27A 4C46A 1YJWP 2D2CC 2M5AB 5KLVD 1P84H 3H1LG 2KOGA 5EFWB 4XFJA 2CPBA 3ABVC 1FJKA 3GL0A 1L0NJ 2OGUA 1BCCD 4ZMDA 3O6QA 1Q81Q 3H1JJ 5AW2B 5E79E 5HL4A 1RF1C 3HUSA 1SQVK 2LXCB 1AVOA 2POHA 1JMBA 2FXMA 1MZ9A 2WTYA 1JTHB 5E79H 1Q86Q 2SPZA 3VMZA 5KAFH 4RESB 2O01H 3VTPC 2WSFJ 1LTBC 3CCSP 2YIUC 3AEAC 1L0LE 4EIJA 1EZVG 3P8MC 2QJKC 2CPSA 2RMZA 2V7QH 3USSA 1KYOI 1GD2E 5APWA 1LWUC 2KS1A 1J1DB 1JCCA 1N86A 5AW5B 3B5NA 4H0LC 1L0LK 4NB8D 1O7NA 4EDFA 1JUNA 3TF5A 3H32B 2L91A 4M3LA 1EDLA 2IDBA 4AAYB 3B5NB 2KLUA 1ZN5A 4JPZB 1IFNA 3A0BH 2D2CB 2QJYC 2IBZG 3RK2B 1AA0A 3H32A 1Y8AA 4BRYB 1SQVE 4KT0J 4HM0A 2LR2A 1PV3A 3A0HH 1URQC 2ZAEB 4BRYA 4AYCA 5AW3B 3CXHH 1ZV8A 2OYIB 2D2CD 4H44D 2JEEA 1SQBD 5CXMA 4R4LA 2AXTH 4I2LC 3M9BA 2OTKE 1NJIQ 2QE7H 3GL2A 1GDTA 1N7SA 1JY3P 4I7ZB 2YIUB 2R44A 3H1KD 3TNUB 1RE4C 2I7FA 3QWOC 2E4QA 1YJNP 1L0ND 1LTJA 4L73A 2W6JH 5APVA 1DD3A 1NTKG 1OVUA 3TNUA 1YJ9P 5BOKA 1GL2A 3L70E 3L73E 1T8ZA 4NBGD 2Q3EA 5AVQB 2HFED 2O01N 4IFDK 3P8CE 3T97A 1ZOYC 3H1LD 2YKOA 2ZYLA 1N73B 1FZCB 1G8JB 5AEWA 1BE3J 1KMIZ 2L5GB 3HE4B 5AVRB 2PP6A 2OYIC 3L74G 1O7GA 2DE6D 3BRTB 3CCRP 3HE4A 2B24A 2KP8A 3TGUG 5KLIB 3C8VA 4JYBA 2IBZD 2VRSA 1JEKA 1SLQA 5AW8B 1M8OB 2A06G 3KQGA 2QM8A 1YQ3C 2NRGA 1L0LD 4IFFA 2Y0EA 1R5LA 3CX5E 1U7JA 4BXLA 3GLMA 1S2EA 3VP8A 1NU1G 1H0TB 1NH4A 1SQXE 3RK3C 2I8DA 1VQPP 2R5BA 3BCCE 2FYUJ 3A2AA 4Y99B 1VQ9P 3GOBA 1USEA 1QGKB 1BGYJ 3RK3D 2P2UA 1NTKK 1P84D 2P7JA 3HE5B 1SFCA 1NTZJ 1EDJA 1HGVA 1T2KC 3C0DA 4PD4D 1IO4A 5KLVE 3OW2O 1ZXGA 3VMYA 1RF1A 3VN0A 2PFXA 3A0HE 3TYYA 2FYNB 2NVEA 1YITP 1SQPE 2ZT9C 3CMAP 2ZYAA 3FWLA 1OIPA 1PZQA 2NPSD 3N7NA 1QLED 3A3YB 3VMGD 1L0NE 2N9YB 3CWBD 4GOFA 3P7KA 4XA4A 1VF5C 3H1LJ 3CCJP 1LTIC 1L4AC 2YMYA 2B1XA 5AVXB 4GIFA 3HD7D 3KDPB 3BCCG 3CWBJ 4U3FG 4HJLA 2BEQD 4AUWA 3AE3C 1N2DC 3L71E 3AE1C 3MUDC 3H1HJ 2Q3IA 2KSJA 4LGDE 4N78D 5AVYB 1KV4A 4NB9D 3S9OA 5B66E 2YFJA 1LTAC 2XKMA 3O8ZA 3CCUP 2C9NY 1M57D 3PP5A 1YQ4C 1S5LE 2KZIA 1BGYE 3IR9A 2WMMA 3LIDA 2JO6A 2I1JA 1FDOA 1S1CX 5CMZA 3V6IA 1GMJA 3WMM0 3MHVA 3II6A 1FQTA 2HPCA 5CCHC 2DE5D 4WVZA 3L75D 3CCLP 1SQXD 1ZP0C 1USDA 3VMAA 2HMJA 2KYVA 1BGYD 3OAKA 2FXPA 1NVOA 3FXEA 1LJ2A 1QX8A 5KKZC 4P1CH 3HTKB 5AVSB 3V2RA 1NYHA 3S1KA 1W2BO 2W8ZA 5AW7B 1FJPA 1OX3A 2N1TD 1VQ6P 2M8RA 3H1KJ 1UUVA 1K9MQ 2JKVA 4O9BA 1R5SA 3CD6P 2YVJB 4TLFA 1KB9D 3L73J 1IZNB 3JCUE 2A06D 1NTME 1NTMJ 2JDIH 1LTJC 2BMQA 3LIEA 1LP1B 4UB8H 1JB0J 4YTPC 1LT1A 1KZUB 4Y28J 1KTMA 1JM0A 3EWKA 3M0DA 5CHXA 4AQRD 1YI2P 1N7SB 1SQPD 4WB4A 2QJKB 3NTNA 1KQLA 2H89C 3L72D 4HM6A 3TGUD 2OTJP 3V4WA 1JY2P 1N8RQ 3GW6A 1VDFA 4OWFA 1AJYA 1VQ7P 4EOTA 3EN1A 1SFCD 2P10A 4HM1A 1SQBK 3KPEA 3TGUJ 1KQFB 3W67A 1PGJA 2QM7A 2QJYB 2ZVOB 3L74E 1KILE 1VCKA 2Y9YA 2IX7C 5KTBA 1ZLLA 2QA4P 1LWUB 1RQUA 2ZXEB 4QCKA 1NHLA 5APXA 3EFFK 1AVYA 3CX5D 2RKLA 5CJ0A 3H6PA 3CXHE 1PP9E 1BSHA 2JJLA 1OVVA 2V4HA 1T6AA 2IBZE 4JF7A 5CJ4A 1CI6A 1JO5A 2GUSA 5AW1B 1LTSC 1URQB 3SSUA 3PRJA 1XTGB 3H25A 4H13B 1JY3N 4NPEA 1RHZB 5K5GB 4PV1D 1LTGC 3BVHA 3SFDC 1K05A 3L35A 1ULIA 1EZVI 3SFEC 2KIKA 2CKFA 1DD4A 3D6ZA 1RF0C 1DEEG 2N1TC 2ZFCA 4PJ0E 3PTZA 4I7ZC 5KAFE 1GU5A 2MKVA 2K9YA 1Q90C 3R2PA 3JC22 3CXHI 4ZNCA 1CW5A 1QL1A 3AE7C 3WU2E 2WSEH 1L2PA 1OW8A 3BRVB 1SQVG 3CXHD 1SQPG 3AEFC 1RQVA 2E74B 1RF0A 2A45G 2FBWC 1NGMB 2HYNA 1LTTC 1Q2NA 2K9JB 3F89A 2E5TA 1M1JA 2FYUE 2ZJSE 3BCCJ 3CWBG 2M3BA 4IOIH 2GBXA 4MN4C 2FKWB 1ZW0A 2WSFH 3SWYA 5CCHA 3L70J 2B89A 3KZIH 4W7ZA 3HD7C 2KXPB 2Q7CA 5APUA 2ZVNB 5H2FH 1FU1A 3U1CA 5AEUA 3V2PA 2QIWA 4NBAD 5CCGD 3GHGC 1GK4A 2JZAA 3CWBE 3RK3B 3RK3E 1FZEA 1NU1E 2YO3A 3RGUA 4H0LB 2IZ1A 4U7JA 3H1JD 5B66H 2K37A 4B86A 4PJ0H 2QEXP 4Y99C 3O6QB 3DQYA 1RH5B 5APQA 5GTIE 1CZQA 3N0QA 3CPWO 4H44B 3VOPA 1IFDA 1NAYA 3HUSB 1GL2C 4K3AA 4KJMA 2H7HA 4NBHD 1DEBA 4ZKPA 2HMMA 1VQKP 1G8KB 2KZJA 4QURA 1RFSA 2B87A 2NWFA 1FZFA 1NTZK 1WRGA 3AEDC 3H1KG 1RE3C 2Q9IA 2AXCA 4IFMA 1PFIA 2Z5HA 3NMDA 1RIEA 1Q82Q 1MKMA 4NPFX 1GK6A 4N78E 5AW4B 1L4AB 5AVWB 4OVNF 4QUQA 1FAVA 3TSIA 3H1LE 1FS0E 1KQGB 1UUWA 4CPGA 1OFCX 1FBMA 3C9IA 1YTZI 2G3AA 3L70D 3CC2P 4C7RA 3VMHD 4HM4A 3M9QA 3L72J 5APTA 1SQBJ 3IN6A 5KAIE 1L4AD 2H88C 2BCCG 3AE5C 1VF5B 3H1JE 1ZRTD 1O7HA 2GBWA 2I1KA 4UB6H 3GCEA 2E42A 1XTCC 3G4SP 4HM8A 1PPJG 2O1KA 1G1IA 1MFZA 1SQQE 2W83C 1GL2D 1U57A 1NDOA 1OWAA 2KSEA 2IYOA 2O3JA 2H8PD
chains in the Genus database with same CATH topology
1K04A 3B71A 3VCPA 1FQTA 1WMKA 4HM2A 2HMLA 2DE5D 2E76C 2WQYC 1PPJE 1ZP0C 3GZYA 2HMJA 4H0LD 4NBFD 2FXPA 3AE6C 2XSHA 4QDCA 1PL5A 2WPVB 3T97B 5KKZC 1EXJA 3GTEA 4P1CH 2BEZF 4U3FE 1O7MA 1VF5D 3H1KE 1NYHA 3AE2C 1NYKA 3GMAA 3AEGC 1UUVA 4HKVA 2QJPC 2YVJB 2BCCE 2E75B 1NTME 3VCAA 4H13C 1FDIA 2BMQA 2G8YA 1S5LX 2OQQA 3Q1MA 2D2CC 1JB0J 4IL6X 4YTPC 4YXDC 3Q3DA 4XFJA 4Y28J 2BMOA 3ABVC 1KTMA 3EWKA 3GL0A 1DIPA 3Q5SA 1HF9A 3O6QA 5KLIC 3AE4C 5HL4A 2XSOA 3H1HE 1EG9A 1O7PA 2NUKA 1UIXA 2E4PA 1NTKE 2H89C 1R8EA 4HM6A 2A06E 2DE7D 1OW7A 2WSFJ 2YIUC 3AEAC 1L0LE 1AJYA 1SQBE 2QJKC 3AE9C 4HM7A 3EN1A 2P10A 3GF3A 4HM1A 4H0LC 2NUMA 1HJ0A 4NB8D 1KQFB 1O7NA 3L74E 1KILE 4PV1C 1VCKA 2IDBA 4AAYB 2ZT9D 2D2CB 2QJYC 1RQUA 1SQVE 4KT0J 4HM0A 1PV3A 4QCKA 2QPZA 2FYNC 3CXHE 1ULJA 3TGUE 1PP9E 2WSEJ 3L72E 3Q5RA 1ZRTE 2J5UA 1Y9BA 3D89A 4H44C 2IBZE 2D2CD 4H44D 1EXIA 5CXMA 1KB9E 1ZMEC 4R4LA 3R4YA 2HMOA 3H25A 3D71A 4H13B 2BMRA 3GL2A 4RKUJ 1WQLA 4NBDD 4PV1D 3G9RA 3SFDC 1K05A 1ULIA 4I7ZB 3SFEC 2Q3WA 2JP3A 2CKFA 1DD4A 3D6ZA 4P1BH 2NZ2A 2I7FA 2E4QA 2HMNA 4I7ZC 2JO1A 1DD3A 3LW5J 2MKVA 5BOKA 2K9YA 3RL0g 2E76D 1Q90C 4NBED 3L70E 3L73E 3L75E 4NBGD 3AE7C 2E74C 1OW8A 1ZOYC 4Z1MH 3AEBC 1OMIA 2ZYLA 3AEFC 1RQVA 2E74B 2YFLA 1G8JB 5AEWA 1KMIZ 2FBWC 1NGMB 3AE8C 1KORA 1IK7A 3AZCA 3GZXA 1O7GA 2HMKA 2DE6D 4NBCD 2FYUE 4PV1B 2B24A 2GBXA 3C8VA 3FOUA 1EZVE 4QDDA 3Q2YA 1YQ3C 3Q5PA 1O7WA 3GTSA 3CX5E 4OGQB 1VL2A 3GLMA 1SQXE 4QUPA 5AEUA 4PD4E 2QIWA 2E75D 2NVGA 4NBAD 2JZAA 3CWBE 1KYOE 1P84E 3BCCE 3RK3E 2YFIA 1NU1E 3EQQA 3D6YA 4H0LB 3GOBA 2XR8A 4U7JA 3AEEC 1BE3E 1BCCE 3DQYA 2V7QJ 1TU3F 3N0QA 3GB4A 3C0DA 4H44B 3IAOA 5KLVE 3VMID 4EMJB 1OW6A 1VM9A 4H13D 2ZT9B 4NBHD 3GKEA 2HMMA 2NVFA 1G8KB 4QURA 4R4MA 2NVEA 1RFSA 1SQPE 2NWFA 2ZT9C 3AEDC 3FGAD 4HM5A 2QSIA 4TT3H 1JM1A 1RIEA 3VMGD 1MKMA 4GDOA 1L0NE 4OGQC 2E75C 4QUQA 2XRXA 1Q90D 1VF5C 3H1LE 1KQGB 1UUWA 4QDFA 3H1IE 2B1XA 2G3AA 5L8RJ 3VMHD 1PIXA 4HM4A 4HJLA 4OGQD 4QDFB 2BEQD 3IN6A 3AE3C 3D70A 3L71E 3AE5C 2H88C 3AE1C 1SJGA 1VF5B 4HM3A 3H1JE 2GBWA 1O7HA 4AIVA 3GF7A 3GCEA 2YMKA 4NB9D 2O01J 4NBBD 1NTZE 3AECC 4HM8A 3S9OA 2YFJA 1YQ4C 5M1BA 1SQQE 1U57A 2WSCJ 2E76B 2JO6A 1NDOA 1FDOA 1S1CX 2E74D 1GMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV E;  5BOK A;  2K9Y A;  1NTK E;  3VCP A;  3VMI D;  4EMJ B;  2E76 D;  1FQT A;  1Q90 C;  4HM6 A;  4HM2 A;  4NBE D;  1VM9 A;  2HML A;  3L70 E;  3L73 E;  3L75 E;  4H13 D;  4NBG D;  2A06 E;  2DE7 D;  2DE5 D;  2ZT9 B;  4NBH D;  2WSF J;  2YIU C;  1PPJ E;  1L0L E;  3GKE A;  1SQB E;  2HMM A;  2QJK C;  3GZY A;  4HM7 A;  2NVF A;  2HMJ A;  1G8K B;  3EN1 A;  4H0L D;  4QUR A;  2NVE A;  4NBF D;  1RFS A;  1SQP E;  4HM1 A;  2NWF A;  2XSH A;  2NUM A;  4NB8 D;  2ZYL A;  1O7N A;  2E74 B;  4QDC A;  2WPV B;  5KKZ C;  2YFL A;  4HM5 A;  2QSI A;  3GTE A;  4P1C H;  1G8J B;  5AEW A;  1JM1 A;  3L74 E;  1VCK A;  4U3F E;  1O7M A;  4AAY B;  1VF5 D;  3AZC A;  3GZX A;  1O7G A;  1RIE A;  2HMK A;  3H1K E;  2ZT9 D;  2D2C B;  3VMG D;  2DE6 D;  2QJY C;  4NBC D;  1L0N E;  1NYK A;  2FYU E;  1SQV E;  4KT0 J;  4PV1 B;  4HM0 A;  4QCK A;  2B24 A;  2GBX A;  3C8V A;  3FOU A;  1UUV A;  1EZV E;  2QPZ A;  4QUQ A;  2FYN C;  2XRX A;  4HKV A;  4QDD A;  3CXH E;  1Q90 D;  2QJP C;  1ULJ A;  3H1L E;  3TGU E;  1PP9 E;  2YVJ B;  2BCC E;  1UUW A;  2WSE J;  4QDF A;  3L72 E;  1ZRT E;  2E75 B;  3H1I E;  2B1X A;  3D89 A;  1NTM E;  3VCA A;  1O7W A;  2IBZ E;  3GTS A;  5L8R J;  3CX5 E;  4OGQ B;  2BMQ A;  3VMH D;  2D2C D;  1S5L X;  4HM4 A;  4H44 D;  4HJL A;  4OGQ D;  5CXM A;  1SQX E;  4QDF B;  4QUP A;  1KB9 E;  5AEU A;  4PD4 E;  2QIW A;  1JB0 J;  2E75 D;  3L71 E;  4IL6 X;  1SJG A;  2NVG A;  1VF5 B;  2HMO A;  4NBA D;  4HM3 A;  4H13 B;  2BMR A;  3H1J E;  4Y28 J;  1O7H A;  2BMO A;  2GBW A;  2JZA A;  3GL2 A;  4AIV A;  4RKU J;  3CWB E;  1KYO E;  3GCE A;  1WQL A;  1P84 E;  4NB9 D;  4NBD D;  4PV1 D;  2O01 J;  3GL0 A;  4NBB D;  3BCC E;  1NTZ E;  2YFI A;  1ULI A;  1NU1 E;  4HM8 A;  3EQQ A;  4I7Z B;  2Q3W A;  4H0L B;  2YFJ A;  5KLI C;  3GOB A;  5HL4 A;  2XR8 A;  2CKF A;  2XSO A;  3H1H E;  1EG9 A;  4P1B H;  2I7F A;  1O7P A;  1SQQ E;  2E4Q A;  1BE3 E;  2WSC J;  2E76 B;  1BCC E;  2NUK A;  2HMN A;  3DQY A;  2JO6 A;  1NDO A;  3N0Q A;  3LW5 J;  2E4P A;  3GB4 A;  3C0D A;  4H44 B;  2E74 D; 
#chains in the Genus database with same CATH topology
 1K04 A;  3B71 A;  1GU4 A;  4JQ0 D;  2Z5I A;  3M06 A;  1EZV D;  2E76 C;  3MTU E;  3L73 D;  4K35 A;  1YIJ P;  1GL2 B;  4NBF D;  4JBZ A;  2P58 A;  2R3C A;  3L71 G;  3T97 B;  1EXJ A;  1JY2 O;  2FY8 A;  4GT1 A;  2JR8 A;  1FDM A;  1M7L A;  1O7M A;  1QVF O;  2WZ7 A;  3A0B E;  1M56 D;  3B5N D;  1KD1 Q;  1PGP A;  1NYK A;  4HYT B;  1MFT A;  4YPC A;  2WIT A;  2IFM A;  2Y0C A;  2RH0 A;  1FOS E;  4L74 A;  2E75 B;  2R32 A;  4ZKU A;  3G6E P;  1D7M A;  1S5L X;  3H1I G;  3PHL A;  3P32 A;  3BAS A;  5CCH D;  5GTH E;  1X79 B;  3KXD A;  1H0T A;  3EQ2 A;  1DIP A;  3Q5S A;  1LTJ B;  3AE4 C;  2XSO A;  1SP4 A;  4I1L A;  4YXW H;  3NXS A;  1JCD A;  2R3S A;  1LT9 B;  1W2E A;  3GHG A;  1UIX A;  3OA7 A;  3KHU A;  3QH9 A;  4IL6 E;  2AEF A;  5AW0 B;  2XZR A;  1R8E A;  3HE5 A;  3SWF A;  2WVR A;  1SFC B;  2LKM A;  1N7S C;  2IZ0 A;  4D6T E;  1G1J A;  2DE7 D;  2IBZ I;  1OW7 A;  1PP9 J;  1WT6 A;  1S9K E;  1IK9 A;  1A02 J;  5BVZ A;  3GF3 A;  4DCK A;  1BCC J;  1VQ8 P;  1BGY G;  1J1E B;  4PV1 C;  3KZI E;  4C7N B;  4HKZ H;  2Y9Z A;  2ZT9 D;  1GW3 A;  1NTZ G;  2M3E A;  1X0T A;  2MJZ A;  1N7L A;  2O1J A;  1S72 P;  1X22 A;  1Z56 A;  4WY4 A;  2QPZ A;  3CI9 A;  1KFN A;  5AVV B;  1HBW A;  3TGU E;  3FX0 A;  3CC7 P;  2WSE J;  5APS A;  3L72 E;  1N73 C;  1URQ D;  3V4Q A;  4H44 C;  3L71 D;  5KAI H;  1EXI A;  3V2N A;  1ZME C;  3R4Y A;  5KJ7 A;  2HMO A;  3D71 A;  1HJB A;  1FZA A;  3H1H D;  4RKU J;  1SFC C;  4NBD D;  2XV5 A;  2Q3W A;  2JP3 A;  1GTW A;  4P1B H;  2NZ2 A;  1KC8 Q;  4U3F D;  1M1J C;  1Y47 A;  4PD4 I;  2JO1 A;  1ZR2 A;  1A02 F;  3CX5 I;  1FZG A;  1RF1 B;  5APY A;  1EC5 A;  3LW5 J;  1J1D C;  3V2Q A;  3RL0 g;  1S9K D;  4U3F J;  4L76 A;  4NBE D;  1OZH A;  2OYH A;  3L75 G;  1KIL A;  3H1H G;  2E74 C;  4XE5 B;  1SQX J;  1JTH A;  2YO2 A;  3ZDM A;  4Z1M H;  1OMI A;  1KIL B;  2YFL A;  1DX7 A;  3NFQ A;  2PRR A;  2IFN A;  1EDK A;  2KS1 B;  1KOR A;  3F5H A;  1IK7 A;  1IFI A;  2NPS B;  1L0N G;  2HMK A;  2FFD B;  4PV1 B;  1PPJ D;  2NPS A;  1GW4 A;  1SQB G;  4QDD A;  2BCC J;  3EFG A;  3Q2Y A;  1E79 H;  1KFM A;  3Q5P A;  4WWI A;  2J59 M;  3A7O A;  2Q5U A;  1NKZ B;  2KI7 B;  1N7S D;  3TK1 A;  2WSS H;  3L4F A;  2E75 D;  2W6B A;  1T2K D;  2DW3 A;  1BE3 D;  5B5E E;  3L74 D;  2YFI A;  3I55 P;  1LGH B;  1HVV A;  1NU1 D;  4OH8 B;  1BCC E;  3CME P;  1KIL C;  4IL6 H;  1TU3 F;  3RBZ A;  3FXD A;  1NTM G;  1FZB A;  3W68 A;  3E1R A;  5TIS H;  1OW6 A;  1FZC C;  1VM9 A;  4H13 D;  2A45 H;  5BU8 B;  4EYY Q;  2H43 A;  3L36 A;  4QMA A;  2ZXX A;  1YBK A;  5CBN A;  2NVF A;  1KB9 I;  3RL0 D;  3V5B A;  1YYC A;  1NWQ A;  3CCV P;  3FGA D;  3L37 A;  2FYU D;  2QSI A;  4HM5 A;  2CK3 H;  4TT3 H;  3PLN A;  3IF4 A;  2KUB A;  1IJD B;  3PJS K;  2YXR B;  5TJH A;  1T3J A;  2KLV A;  4W7Y A;  1IFJ A;  2OYI A;  1NTK J;  4GOE A;  1LP1 A;  5L8R J;  5KLV J;  1W5C E;  3B5N C;  3VMX A;  5H2F E;  3N4X A;  2WWW A;  4UB6 E;  3D70 A;  1HGZ A;  4WY4 D;  4HM3 A;  4RJT A;  4AIV A;  2YMK A;  4HJG H;  2O01 J;  4NBB D;  2KB7 P;  1NTZ E;  1NO4 A;  3I5C A;  2HLO A;  2XND H;  2E5Y A;  3L74 J;  2WSC J;  2E76 B;  1KYO H;  1PP9 G;  1X8Y A;  5KJ7 D;  5B5E H;  4EI2 A;  5CCG A;  2OYO A;  1AV1 A;  2KNC A;  2E74 D;  3VCP A;  5TIS E;  1DH3 A;  1SQQ G;  4HM2 A;  1BCC G;  1T3U A;  1M1K Q;  2GA1 A;  2KNC B;  3M0D C;  2WQY C;  1PPJ E;  3GZY A;  4H0L D;  1ZR4 A;  1NU1 J;  3PH0 A;  4NPD A;  2XSH A;  2QG4 A;  4QDC A;  3GTE A;  1NTM K;  1VQ4 P;  2IYP A;  1VF5 D;  3GMA A;  1KYO D;  2P1J A;  2GUV A;  3M91 A;  1IC2 A;  3KYQ A;  1E5W A;  1SS1 A;  3AEG C;  2K9J A;  3WUT A;  4HH2 A;  1HTL C;  2QJP C;  1M1J B;  3U1A A;  3M0A A;  4KHX A;  2B88 A;  1GZL A;  3E1I A;  4L75 A;  1KN7 A;  4UB8 E;  4H13 C;  1FDI A;  1OXZ A;  1SQQ K;  3Q1M A;  4D6T G;  3CX5 H;  1KB9 H;  1JY3 O;  3M9H A;  4IL6 X;  1SVF A;  4YXD C;  3Q3D A;  3ITK A;  3RK2 D;  1J2J B;  2BMO A;  2FFD C;  2WPS A;  1HF9 A;  2IPP A;  5BU5 A;  5KLI C;  3H1H E;  1EG9 A;  3CCQ P;  1O7P A;  1NKN A;  3L70 G;  2NUK A;  1K73 Q;  1H89 A;  2QVA A;  2HOD B;  1G2C B;  1SQX G;  2QRX A;  2E4P A;  3G71 P;  4WBA A;  1VQO P;  1NTK E;  5GTI H;  2HOD A;  1G2C A;  1NTM D;  2A06 E;  3WUU A;  2C0X A;  5AVU B;  2ITA A;  5CCG C;  1SQB E;  1QEX A;  3AE9 C;  2HPC B;  4HM7 A;  1HUC A;  2NUM A;  1HJ0 A;  2ZYG A;  2OYH B;  2E43 A;  2Q1K A;  1VQM P;  4GOD A;  1HWT C;  4N6J A;  2YKQ A;  1K8A Q;  2XNX A;  2FXO A;  2FYN C;  4HB1 A;  1L0L J;  1ULJ A;  5AW9 B;  4LLH A;  1MUU A;  3Q5R A;  1ZRT E;  2J5U A;  1Y9B A;  2M5A A;  2K3R A;  3D89 A;  3RK2 C;  1NAF A;  2QJP B;  1M90 Q;  1BDC A;  1KB9 E;  2P67 A;  1U7M A;  1JOC A;  2Z4E A;  2BMR A;  3HD7 A;  2YKP A;  1WQL A;  1Q7Y Q;  2PAJ A;  3G9R A;  3MP7 B;  1AQT A;  2B9B A;  3B4S A;  3HD7 B;  3WU2 H;  1VQL P;  3MD0 A;  1NTZ D;  2Y0D A;  1FOS F;  2HMN A;  1FC2 C;  2W90 A;  1PGO A;  3SWK A;  1VQN P;  3H1J G;  2E76 D;  2OYH C;  4BWN A;  3L75 E;  3L72 G;  2B87 B;  4DZO A;  1S5L H;  3L73 G;  3MIW A;  1NTK D;  2WPQ A;  3HTK A;  5AVZ B;  1PP9 D;  3AEB C;  1H88 A;  2NPS C;  3HUS C;  3AE8 C;  4N3Y B;  3JCU H;  4GKG A;  3AZC A;  1JNM A;  3GZX A;  1FE6 A;  2XDJ A;  4NBC D;  2YXQ B;  2RN0 A;  5KLV G;  1P84 I;  4JYC A;  4DT0 A;  3FOU A;  1EZV E;  2KK7 A;  3RBX A;  1EQ7 A;  3JSV C;  1KQS O;  1PGQ A;  3MGN A;  3TDK A;  2UWJ E;  5KKZ B;  1VQ5 P;  2A45 I;  2N1T A;  1O7W A;  3GTS A;  4OGQ B;  1VL2 A;  1LT9 C;  3VYI A;  4LC1 A;  4QUP A;  1SQV D;  2XU6 A;  1NU1 K;  4PD4 E;  1JY2 N;  3L71 J;  1CSB A;  2N1T B;  2NVG A;  3BAT A;  4ASV A;  1CI6 B;  1KYO E;  1JMM A;  1P84 E;  3MZW B;  1LNQ A;  3CC4 P;  1URQ A;  2K88 A;  3EQQ A;  2OAR A;  3D6Y A;  2XR8 A;  3A5T A;  1SQQ J;  3AEE C;  1S3J A;  3BCC D;  3B8E B;  1BE3 E;  2J58 A;  2V7Q J;  3GB4 A;  3IAO A;  3CL3 D;  5KJ7 C;  3VMI D;  4EMJ B;  3FWN A;  2M0B A;  2JWD A;  3RL0 B;  2FYU K;  3H1I J;  2GM4 A;  2ZT9 B;  1N73 A;  3GKE A;  2Q6Q A;  1FZC A;  2C9L Y;  1SQP K;  3CCE P;  4R4M A;  3H1I D;  4WY4 C;  1IFM A;  3E7K A;  4RO0 A;  1LWU A;  1NOH A;  1JM1 A;  1AFO A;  3WUV A;  1IFP A;  1BDD A;  5KLV K;  1QL2 A;  1UII A;  1AQ5 A;  2BAS A;  4GDO A;  4OGQ C;  5DJU B;  2WSC H;  2E75 C;  1MV8 A;  3VP9 A;  4D6T J;  2XRX A;  1BE3 G;  1Q90 D;  3OJA B;  2ZYD A;  4QDF A;  3U59 A;  2BCC D;  3H1I E;  1H8A A;  1RY3 A;  2LXB A;  1RE4 A;  2AXT E;  1L0N K;  1PIX A;  4OGQ D;  4QDF B;  4PD4 H;  2WPR A;  4DJG A;  1SJG A;  1SQX K;  2HR3 A;  2OTL P;  3K5B A;  1QVG O;  3S4R A;  3GF7 A;  2R5D A;  1X9V A;  2YNY A;  3RL0 C;  1SQV J;  1YHQ P;  3AEC C;  1SQP J;  1LT9 A;  3GHG B;  2C0W A;  2N9B A;  5M1B A;  1BSN A;  4A7P A;  3G3Z A;  2HG5 D;  3UIA A;  2FYU G;  1KIL D;  4W80 A;  3CCM P;  2K1A A;  5CBO A;  3P8C D;  1WMK A;  3LW5 H;  3IFM A;  2HML A;  3CLQ A;  5AVT B;  2FYZ A;  4I6M C;  2JWA A;  1OVR A;  1SQQ D;  3HRN A;  3MUD A;  1YTZ T;  5C39 A;  3AE6 C;  4C7N A;  3GG2 A;  3C1L A;  1PL5 A;  2WPV B;  1RE3 A;  2BEZ F;  1HH0 A;  1L0L G;  4ASW A;  4U3F E;  1S4X A;  3H1K E;  4WY4 B;  5DJT B;  2WT7 B;  2AEJ A;  3AE2 C;  2AEM A;  5GTH H;  4HKV A;  2WT7 A;  2FFD A;  1J1E C;  5AW6 B;  2BCC E;  1VPC A;  3I56 P;  1L4A A;  3L75 J;  2W6A A;  4D6T D;  3VCA A;  2G8Y A;  2OQQ A;  4DOJ A;  2PGD A;  1EDI A;  2W27 A;  4C46 A;  1YJW P;  2D2C C;  2M5A B;  5KLV D;  1P84 H;  3H1L G;  2KOG A;  5EFW B;  4XFJ A;  2CPB A;  3ABV C;  1FJK A;  3GL0 A;  1L0N J;  2OGU A;  1BCC D;  4ZMD A;  3O6Q A;  1Q81 Q;  3H1J J;  5AW2 B;  5E79 E;  5HL4 A;  1RF1 C;  3HUS A;  1SQV K;  2LXC B;  1AVO A;  2POH A;  1JMB A;  2FXM A;  1MZ9 A;  2WTY A;  1JTH B;  5E79 H;  1Q86 Q;  2SPZ A;  3VMZ A;  5KAF H;  4RES B;  2O01 H;  3VTP C;  2WSF J;  1LTB C;  3CCS P;  2YIU C;  3AEA C;  1L0L E;  4EIJ A;  1EZV G;  3P8M C;  2QJK C;  2CPS A;  2RMZ A;  2V7Q H;  3USS A;  1KYO I;  1GD2 E;  5APW A;  1LWU C;  2KS1 A;  1J1D B;  1JCC A;  1N86 A;  5AW5 B;  3B5N A;  4H0L C;  1L0L K;  4NB8 D;  1O7N A;  4EDF A;  1JUN A;  3TF5 A;  3H32 B;  2L91 A;  4M3L A;  1EDL A;  2IDB A;  4AAY B;  3B5N B;  2KLU A;  1ZN5 A;  4JPZ B;  1IFN A;  3A0B H;  2D2C B;  2QJY C;  2IBZ G;  3RK2 B;  1AA0 A;  3H32 A;  1Y8A A;  4BRY B;  1SQV E;  4KT0 J;  4HM0 A;  2LR2 A;  1PV3 A;  3A0H H;  1URQ C;  2ZAE B;  4BRY A;  4AYC A;  5AW3 B;  3CXH H;  1ZV8 A;  2OYI B;  2D2C D;  4H44 D;  2JEE A;  1SQB D;  5CXM A;  4R4L A;  2AXT H;  4I2L C;  3M9B A;  2OTK E;  1NJI Q;  2QE7 H;  3GL2 A;  1GDT A;  1N7S A;  1JY3 P;  4I7Z B;  2YIU B;  2R44 A;  3H1K D;  3TNU B;  1RE4 C;  2I7F A;  3QWO C;  2E4Q A;  1YJN P;  1L0N D;  1LTJ A;  4L73 A;  2W6J H;  5APV A;  1DD3 A;  1NTK G;  1OVU A;  3TNU A;  1YJ9 P;  5BOK A;  1GL2 A;  3L70 E;  3L73 E;  1T8Z A;  4NBG D;  2Q3E A;  5AVQ B;  2HFE D;  2O01 N;  4IFD K;  3P8C E;  3T97 A;  1ZOY C;  3H1L D;  2YKO A;  2ZYL A;  1N73 B;  1FZC B;  1G8J B;  5AEW A;  1BE3 J;  1KMI Z;  2L5G B;  3HE4 B;  5AVR B;  2PP6 A;  2OYI C;  3L74 G;  1O7G A;  2DE6 D;  3BRT B;  3CCR P;  3HE4 A;  2B24 A;  2KP8 A;  3TGU G;  5KLI B;  3C8V A;  4JYB A;  2IBZ D;  2VRS A;  1JEK A;  1SLQ A;  5AW8 B;  1M8O B;  2A06 G;  3KQG A;  2QM8 A;  1YQ3 C;  2NRG A;  1L0L D;  4IFF A;  2Y0E A;  1R5L A;  3CX5 E;  1U7J A;  4BXL A;  3GLM A;  1S2E A;  3VP8 A;  1NU1 G;  1H0T B;  1NH4 A;  1SQX E;  3RK3 C;  2I8D A;  1VQP P;  2R5B A;  3BCC E;  2FYU J;  3A2A A;  4Y99 B;  1VQ9 P;  3GOB A;  1USE A;  1QGK B;  1BGY J;  3RK3 D;  2P2U A;  1NTK K;  1P84 D;  2P7J A;  3HE5 B;  1SFC A;  1NTZ J;  1EDJ A;  1HGV A;  1T2K C;  3C0D A;  4PD4 D;  1IO4 A;  5KLV E;  3OW2 O;  1ZXG A;  3VMY A;  1RF1 A;  3VN0 A;  2PFX A;  3A0H E;  3TYY A;  2FYN B;  2NVE A;  1YIT P;  1SQP E;  2ZT9 C;  3CMA P;  2ZYA A;  3FWL A;  1OIP A;  1PZQ A;  2NPS D;  3N7N A;  1QLE D;  3A3Y B;  3VMG D;  1L0N E;  2N9Y B;  3CWB D;  4GOF A;  3P7K A;  4XA4 A;  1VF5 C;  3H1L J;  3CCJ P;  1LTI C;  1L4A C;  2YMY A;  2B1X A;  5AVX B;  4GIF A;  3HD7 D;  3KDP B;  3BCC G;  3CWB J;  4U3F G;  4HJL A;  2BEQ D;  4AUW A;  3AE3 C;  1N2D C;  3L71 E;  3AE1 C;  3MUD C;  3H1H J;  2Q3I A;  2KSJ A;  4LGD E;  4N78 D;  5AVY B;  1KV4 A;  4NB9 D;  3S9O A;  5B66 E;  2YFJ A;  1LTA C;  2XKM A;  3O8Z A;  3CCU P;  2C9N Y;  1M57 D;  3PP5 A;  1YQ4 C;  1S5L E;  2KZI A;  1BGY E;  3IR9 A;  2WMM A;  3LID A;  2JO6 A;  2I1J A;  1FDO A;  1S1C X;  5CMZ A;  3V6I A;  1GMJ A;  3WMM 0;  3MHV A;  3II6 A;  1FQT A;  2HPC A;  5CCH C;  2DE5 D;  4WVZ A;  3L75 D;  3CCL P;  1SQX D;  1ZP0 C;  1USD A;  3VMA A;  2HMJ A;  2KYV A;  1BGY D;  3OAK A;  2FXP A;  1NVO A;  3FXE A;  1LJ2 A;  1QX8 A;  5KKZ C;  4P1C H;  3HTK B;  5AVS B;  3V2R A;  1NYH A;  3S1K A;  1W2B O;  2W8Z A;  5AW7 B;  1FJP A;  1OX3 A;  2N1T D;  1VQ6 P;  2M8R A;  3H1K J;  1UUV A;  1K9M Q;  2JKV A;  4O9B A;  1R5S A;  3CD6 P;  2YVJ B;  4TLF A;  1KB9 D;  3L73 J;  1IZN B;  3JCU E;  2A06 D;  1NTM E;  1NTM J;  2JDI H;  1LTJ C;  2BMQ A;  3LIE A;  1LP1 B;  4UB8 H;  1JB0 J;  4YTP C;  1LT1 A;  1KZU B;  4Y28 J;  1KTM A;  1JM0 A;  3EWK A;  3M0D A;  5CHX A;  4AQR D;  1YI2 P;  1N7S B;  1SQP D;  4WB4 A;  2QJK B;  3NTN A;  1KQL A;  2H89 C;  3L72 D;  4HM6 A;  3TGU D;  2OTJ P;  3V4W A;  1JY2 P;  1N8R Q;  3GW6 A;  1VDF A;  4OWF A;  1AJY A;  1VQ7 P;  4EOT A;  3EN1 A;  1SFC D;  2P10 A;  4HM1 A;  1SQB K;  3KPE A;  3TGU J;  1KQF B;  3W67 A;  1PGJ A;  2QM7 A;  2QJY B;  2ZVO B;  3L74 E;  1KIL E;  1VCK A;  2Y9Y A;  2IX7 C;  5KTB A;  1ZLL A;  2QA4 P;  1LWU B;  1RQU A;  2ZXE B;  4QCK A;  1NHL A;  5APX A;  3EFF K;  1AVY A;  3CX5 D;  2RKL A;  5CJ0 A;  3H6P A;  3CXH E;  1PP9 E;  1BSH A;  2JJL A;  1OVV A;  2V4H A;  1T6A A;  2IBZ E;  4JF7 A;  5CJ4 A;  1CI6 A;  1JO5 A;  2GUS A;  5AW1 B;  1LTS C;  1URQ B;  3SSU A;  3PRJ A;  1XTG B;  3H25 A;  4H13 B;  1JY3 N;  4NPE A;  1RHZ B;  5K5G B;  4PV1 D;  1LTG C;  3BVH A;  3SFD C;  1K05 A;  3L35 A;  1ULI A;  1EZV I;  3SFE C;  2KIK A;  2CKF A;  1DD4 A;  3D6Z A;  1RF0 C;  1DEE G;  2N1T C;  2ZFC A;  4PJ0 E;  3PTZ A;  4I7Z C;  5KAF E;  1GU5 A;  2MKV A;  2K9Y A;  1Q90 C;  3R2P A;  3JC2 2;  3CXH I;  4ZNC A;  1CW5 A;  1QL1 A;  3AE7 C;  3WU2 E;  2WSE H;  1L2P A;  1OW8 A;  3BRV B;  1SQV G;  3CXH D;  1SQP G;  3AEF C;  1RQV A;  2E74 B;  1RF0 A;  2A45 G;  2FBW C;  1NGM B;  2HYN A;  1LTT C;  1Q2N A;  2K9J B;  3F89 A;  2E5T A;  1M1J A;  2FYU E;  2ZJS E;  3BCC J;  3CWB G;  2M3B A;  4IOI H;  2GBX A;  4MN4 C;  2FKW B;  1ZW0 A;  2WSF H;  3SWY A;  5CCH A;  3L70 J;  2B89 A;  3KZI H;  4W7Z A;  3HD7 C;  2KXP B;  2Q7C A;  5APU A;  2ZVN B;  5H2F H;  1FU1 A;  3U1C A;  5AEU A;  3V2P A;  2QIW A;  4NBA D;  5CCG D;  3GHG C;  1GK4 A;  2JZA A;  3CWB E;  3RK3 B;  3RK3 E;  1FZE A;  1NU1 E;  2YO3 A;  3RGU A;  4H0L B;  2IZ1 A;  4U7J A;  3H1J D;  5B66 H;  2K37 A;  4B86 A;  4PJ0 H;  2QEX P;  4Y99 C;  3O6Q B;  3DQY A;  1RH5 B;  5APQ A;  5GTI E;  1CZQ A;  3N0Q A;  3CPW O;  4H44 B;  3VOP A;  1IFD A;  1NAY A;  3HUS B;  1GL2 C;  4K3A A;  4KJM A;  2H7H A;  4NBH D;  1DEB A;  4ZKP A;  2HMM A;  1VQK P;  1G8K B;  2KZJ A;  4QUR A;  1RFS A;  2B87 A;  2NWF A;  1FZF A;  1NTZ K;  1WRG A;  3AED C;  3H1K G;  1RE3 C;  2Q9I A;  2AXC A;  4IFM A;  1PFI A;  2Z5H A;  3NMD A;  1RIE A;  1Q82 Q;  1MKM A;  4NPF X;  1GK6 A;  4N78 E;  5AW4 B;  1L4A B;  5AVW B;  4OVN F;  4QUQ A;  1FAV A;  3TSI A;  3H1L E;  1FS0 E;  1KQG B;  1UUW A;  4CPG A;  1OFC X;  1FBM A;  3C9I A;  1YTZ I;  2G3A A;  3L70 D;  3CC2 P;  4C7R A;  3VMH D;  4HM4 A;  3M9Q A;  3L72 J;  5APT A;  1SQB J;  3IN6 A;  5KAI E;  1L4A D;  2H88 C;  2BCC G;  3AE5 C;  1VF5 B;  3H1J E;  1ZRT D;  1O7H A;  2GBW A;  2I1K A;  4UB6 H;  3GCE A;  2E42 A;  1XTC C;  3G4S P;  4HM8 A;  1PPJ G;  2O1K A;  1G1I A;  1MFZ A;  1SQQ E;  2W83 C;  1GL2 D;  1U57 A;  1NDO A;  1OWA A;  2KSE A;  2IYO A;  2O3J A;  2H8P D; 
#chains in the Genus database with same CATH homology
 1K04 A;  3B71 A;  3VCP A;  1FQT A;  1WMK A;  4HM2 A;  2HML A;  2DE5 D;  2E76 C;  2WQY C;  1PPJ E;  1ZP0 C;  3GZY A;  2HMJ A;  4H0L D;  4NBF D;  2FXP A;  3AE6 C;  2XSH A;  4QDC A;  1PL5 A;  2WPV B;  3T97 B;  5KKZ C;  1EXJ A;  3GTE A;  4P1C H;  2BEZ F;  4U3F E;  1O7M A;  1VF5 D;  3H1K E;  1NYH A;  3AE2 C;  1NYK A;  3GMA A;  3AEG C;  1UUV A;  4HKV A;  2QJP C;  2YVJ B;  2BCC E;  2E75 B;  1NTM E;  3VCA A;  4H13 C;  1FDI A;  2BMQ A;  2G8Y A;  1S5L X;  2OQQ A;  3Q1M A;  2D2C C;  1JB0 J;  4IL6 X;  4YTP C;  4YXD C;  3Q3D A;  4XFJ A;  4Y28 J;  2BMO A;  3ABV C;  1KTM A;  3EWK A;  3GL0 A;  1DIP A;  3Q5S A;  1HF9 A;  3O6Q A;  5KLI C;  3AE4 C;  5HL4 A;  2XSO A;  3H1H E;  1EG9 A;  1O7P A;  2NUK A;  1UIX A;  2E4P A;  1NTK E;  2H89 C;  1R8E A;  4HM6 A;  2A06 E;  2DE7 D;  1OW7 A;  2WSF J;  2YIU C;  3AEA C;  1L0L E;  1AJY A;  1SQB E;  2QJK C;  3AE9 C;  4HM7 A;  3EN1 A;  2P10 A;  3GF3 A;  4HM1 A;  4H0L C;  2NUM A;  1HJ0 A;  4NB8 D;  1KQF B;  1O7N A;  3L74 E;  1KIL E;  4PV1 C;  1VCK A;  2IDB A;  4AAY B;  2ZT9 D;  2D2C B;  2QJY C;  1RQU A;  1SQV E;  4KT0 J;  4HM0 A;  1PV3 A;  4QCK A;  2QPZ A;  2FYN C;  3CXH E;  1ULJ A;  3TGU E;  1PP9 E;  2WSE J;  3L72 E;  3Q5R A;  1ZRT E;  2J5U A;  1Y9B A;  3D89 A;  4H44 C;  2IBZ E;  2D2C D;  4H44 D;  1EXI A;  5CXM A;  1KB9 E;  1ZME C;  4R4L A;  3R4Y A;  2HMO A;  3H25 A;  3D71 A;  4H13 B;  2BMR A;  3GL2 A;  4RKU J;  1WQL A;  4NBD D;  4PV1 D;  3G9R A;  3SFD C;  1K05 A;  1ULI A;  4I7Z B;  3SFE C;  2Q3W A;  2JP3 A;  2CKF A;  1DD4 A;  3D6Z A;  4P1B H;  2NZ2 A;  2I7F A;  2E4Q A;  2HMN A;  4I7Z C;  2JO1 A;  1DD3 A;  3LW5 J;  2MKV A;  5BOK A;  2K9Y A;  3RL0 g;  2E76 D;  1Q90 C;  4NBE D;  3L70 E;  3L73 E;  3L75 E;  4NBG D;  3AE7 C;  2E74 C;  1OW8 A;  1ZOY C;  4Z1M H;  3AEB C;  1OMI A;  2ZYL A;  3AEF C;  1RQV A;  2E74 B;  2YFL A;  1G8J B;  5AEW A;  1KMI Z;  2FBW C;  1NGM B;  3AE8 C;  1KOR A;  1IK7 A;  3AZC A;  3GZX A;  1O7G A;  2HMK A;  2DE6 D;  4NBC D;  2FYU E;  4PV1 B;  2B24 A;  2GBX A;  3C8V A;  3FOU A;  1EZV E;  4QDD A;  3Q2Y A;  1YQ3 C;  3Q5P A;  1O7W A;  3GTS A;  3CX5 E;  4OGQ B;  1VL2 A;  3GLM A;  1SQX E;  4QUP A;  5AEU A;  4PD4 E;  2QIW A;  2E75 D;  2NVG A;  4NBA D;  2JZA A;  3CWB E;  1KYO E;  1P84 E;  3BCC E;  3RK3 E;  2YFI A;  1NU1 E;  3EQQ A;  3D6Y A;  4H0L B;  3GOB A;  2XR8 A;  4U7J A;  3AEE C;  1BE3 E;  1BCC E;  3DQY A;  2V7Q J;  1TU3 F;  3N0Q A;  3GB4 A;  3C0D A;  4H44 B;  3IAO A;  5KLV E;  3VMI D;  4EMJ B;  1OW6 A;  1VM9 A;  4H13 D;  2ZT9 B;  4NBH D;  3GKE A;  2HMM A;  2NVF A;  1G8K B;  4QUR A;  4R4M A;  2NVE A;  1RFS A;  1SQP E;  2NWF A;  2ZT9 C;  3AED C;  3FGA D;  4HM5 A;  2QSI A;  4TT3 H;  1JM1 A;  1RIE A;  3VMG D;  1MKM A;  4GDO A;  1L0N E;  4OGQ C;  2E75 C;  4QUQ A;  2XRX A;  1Q90 D;  1VF5 C;  3H1L E;  1KQG B;  1UUW A;  4QDF A;  3H1I E;  2B1X A;  2G3A A;  5L8R J;  3VMH D;  1PIX A;  4HM4 A;  4HJL A;  4OGQ D;  4QDF B;  2BEQ D;  3IN6 A;  3AE3 C;  3D70 A;  3L71 E;  3AE5 C;  2H88 C;  3AE1 C;  1SJG A;  1VF5 B;  4HM3 A;  3H1J E;  2GBW A;  1O7H A;  4AIV A;  3GF7 A;  3GCE A;  2YMK A;  4NB9 D;  2O01 J;  4NBB D;  1NTZ E;  3AEC C;  4HM8 A;  3S9O A;  2YFJ A;  1YQ4 C;  5M1B A;  1SQQ E;  1U57 A;  2WSC J;  2E76 B;  2JO6 A;  1NDO A;  1FDO A;  1S1C X;  2E74 D;  1GMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...