5KLIC

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 52
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kliC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kliC02
1O7NA 1EZVE 2BCCE 1JM1A 3LW5J 1ULJA 4QDFB 1O7GA 2QJPC 2FYNC 4NBAD 4AIVA 2E75D 5AEWA 3CWBE 4HM7A 1P84E 4NBBD 1ULIA 2BMQA 3CX5E 3L75E 5CXMA 1SQVE 2D2CD 4HM1A 3GTSA 4P1CH 1SQPE 3VMHD 3VMID 4NBFD 1KYOE 2XSOA 4QCKA 2QIWA 3AZCA 3EQQA 4PV1B 4NBED 3L74E 1NDOA 3H1HE 3CXHE 2ZYLA 3VMGD 2ZT9B 3L70E 2NUMA 1O7MA 1NYKA 2E76D 4EMJB 4HM8A 5KLIC 3C0DA 1G8KB 2E75B 3GZXA 1NTZE 5BOKA 3BCCE 3GZYA 2QSIA 2NUKA 2HMLA 2DE7D 1FQTA 2E76B 2XR8A 2WSFJ 1VF5B 2NVFA 2ZT9D 2NVEA 4HM6A 1Q90D 2YFIA 4U3FE 1G8JB 1Q90C 4PV1D 2E4PA 1EG9A 2IBZE 1O7WA 1SQXE 1UUWA 2HMOA 3GCEA 1O7HA 4H13B 4H0LD 2O01J 1PPJE 2HMNA 3H1IE 4QUPA 1SJGA 1VF5D 2YFLA 4HKVA 4HJLA 4P1BH 1NTKE 2DE5D 3C8VA 3GKEA 4HM2A 4AAYB 1L0LE 2BMRA 4QDFA 5L8RJ 1VM9A 2YVJB 3EN1A 2XRXA 4RKUJ 1O7PA 3GL2A 4OGQD 4QUQA 2E74D 2WSEJ 1NTME 2WSCJ 2HMJA 3L73E 3L71E 2Q3WA 4HM0A 3DQYA 4H44D 1BE3E 2B24A 2WPVB 2A06E 3GOBA 1WQLA 2BMOA 3VCAA 3GL0A 4I7ZB 2FYUE 2GBXA 3H1LE 4QDDA 1L0NE 4HM4A 2YIUC 1BCCE 5AEUA 2K9YA 4QDCA 2E74B 3FOUA 5HL4A 5KLVE 2HMKA 3GB4A 1UUVA 4PD4E 2B1XA 2NVGA 3VCPA 2DE6D 5KKZC 4NB9D 2HMMA 3L72E 1ZRTE 1RIEA 1S5LX 4QURA 1NU1E 2JO6A 2NWFA 3D89A 2CKFA 2XSHA 1VCKA 4Y28J 2JZAA 2QJYC 1SQQE 2E4QA 3GTEA 1KB9E 1RFSA 4IL6X 3H1JE 1PP9E 3TGUE 2QJKC 2D2CB 4H0LB 4H13D 4NB8D 4HM5A 2I7FA 4NBCD 1SQBE 2GBWA 1JB0J 2QPZA 4H44B 4NBHD 4HM3A 2YFJA 4NBGD 3H1KE 3N0QA 4KT0J 4NBDD 4OGQB
chains in the Genus database with same CATH superfamily
3B71A 2E5YA 4L76A 5DJTB 5CXMA 3Q5RA 2G3AA 3RK3B 1AA0A 3H25A 2ZT9B 1QX8A 1FZAA 3Q1MA 3AE3C 2E75B 2H43A 1NYHA 3SWYA 4IOIH 2N9YB 4N78D 3ABVC 1JY3P 2OTJP 4L73A 3KYQA 2O01J 2XNXA 5CBNA 3LIEA 3G71P 1OFCX 3RK3E 1GU4A 2HR3A 1SQQJ 1EXJA 4EIJA 3D6YA 4OGQD 2WSEJ 1VPCA 1E5WA 3GHGC 3E1RA 1M57D 2XV5A 1YBKA 1SQBG 4QDCA 2E74B 1LJ2A 1LTJA 5AVUB 2GUVA 3A0BH 3AE9C 3S4RA 2XSHA 2KZIA 4OH8B 4IL6X 2O3JA 3M06A 4NBCD 2M3EA 2WT7A 1NTMJ 4NBGD 2JKVA 1R5LA 3H1KE 3N0QA 2IBZD 4WY4D 3NTNA 1S5LH 1S9KD 3WUUA 2QJPC 2P67A 1XTGB 1RE3A 5CCGD 1FDMA 5BU8B 3CCUP 1ULIA 1PP9D 1IZNB 1RE4A 1VQ7P 1FBMA 4HH2A 4N3YB 4JPZB 1E79H 3BCCG 1NDOA 2FYUK 1OVUA 3EFFK 3CX5D 3A0HE 2K37A 1SQXG 1Q86Q 1FQTA 1M1KQ 1LTJC 2Q1KA 2WWWA 3CCRP 4U3FE 1Q90C 3U1CA 1SQXE 2HMOA 3PLNA 4JYBA 4HM2A 1L0LJ 3USSA 4EYYQ 2AXTE 3GL2A 3P8MC 1NO4A 3D71A 2BEQD 4WVZA 1BCCD 2WPRA 2FYUJ 4I7ZB 3GL0A 2GBXA 4HM4A 2E42A 1YHQP 3ITKA 3ZDMA 1VQ6P 1K04A 3PHLA 3CCSP 1VQMP 1PV3A 5M1BA 1T8ZA 3SSUA 4WWIA 2O1KA 1ZR4A 1JO5A 4HM5A 4L74A 1URQD 5GTHH 5AW4B 1Q82Q 1SP4A 3PH0A 1BDDA 1YJNP 5AEWA 2E5TA 1J1DB 2LXBA 3GW6A 1Z56A 1SQVE 1SQPE 2QVAA 4NBFD 1SQBJ 1W5CE 1J2JB 3MZWB 2ZJSE 3T97A 3GZXA 5APTA 3H1KD 2GUSA 2NUKA 3HUSA 4WB4A 4HKZH 4H13C 4PD4I 1EZVD 3KDPB 3TYYA 2YFIA 3Q5SA 1O7WA 2OYHA 1S5LE 5APUA 2WQYC 3H1IE 2AEJA 3W67A 4HKVA 4B86A 3V2PA 1NU1G 3JC22 3TK1A 1ZLLA 1GL2C 2IZ0A 1M7LA 3H1LJ 5B5EH 1D7MA 1BCCG 1IK7A 4PJ0E 1AVOA 2RKLA 1YTZI 3VCAA 1NKZB 1L0NE 2KB7P 1OMIA 3C9IA 1NH4A 1AQ5A 3L75G 1SQBK 4WBAA 1HVVA 4YXWH 3P7KA 1SQBD 2HG5D 2W90A 1SVFA 2JEEA 3OW2O 3GTEA 1KB9E 1GL2B 1S3JA 2GBWA 4D6TE 3VOPA 3CX5I 1L4AB 1EZVE 1H8AA 3B8EB 3NFQA 2FYNC 2FFDB 3V2NA 2NRGA 1NVOA 3F89A 2B87B 4RJTA 1NOHA 2R3CA 3PRJA 3OA7A 3VMID 2XSOA 4QCKA 1RY3A 5APVA 4TT3H 2C9NY 3AE1C 3D70A 1NTZE 3H1HG 2ZT9C 3RL0D 1OW7A 2QSIA 1L0NJ 1VQLP 3HE5B 2FYUD 2AEMA 5K5GB 1EXIA 1SQXD 5KLVG 4HM6A 5APYA 3GCEA 2K3RA 1SFCD 1L0LD 1SQQK 3CMEP 3CI9A 4LGDE 1JY2P 5KAIH 4RKUJ 1BGYE 2L91A 1A02F 1IFDA 1SQVD 5APQA 2K9JA 5KTBA 2KNCA 2ZYDA 1GL2D 1URQC 1OIPA 1MV8A 3BATA 4ZMDA 1N2DC 2K9YA 3MHVA 4U3FD 2V7QJ 2Y9ZA 3FXDA 2LKMA 5KLVK 2FYUG 3V2QA 3CL3D 1NU1E 1S72P 2WPSA 3MIWA 3H1HJ 5DJUB 1PIXA 2QJKC 3TNUA 2W6JH 1O7NA 1NTMD 3V2RA 3CCEP 1DD4A 2BMQA 1IFPA 4W7YA 1KYOE 1QGKB 3GHGA 2V4HA 3GHGB 3O6QA 2IX7C 2A06G 4C7NB 1KB9H 1VQOP 3MD0A 2LR2A 3M9HA 3FXEA 2B9BA 1EDJA 1KB9I 5CJ4A 4UB6H 2K1AA 5AW5B 1T3JA 4H0LD 4H13B 1BGYJ 1RF0C 2H7HA 1S1CX 3L73G 1LTAC 2WITA 2E43A 1PFIA 3M9BA 1N73B 1NTZJ 1W2EA 1SQVG 3H1JG 1LWUB 1OWAA 3PP5A 3GMAA 1PGJA 2ZAEB 2PRRA 5AW3B 1WQLA 1ZXGA 2L5GB 2Q5UA 5E79E 2KLUA 2YKOA 3KZIE 4YTPC 5AEUA 2YKPA 1KTMA 2HMKA 2M3BA 2Y9YA 1ZR2A 1KFMA 1HJBA 1JMBA 3M0AA 4RO0A 3RGUA 1SQQE 3H1JE 3L4FA 2J58A 1HTLC 2O1JA 1MFTA 1CI6B 3A7OA 1GD2E 3HRNA 2QPZA 1IFJA 3H32B 5CCGA 1RF0A 3LW5H 4MN4C 4GKGA 2YIUB 1N7SB 3RK2D 2NPSA 2IYOA 1BGYD 3V4QA 3F5HA 1MFZA 3IFMA 5APSA 2DE7D 1LT1A 3AEAC 4JBZA 4NPDA 2IYPA 3TGUJ 1LTSC 1N7LA 1LTBC 1SJGA 1EZVG 4TLFA 2KXPB 3KZIH 4BXLA 3R2PA 1S2EA 5KJ7C 1JTHA 1JTHB 1O7PA 3H1JD 2H8PD 2HMJA 3DQYA 3WUTA 1T6AA 1RH5B 4OGQC 2FYUE 1QLED 2W6BA 1VDFA 2Y0DA 4PD4E 4JYCA 3CWBG 1RIEA 2YKQA 3E1IA 2YO3A 1OZHA 2NZ2A 1VQNP 2WTYA 3M9QA 5KKZB 2O01H 3L75D 3L75J 3CCVP 3CCLP 3Q5PA 1YI2P 2QM7A 2P7JA 2I8DA 1DEBA 4H44C 4OGQB 4N6JA 3H1IG 3VYIA 2HLOA 4AUWA 2FY8A 3OAKA 2K9JB 2RMZA 4W80A 1U57A 1PGPA 4XFJA 3CXHE 4DJGA 1RE3C 3G6EP 4HM8A 5KLIC 2A45H 5BOKA 4L75A 1M56D 1L0ND 5TISE 2K88A 2ZT9D 3IR9A 2BEZF 5B66E 4PV1C 3I5CA 1KILA 2OYOA 3B5NA 2YO2A 3RK3D 3TF5A 1AV1A 3GF7A 1QVFO 1JY2N 2JR8A 3FWLA 4Z1MH 2DE5D 2Y0CA 5APWA 5AW8B 1VM9A 1KQLA 4N78E 2Q7CA 2N1TD 1GTWA 1NTKJ 5CCHD 5AW6B 2KIKA 2PAJA 5KLIB 4CPGA 1FDIA 4BRYA 3P8CE 4H0LC 3CX5H 1FJKA 2IFMA 5B5EE 3L73J 4KHXA 1VL2A 1EDLA 3VCPA 3SFDC 2M0BA 1G1IA 1NGMB 3C1LA 1PPJD 3IAOA 3CLQA 4R4LA 2Z5IA 1NWQA 2FYNB 2KS1A 2KSJA 1GDTA 2DW3A 1LWUC 3CCMP 2LXCB 2I7FA 1ZMEC 4H44B 4NBHD 3K5BA 1KFNA 3CC4P 3AECC 3UIAA 2B88A 2E75C 2Q3EA 1HGZA 1L0LG 3NMDA 5BVZA 2IFNA 4DOJA 3HTKA 5CHXA 1NTZD 2O01N 2M8RA 2N1TA 2NUMA 4U7JA 4EMJB 1G8KB 2IBZG 2E76B 1QVGO 1VF5B 2NVEA 1JCDA 3RBXA 5KLVD 1S4XA 2HPCB 2IBZE 2R5DA 1RF1A 1YYCA 5AVZB 3BVHA 1YTZT 3V5BA 2E76C 3MTUE 3C8VA 5KAIE 2BMRA 3SWFA 4DCKA 1ZV8A 2QE7H 1KC8Q 4NPFX 5H2FE 2A06E 1SFCC 3L72J 4QMAA 1R5SA 3L74J 2YIUC 1BCCE 2Y0EA 1JUNA 5HL4A 2B1XA 5AW7B 4XA4A 2ITAA 4R4MA 1PPJG 3FGAD 3RK3C 5B66H 3L70J 2QJYC 3KHUA 2C0XA 1N7SC 3H1HD 4YPCA 4H0LB 4H13D 3H1KG 2B89A 2YXRB 2JJLA 1T2KC 1M1JC 4NBDD 4KJMA 4WY4B 3CMAP 1ZN5A 3L70G 2A45I 2R44A 1EZVI 4A7PA 4NBBD 5KJ7D 3CX5E 3D6ZA 1SQVJ 3HE4B 1LTIC 2AEFA 1SQVK 2YNYA 1SQPK 4NBED 1Q81Q 5GTHE 1NYKA 1Y9BA 3CD6P 1H0TA 2KZJA 1NAFA 1P84H 1L0NG 2R3SA 2KS1B 1G8JB 2XKMA 1SQXJ 4RESB 2M5AA 2HMNA 1JY3O 1GMJA 1EDKA 3P32A 3EFGA 5CCGC 2KSEA 3CC7P 2AXTH 2D2CC 3L73E 4C46A 3GOBA 3IN6A 2W8ZA 3EWKA 1WRGA 3L72D 1K73Q 4YXDC 2N1TB 3MGNA 2HMMA 2ZFCA 3L72E 1VQ5P 5GTIH 2PFXA 3TGUG 2CKFA 1HUCA 2QJPB 2QJKB 1K9MQ 2OQQA 1RFSA 2VRSA 2WZ7A 2ZXEB 3AE8C 3P8CD 1RE4C 4HM3A 4AQRD 2OTLP 1QL1A 2JWAA 1ULJA 2BASA 4NBAD 3QH9A 1PGQA 2QA4P 3I55P 1L2PA 2H88C 2KP8A 4EOTA 1N86A 5CCHC 4HM1A 2E74C 3VP9A 1VQKP 1VQPP 4BRYB 2NPSB 3VTPC 3HD7B 1SQQG 1Q2NA 2ZYLA 2HYNA 3VMGD 2HMLA 1X79B 2HODB 3N7NA 1L4AD 1IC2A 2HODA 4UB8H 2IPPA 4PV1D 2E4PA 1EG9A 2CPBA 1GW3A 1ZW0A 1U7JA 2YFLA 3BCCD 1KZUB 5AVTB 2MJZA 3H1KJ 2W6AA 4WY4A 1PGOA 4ASVA 2WSCJ 1UIXA 3G4SP 1P84D 1FAVA 3NXSA 4IFDK 2JP3A 1FZCC 1KB9D 1N7SD 3WUVA 5KLVE 1FU1A 1USDA 3G3ZA 2NVGA 2WMMA 4C7NA 1KD1Q 3U1AA 2Z5HA 4W7ZA 1J1EB 1VCKA 3MUDC 4PD4D 3QWOC 3L37A 1JEKA 2POHA 2M5AB 2WSFH 1MKMA 3FWNA 1KYOH 2ZXXA 1JCCA 3Q2YA 3LW5J 1BCCJ 3L75E 1RHZB 3OJAB 3GG2A 2HFED 3CXHH 5AVQB 4PV1B 1SQPD 1AQTA 3RBZA 3VMZA 1BE3G 1OX3A 1M1JB 1LTJB 2XR8A 2KI7B 2UWJE 2NPSC 3KPEA 2YMKA 2BCCD 1HWTC 3VMYA 3MUDA 2ZVOB 1CI6A 1VF5D 1FC2C 2WT7B 2A06D 3GKEA 4U3FG 1EQ7A 3EN1A 1P84I 1OXZA 3S1KA 1OW6A 1M90Q 1DEEG 4GODA 3WU2E 2B24A 2P2UA 2Q3IA 1PP9J 1TU3F 2BMOA 3A5TA 1X0TA 1KILD 5EFWB 1NTMG 3Q3DA 2JDIH 3O6QB 1ZP0C 3HD7A 4Y99C 2FXPA 3GB4A 1UUVA 1SQPJ 3VN0A 1NTKG 1AJYA 2Q6QA 2C0WA 1NAYA 1Y8AA 1LP1A 3A0BE 3VP8A 5APXA 1X22A 1YQ3C 2RH0A 5C39A 3PTZA 1PP9E 1DIPA 1IO4A 2D2CB 4NB8D 4ASWA 3H1IJ 1JB0J 2W83C 2QG4A 5AW2B 5E79H 3TGUD 2KLVA 1LGHB 1N73A 2BCCE 1JM1A 2FFDA 2ZYGA 4QDFB 2KOGA 5BU5A 1X9VA 4D6TJ 1FJPA 3L71G 1P84E 1QEXA 3RL0g 2D2CD 3AE4C 5AW1B 2B87A 1PL5A 1IFNA 3CWBJ 3AZCA 1ZOYC 1DX7A 2IDBA 1GW4A 1BDCA 3L70E 1FZGA 3G9RA 1EDIA 2V7QH 2I1KA 1KMIZ 1T3UA 3L36A 5CBOA 1JM0A 5AVRB 3I56P 1J1DC 1SQXK 1RF1B 2GM4A 1FE6A 4ZKPA 1BGYG 3BRVB 4GIFA 3RL0B 4AAYB 3CXHD 3VMXA 3BCCJ 2ZVNB 5AVSB 1KILC 3B5NC 4PJ0H 4QUQA 1IFIA 2A45G 3GLMA 3L71E 3TSIA 1JY2O 2C9LY 1FZBA 2QJYB 2PGDA 4ZNCA 2MKVA 4ZKUA 3AE7C 3U59A 1YJWP 3FOUA 4IL6H 5KKZC 4NB9D 1VF5C 4IFFA 1X8YA 1BSNA 4Y99B 3RL0C 4I6MC 2JZAA 1SFCB 1URQA 3B4SA 3AEEC 3V4WA 2JO1A 1LNQA 3BASA 2XU6A 1OVVA 4I2LC 1HH0A 4GT1A 2IZ1A 1Y47A 3A0HH 1AFOA 2E75D 4D6TG 1WT6A 3GTSA 3E7KA 5KAFH 3B5ND 1KILE 3CPWO 1IFMA 2QRXA 3II6A 1MUUA 2E76D 3L74G 3BCCE 3GZYA 4EDFA 3A2AA 2WSFJ 1FZEA 1UUWA 1DD3A 3CXHI 1OW8A 1NHLA 1PPJE 4QUPA 2SPZA 1NTKE 1L0LE 2OGUA 5L8RJ 3SFEC 2Z4EA 2XRXA 1NTME 1RF1C 2ZYAA 1IJDB 1MZ9A 3AEBC 3M0DC 4U3FJ 1LT9C 1L0NK 2WVRA 1NKNA 5CCHA 4QDDA 2WSCH 1HF9A 3RK2B 3HTKB 3HUSB 1VQ8P 4I1LA 1YIJP 1S5LX 3A3YB 2NWFA 1FDOA 3HE5A 1IK9A 2G8YA 4DT0A 2JWDA 3S9OA 3B5NB 1YJ9P 3TGUE 1VQ4P 2HPCA 1L4AC 1BE3J 3TDKA 2YXQB 3H32A 2FXOA 2WPQA 2R32A 3AEDC 4K3AA 5AVWB 3AE6C 3JCUH 1N7SA 1ZRTD 4HJGH 5AVVB 3HUSC 3L71D 3L70D 3VMHD 2XDJA 3RK2C 3M0DA 3L74E 1LT9A 2OYHC 3H1HE 1LT9B 1O7MA 1DH3A 3GF3A 4IL6E 3LIDA 2XZRA 3L74D 1NU1D 2GA1A 1NTZK 1LP1B 3AE2C 2NVFA 2PP6A 2QEXP 1GL2A 1USEA 2NPSD 4GDOA 3WU2H 1GU5A 3FX0A 1CW5A 3TNUB 2BCCG 1L4AA 4GOFA 2KYVA 4QDFA 2FBWC 3L35A 3V6IA 1JMMA 1XTCC 5KLVJ 4JQ0D 1G2CB 1JNMA 3HE4A 1SLQA 1G2CA 1KORA 1CZQA 5KJ7A 3EQ2A 1FZFA 3WMM0 1SS1A 1QL2A 3N4XA 2R5BA 1K8AQ 4OWFA 2DE6D 1ZRTE 3H1LD 2JO6A 3D89A 2KK7A 4O9BA 1NTKK 1NU1K 1L0LK 3SWKA 4LLHA 2E4QA 1H89A 4DZOA 1BSHA 1RQVA 1NTMK 4JF7A 1KQGB 2YFJA 4KT0J 1N8RQ 1PP9G 3JCUE 1H88A 1O7GA 2OTKE 5H2FH 3MP7B 3AEFC 1KQFB 3CCJP 4LC1A 2OYIA 1U7MA 2QIWA 3IF4A 3EQQA 4M3LA 2OYIB 3AEGC 3T97B 3L73D 2IBZI 5AVYB 3VMAA 4HB1A 2FKWB 3CC2P 1KILB 2QM8A 1Q90D 1JOCA 1PZQA 1NTKD 4EI2A 3H1LG 1G1JA 4GOEA 3CWBD 4NPEA 2OYHB 1NU1J 2WSEH 4HJLA 2FXMA 1OVRA 1K05A 2J5UA 1GZLA 1FOSE 4UB6E 2YVJB 3JSVC 4D6TD 3O8ZA 5AW0B 1KYOI 1UIIA 1N73C 2E74D 2FFDC 1WMKA 1YQ4C 4HM0A 1BE3E 3L71J 2WPVB 4BWNA 1FS0E 3H1ID 2RN0A 3KQGA 2I1JA 4WY4C 2OYIC 1EC5A 2Q9IA 1H0TB 1J1EC 4QURA 1HGVA 1KV4A 3PJSK 1BE3D 4C7RA 4K35A 1FZCB 5CMZA 1FZCA 2XNDH 1SQBE 3M91A 2AXCA 1SQPG 1S9KE 2W27A 1YITP 1KQSO 5AW9B 5CJ0A 5AVXB 3H6PA 4AIVA 1LWUA 1CSBA 2N1TC 3CWBE 4OVNF 4HM7A 1GK4A 2FYZA 4P1CH 1T2KD 1NJIQ 3W68A 4AYCA 2OARA 5TISH 2BCCJ 1VQ9P 3C0DA 2WSSH 2J59M 4XE5B 2H89C 4HYTB 2KUBA 1A02J 1LTGC 3H1JJ 1O7HA 1NTZG 3AE5C 2P58A 1KYOD 4P1BH 3CCQP 3L72G 4IFMA 1FOSF 3R4YA 2Q3WA 2KNCB 4H44D 1W2BO 2N9BA 2P1JA 1LTTC 5KAFE 2YMYA 1R8EA 3H1LE 3KXDA 1JY3N 1M8OB 5TJHA 1M1JA 4PD4H 1HJ0A 2CK3H 3HD7D 1HBWA 1URQB 1SFCA 4Y28J 5GTIE 1SQQD 1Q7YQ 3HD7C 2P10A 1KN7A 3BRTB 4UB8E 4I7ZC 1GK6A 2CPSA 1RQUA 1AVYA
chains in the Genus database with same CATH topology
1O7NA 3B71A 2E75D 4NBBD 1DD4A 2BMQA 3CX5E 5CXMA 3D6ZA 3GTSA 3Q5RA 1KYOE 2G3AA 1KILE 4NBED 3H25A 3O6QA 2ZT9B 3Q1MA 1NYKA 2E76D 1Y9BA 3AE3C 2E75B 3BCCE 1NYHA 3GZYA 2WSFJ 3ABVC 1G8JB 1UUWA 1DD3A 4H0LD 1OW8A 4H13B 2O01J 1PPJE 2HMNA 4QUPA 1S1CX 1GMJA 3RK3E 1NTKE 1L0LE 1EXJA 5L8RJ 3SFEC 3D6YA 2XRXA 4OGQD 2WSEJ 1NTME 2D2CC 3AEBC 3L73E 3GMAA 3GOBA 3IN6A 1WQLA 3EWKA 4QDDA 1HF9A 5AEUA 4YTPC 4QDCA 2E74B 1KTMA 2HMKA 4YXDC 2HMMA 3L72E 1S5LX 3AE9C 2NWFA 1FDOA 2CKFA 2XSHA 2G8YA 3S9OA 2OQQA 1SQQE 3TGUE 1RFSA 4IL6X 3H1JE 3AE8C 4NBCD 2QPZA 4HM3A 4NBGD 3H1KE 3N0QA 3AEDC 1ULJA 3AE6C 2QJPC 4NBAD 1ULIA 2H88C 4HM1A 3VMHD 2E74C 3L74E 1NDOA 3H1HE 2ZYLA 3VMGD 1O7MA 3GF3A 2HMLA 2DE7D 1FQTA 3AEAC 3AE2C 2NVFA 4U3FE 4PV1D 1Q90C 2E4PA 1EG9A 4GDOA 1SQXE 2HMOA 1SJGA 2YFLA 4HM2A 4QDFA 2FBWC 1O7PA 3GL2A 3D71A 2WSCJ 2HMJA 3DQYA 1UIXA 2BEQD 4OGQC 3GL0A 4I7ZB 2FYUE 1KORA 2GBXA 4HM4A 2JP3A 1K04A 5KLVE 4PD4E 2NVGA 2DE6D 1ZRTE 1RIEA 2JO6A 3D89A 1PV3A 1VCKA 2NZ2A 5M1BA 2E4QA 4HM5A 3Q5PA 1RQVA 1KQGB 2YFJA 4KT0J 1MKMA 4H44C 4OGQB 3Q2YA 3LW5J 1O7GA 5AEWA 3L75E 1SQVE 3AEFC 1KQFB 1SQPE 4NBFD 1U57A 2QIWA 3EQQA 4PV1B 4XFJA 3AEGC 3CXHE 3T97B 4HM8A 5KLIC 3GZXA 5BOKA 2NUKA 4H13C 2XR8A 2ZT9D 2BEZF 2YMKA 1Q90D 4PV1C 2YFIA 3Q5SA 1O7WA 3GF7A 2WQYC 3H1IE 1VF5D 4HKVA 4HJLA 4Z1MH 2DE5D 3GKEA 1K05A 2J5UA 1VM9A 2YVJB 3EN1A 2E74D 1OW6A 1IK7A 1WMKA 1YQ4C 4HM0A 1BE3E 2WPVB 2B24A 1TU3F 2BMOA 3VCAA 1FDIA 3Q3DA 1L0NE 4H0LC 1OMIA 1ZP0C 2FXPA 1VL2A 3GB4A 1UUVA 3VCPA 3SFDC 1NGMB 1AJYA 4QURA 3IAOA 4R4LA 1YQ3C 3GTEA 1KB9E 1DIPA 1PP9E 2D2CB 4NB8D 2I7FA 1SQBE 2GBWA 1ZMEC 1JB0J 4H44B 4NBHD 3AECC 1EZVE 2BCCE 1JM1A 4QDFB 2FYNC 4AIVA 2E75C 3CWBE 4HM7A 1P84E 3RL0g 2D2CD 3AE4C 4P1CH 3VMID 2XSOA 1PL5A 4QCKA 3AZCA 1ZOYC 2IDBA 4TT3H 3AE1C 3D70A 3L70E 2NUMA 4U7JA 4EMJB 3C0DA 1G8KB 3G9RA 1NTZE 2ZT9C 1OW7A 2QSIA 2H89C 2E76B 1KMIZ 1VF5B 1EXIA 2NVEA 4HM6A 2IBZE 3GCEA 1O7HA 3AE5C 4P1BH 2E76C 3C8VA 4AAYB 2BMRA 4RKUJ 4QUQA 3GLMA 3R4YA 3L71E 2Q3WA 4H44D 2A06E 1R8EA 3H1LE 2YIUC 2MKVA 1BCCE 2K9YA 3AE7C 3FOUA 5HL4A 2V7QJ 2B1XA 5KKZC 4NB9D 1VF5C 4R4MA 1HJ0A 1NU1E 3FGAD 4Y28J 2JZAA 2QJYC 3AEEC 1PIXA 2QJKC 2JO1A 4H0LB 4H13D 2P10A 4I7ZC 4NBDD 1RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7N A;  1EZV E;  2BCC E;  1JM1 A;  3LW5 J;  1ULJ A;  4QDF B;  1O7G A;  2QJP C;  2FYN C;  4NBA D;  4AIV A;  2E75 D;  5AEW A;  3CWB E;  4HM7 A;  1P84 E;  4NBB D;  1ULI A;  2BMQ A;  3CX5 E;  3L75 E;  5CXM A;  1SQV E;  2D2C D;  4HM1 A;  3GTS A;  4P1C H;  1SQP E;  3VMH D;  3VMI D;  4NBF D;  1KYO E;  2XSO A;  4QCK A;  2QIW A;  3AZC A;  3EQQ A;  4PV1 B;  4NBE D;  3L74 E;  1NDO A;  3H1H E;  3CXH E;  2ZYL A;  3VMG D;  2ZT9 B;  3L70 E;  2NUM A;  1O7M A;  1NYK A;  2E76 D;  4EMJ B;  4HM8 A;  5KLI C;  3C0D A;  1G8K B;  2E75 B;  3GZX A;  1NTZ E;  5BOK A;  3BCC E;  3GZY A;  2QSI A;  2NUK A;  2HML A;  2DE7 D;  1FQT A;  2E76 B;  2XR8 A;  2WSF J;  1VF5 B;  2NVF A;  2ZT9 D;  2NVE A;  4HM6 A;  1Q90 D;  2YFI A;  4U3F E;  1G8J B;  1Q90 C;  4PV1 D;  2E4P A;  1EG9 A;  2IBZ E;  1O7W A;  1SQX E;  1UUW A;  2HMO A;  3GCE A;  1O7H A;  4H13 B;  4H0L D;  2O01 J;  1PPJ E;  2HMN A;  3H1I E;  4QUP A;  1SJG A;  1VF5 D;  2YFL A;  4HKV A;  4HJL A;  4P1B H;  1NTK E;  2DE5 D;  3C8V A;  3GKE A;  4HM2 A;  4AAY B;  1L0L E;  2BMR A;  4QDF A;  5L8R J;  1VM9 A;  2YVJ B;  3EN1 A;  2XRX A;  4RKU J;  1O7P A;  3GL2 A;  4OGQ D;  4QUQ A;  2E74 D;  2WSE J;  1NTM E;  2WSC J;  2HMJ A;  3L73 E;  3L71 E;  2Q3W A;  4HM0 A;  3DQY A;  4H44 D;  1BE3 E;  2B24 A;  2WPV B;  2A06 E;  3GOB A;  1WQL A;  2BMO A;  3VCA A;  3GL0 A;  4I7Z B;  2FYU E;  2GBX A;  3H1L E;  4QDD A;  1L0N E;  4HM4 A;  2YIU C;  1BCC E;  5AEU A;  2K9Y A;  4QDC A;  2E74 B;  3FOU A;  5HL4 A;  5KLV E;  2HMK A;  3GB4 A;  1UUV A;  4PD4 E;  2B1X A;  2NVG A;  3VCP A;  2DE6 D;  5KKZ C;  4NB9 D;  2HMM A;  3L72 E;  1ZRT E;  1RIE A;  1S5L X;  4QUR A;  1NU1 E;  2JO6 A;  2NWF A;  3D89 A;  2CKF A;  2XSH A;  1VCK A;  4Y28 J;  2JZA A;  2QJY C;  1SQQ E;  2E4Q A;  3GTE A;  1KB9 E;  1RFS A;  4IL6 X;  3H1J E;  1PP9 E;  3TGU E;  2QJK C;  2D2C B;  4H0L B;  4H13 D;  4NB8 D;  4HM5 A;  2I7F A;  4NBC D;  1SQB E;  2GBW A;  1JB0 J;  2QPZ A;  4H44 B;  4NBH D;  4HM3 A;  2YFJ A;  4NBG D;  3H1K E;  3N0Q A;  4KT0 J;  4NBD D;  4OGQ B; 
#chains in the Genus database with same CATH topology
 3B71 A;  2E5Y A;  4L76 A;  5DJT B;  5CXM A;  3Q5R A;  2G3A A;  3RK3 B;  1AA0 A;  3H25 A;  2ZT9 B;  1QX8 A;  1FZA A;  3Q1M A;  3AE3 C;  2E75 B;  2H43 A;  1NYH A;  3SWY A;  4IOI H;  2N9Y B;  4N78 D;  3ABV C;  1JY3 P;  2OTJ P;  4L73 A;  3KYQ A;  2O01 J;  2XNX A;  5CBN A;  3LIE A;  3G71 P;  1OFC X;  3RK3 E;  1GU4 A;  2HR3 A;  1SQQ J;  1EXJ A;  4EIJ A;  3D6Y A;  4OGQ D;  2WSE J;  1VPC A;  1E5W A;  3GHG C;  3E1R A;  1M57 D;  2XV5 A;  1YBK A;  1SQB G;  4QDC A;  2E74 B;  1LJ2 A;  1LTJ A;  5AVU B;  2GUV A;  3A0B H;  3AE9 C;  3S4R A;  2XSH A;  2KZI A;  4OH8 B;  4IL6 X;  2O3J A;  3M06 A;  4NBC D;  2M3E A;  2WT7 A;  1NTM J;  4NBG D;  2JKV A;  1R5L A;  3H1K E;  3N0Q A;  2IBZ D;  4WY4 D;  3NTN A;  1S5L H;  1S9K D;  3WUU A;  2QJP C;  2P67 A;  1XTG B;  1RE3 A;  5CCG D;  1FDM A;  5BU8 B;  3CCU P;  1ULI A;  1PP9 D;  1IZN B;  1RE4 A;  1VQ7 P;  1FBM A;  4HH2 A;  4N3Y B;  4JPZ B;  1E79 H;  3BCC G;  1NDO A;  2FYU K;  1OVU A;  3EFF K;  3CX5 D;  3A0H E;  2K37 A;  1SQX G;  1Q86 Q;  1FQT A;  1M1K Q;  1LTJ C;  2Q1K A;  2WWW A;  3CCR P;  4U3F E;  1Q90 C;  3U1C A;  1SQX E;  2HMO A;  3PLN A;  4JYB A;  4HM2 A;  1L0L J;  3USS A;  4EYY Q;  2AXT E;  3GL2 A;  3P8M C;  1NO4 A;  3D71 A;  2BEQ D;  4WVZ A;  1BCC D;  2WPR A;  2FYU J;  4I7Z B;  3GL0 A;  2GBX A;  4HM4 A;  2E42 A;  1YHQ P;  3ITK A;  3ZDM A;  1VQ6 P;  1K04 A;  3PHL A;  3CCS P;  1VQM P;  1PV3 A;  5M1B A;  1T8Z A;  3SSU A;  4WWI A;  2O1K A;  1ZR4 A;  1JO5 A;  4HM5 A;  4L74 A;  1URQ D;  5GTH H;  5AW4 B;  1Q82 Q;  1SP4 A;  3PH0 A;  1BDD A;  1YJN P;  5AEW A;  2E5T A;  1J1D B;  2LXB A;  3GW6 A;  1Z56 A;  1SQV E;  1SQP E;  2QVA A;  4NBF D;  1SQB J;  1W5C E;  1J2J B;  3MZW B;  2ZJS E;  3T97 A;  3GZX A;  5APT A;  3H1K D;  2GUS A;  2NUK A;  3HUS A;  4WB4 A;  4HKZ H;  4H13 C;  4PD4 I;  1EZV D;  3KDP B;  3TYY A;  2YFI A;  3Q5S A;  1O7W A;  2OYH A;  1S5L E;  5APU A;  2WQY C;  3H1I E;  2AEJ A;  3W67 A;  4HKV A;  4B86 A;  3V2P A;  1NU1 G;  3JC2 2;  3TK1 A;  1ZLL A;  1GL2 C;  2IZ0 A;  1M7L A;  3H1L J;  5B5E H;  1D7M A;  1BCC G;  1IK7 A;  4PJ0 E;  1AVO A;  2RKL A;  1YTZ I;  3VCA A;  1NKZ B;  1L0N E;  2KB7 P;  1OMI A;  3C9I A;  1NH4 A;  1AQ5 A;  3L75 G;  1SQB K;  4WBA A;  1HVV A;  4YXW H;  3P7K A;  1SQB D;  2HG5 D;  2W90 A;  1SVF A;  2JEE A;  3OW2 O;  3GTE A;  1KB9 E;  1GL2 B;  1S3J A;  2GBW A;  4D6T E;  3VOP A;  3CX5 I;  1L4A B;  1EZV E;  1H8A A;  3B8E B;  3NFQ A;  2FYN C;  2FFD B;  3V2N A;  2NRG A;  1NVO A;  3F89 A;  2B87 B;  4RJT A;  1NOH A;  2R3C A;  3PRJ A;  3OA7 A;  3VMI D;  2XSO A;  4QCK A;  1RY3 A;  5APV A;  4TT3 H;  2C9N Y;  3AE1 C;  3D70 A;  1NTZ E;  3H1H G;  2ZT9 C;  3RL0 D;  1OW7 A;  2QSI A;  1L0N J;  1VQL P;  3HE5 B;  2FYU D;  2AEM A;  5K5G B;  1EXI A;  1SQX D;  5KLV G;  4HM6 A;  5APY A;  3GCE A;  2K3R A;  1SFC D;  1L0L D;  1SQQ K;  3CME P;  3CI9 A;  4LGD E;  1JY2 P;  5KAI H;  4RKU J;  1BGY E;  2L91 A;  1A02 F;  1IFD A;  1SQV D;  5APQ A;  2K9J A;  5KTB A;  2KNC A;  2ZYD A;  1GL2 D;  1URQ C;  1OIP A;  1MV8 A;  3BAT A;  4ZMD A;  1N2D C;  2K9Y A;  3MHV A;  4U3F D;  2V7Q J;  2Y9Z A;  3FXD A;  2LKM A;  5KLV K;  2FYU G;  3V2Q A;  3CL3 D;  1NU1 E;  1S72 P;  2WPS A;  3MIW A;  3H1H J;  5DJU B;  1PIX A;  2QJK C;  3TNU A;  2W6J H;  1O7N A;  1NTM D;  3V2R A;  3CCE P;  1DD4 A;  2BMQ A;  1IFP A;  4W7Y A;  1KYO E;  1QGK B;  3GHG A;  2V4H A;  3GHG B;  3O6Q A;  2IX7 C;  2A06 G;  4C7N B;  1KB9 H;  1VQO P;  3MD0 A;  2LR2 A;  3M9H A;  3FXE A;  2B9B A;  1EDJ A;  1KB9 I;  5CJ4 A;  4UB6 H;  2K1A A;  5AW5 B;  1T3J A;  4H0L D;  4H13 B;  1BGY J;  1RF0 C;  2H7H A;  1S1C X;  3L73 G;  1LTA C;  2WIT A;  2E43 A;  1PFI A;  3M9B A;  1N73 B;  1NTZ J;  1W2E A;  1SQV G;  3H1J G;  1LWU B;  1OWA A;  3PP5 A;  3GMA A;  1PGJ A;  2ZAE B;  2PRR A;  5AW3 B;  1WQL A;  1ZXG A;  2L5G B;  2Q5U A;  5E79 E;  2KLU A;  2YKO A;  3KZI E;  4YTP C;  5AEU A;  2YKP A;  1KTM A;  2HMK A;  2M3B A;  2Y9Y A;  1ZR2 A;  1KFM A;  1HJB A;  1JMB A;  3M0A A;  4RO0 A;  3RGU A;  1SQQ E;  3H1J E;  3L4F A;  2J58 A;  1HTL C;  2O1J A;  1MFT A;  1CI6 B;  3A7O A;  1GD2 E;  3HRN A;  2QPZ A;  1IFJ A;  3H32 B;  5CCG A;  1RF0 A;  3LW5 H;  4MN4 C;  4GKG A;  2YIU B;  1N7S B;  3RK2 D;  2NPS A;  2IYO A;  1BGY D;  3V4Q A;  3F5H A;  1MFZ A;  3IFM A;  5APS A;  2DE7 D;  1LT1 A;  3AEA C;  4JBZ A;  4NPD A;  2IYP A;  3TGU J;  1LTS C;  1N7L A;  1LTB C;  1SJG A;  1EZV G;  4TLF A;  2KXP B;  3KZI H;  4BXL A;  3R2P A;  1S2E A;  5KJ7 C;  1JTH A;  1JTH B;  1O7P A;  3H1J D;  2H8P D;  2HMJ A;  3DQY A;  3WUT A;  1T6A A;  1RH5 B;  4OGQ C;  2FYU E;  1QLE D;  2W6B A;  1VDF A;  2Y0D A;  4PD4 E;  4JYC A;  3CWB G;  1RIE A;  2YKQ A;  3E1I A;  2YO3 A;  1OZH A;  2NZ2 A;  1VQN P;  2WTY A;  3M9Q A;  5KKZ B;  2O01 H;  3L75 D;  3L75 J;  3CCV P;  3CCL P;  3Q5P A;  1YI2 P;  2QM7 A;  2P7J A;  2I8D A;  1DEB A;  4H44 C;  4OGQ B;  4N6J A;  3H1I G;  3VYI A;  2HLO A;  4AUW A;  2FY8 A;  3OAK A;  2K9J B;  2RMZ A;  4W80 A;  1U57 A;  1PGP A;  4XFJ A;  3CXH E;  4DJG A;  1RE3 C;  3G6E P;  4HM8 A;  5KLI C;  2A45 H;  5BOK A;  4L75 A;  1M56 D;  1L0N D;  5TIS E;  2K88 A;  2ZT9 D;  3IR9 A;  2BEZ F;  5B66 E;  4PV1 C;  3I5C A;  1KIL A;  2OYO A;  3B5N A;  2YO2 A;  3RK3 D;  3TF5 A;  1AV1 A;  3GF7 A;  1QVF O;  1JY2 N;  2JR8 A;  3FWL A;  4Z1M H;  2DE5 D;  2Y0C A;  5APW A;  5AW8 B;  1VM9 A;  1KQL A;  4N78 E;  2Q7C A;  2N1T D;  1GTW A;  1NTK J;  5CCH D;  5AW6 B;  2KIK A;  2PAJ A;  5KLI B;  4CPG A;  1FDI A;  4BRY A;  3P8C E;  4H0L C;  3CX5 H;  1FJK A;  2IFM A;  5B5E E;  3L73 J;  4KHX A;  1VL2 A;  1EDL A;  3VCP A;  3SFD C;  2M0B A;  1G1I A;  1NGM B;  3C1L A;  1PPJ D;  3IAO A;  3CLQ A;  4R4L A;  2Z5I A;  1NWQ A;  2FYN B;  2KS1 A;  2KSJ A;  1GDT A;  2DW3 A;  1LWU C;  3CCM P;  2LXC B;  2I7F A;  1ZME C;  4H44 B;  4NBH D;  3K5B A;  1KFN A;  3CC4 P;  3AEC C;  3UIA A;  2B88 A;  2E75 C;  2Q3E A;  1HGZ A;  1L0L G;  3NMD A;  5BVZ A;  2IFN A;  4DOJ A;  3HTK A;  5CHX A;  1NTZ D;  2O01 N;  2M8R A;  2N1T A;  2NUM A;  4U7J A;  4EMJ B;  1G8K B;  2IBZ G;  2E76 B;  1QVG O;  1VF5 B;  2NVE A;  1JCD A;  3RBX A;  5KLV D;  1S4X A;  2HPC B;  2IBZ E;  2R5D A;  1RF1 A;  1YYC A;  5AVZ B;  3BVH A;  1YTZ T;  3V5B A;  2E76 C;  3MTU E;  3C8V A;  5KAI E;  2BMR A;  3SWF A;  4DCK A;  1ZV8 A;  2QE7 H;  1KC8 Q;  4NPF X;  5H2F E;  2A06 E;  1SFC C;  3L72 J;  4QMA A;  1R5S A;  3L74 J;  2YIU C;  1BCC E;  2Y0E A;  1JUN A;  5HL4 A;  2B1X A;  5AW7 B;  4XA4 A;  2ITA A;  4R4M A;  1PPJ G;  3FGA D;  3RK3 C;  5B66 H;  3L70 J;  2QJY C;  3KHU A;  2C0X A;  1N7S C;  3H1H D;  4YPC A;  4H0L B;  4H13 D;  3H1K G;  2B89 A;  2YXR B;  2JJL A;  1T2K C;  1M1J C;  4NBD D;  4KJM A;  4WY4 B;  3CMA P;  1ZN5 A;  3L70 G;  2A45 I;  2R44 A;  1EZV I;  4A7P A;  4NBB D;  5KJ7 D;  3CX5 E;  3D6Z A;  1SQV J;  3HE4 B;  1LTI C;  2AEF A;  1SQV K;  2YNY A;  1SQP K;  4NBE D;  1Q81 Q;  5GTH E;  1NYK A;  1Y9B A;  3CD6 P;  1H0T A;  2KZJ A;  1NAF A;  1P84 H;  1L0N G;  2R3S A;  2KS1 B;  1G8J B;  2XKM A;  1SQX J;  4RES B;  2M5A A;  2HMN A;  1JY3 O;  1GMJ A;  1EDK A;  3P32 A;  3EFG A;  5CCG C;  2KSE A;  3CC7 P;  2AXT H;  2D2C C;  3L73 E;  4C46 A;  3GOB A;  3IN6 A;  2W8Z A;  3EWK A;  1WRG A;  3L72 D;  1K73 Q;  4YXD C;  2N1T B;  3MGN A;  2HMM A;  2ZFC A;  3L72 E;  1VQ5 P;  5GTI H;  2PFX A;  3TGU G;  2CKF A;  1HUC A;  2QJP B;  2QJK B;  1K9M Q;  2OQQ A;  1RFS A;  2VRS A;  2WZ7 A;  2ZXE B;  3AE8 C;  3P8C D;  1RE4 C;  4HM3 A;  4AQR D;  2OTL P;  1QL1 A;  2JWA A;  1ULJ A;  2BAS A;  4NBA D;  3QH9 A;  1PGQ A;  2QA4 P;  3I55 P;  1L2P A;  2H88 C;  2KP8 A;  4EOT A;  1N86 A;  5CCH C;  4HM1 A;  2E74 C;  3VP9 A;  1VQK P;  1VQP P;  4BRY B;  2NPS B;  3VTP C;  3HD7 B;  1SQQ G;  1Q2N A;  2ZYL A;  2HYN A;  3VMG D;  2HML A;  1X79 B;  2HOD B;  3N7N A;  1L4A D;  1IC2 A;  2HOD A;  4UB8 H;  2IPP A;  4PV1 D;  2E4P A;  1EG9 A;  2CPB A;  1GW3 A;  1ZW0 A;  1U7J A;  2YFL A;  3BCC D;  1KZU B;  5AVT B;  2MJZ A;  3H1K J;  2W6A A;  4WY4 A;  1PGO A;  4ASV A;  2WSC J;  1UIX A;  3G4S P;  1P84 D;  1FAV A;  3NXS A;  4IFD K;  2JP3 A;  1FZC C;  1KB9 D;  1N7S D;  3WUV A;  5KLV E;  1FU1 A;  1USD A;  3G3Z A;  2NVG A;  2WMM A;  4C7N A;  1KD1 Q;  3U1A A;  2Z5H A;  4W7Z A;  1J1E B;  1VCK A;  3MUD C;  4PD4 D;  3QWO C;  3L37 A;  1JEK A;  2POH A;  2M5A B;  2WSF H;  1MKM A;  3FWN A;  1KYO H;  2ZXX A;  1JCC A;  3Q2Y A;  3LW5 J;  1BCC J;  3L75 E;  1RHZ B;  3OJA B;  3GG2 A;  2HFE D;  3CXH H;  5AVQ B;  4PV1 B;  1SQP D;  1AQT A;  3RBZ A;  3VMZ A;  1BE3 G;  1OX3 A;  1M1J B;  1LTJ B;  2XR8 A;  2KI7 B;  2UWJ E;  2NPS C;  3KPE A;  2YMK A;  2BCC D;  1HWT C;  3VMY A;  3MUD A;  2ZVO B;  1CI6 A;  1VF5 D;  1FC2 C;  2WT7 B;  2A06 D;  3GKE A;  4U3F G;  1EQ7 A;  3EN1 A;  1P84 I;  1OXZ A;  3S1K A;  1OW6 A;  1M90 Q;  1DEE G;  4GOD A;  3WU2 E;  2B24 A;  2P2U A;  2Q3I A;  1PP9 J;  1TU3 F;  2BMO A;  3A5T A;  1X0T A;  1KIL D;  5EFW B;  1NTM G;  3Q3D A;  2JDI H;  3O6Q B;  1ZP0 C;  3HD7 A;  4Y99 C;  2FXP A;  3GB4 A;  1UUV A;  1SQP J;  3VN0 A;  1NTK G;  1AJY A;  2Q6Q A;  2C0W A;  1NAY A;  1Y8A A;  1LP1 A;  3A0B E;  3VP8 A;  5APX A;  1X22 A;  1YQ3 C;  2RH0 A;  5C39 A;  3PTZ A;  1PP9 E;  1DIP A;  1IO4 A;  2D2C B;  4NB8 D;  4ASW A;  3H1I J;  1JB0 J;  2W83 C;  2QG4 A;  5AW2 B;  5E79 H;  3TGU D;  2KLV A;  1LGH B;  1N73 A;  2BCC E;  1JM1 A;  2FFD A;  2ZYG A;  4QDF B;  2KOG A;  5BU5 A;  1X9V A;  4D6T J;  1FJP A;  3L71 G;  1P84 E;  1QEX A;  3RL0 g;  2D2C D;  3AE4 C;  5AW1 B;  2B87 A;  1PL5 A;  1IFN A;  3CWB J;  3AZC A;  1ZOY C;  1DX7 A;  2IDB A;  1GW4 A;  1BDC A;  3L70 E;  1FZG A;  3G9R A;  1EDI A;  2V7Q H;  2I1K A;  1KMI Z;  1T3U A;  3L36 A;  5CBO A;  1JM0 A;  5AVR B;  3I56 P;  1J1D C;  1SQX K;  1RF1 B;  2GM4 A;  1FE6 A;  4ZKP A;  1BGY G;  3BRV B;  4GIF A;  3RL0 B;  4AAY B;  3CXH D;  3VMX A;  3BCC J;  2ZVN B;  5AVS B;  1KIL C;  3B5N C;  4PJ0 H;  4QUQ A;  1IFI A;  2A45 G;  3GLM A;  3L71 E;  3TSI A;  1JY2 O;  2C9L Y;  1FZB A;  2QJY B;  2PGD A;  4ZNC A;  2MKV A;  4ZKU A;  3AE7 C;  3U59 A;  1YJW P;  3FOU A;  4IL6 H;  5KKZ C;  4NB9 D;  1VF5 C;  4IFF A;  1X8Y A;  1BSN A;  4Y99 B;  3RL0 C;  4I6M C;  2JZA A;  1SFC B;  1URQ A;  3B4S A;  3AEE C;  3V4W A;  2JO1 A;  1LNQ A;  3BAS A;  2XU6 A;  1OVV A;  4I2L C;  1HH0 A;  4GT1 A;  2IZ1 A;  1Y47 A;  3A0H H;  1AFO A;  2E75 D;  4D6T G;  1WT6 A;  3GTS A;  3E7K A;  5KAF H;  3B5N D;  1KIL E;  3CPW O;  1IFM A;  2QRX A;  3II6 A;  1MUU A;  2E76 D;  3L74 G;  3BCC E;  3GZY A;  4EDF A;  3A2A A;  2WSF J;  1FZE A;  1UUW A;  1DD3 A;  3CXH I;  1OW8 A;  1NHL A;  1PPJ E;  4QUP A;  2SPZ A;  1NTK E;  1L0L E;  2OGU A;  5L8R J;  3SFE C;  2Z4E A;  2XRX A;  1NTM E;  1RF1 C;  2ZYA A;  1IJD B;  1MZ9 A;  3AEB C;  3M0D C;  4U3F J;  1LT9 C;  1L0N K;  2WVR A;  1NKN A;  5CCH A;  4QDD A;  2WSC H;  1HF9 A;  3RK2 B;  3HTK B;  3HUS B;  1VQ8 P;  4I1L A;  1YIJ P;  1S5L X;  3A3Y B;  2NWF A;  1FDO A;  3HE5 A;  1IK9 A;  2G8Y A;  4DT0 A;  2JWD A;  3S9O A;  3B5N B;  1YJ9 P;  3TGU E;  1VQ4 P;  2HPC A;  1L4A C;  1BE3 J;  3TDK A;  2YXQ B;  3H32 A;  2FXO A;  2WPQ A;  2R32 A;  3AED C;  4K3A A;  5AVW B;  3AE6 C;  3JCU H;  1N7S A;  1ZRT D;  4HJG H;  5AVV B;  3HUS C;  3L71 D;  3L70 D;  3VMH D;  2XDJ A;  3RK2 C;  3M0D A;  3L74 E;  1LT9 A;  2OYH C;  3H1H E;  1LT9 B;  1O7M A;  1DH3 A;  3GF3 A;  4IL6 E;  3LID A;  2XZR A;  3L74 D;  1NU1 D;  2GA1 A;  1NTZ K;  1LP1 B;  3AE2 C;  2NVF A;  2PP6 A;  2QEX P;  1GL2 A;  1USE A;  2NPS D;  4GDO A;  3WU2 H;  1GU5 A;  3FX0 A;  1CW5 A;  3TNU B;  2BCC G;  1L4A A;  4GOF A;  2KYV A;  4QDF A;  2FBW C;  3L35 A;  3V6I A;  1JMM A;  1XTC C;  5KLV J;  4JQ0 D;  1G2C B;  1JNM A;  3HE4 A;  1SLQ A;  1G2C A;  1KOR A;  1CZQ A;  5KJ7 A;  3EQ2 A;  1FZF A;  3WMM 0;  1SS1 A;  1QL2 A;  3N4X A;  2R5B A;  1K8A Q;  4OWF A;  2DE6 D;  1ZRT E;  3H1L D;  2JO6 A;  3D89 A;  2KK7 A;  4O9B A;  1NTK K;  1NU1 K;  1L0L K;  3SWK A;  4LLH A;  2E4Q A;  1H89 A;  4DZO A;  1BSH A;  1RQV A;  1NTM K;  4JF7 A;  1KQG B;  2YFJ A;  4KT0 J;  1N8R Q;  1PP9 G;  3JCU E;  1H88 A;  1O7G A;  2OTK E;  5H2F H;  3MP7 B;  3AEF C;  1KQF B;  3CCJ P;  4LC1 A;  2OYI A;  1U7M A;  2QIW A;  3IF4 A;  3EQQ A;  4M3L A;  2OYI B;  3AEG C;  3T97 B;  3L73 D;  2IBZ I;  5AVY B;  3VMA A;  4HB1 A;  2FKW B;  3CC2 P;  1KIL B;  2QM8 A;  1Q90 D;  1JOC A;  1PZQ A;  1NTK D;  4EI2 A;  3H1L G;  1G1J A;  4GOE A;  3CWB D;  4NPE A;  2OYH B;  1NU1 J;  2WSE H;  4HJL A;  2FXM A;  1OVR A;  1K05 A;  2J5U A;  1GZL A;  1FOS E;  4UB6 E;  2YVJ B;  3JSV C;  4D6T D;  3O8Z A;  5AW0 B;  1KYO I;  1UII A;  1N73 C;  2E74 D;  2FFD C;  1WMK A;  1YQ4 C;  4HM0 A;  1BE3 E;  3L71 J;  2WPV B;  4BWN A;  1FS0 E;  3H1I D;  2RN0 A;  3KQG A;  2I1J A;  4WY4 C;  2OYI C;  1EC5 A;  2Q9I A;  1H0T B;  1J1E C;  4QUR A;  1HGV A;  1KV4 A;  3PJS K;  1BE3 D;  4C7R A;  4K35 A;  1FZC B;  5CMZ A;  1FZC A;  2XND H;  1SQB E;  3M91 A;  2AXC A;  1SQP G;  1S9K E;  2W27 A;  1YIT P;  1KQS O;  5AW9 B;  5CJ0 A;  5AVX B;  3H6P A;  4AIV A;  1LWU A;  1CSB A;  2N1T C;  3CWB E;  4OVN F;  4HM7 A;  1GK4 A;  2FYZ A;  4P1C H;  1T2K D;  1NJI Q;  3W68 A;  4AYC A;  2OAR A;  5TIS H;  2BCC J;  1VQ9 P;  3C0D A;  2WSS H;  2J59 M;  4XE5 B;  2H89 C;  4HYT B;  2KUB A;  1A02 J;  1LTG C;  3H1J J;  1O7H A;  1NTZ G;  3AE5 C;  2P58 A;  1KYO D;  4P1B H;  3CCQ P;  3L72 G;  4IFM A;  1FOS F;  3R4Y A;  2Q3W A;  2KNC B;  4H44 D;  1W2B O;  2N9B A;  2P1J A;  1LTT C;  5KAF E;  2YMY A;  1R8E A;  3H1L E;  3KXD A;  1JY3 N;  1M8O B;  5TJH A;  1M1J A;  4PD4 H;  1HJ0 A;  2CK3 H;  3HD7 D;  1HBW A;  1URQ B;  1SFC A;  4Y28 J;  5GTI E;  1SQQ D;  1Q7Y Q;  3HD7 C;  2P10 A;  1KN7 A;  3BRT B;  4UB8 E;  4I7Z C;  1GK6 A;  2CPS A;  1RQU A;  1AVY A; 
#chains in the Genus database with same CATH homology
 1O7N A;  3B71 A;  2E75 D;  4NBB D;  1DD4 A;  2BMQ A;  3CX5 E;  5CXM A;  3D6Z A;  3GTS A;  3Q5R A;  1KYO E;  2G3A A;  1KIL E;  4NBE D;  3H25 A;  3O6Q A;  2ZT9 B;  3Q1M A;  1NYK A;  2E76 D;  1Y9B A;  3AE3 C;  2E75 B;  3BCC E;  1NYH A;  3GZY A;  2WSF J;  3ABV C;  1G8J B;  1UUW A;  1DD3 A;  4H0L D;  1OW8 A;  4H13 B;  2O01 J;  1PPJ E;  2HMN A;  4QUP A;  1S1C X;  1GMJ A;  3RK3 E;  1NTK E;  1L0L E;  1EXJ A;  5L8R J;  3SFE C;  3D6Y A;  2XRX A;  4OGQ D;  2WSE J;  1NTM E;  2D2C C;  3AEB C;  3L73 E;  3GMA A;  3GOB A;  3IN6 A;  1WQL A;  3EWK A;  4QDD A;  1HF9 A;  5AEU A;  4YTP C;  4QDC A;  2E74 B;  1KTM A;  2HMK A;  4YXD C;  2HMM A;  3L72 E;  1S5L X;  3AE9 C;  2NWF A;  1FDO A;  2CKF A;  2XSH A;  2G8Y A;  3S9O A;  2OQQ A;  1SQQ E;  3TGU E;  1RFS A;  4IL6 X;  3H1J E;  3AE8 C;  4NBC D;  2QPZ A;  4HM3 A;  4NBG D;  3H1K E;  3N0Q A;  3AED C;  1ULJ A;  3AE6 C;  2QJP C;  4NBA D;  1ULI A;  2H88 C;  4HM1 A;  3VMH D;  2E74 C;  3L74 E;  1NDO A;  3H1H E;  2ZYL A;  3VMG D;  1O7M A;  3GF3 A;  2HML A;  2DE7 D;  1FQT A;  3AEA C;  3AE2 C;  2NVF A;  4U3F E;  4PV1 D;  1Q90 C;  2E4P A;  1EG9 A;  4GDO A;  1SQX E;  2HMO A;  1SJG A;  2YFL A;  4HM2 A;  4QDF A;  2FBW C;  1O7P A;  3GL2 A;  3D71 A;  2WSC J;  2HMJ A;  3DQY A;  1UIX A;  2BEQ D;  4OGQ C;  3GL0 A;  4I7Z B;  2FYU E;  1KOR A;  2GBX A;  4HM4 A;  2JP3 A;  1K04 A;  5KLV E;  4PD4 E;  2NVG A;  2DE6 D;  1ZRT E;  1RIE A;  2JO6 A;  3D89 A;  1PV3 A;  1VCK A;  2NZ2 A;  5M1B A;  2E4Q A;  4HM5 A;  3Q5P A;  1RQV A;  1KQG B;  2YFJ A;  4KT0 J;  1MKM A;  4H44 C;  4OGQ B;  3Q2Y A;  3LW5 J;  1O7G A;  5AEW A;  3L75 E;  1SQV E;  3AEF C;  1KQF B;  1SQP E;  4NBF D;  1U57 A;  2QIW A;  3EQQ A;  4PV1 B;  4XFJ A;  3AEG C;  3CXH E;  3T97 B;  4HM8 A;  5KLI C;  3GZX A;  5BOK A;  2NUK A;  4H13 C;  2XR8 A;  2ZT9 D;  2BEZ F;  2YMK A;  1Q90 D;  4PV1 C;  2YFI A;  3Q5S A;  1O7W A;  3GF7 A;  2WQY C;  3H1I E;  1VF5 D;  4HKV A;  4HJL A;  4Z1M H;  2DE5 D;  3GKE A;  1K05 A;  2J5U A;  1VM9 A;  2YVJ B;  3EN1 A;  2E74 D;  1OW6 A;  1IK7 A;  1WMK A;  1YQ4 C;  4HM0 A;  1BE3 E;  2WPV B;  2B24 A;  1TU3 F;  2BMO A;  3VCA A;  1FDI A;  3Q3D A;  1L0N E;  4H0L C;  1OMI A;  1ZP0 C;  2FXP A;  1VL2 A;  3GB4 A;  1UUV A;  3VCP A;  3SFD C;  1NGM B;  1AJY A;  4QUR A;  3IAO A;  4R4L A;  1YQ3 C;  3GTE A;  1KB9 E;  1DIP A;  1PP9 E;  2D2C B;  4NB8 D;  2I7F A;  1SQB E;  2GBW A;  1ZME C;  1JB0 J;  4H44 B;  4NBH D;  3AEC C;  1EZV E;  2BCC E;  1JM1 A;  4QDF B;  2FYN C;  4AIV A;  2E75 C;  3CWB E;  4HM7 A;  1P84 E;  3RL0 g;  2D2C D;  3AE4 C;  4P1C H;  3VMI D;  2XSO A;  1PL5 A;  4QCK A;  3AZC A;  1ZOY C;  2IDB A;  4TT3 H;  3AE1 C;  3D70 A;  3L70 E;  2NUM A;  4U7J A;  4EMJ B;  3C0D A;  1G8K B;  3G9R A;  1NTZ E;  2ZT9 C;  1OW7 A;  2QSI A;  2H89 C;  2E76 B;  1KMI Z;  1VF5 B;  1EXI A;  2NVE A;  4HM6 A;  2IBZ E;  3GCE A;  1O7H A;  3AE5 C;  4P1B H;  2E76 C;  3C8V A;  4AAY B;  2BMR A;  4RKU J;  4QUQ A;  3GLM A;  3R4Y A;  3L71 E;  2Q3W A;  4H44 D;  2A06 E;  1R8E A;  3H1L E;  2YIU C;  2MKV A;  1BCC E;  2K9Y A;  3AE7 C;  3FOU A;  5HL4 A;  2V7Q J;  2B1X A;  5KKZ C;  4NB9 D;  1VF5 C;  4R4M A;  1HJ0 A;  1NU1 E;  3FGA D;  4Y28 J;  2JZA A;  2QJY C;  3AEE C;  1PIX A;  2QJK C;  2JO1 A;  4H0L B;  4H13 D;  2P10 A;  4I7Z C;  4NBD D;  1RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...