5KLIC

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 52
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kliC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kliC02
1VF5D 2D2CB 3GTEA 1EZVE 3EN1A 2A06E 3H1LE 2DE6D 4NBAD 4PV1D 2FYNC 1Q90D 2YVJB 3C8VA 2IBZE 1S5LX 1P84E 3GOBA 3VMID 1EG9A 3L73E 4QDFA 2NUKA 2XRXA 4HM2A 1VM9A 2HMOA 2E76B 1G8JB 4QDCA 1SQXE 1RFSA 2E74D 4H44B 3FOUA 4H0LB 4NBED 3VCPA 4P1BH 4HM4A 5AEUA 2WPVB 4AAYB 2QJPC 2B1XA 1L0LE 2NVFA 4QUQA 2E4PA 3VMGD 1VCKA 2DE7D 2E75D 3L71E 1O7MA 3DQYA 2WSCJ 1BE3E 3H1JE 2JO6A 2ZYLA 3H1IE 2NVGA 3AZCA 4QDDA 5HL4A 4QURA 4HJLA 1UUWA 4NBBD 4NBGD 4HM8A 3H1KE 1L0NE 1ULIA 4QDFB 3L75E 4PD4E 1NDOA 4NB8D 1NTZE 2O01J 2K9YA 1JM1A 3GZXA 4H44D 4Y28J 2ZT9D 3L72E 4EMJB 2YFLA 2WSFJ 2YFJA 2YIUC 3CXHE 3VMHD 4NBDD 3D89A 4RKUJ 4NBCD 4KT0J 2XR8A 5KLIC 3LW5J 1PPJE 1SQVE 1O7HA 2HMLA 4HM0A 1KYOE 4P1CH 2D2CD 2NVEA 1WQLA 1Q90C 1ZRTE 2BMOA 5L8RJ 3GTSA 3H1HE 4HKVA 1NU1E 2JZAA 1SQQE 5KLVE 3CX5E 1FQTA 1O7NA 1RIEA 2GBXA 4QUPA 2Q3WA 2E76D 3GKEA 2E74B 3BCCE 2QJKC 2HMMA 1O7PA 4H0LD 4H13B 1O7GA 4U3FE 4OGQB 2B24A 1NTME 2E4QA 1JB0J 2HMJA 2QIWA 2BMRA 4NB9D 5KKZC 2YFIA 4HM3A 1NYKA 2BCCE 3N0QA 1G8KB 1VF5B 3GL2A 1UUVA 2QJYC 4PV1B 1KB9E 1SQBE 2FYUE 2GBWA 2I7FA 3C0DA 3L70E 4NBHD 2XSOA 2QPZA 5CXMA 5AEWA 4HM1A 2HMNA 3GZYA 3EQQA 4HM5A 1NTKE 1SJGA 3GB4A 2QSIA 2ZT9B 4IL6X 2NWFA 1O7WA 4H13D 2HMKA 3GCEA 4NBFD 4AIVA 1BCCE 3CWBE 4OGQD 1PP9E 2DE5D 4HM7A 4I7ZB 4QCKA 2XSHA 2BMQA 3GL0A 2NUMA 2E75B 2CKFA 3TGUE 2WSEJ 5BOKA 3L74E 1SQPE 1ULJA 3VCAA 4HM6A
chains in the Genus database with same CATH superfamily
2YMKA 2A06G 3H1ID 3VMID 2FXMA 3C9IA 3MZWB 3L75G 1RQUA 3VCPA 1OIPA 5AW6B 2QJPC 1L0LE 1USEA 3SWKA 4W7ZA 1EDLA 3HE5B 1O7MA 5AW0B 2RH0A 1FZBA 3V2NA 2KK7A 4N3YB 2IYPA 2HPCB 2V4HA 5CCGC 3RK2C 5KAIH 2OGUA 2LKMA 1BSNA 1IFIA 1DEBA 3W68A 2R3CA 3KHUA 5KLVK 1KN7A 5APTA 4H0LD 3BCCG 2KSJA 2BMRA 2IYOA 5KKZC 2XNDH 3WU2E 4IL6E 2OYHA 3RL0B 2R32A 4PV1B 4I1LA 1S4XA 1M1JC 3CMEP 3V5BA 3IN6A 4JBZA 3RK3E 3GCEA 3L73D 3M9QA 1QVGO 2DE5D 1HWTC 3AE7C 2OYIC 5BU8B 5AVQB 3GHGB 1FZEA 3VN0A 4L73A 3GF3A 4H44B 4YTPC 1QX8A 3PRJA 3VTPC 1ZOYC 3RBXA 1VL2A 2YMYA 3RK3B 3ITKA 4GOFA 5B66H 2P7JA 3AZCA 1M8OB 1L0LD 3AE2C 3H1KE 1YJWP 3UIAA 2WTYA 1JY3P 4H13C 4YXDC 1YQ3C 1SQQD 2FFDB 2AXTH 3VMZA 3HUSC 2XV5A 2FXPA 1LTJC 1KMIZ 1SQVJ 1PPJE 2WMMA 2B9BA 1TU3F 1GL2B 1FS0E 3CD6P 1KILD 3BASA 2KXPB 3TSIA 2QJKC 1Y8AA 1KB9D 3L70D 1BCCJ 1PP9J 5KJ7D 2B24A 3A7OA 5H2FH 1GDTA 2YFIA 2ZAEB 3Q1MA 1N73B 3H25A 2VRSA 4TT3H 3MTUE 1GMJA 3D70A 1CI6A 2FYUE 3C0DA 2B88A 1FOSE 2JO1A 2IBZG 2QA4P 1FU1A 3A2AA 3KPEA 3O6QA 2FYZA 3P32A 3SFEC 3GL0A 2Q5UA 1OW6A 1HGZA 2NPSB 1FZCA 1SQPE 4HM6A 1M56D 1VQ6P 3H1LE 4A7PA 1XTGB 1KILA 1LTTC 2FYNB 1M7LA 4HJGH 3IFMA 3LIEA 3NMDA 5KJ7A 3SSUA 2P10A 1OX3A 5AVXB 2C0XA 2O1KA 5TISH 2P1JA 2ZXEB 3H1JE 1MZ9A 1KC8Q 5APSA 4NBBD 1JY2O 1JNMA 5GTIH 1RF1A 3EFGA 3L72E 5KLVD 2YKPA 4PJ0E 4NBCD 4KT0J 4EYYQ 4BRYB 1RHZB 1GK4A 3PH0A 2HMLA 3GLMA 1SQVG 3A3YB 1PPJD 3G71P 1W5CE 2QM7A 3E1IA 1SQQG 3GKEA 4N6JA 4GODA 1J1EB 1CZQA 2FKWB 2IZ1A 3KZIE 2KIKA 3MHVA 2WITA 2ZJSE 3RL0C 4NBHD 4WVZA 1S5LH 3SWYA 1O7WA 2HMKA 1VPCA 3CWBJ 3L71J 3PLNA 3VCAA 1S2EA 2A06E 3GMAA 3GHGC 1BE3D 1EZVG 4DOJA 1M90Q 2E76B 1HJBA 1X22A 3F89A 1PGJA 2J59M 1IK9A 1URQB 3RK3C 2HR3A 1NTZD 2E75D 1YTZT 2FY8A 1YHQP 4GIFA 4HJLA 3T97B 1IC2A 1L4AB 4TLFA 5APQA 1NDOA 2FFDC 3H1HD 2ZT9D 3CCEP 1GW3A 4LC1A 1VQPP 3CXHE 5B5EE 1QL2A 3A0HH 1GL2C 1EDIA 2B87A 1J1DB 1GZLA 3GTSA 4D6TD 2OTKE 5KLVG 4KJMA 2GBXA 3TNUB 3BCCE 2Q1KA 4GKGA 1LT9A 2Z5HA 2XNXA 1D7MA 1N73C 2ITAA 2HLOA 1UUVA 3TGUD 4AYCA 1SQXJ 2SPZA 2M5AA 5APXA 1RE4A 4OGQD 3G6EP 3CWBG 5KAFH 2NPSC 2WPQA 3L71G 4HYTB 4ZMDA 2JWDA 4PD4I 5KKZB 3U59A 2JP3A 1ZV8A 1UIXA 2FYNC 2E5YA 1S5LX 1NAYA 3BRVB 4JYCA 1FE6A 2XZRA 2KLUA 4HKZH 4P1BH 4UB8E 4HM4A 3G9RA 3L37A 3L75D 1EDKA 1FJKA 1G1JA 3CMAP 4KHXA 3H1IE 1IFJA 5CBOA 1BE3G 3AE4C 2KZJA 2W6JH 1ZRTD 1PFIA 5CMZA 2ZYAA 1NTZG 3VMHD 3CX5D 1KYOH 1YQ4C 1PIXA 3I5CA 2BCCJ 1VF5C 3JSVC 1NTMD 2R3SA 1J2JB 2Q6QA 4M3LA 1HH0A 2JR8A 5E79E 3WUVA 2WT7A 1G1IA 3H1HG 5AW1B 1J1EC 1R5SA 1HVVA 1JEKA 4H13B 2E4QA 4B86A 3A0BE 3L74J 3P8MC 3HUSB 3N0QA 1G8KB 1PGPA 1H8AA 1R8EA 2OYHB 4HH2A 4D6TG 1SQVK 2E42A 2QJYB 3I56P 2YXQB 4HM1A 3EQQA 3VMAA 2N1TD 3SFDC 3VP9A 4AIVA 1T3UA 1IK7A 2QJKB 2ZYGA 4QCKA 4BXLA 2Q7CA 2C9NY 3JCUE 4EI2A 1PGQA 2KLVA 1N86A 3M0DC 3L73E 2E76C 2KNCB 1E79H 4QDFA 3FGAD 3L4FA 3BRTB 1RF0C 4H0LB 1N7SD 3AE9C 1U7JA 3CCQP 5KAIE 1K04A 2XKMA 4ZKPA 1YITP 3CCUP 2JO6A 2GM4A 2QE7H 1P84H 1MKMA 2C0WA 3PP5A 1K73Q 1L4AC 3MP7B 1A02F 2N1TA 1IFMA 4Y28J 4EMJB 2YFLA 1FZGA 1KV4A 2FXOA 1OZHA 2L91A 2R5DA 1SQVE 1GTWA 1J1DC 2D2CD 5AW3B 1G2CB 2BMOA 2WVRA 1SQQE 1VQ9P 1LT1A 3ABVC 1FQTA 3OW2O 1KD1Q 4CPGA 1N7SA 4O9BA 1OW8A 2QIWA 1VQ4P 4LLHA 1NTMG 1XTCC 1KILE 3L74G 1BDDA 1W2EA 3LIDA 1PL5A 1T2KC 1CI6B 1KB9E 3L70E 2PFXA 2XSOA 2QPZA 3CCMP 5AEWA 2Y0DA 1IO4A 3TF5A 2A45I 1HF9A 5AW5B 4BWNA 2IBZD 1P84D 2IX7C 2KSEA 3NTNA 1FZCB 1KQGB 3VOPA 1JTHA 1HTLC 1EZVE 2QVAA 3WUUA 3FXDA 1KILB 5B66E 1NO4A 3AE3C 3B5ND 3IF4A 4NBED 1H0TA 2O3JA 4I6MC 5AVTB 1JY2P 1HGVA 4XE5B 1KB9I 1K8AQ 2WSCJ 2AXTE 2ZYLA 1PV3A 2NVGA 5HL4A 1E5WA 3K5BA 1RF1B 4ASVA 2WPRA 3H6PA 2C9LY 2Y0CA 1DH3A 1FOSF 4NBDD 1ZP0C 3Q3DA 2M3BA 3CCJP 5H2FE 4P1CH 3R4YA 2Q3EA 1SFCD 5KLVE 2JZAA 3M91A 1SQVD 3B5NA 1NTKJ 1VQ5P 3WMM0 5AVVB 2W8ZA 4IL6H 1NTZK 1LTAC 3SWFA 1VQMP 2W27A 1BCCD 3PHLA 2OYHC 1PP9D 2IZ0A 2KB7P 2QJYC 4R4MA 3VMXA 3GZYA 5AVSB 2R44A 3D6YA 1NJIQ 3CWBE 4LGDE 2XSHA 1X79B 3AE8C 3MUDA 1EXIA 4WWIA 1VQ7P 5TISE 4PV1D 1AVOA 1Q90D 1SFCA 1NKZB 3H32A 1KZUB 4C46A 2PGDA 5GTIE 4H0LC 1EZVD 1GD2E 2E74D 5AEUA 1SQXK 2WPVB 1HUCA 1BGYJ 3DQYA 1BE3E 3D71A 4EIJA 2JEEA 4QDDA 3W67A 1L0NJ 1N7LA 1OW7A 1NTZE 4H44D 1AA0A 2M0BA 1A02J 4N78D 1NAFA 2B87B 1M57D 3F5HA 1EC5A 3AE1C 4HKVA 3H1HE 2O01H 3L35A 2DW3A 3HRNA 1NTKG 3AE5C 4Z1MH 3FWNA 1LT9B 4Y99C 1QLED 2H88C 1S5LE 1SLQA 3V4QA 3AEGC 1VQOP 4HM3A 1NYKA 2YKOA 1QGKB 4D6TE 1VF5B 3HD7D 5AVWB 2W83C 1FDIA 2LXCB 4JYBA 4GDOA 3TDKA 2AXCA 2M5AB 2ZT9B 1DIPA 1NVOA 4IL6X 4NBFD 1PZQA 4MN4C 3V2RA 1BCCG 1FZCC 1PP9G 3TGUE 3FXEA 1NTMK 1OVVA 3CWBD 4UB6E 2Y9ZA 3H1KJ 1KILC 3L71D 3GTEA 2OQQA 3C8VA 1VQ8P 1FBMA 1VM9A 3ZDMA 1AV1A 5KJ7C 4DT0A 2GA1A 2WSEH 2NVFA 3V2QA 5AW2B 2DE7D 4WBAA 2UWJE 2Y0EA 1BGYG 1RY3A 3AECC 3HD7A 1RF1C 5CCHD 1AQ5A 3L75E 1KQSO 1L0NG 2BEQD 4PJ0H 2O01J 1RE3A 2G3AA 1U7MA 1R5LA 4C7RA 4IFDK 3M9BA 2FYUJ 1ZRTE 1RQVA 5K5GB 4XA4A 2JWAA 2JDIH 3CX5E 1O7NA 2Y9YA 3KZIH 1O7GA 1NTME 4NB9D 1SQPJ 1BDCA 2GUSA 5KAFE 3H1LJ 4WY4D 2GUVA 2N9BA 3CC2P 2I7FA 3BATA 5CCHA 3AEEC 3N7NA 2BEZF 1FZFA 2KI7B 2P2UA 4GT1A 1JUNA 3KYQA 1LJ2A 2K1AA 1SQXD 3S1KA 2BMQA 3H1JJ 2WSEJ 1KQFB 3CX5I 1ULJA 1EQ7A 1PGOA 2IFMA 1YTZI 3FWLA 1LP1A 4NBAD 5AW4B 4NPEA 1N8RQ 3H1KG 2YVJB 3CXHI 2HMOA 2KZIA 3L72J 1OWAA 2KOGA 3FOUA 1QEXA 3CC7P 2CPBA 1Q86Q 2B89A 4WY4A 5APYA 4QURA 1JY2N 5GTHH 3HTKA 4OVNF 3JC22 3RGUA 2N1TB 1VQNP 3GZXA 1HBWA 1NU1D 3U1AA 1KORA 1URQD 3D89A 1S1CX 1NYHA 2WSSH 1O7HA 5APUA 1NGMB 4C7NA 4PD4H 1NU1J 2BCCD 1FC2C 1YIJP 2WSFH 1NHLA 2Q3WA 1MFTA 4IFMA 1LT9C 1N7SB 4U3FJ 3WUTA 2H7HA 2E75C 1U57A 1N2DC 1JY3N 3GL2A 4DCKA 1SQBJ 3PTZA 2HG5D 3L74D 5CCGD 3HE4A 4HM5A 2ZT9C 2H43A 2O1JA 3RK2D 1RE4C 5EFWB 1LNQA 1NTKK 3CCVP 4QMAA 4HB1A 2V7QH 4XFJA 1T6AA 1JTHB 3H1JG 4JQ0D 2D2CB 1DX7A 1JMMA 5AW8B 2K88A 3T97A 2IBZE 1P84E 1NWQA 3NFQA 5AVZB 1H0TB 1IZNB 1SQXG 3L72G 1NH4A 2B1XA 2NZ2A 2IDBA 3M9HA 1ZR4A 1DD4A 2WQYC 4L76A 3OA7A 4HM8A 1SVFA 3P8CE 3B4SA 1KYOD 4YPCA 3BCCJ 2K9JA 4OGQC 2WSFJ 5CHXA 2RN0A 2IBZI 2XR8A 5KLIC 4NPFX 1DEEG 1T3JA 3Q5SA 2WZ7A 3B5NB 1NU1G 4JPZB 4WB4A 1SP4A 2PRRA 1CW5A 3A0BH 1L0NK 1IFPA 4GOEA 4DZOA 2WSCH 4K35A 4U3FG 1YJ9P 2IFNA 1KQLA 1ZMEC 1X8YA 2BCCG 2V7QJ 3V6IA 3CL3D 2ZFCA 3MIWA 1IFNA 1SQBG 2OYOA 1M1JA 3AEFC 4IFFA 2NWFA 4H13D 1BCCE 1BSHA 1PP9E 4I7ZB 4Y99B 3JCUH 3VMYA 3H1IJ 2OYIA 3U1CA 1SFCB 2R5BA 3H32B 1KFMA 3II6A 3O6QB 3CC4P 4R4LA 2JJLA 1BGYE 2CK3H 1AJYA 2I8DA 3RL0g 5KTBA 1YJNP 1RH5B 5AW9B 5M1BA 5CJ4A 1LTGC 1L0NE 2YO3A 1ULIA 2N1TC 2QEXP 4AUWA 3I55P 1JM1A 2Q9IA 1ZW0A 3P8CD 1IFDA 2A45H 1IJDB 3L36A 3HUSA 2JKVA 1FAVA 1LTJA 2AEFA 3IAOA 1LWUA 3G3ZA 3PJSK 1QVFO 2P58A 1ZXGA 2HODA 1T8ZA 4QUPA 1N7SC 2E74B 3M0AA 2LR2A 3VYIA 3LW5H 3Q2YA 4N78E 1EZVI 1NTKD 5AW7B 1GU5A 2HMJA 2ZYDA 2L5GB 1KB9H 4IOIH 2KYVA 1FDMA 1S9KD 3L73J 2KNCA 1EDJA 4K3AA 2FYUK 1UIIA 4W80A 1JCCA 3GB4A 1JMBA 2KS1A 3WU2H 2HYNA 1VQLP 2H89C 5CBNA 4AQRD 3A5TA 2D2CC 3H1IG 1ZLLA 1OXZA 1SQPK 2DE6D 2P67A 2E5TA 1EG9A 1W2BO 1Q82Q 1Q2NA 3OAKA 1Q81Q 4QDCA 1RFSA 3FX0A 3D6ZA 2AEJA 3CCSP 3CI9A 1L0LJ 2W6BA 3L71E 3HE5A 1LWUC 3HD7B 1G2CA 1BGYD 2HPCA 3RL0D 1SQQJ 1GU4A 1ZR2A 4OH8B 3CCRP 2YNYA 2YIUC 4EOTA 1LTSC 1L0ND 1AQTA 3LW5J 2N9YB 4HM0A 1JOCA 2J58A 2QM8A 3L70J 1FDOA 3QWOC 3B5NC 3S9OA 3Q5PA 2E43A 5APVA 2RMZA 2W90A 2HMMA 3TK1A 1HJ0A 1LTBC 4RESB 1K05A 3RK3D 3B8EB 2POHA 1VDFA 2QG4A 1YI2P 4U7JA 3EWKA 1OFCX 3L73G 1DD3A 1NU1K 4I7ZC 1H89A 5C39A 3MUDC 2PAJA 2E75B 2CKFA 1S3JA 5BOKA 2Z5IA 1AFOA 1OVUA 3EN1A 1SFCC 1LP1B 1GL2D 1YYCA 4L75A 2WWWA 5DJTB 1LGHB 3GHGA 3CCLP 3B71A 1WT6A 4HM2A 1FJPA 5CJ0A 1SQBK 1SQXE 2KUBA 3H1KD 2OTLP 3AEAC 3C1LA 2W6AA 3CLQA 1L0LG 5AVRB 1MUUA 2A45G 4WY4B 1UUWA 4NBGD 2XDJA 5KLVJ 3HTKB 2ZVOB 5APWA 1YBKA 2YFJA 2FFDA 1QL1A 2NPSD 1JY3O 4PV1C 5AVUB 4C7NB 1WQLA 3P7KA 1Q90C 1GL2A 5L8RJ 5TJHA 1NU1E 3L70G 3A0HE 2H8PD 1JO5A 2E74C 1Y47A 3RBZA 1Z56A 2FYUD 4W7YA 4U3FE 5DJUB 4OGQB 3EFFK 3V4WA 2AEMA 3V2PA 3EQ2A 3TYYA 2Q3IA 2BCCE 5KLIB 1N73A 1SQBE 1SQPD 2WT7B 3HE4B 2HMNA 4H44C 3H1LD 1SJGA 2QSIA 1KFNA 2LXBA 2XU6A 4HM7A 4UB6H 2NUMA 1BE3J 1JCDA 1X9VA 1MV8A 2NPSA 3L74E 2O01N 1VF5D 3KQGA 4JF7A 2QRXA 3BVHA 3H1JD 5AVYB 2XRXA 1NTZJ 1OMIA 3AEBC 5GTHE 5BVZA 3USSA 2G8YA 4YXWH 4QUQA 3VMGD 1VCKA 2QJPB 1WMKA 3L72D 1VQKP 3HD7C 3N4XA 3GG2A 3OJAB 4ZNCA 3H1HJ 1FZAA 1SS1A 4QDFB 1RE3C 4PD4E 3KDPB 2MKVA 3RK2B 2K9JB 3VP8A 4DJGA 4ASWA 4RJTA 1AVYA 3E1RA 4RKUJ 4BRYA 1X0TA 4D6TJ 2M3EA 2OARA 3Q5RA 1KYOE 1PPJG 2Z4EA 2NVEA 3MD0A 3CX5H 5BU5A 3G4SP 1RIEA 3CXHH 2E76D 1O7PA 5B5EH 1OVRA 3TGUJ 3MGNA 2J5UA 1LTIC 4L74A 4U3FD 1GW4A 3GF7A 5CCHC 2GBWA 1H88A 5CXMA 2FYUG 1M1JB 2ZXXA 3KXDA 1L4AD 2A06D 1KYOI 1CSBA 1SQBD 3R2PA 2FBWC 4I2LC 3O8ZA 2OYIB 1SQPG 2IPPA 3H1LG 4RO0A 3GOBA 3L75J 2NUKA 3M0DA 2YXRB 1G8JB 2MJZA 1S72P 1RF0A 2BASA 4AAYB 2M8RA 2E4PA 1URQA 1Y9BA 4WY4C 3CPWO 2PP6A 3CXHD 3IR9A 1KTMA 2ZVNB 1T2KD 1K9MQ 2K3RA 2YKQA 3M06A 4UB8H 3AEDC 1L4AA 4NPDA 4NB8D 2K9YA 2KP8A 1M1KQ 1NTMJ 2WPSA 4PD4D 3BCCD 3E7KA 2CPSA 1GK6A 1LTJB 2NRGA 1L0LK 1LWUB 2HODB 5CCGA 1SQQK 1WRGA 3TNUA 2HFED 3QH9A 1ZN5A 1JB0J 2I1KA 2YIUB 1P84I 3TGUG 5E79H 2RKLA 2OTJP 2YO2A 3GW6A 2I1JA 4OWFA 1NTKE 2KS1B 3AE6C 1Q7YQ 1URQC 1L2PA 1NOHA 1MFZA 1NKNA 3S4RA 4ZKUA 4EDFA 1JM0A 3NXSA 1USDA 1S9KE 2K37A 1EXJA
chains in the Genus database with same CATH topology
2JP3A 3GTEA 2DE6D 1UIXA 2FYNC 2OQQA 2YMKA 3C8VA 1S5LX 3VMID 1EG9A 1VM9A 4QDCA 1RFSA 3D6ZA 1RQUA 3VCPA 4P1BH 4HM4A 3G9RA 2QJPC 2NVFA 1L0LE 2DE7D 3L71E 1O7MA 3AECC 3H1IE 3AE4C 3L75E 2BEQD 2O01J 2YIUC 2G3AA 3VMHD 1YQ4C 1PIXA 3LW5J 1VF5C 4HM0A 1FDOA 1ZRTE 1RQVA 3S9OA 3Q5PA 3CX5E 1O7NA 2HMMA 4H0LD 4H13B 1O7GA 1HJ0A 1NTME 2E4QA 2BMRA 4NB9D 5KKZC 1K05A 3N0QA 1G8KB 1R8EA 4PV1B 4U7JA 2I7FA 3EWKA 4HM1A 3AEEC 3EQQA 3IN6A 1DD3A 2BEZF 3SFDC 3RK3E 4AIVA 3GCEA 1IK7A 4I7ZC 2DE5D 4QCKA 2BMQA 2E75B 2CKFA 3AE7C 2WSEJ 5BOKA 1KQFB 1ULJA 3EN1A 4NBAD 2YVJB 3L73E 2E76C 3B71A 4QDFA 3FGAD 4HM2A 2HMOA 1SQXE 3GF3A 4H44B 3AEAC 3FOUA 4H0LB 3AE9C 1K04A 4YTPC 1ZOYC 1VL2A 2JO6A 3AZCA 4QURA 1MKMA 1UUWA 4NBGD 3AE2C 3H1KE 4H13C 4YXDC 3GZXA 4Y28J 4EMJB 1YQ3C 2YFLA 2YFJA 1KORA 3D89A 1S1CX 1NYHA 2FXPA 1KMIZ 1PPJE 1SQVE 1O7HA 4PV1C 2D2CD 1TU3F 1NGMB 1WQLA 1Q90C 2BMOA 5L8RJ 1NU1E 1SQQE 2E74C 3ABVC 1FQTA 2Q3WA 2QJKC 4U3FE 4OGQB 2E75C 2B24A 1OW8A 2QIWA 1U57A 2YFIA 1KILE 3Q1MA 2BCCE 3GL2A 3H25A 4TT3H 1PL5A 1GMJA 3D70A 1KB9E 1SQBE 2FYUE 3L70E 3C0DA 2XSOA 2QPZA 5AEWA 2JO1A 2HMNA 4H44C 4HM5A 2ZT9C 1SJGA 2QSIA 1HF9A 3O6QA 3SFEC 4HM7A 3GL0A 2NUMA 1OW6A 4XFJA 1KQGB 3L74E 1SQPE 4HM6A 1VF5D 2D2CB 1EZVE 3H1LE 2IBZE 3AE3C 1P84E 2XRXA 1OMIA 3AEBC 4NBED 2G8YA 2P10A 2B1XA 4QUQA 2NZ2A 2IDBA 3VMGD 1VCKA 1WMKA 2WSCJ 3H1JE 1DD4A 2ZYLA 1PV3A 2NVGA 5HL4A 2WQYC 4NBBD 4HM8A 4QDFB 4PD4E 2MKVA 4OGQC 3L72E 2WSFJ 4NBDD 4RKUJ 4NBCD 4KT0J 2XR8A 5KLIC 1ZP0C 3Q3DA 2HMLA 3GLMA 3Q5RA 1KYOE 4P1CH 2NVEA 3R4YA 2JZAA 3Q5SA 5KLVE 1RIEA 2E76D 3GKEA 1O7PA 2J5UA 1ZMEC 2V7QJ 4R4MA 2QJYC 3GF7A 2GBWA 4NBHD 5CXMA 3GZYA 3AEFC 3D6YA 2NWFA 4H13D 1O7WA 2HMKA 1BCCE 3CWBE 1PP9E 4I7ZB 2XSHA 2FBWC 3AE8C 1EXIA 3VCAA 3GMAA 2A06E 4PV1D 1Q90D 3GOBA 2NUKA 2E76B 1G8JB 4H0LC 2E74D 5AEUA 4R4LA 2WPVB 4AAYB 2E4PA 2E75D 1Y9BA 3DQYA 1BE3E 1AJYA 3D71A 3RL0g 4QDDA 5M1BA 4HJLA 1KTMA 3T97B 1L0NE 1ULIA 1OW7A 3AEDC 1NDOA 4NB8D 4H44D 2K9YA 1JM1A 1NTZE 2ZT9D 3CXHE 3IAOA 3AE1C 3GTSA 4HKVA 3H1HE 2GBXA 4QUPA 2E74B 3BCCE 3AE5C 4Z1MH 3Q2YA 2H88C 1JB0J 2HMJA 3AEGC 4HM3A 1NYKA 1VF5B 1UUVA 1FDIA 4GDOA 1NTKE 3GB4A 3AE6C 2ZT9B 1DIPA 4IL6X 4NBFD 4OGQD 2H89C 3TGUE 2D2CC 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 D;  2D2C B;  3GTE A;  1EZV E;  3EN1 A;  2A06 E;  3H1L E;  2DE6 D;  4NBA D;  4PV1 D;  2FYN C;  1Q90 D;  2YVJ B;  3C8V A;  2IBZ E;  1S5L X;  1P84 E;  3GOB A;  3VMI D;  1EG9 A;  3L73 E;  4QDF A;  2NUK A;  2XRX A;  4HM2 A;  1VM9 A;  2HMO A;  2E76 B;  1G8J B;  4QDC A;  1SQX E;  1RFS A;  2E74 D;  4H44 B;  3FOU A;  4H0L B;  4NBE D;  3VCP A;  4P1B H;  4HM4 A;  5AEU A;  2WPV B;  4AAY B;  2QJP C;  2B1X A;  1L0L E;  2NVF A;  4QUQ A;  2E4P A;  3VMG D;  1VCK A;  2DE7 D;  2E75 D;  3L71 E;  1O7M A;  3DQY A;  2WSC J;  1BE3 E;  3H1J E;  2JO6 A;  2ZYL A;  3H1I E;  2NVG A;  3AZC A;  4QDD A;  5HL4 A;  4QUR A;  4HJL A;  1UUW A;  4NBB D;  4NBG D;  4HM8 A;  3H1K E;  1L0N E;  1ULI A;  4QDF B;  3L75 E;  4PD4 E;  1NDO A;  4NB8 D;  1NTZ E;  2O01 J;  2K9Y A;  1JM1 A;  3GZX A;  4H44 D;  4Y28 J;  2ZT9 D;  3L72 E;  4EMJ B;  2YFL A;  2WSF J;  2YFJ A;  2YIU C;  3CXH E;  3VMH D;  4NBD D;  3D89 A;  4RKU J;  4NBC D;  4KT0 J;  2XR8 A;  5KLI C;  3LW5 J;  1PPJ E;  1SQV E;  1O7H A;  2HML A;  4HM0 A;  1KYO E;  4P1C H;  2D2C D;  2NVE A;  1WQL A;  1Q90 C;  1ZRT E;  2BMO A;  5L8R J;  3GTS A;  3H1H E;  4HKV A;  1NU1 E;  2JZA A;  1SQQ E;  5KLV E;  3CX5 E;  1FQT A;  1O7N A;  1RIE A;  2GBX A;  4QUP A;  2Q3W A;  2E76 D;  3GKE A;  2E74 B;  3BCC E;  2QJK C;  2HMM A;  1O7P A;  4H0L D;  4H13 B;  1O7G A;  4U3F E;  4OGQ B;  2B24 A;  1NTM E;  2E4Q A;  1JB0 J;  2HMJ A;  2QIW A;  2BMR A;  4NB9 D;  5KKZ C;  2YFI A;  4HM3 A;  1NYK A;  2BCC E;  3N0Q A;  1G8K B;  1VF5 B;  3GL2 A;  1UUV A;  2QJY C;  4PV1 B;  1KB9 E;  1SQB E;  2FYU E;  2GBW A;  2I7F A;  3C0D A;  3L70 E;  4NBH D;  2XSO A;  2QPZ A;  5CXM A;  5AEW A;  4HM1 A;  2HMN A;  3GZY A;  3EQQ A;  4HM5 A;  1NTK E;  1SJG A;  3GB4 A;  2QSI A;  2ZT9 B;  4IL6 X;  2NWF A;  1O7W A;  4H13 D;  2HMK A;  3GCE A;  4NBF D;  4AIV A;  1BCC E;  3CWB E;  4OGQ D;  1PP9 E;  2DE5 D;  4HM7 A;  4I7Z B;  4QCK A;  2XSH A;  2BMQ A;  3GL0 A;  2NUM A;  2E75 B;  2CKF A;  3TGU E;  2WSE J;  5BOK A;  3L74 E;  1SQP E;  1ULJ A;  3VCA A;  4HM6 A; 
#chains in the Genus database with same CATH topology
 2YMK A;  2A06 G;  3H1I D;  3VMI D;  2FXM A;  3C9I A;  3MZW B;  3L75 G;  1RQU A;  3VCP A;  1OIP A;  5AW6 B;  2QJP C;  1L0L E;  1USE A;  3SWK A;  4W7Z A;  1EDL A;  3HE5 B;  1O7M A;  5AW0 B;  2RH0 A;  1FZB A;  3V2N A;  2KK7 A;  4N3Y B;  2IYP A;  2HPC B;  2V4H A;  5CCG C;  3RK2 C;  5KAI H;  2OGU A;  2LKM A;  1BSN A;  1IFI A;  1DEB A;  3W68 A;  2R3C A;  3KHU A;  5KLV K;  1KN7 A;  5APT A;  4H0L D;  3BCC G;  2KSJ A;  2BMR A;  2IYO A;  5KKZ C;  2XND H;  3WU2 E;  4IL6 E;  2OYH A;  3RL0 B;  2R32 A;  4PV1 B;  4I1L A;  1S4X A;  1M1J C;  3CME P;  3V5B A;  3IN6 A;  4JBZ A;  3RK3 E;  3GCE A;  3L73 D;  3M9Q A;  1QVG O;  2DE5 D;  1HWT C;  3AE7 C;  2OYI C;  5BU8 B;  5AVQ B;  3GHG B;  1FZE A;  3VN0 A;  4L73 A;  3GF3 A;  4H44 B;  4YTP C;  1QX8 A;  3PRJ A;  3VTP C;  1ZOY C;  3RBX A;  1VL2 A;  2YMY A;  3RK3 B;  3ITK A;  4GOF A;  5B66 H;  2P7J A;  3AZC A;  1M8O B;  1L0L D;  3AE2 C;  3H1K E;  1YJW P;  3UIA A;  2WTY A;  1JY3 P;  4H13 C;  4YXD C;  1YQ3 C;  1SQQ D;  2FFD B;  2AXT H;  3VMZ A;  3HUS C;  2XV5 A;  2FXP A;  1LTJ C;  1KMI Z;  1SQV J;  1PPJ E;  2WMM A;  2B9B A;  1TU3 F;  1GL2 B;  1FS0 E;  3CD6 P;  1KIL D;  3BAS A;  2KXP B;  3TSI A;  2QJK C;  1Y8A A;  1KB9 D;  3L70 D;  1BCC J;  1PP9 J;  5KJ7 D;  2B24 A;  3A7O A;  5H2F H;  1GDT A;  2YFI A;  2ZAE B;  3Q1M A;  1N73 B;  3H25 A;  2VRS A;  4TT3 H;  3MTU E;  1GMJ A;  3D70 A;  1CI6 A;  2FYU E;  3C0D A;  2B88 A;  1FOS E;  2JO1 A;  2IBZ G;  2QA4 P;  1FU1 A;  3A2A A;  3KPE A;  3O6Q A;  2FYZ A;  3P32 A;  3SFE C;  3GL0 A;  2Q5U A;  1OW6 A;  1HGZ A;  2NPS B;  1FZC A;  1SQP E;  4HM6 A;  1M56 D;  1VQ6 P;  3H1L E;  4A7P A;  1XTG B;  1KIL A;  1LTT C;  2FYN B;  1M7L A;  4HJG H;  3IFM A;  3LIE A;  3NMD A;  5KJ7 A;  3SSU A;  2P10 A;  1OX3 A;  5AVX B;  2C0X A;  2O1K A;  5TIS H;  2P1J A;  2ZXE B;  3H1J E;  1MZ9 A;  1KC8 Q;  5APS A;  4NBB D;  1JY2 O;  1JNM A;  5GTI H;  1RF1 A;  3EFG A;  3L72 E;  5KLV D;  2YKP A;  4PJ0 E;  4NBC D;  4KT0 J;  4EYY Q;  4BRY B;  1RHZ B;  1GK4 A;  3PH0 A;  2HML A;  3GLM A;  1SQV G;  3A3Y B;  1PPJ D;  3G71 P;  1W5C E;  2QM7 A;  3E1I A;  1SQQ G;  3GKE A;  4N6J A;  4GOD A;  1J1E B;  1CZQ A;  2FKW B;  2IZ1 A;  3KZI E;  2KIK A;  3MHV A;  2WIT A;  2ZJS E;  3RL0 C;  4NBH D;  4WVZ A;  1S5L H;  3SWY A;  1O7W A;  2HMK A;  1VPC A;  3CWB J;  3L71 J;  3PLN A;  3VCA A;  1S2E A;  2A06 E;  3GMA A;  3GHG C;  1BE3 D;  1EZV G;  4DOJ A;  1M90 Q;  2E76 B;  1HJB A;  1X22 A;  3F89 A;  1PGJ A;  2J59 M;  1IK9 A;  1URQ B;  3RK3 C;  2HR3 A;  1NTZ D;  2E75 D;  1YTZ T;  2FY8 A;  1YHQ P;  4GIF A;  4HJL A;  3T97 B;  1IC2 A;  1L4A B;  4TLF A;  5APQ A;  1NDO A;  2FFD C;  3H1H D;  2ZT9 D;  3CCE P;  1GW3 A;  4LC1 A;  1VQP P;  3CXH E;  5B5E E;  1QL2 A;  3A0H H;  1GL2 C;  1EDI A;  2B87 A;  1J1D B;  1GZL A;  3GTS A;  4D6T D;  2OTK E;  5KLV G;  4KJM A;  2GBX A;  3TNU B;  3BCC E;  2Q1K A;  4GKG A;  1LT9 A;  2Z5H A;  2XNX A;  1D7M A;  1N73 C;  2ITA A;  2HLO A;  1UUV A;  3TGU D;  4AYC A;  1SQX J;  2SPZ A;  2M5A A;  5APX A;  1RE4 A;  4OGQ D;  3G6E P;  3CWB G;  5KAF H;  2NPS C;  2WPQ A;  3L71 G;  4HYT B;  4ZMD A;  2JWD A;  4PD4 I;  5KKZ B;  3U59 A;  2JP3 A;  1ZV8 A;  1UIX A;  2FYN C;  2E5Y A;  1S5L X;  1NAY A;  3BRV B;  4JYC A;  1FE6 A;  2XZR A;  2KLU A;  4HKZ H;  4P1B H;  4UB8 E;  4HM4 A;  3G9R A;  3L37 A;  3L75 D;  1EDK A;  1FJK A;  1G1J A;  3CMA P;  4KHX A;  3H1I E;  1IFJ A;  5CBO A;  1BE3 G;  3AE4 C;  2KZJ A;  2W6J H;  1ZRT D;  1PFI A;  5CMZ A;  2ZYA A;  1NTZ G;  3VMH D;  3CX5 D;  1KYO H;  1YQ4 C;  1PIX A;  3I5C A;  2BCC J;  1VF5 C;  3JSV C;  1NTM D;  2R3S A;  1J2J B;  2Q6Q A;  4M3L A;  1HH0 A;  2JR8 A;  5E79 E;  3WUV A;  2WT7 A;  1G1I A;  3H1H G;  5AW1 B;  1J1E C;  1R5S A;  1HVV A;  1JEK A;  4H13 B;  2E4Q A;  4B86 A;  3A0B E;  3L74 J;  3P8M C;  3HUS B;  3N0Q A;  1G8K B;  1PGP A;  1H8A A;  1R8E A;  2OYH B;  4HH2 A;  4D6T G;  1SQV K;  2E42 A;  2QJY B;  3I56 P;  2YXQ B;  4HM1 A;  3EQQ A;  3VMA A;  2N1T D;  3SFD C;  3VP9 A;  4AIV A;  1T3U A;  1IK7 A;  2QJK B;  2ZYG A;  4QCK A;  4BXL A;  2Q7C A;  2C9N Y;  3JCU E;  4EI2 A;  1PGQ A;  2KLV A;  1N86 A;  3M0D C;  3L73 E;  2E76 C;  2KNC B;  1E79 H;  4QDF A;  3FGA D;  3L4F A;  3BRT B;  1RF0 C;  4H0L B;  1N7S D;  3AE9 C;  1U7J A;  3CCQ P;  5KAI E;  1K04 A;  2XKM A;  4ZKP A;  1YIT P;  3CCU P;  2JO6 A;  2GM4 A;  2QE7 H;  1P84 H;  1MKM A;  2C0W A;  3PP5 A;  1K73 Q;  1L4A C;  3MP7 B;  1A02 F;  2N1T A;  1IFM A;  4Y28 J;  4EMJ B;  2YFL A;  1FZG A;  1KV4 A;  2FXO A;  1OZH A;  2L91 A;  2R5D A;  1SQV E;  1GTW A;  1J1D C;  2D2C D;  5AW3 B;  1G2C B;  2BMO A;  2WVR A;  1SQQ E;  1VQ9 P;  1LT1 A;  3ABV C;  1FQT A;  3OW2 O;  1KD1 Q;  4CPG A;  1N7S A;  4O9B A;  1OW8 A;  2QIW A;  1VQ4 P;  4LLH A;  1NTM G;  1XTC C;  1KIL E;  3L74 G;  1BDD A;  1W2E A;  3LID A;  1PL5 A;  1T2K C;  1CI6 B;  1KB9 E;  3L70 E;  2PFX A;  2XSO A;  2QPZ A;  3CCM P;  5AEW A;  2Y0D A;  1IO4 A;  3TF5 A;  2A45 I;  1HF9 A;  5AW5 B;  4BWN A;  2IBZ D;  1P84 D;  2IX7 C;  2KSE A;  3NTN A;  1FZC B;  1KQG B;  3VOP A;  1JTH A;  1HTL C;  1EZV E;  2QVA A;  3WUU A;  3FXD A;  1KIL B;  5B66 E;  1NO4 A;  3AE3 C;  3B5N D;  3IF4 A;  4NBE D;  1H0T A;  2O3J A;  4I6M C;  5AVT B;  1JY2 P;  1HGV A;  4XE5 B;  1KB9 I;  1K8A Q;  2WSC J;  2AXT E;  2ZYL A;  1PV3 A;  2NVG A;  5HL4 A;  1E5W A;  3K5B A;  1RF1 B;  4ASV A;  2WPR A;  3H6P A;  2C9L Y;  2Y0C A;  1DH3 A;  1FOS F;  4NBD D;  1ZP0 C;  3Q3D A;  2M3B A;  3CCJ P;  5H2F E;  4P1C H;  3R4Y A;  2Q3E A;  1SFC D;  5KLV E;  2JZA A;  3M91 A;  1SQV D;  3B5N A;  1NTK J;  1VQ5 P;  3WMM 0;  5AVV B;  2W8Z A;  4IL6 H;  1NTZ K;  1LTA C;  3SWF A;  1VQM P;  2W27 A;  1BCC D;  3PHL A;  2OYH C;  1PP9 D;  2IZ0 A;  2KB7 P;  2QJY C;  4R4M A;  3VMX A;  3GZY A;  5AVS B;  2R44 A;  3D6Y A;  1NJI Q;  3CWB E;  4LGD E;  2XSH A;  1X79 B;  3AE8 C;  3MUD A;  1EXI A;  4WWI A;  1VQ7 P;  5TIS E;  4PV1 D;  1AVO A;  1Q90 D;  1SFC A;  1NKZ B;  3H32 A;  1KZU B;  4C46 A;  2PGD A;  5GTI E;  4H0L C;  1EZV D;  1GD2 E;  2E74 D;  5AEU A;  1SQX K;  2WPV B;  1HUC A;  1BGY J;  3DQY A;  1BE3 E;  3D71 A;  4EIJ A;  2JEE A;  4QDD A;  3W67 A;  1L0N J;  1N7L A;  1OW7 A;  1NTZ E;  4H44 D;  1AA0 A;  2M0B A;  1A02 J;  4N78 D;  1NAF A;  2B87 B;  1M57 D;  3F5H A;  1EC5 A;  3AE1 C;  4HKV A;  3H1H E;  2O01 H;  3L35 A;  2DW3 A;  3HRN A;  1NTK G;  3AE5 C;  4Z1M H;  3FWN A;  1LT9 B;  4Y99 C;  1QLE D;  2H88 C;  1S5L E;  1SLQ A;  3V4Q A;  3AEG C;  1VQO P;  4HM3 A;  1NYK A;  2YKO A;  1QGK B;  4D6T E;  1VF5 B;  3HD7 D;  5AVW B;  2W83 C;  1FDI A;  2LXC B;  4JYB A;  4GDO A;  3TDK A;  2AXC A;  2M5A B;  2ZT9 B;  1DIP A;  1NVO A;  4IL6 X;  4NBF D;  1PZQ A;  4MN4 C;  3V2R A;  1BCC G;  1FZC C;  1PP9 G;  3TGU E;  3FXE A;  1NTM K;  1OVV A;  3CWB D;  4UB6 E;  2Y9Z A;  3H1K J;  1KIL C;  3L71 D;  3GTE A;  2OQQ A;  3C8V A;  1VQ8 P;  1FBM A;  1VM9 A;  3ZDM A;  1AV1 A;  5KJ7 C;  4DT0 A;  2GA1 A;  2WSE H;  2NVF A;  3V2Q A;  5AW2 B;  2DE7 D;  4WBA A;  2UWJ E;  2Y0E A;  1BGY G;  1RY3 A;  3AEC C;  3HD7 A;  1RF1 C;  5CCH D;  1AQ5 A;  3L75 E;  1KQS O;  1L0N G;  2BEQ D;  4PJ0 H;  2O01 J;  1RE3 A;  2G3A A;  1U7M A;  1R5L A;  4C7R A;  4IFD K;  3M9B A;  2FYU J;  1ZRT E;  1RQV A;  5K5G B;  4XA4 A;  2JWA A;  2JDI H;  3CX5 E;  1O7N A;  2Y9Y A;  3KZI H;  1O7G A;  1NTM E;  4NB9 D;  1SQP J;  1BDC A;  2GUS A;  5KAF E;  3H1L J;  4WY4 D;  2GUV A;  2N9B A;  3CC2 P;  2I7F A;  3BAT A;  5CCH A;  3AEE C;  3N7N A;  2BEZ F;  1FZF A;  2KI7 B;  2P2U A;  4GT1 A;  1JUN A;  3KYQ A;  1LJ2 A;  2K1A A;  1SQX D;  3S1K A;  2BMQ A;  3H1J J;  2WSE J;  1KQF B;  3CX5 I;  1ULJ A;  1EQ7 A;  1PGO A;  2IFM A;  1YTZ I;  3FWL A;  1LP1 A;  4NBA D;  5AW4 B;  4NPE A;  1N8R Q;  3H1K G;  2YVJ B;  3CXH I;  2HMO A;  2KZI A;  3L72 J;  1OWA A;  2KOG A;  3FOU A;  1QEX A;  3CC7 P;  2CPB A;  1Q86 Q;  2B89 A;  4WY4 A;  5APY A;  4QUR A;  1JY2 N;  5GTH H;  3HTK A;  4OVN F;  3JC2 2;  3RGU A;  2N1T B;  1VQN P;  3GZX A;  1HBW A;  1NU1 D;  3U1A A;  1KOR A;  1URQ D;  3D89 A;  1S1C X;  1NYH A;  2WSS H;  1O7H A;  5APU A;  1NGM B;  4C7N A;  4PD4 H;  1NU1 J;  2BCC D;  1FC2 C;  1YIJ P;  2WSF H;  1NHL A;  2Q3W A;  1MFT A;  4IFM A;  1LT9 C;  1N7S B;  4U3F J;  3WUT A;  2H7H A;  2E75 C;  1U57 A;  1N2D C;  1JY3 N;  3GL2 A;  4DCK A;  1SQB J;  3PTZ A;  2HG5 D;  3L74 D;  5CCG D;  3HE4 A;  4HM5 A;  2ZT9 C;  2H43 A;  2O1J A;  3RK2 D;  1RE4 C;  5EFW B;  1LNQ A;  1NTK K;  3CCV P;  4QMA A;  4HB1 A;  2V7Q H;  4XFJ A;  1T6A A;  1JTH B;  3H1J G;  4JQ0 D;  2D2C B;  1DX7 A;  1JMM A;  5AW8 B;  2K88 A;  3T97 A;  2IBZ E;  1P84 E;  1NWQ A;  3NFQ A;  5AVZ B;  1H0T B;  1IZN B;  1SQX G;  3L72 G;  1NH4 A;  2B1X A;  2NZ2 A;  2IDB A;  3M9H A;  1ZR4 A;  1DD4 A;  2WQY C;  4L76 A;  3OA7 A;  4HM8 A;  1SVF A;  3P8C E;  3B4S A;  1KYO D;  4YPC A;  3BCC J;  2K9J A;  4OGQ C;  2WSF J;  5CHX A;  2RN0 A;  2IBZ I;  2XR8 A;  5KLI C;  4NPF X;  1DEE G;  1T3J A;  3Q5S A;  2WZ7 A;  3B5N B;  1NU1 G;  4JPZ B;  4WB4 A;  1SP4 A;  2PRR A;  1CW5 A;  3A0B H;  1L0N K;  1IFP A;  4GOE A;  4DZO A;  2WSC H;  4K35 A;  4U3F G;  1YJ9 P;  2IFN A;  1KQL A;  1ZME C;  1X8Y A;  2BCC G;  2V7Q J;  3V6I A;  3CL3 D;  2ZFC A;  3MIW A;  1IFN A;  1SQB G;  2OYO A;  1M1J A;  3AEF C;  4IFF A;  2NWF A;  4H13 D;  1BCC E;  1BSH A;  1PP9 E;  4I7Z B;  4Y99 B;  3JCU H;  3VMY A;  3H1I J;  2OYI A;  3U1C A;  1SFC B;  2R5B A;  3H32 B;  1KFM A;  3II6 A;  3O6Q B;  3CC4 P;  4R4L A;  2JJL A;  1BGY E;  2CK3 H;  1AJY A;  2I8D A;  3RL0 g;  5KTB A;  1YJN P;  1RH5 B;  5AW9 B;  5M1B A;  5CJ4 A;  1LTG C;  1L0N E;  2YO3 A;  1ULI A;  2N1T C;  2QEX P;  4AUW A;  3I55 P;  1JM1 A;  2Q9I A;  1ZW0 A;  3P8C D;  1IFD A;  2A45 H;  1IJD B;  3L36 A;  3HUS A;  2JKV A;  1FAV A;  1LTJ A;  2AEF A;  3IAO A;  1LWU A;  3G3Z A;  3PJS K;  1QVF O;  2P58 A;  1ZXG A;  2HOD A;  1T8Z A;  4QUP A;  1N7S C;  2E74 B;  3M0A A;  2LR2 A;  3VYI A;  3LW5 H;  3Q2Y A;  4N78 E;  1EZV I;  1NTK D;  5AW7 B;  1GU5 A;  2HMJ A;  2ZYD A;  2L5G B;  1KB9 H;  4IOI H;  2KYV A;  1FDM A;  1S9K D;  3L73 J;  2KNC A;  1EDJ A;  4K3A A;  2FYU K;  1UII A;  4W80 A;  1JCC A;  3GB4 A;  1JMB A;  2KS1 A;  3WU2 H;  2HYN A;  1VQL P;  2H89 C;  5CBN A;  4AQR D;  3A5T A;  2D2C C;  3H1I G;  1ZLL A;  1OXZ A;  1SQP K;  2DE6 D;  2P67 A;  2E5T A;  1EG9 A;  1W2B O;  1Q82 Q;  1Q2N A;  3OAK A;  1Q81 Q;  4QDC A;  1RFS A;  3FX0 A;  3D6Z A;  2AEJ A;  3CCS P;  3CI9 A;  1L0L J;  2W6B A;  3L71 E;  3HE5 A;  1LWU C;  3HD7 B;  1G2C A;  1BGY D;  2HPC A;  3RL0 D;  1SQQ J;  1GU4 A;  1ZR2 A;  4OH8 B;  3CCR P;  2YNY A;  2YIU C;  4EOT A;  1LTS C;  1L0N D;  1AQT A;  3LW5 J;  2N9Y B;  4HM0 A;  1JOC A;  2J58 A;  2QM8 A;  3L70 J;  1FDO A;  3QWO C;  3B5N C;  3S9O A;  3Q5P A;  2E43 A;  5APV A;  2RMZ A;  2W90 A;  2HMM A;  3TK1 A;  1HJ0 A;  1LTB C;  4RES B;  1K05 A;  3RK3 D;  3B8E B;  2POH A;  1VDF A;  2QG4 A;  1YI2 P;  4U7J A;  3EWK A;  1OFC X;  3L73 G;  1DD3 A;  1NU1 K;  4I7Z C;  1H89 A;  5C39 A;  3MUD C;  2PAJ A;  2E75 B;  2CKF A;  1S3J A;  5BOK A;  2Z5I A;  1AFO A;  1OVU A;  3EN1 A;  1SFC C;  1LP1 B;  1GL2 D;  1YYC A;  4L75 A;  2WWW A;  5DJT B;  1LGH B;  3GHG A;  3CCL P;  3B71 A;  1WT6 A;  4HM2 A;  1FJP A;  5CJ0 A;  1SQB K;  1SQX E;  2KUB A;  3H1K D;  2OTL P;  3AEA C;  3C1L A;  2W6A A;  3CLQ A;  1L0L G;  5AVR B;  1MUU A;  2A45 G;  4WY4 B;  1UUW A;  4NBG D;  2XDJ A;  5KLV J;  3HTK B;  2ZVO B;  5APW A;  1YBK A;  2YFJ A;  2FFD A;  1QL1 A;  2NPS D;  1JY3 O;  4PV1 C;  5AVU B;  4C7N B;  1WQL A;  3P7K A;  1Q90 C;  1GL2 A;  5L8R J;  5TJH A;  1NU1 E;  3L70 G;  3A0H E;  2H8P D;  1JO5 A;  2E74 C;  1Y47 A;  3RBZ A;  1Z56 A;  2FYU D;  4W7Y A;  4U3F E;  5DJU B;  4OGQ B;  3EFF K;  3V4W A;  2AEM A;  3V2P A;  3EQ2 A;  3TYY A;  2Q3I A;  2BCC E;  5KLI B;  1N73 A;  1SQB E;  1SQP D;  2WT7 B;  3HE4 B;  2HMN A;  4H44 C;  3H1L D;  1SJG A;  2QSI A;  1KFN A;  2LXB A;  2XU6 A;  4HM7 A;  4UB6 H;  2NUM A;  1BE3 J;  1JCD A;  1X9V A;  1MV8 A;  2NPS A;  3L74 E;  2O01 N;  1VF5 D;  3KQG A;  4JF7 A;  2QRX A;  3BVH A;  3H1J D;  5AVY B;  2XRX A;  1NTZ J;  1OMI A;  3AEB C;  5GTH E;  5BVZ A;  3USS A;  2G8Y A;  4YXW H;  4QUQ A;  3VMG D;  1VCK A;  2QJP B;  1WMK A;  3L72 D;  1VQK P;  3HD7 C;  3N4X A;  3GG2 A;  3OJA B;  4ZNC A;  3H1H J;  1FZA A;  1SS1 A;  4QDF B;  1RE3 C;  4PD4 E;  3KDP B;  2MKV A;  3RK2 B;  2K9J B;  3VP8 A;  4DJG A;  4ASW A;  4RJT A;  1AVY A;  3E1R A;  4RKU J;  4BRY A;  1X0T A;  4D6T J;  2M3E A;  2OAR A;  3Q5R A;  1KYO E;  1PPJ G;  2Z4E A;  2NVE A;  3MD0 A;  3CX5 H;  5BU5 A;  3G4S P;  1RIE A;  3CXH H;  2E76 D;  1O7P A;  5B5E H;  1OVR A;  3TGU J;  3MGN A;  2J5U A;  1LTI C;  4L74 A;  4U3F D;  1GW4 A;  3GF7 A;  5CCH C;  2GBW A;  1H88 A;  5CXM A;  2FYU G;  1M1J B;  2ZXX A;  3KXD A;  1L4A D;  2A06 D;  1KYO I;  1CSB A;  1SQB D;  3R2P A;  2FBW C;  4I2L C;  3O8Z A;  2OYI B;  1SQP G;  2IPP A;  3H1L G;  4RO0 A;  3GOB A;  3L75 J;  2NUK A;  3M0D A;  2YXR B;  1G8J B;  2MJZ A;  1S72 P;  1RF0 A;  2BAS A;  4AAY B;  2M8R A;  2E4P A;  1URQ A;  1Y9B A;  4WY4 C;  3CPW O;  2PP6 A;  3CXH D;  3IR9 A;  1KTM A;  2ZVN B;  1T2K D;  1K9M Q;  2K3R A;  2YKQ A;  3M06 A;  4UB8 H;  3AED C;  1L4A A;  4NPD A;  4NB8 D;  2K9Y A;  2KP8 A;  1M1K Q;  1NTM J;  2WPS A;  4PD4 D;  3BCC D;  3E7K A;  2CPS A;  1GK6 A;  1LTJ B;  2NRG A;  1L0L K;  1LWU B;  2HOD B;  5CCG A;  1SQQ K;  1WRG A;  3TNU A;  2HFE D;  3QH9 A;  1ZN5 A;  1JB0 J;  2I1K A;  2YIU B;  1P84 I;  3TGU G;  5E79 H;  2RKL A;  2OTJ P;  2YO2 A;  3GW6 A;  2I1J A;  4OWF A;  1NTK E;  2KS1 B;  3AE6 C;  1Q7Y Q;  1URQ C;  1L2P A;  1NOH A;  1MFZ A;  1NKN A;  3S4R A;  4ZKU A;  4EDF A;  1JM0 A;  3NXS A;  1USD A;  1S9K E;  2K37 A;  1EXJ A; 
#chains in the Genus database with same CATH homology
 2JP3 A;  3GTE A;  2DE6 D;  1UIX A;  2FYN C;  2OQQ A;  2YMK A;  3C8V A;  1S5L X;  3VMI D;  1EG9 A;  1VM9 A;  4QDC A;  1RFS A;  3D6Z A;  1RQU A;  3VCP A;  4P1B H;  4HM4 A;  3G9R A;  2QJP C;  2NVF A;  1L0L E;  2DE7 D;  3L71 E;  1O7M A;  3AEC C;  3H1I E;  3AE4 C;  3L75 E;  2BEQ D;  2O01 J;  2YIU C;  2G3A A;  3VMH D;  1YQ4 C;  1PIX A;  3LW5 J;  1VF5 C;  4HM0 A;  1FDO A;  1ZRT E;  1RQV A;  3S9O A;  3Q5P A;  3CX5 E;  1O7N A;  2HMM A;  4H0L D;  4H13 B;  1O7G A;  1HJ0 A;  1NTM E;  2E4Q A;  2BMR A;  4NB9 D;  5KKZ C;  1K05 A;  3N0Q A;  1G8K B;  1R8E A;  4PV1 B;  4U7J A;  2I7F A;  3EWK A;  4HM1 A;  3AEE C;  3EQQ A;  3IN6 A;  1DD3 A;  2BEZ F;  3SFD C;  3RK3 E;  4AIV A;  3GCE A;  1IK7 A;  4I7Z C;  2DE5 D;  4QCK A;  2BMQ A;  2E75 B;  2CKF A;  3AE7 C;  2WSE J;  5BOK A;  1KQF B;  1ULJ A;  3EN1 A;  4NBA D;  2YVJ B;  3L73 E;  2E76 C;  3B71 A;  4QDF A;  3FGA D;  4HM2 A;  2HMO A;  1SQX E;  3GF3 A;  4H44 B;  3AEA C;  3FOU A;  4H0L B;  3AE9 C;  1K04 A;  4YTP C;  1ZOY C;  1VL2 A;  2JO6 A;  3AZC A;  4QUR A;  1MKM A;  1UUW A;  4NBG D;  3AE2 C;  3H1K E;  4H13 C;  4YXD C;  3GZX A;  4Y28 J;  4EMJ B;  1YQ3 C;  2YFL A;  2YFJ A;  1KOR A;  3D89 A;  1S1C X;  1NYH A;  2FXP A;  1KMI Z;  1PPJ E;  1SQV E;  1O7H A;  4PV1 C;  2D2C D;  1TU3 F;  1NGM B;  1WQL A;  1Q90 C;  2BMO A;  5L8R J;  1NU1 E;  1SQQ E;  2E74 C;  3ABV C;  1FQT A;  2Q3W A;  2QJK C;  4U3F E;  4OGQ B;  2E75 C;  2B24 A;  1OW8 A;  2QIW A;  1U57 A;  2YFI A;  1KIL E;  3Q1M A;  2BCC E;  3GL2 A;  3H25 A;  4TT3 H;  1PL5 A;  1GMJ A;  3D70 A;  1KB9 E;  1SQB E;  2FYU E;  3L70 E;  3C0D A;  2XSO A;  2QPZ A;  5AEW A;  2JO1 A;  2HMN A;  4H44 C;  4HM5 A;  2ZT9 C;  1SJG A;  2QSI A;  1HF9 A;  3O6Q A;  3SFE C;  4HM7 A;  3GL0 A;  2NUM A;  1OW6 A;  4XFJ A;  1KQG B;  3L74 E;  1SQP E;  4HM6 A;  1VF5 D;  2D2C B;  1EZV E;  3H1L E;  2IBZ E;  3AE3 C;  1P84 E;  2XRX A;  1OMI A;  3AEB C;  4NBE D;  2G8Y A;  2P10 A;  2B1X A;  4QUQ A;  2NZ2 A;  2IDB A;  3VMG D;  1VCK A;  1WMK A;  2WSC J;  3H1J E;  1DD4 A;  2ZYL A;  1PV3 A;  2NVG A;  5HL4 A;  2WQY C;  4NBB D;  4HM8 A;  4QDF B;  4PD4 E;  2MKV A;  4OGQ C;  3L72 E;  2WSF J;  4NBD D;  4RKU J;  4NBC D;  4KT0 J;  2XR8 A;  5KLI C;  1ZP0 C;  3Q3D A;  2HML A;  3GLM A;  3Q5R A;  1KYO E;  4P1C H;  2NVE A;  3R4Y A;  2JZA A;  3Q5S A;  5KLV E;  1RIE A;  2E76 D;  3GKE A;  1O7P A;  2J5U A;  1ZME C;  2V7Q J;  4R4M A;  2QJY C;  3GF7 A;  2GBW A;  4NBH D;  5CXM A;  3GZY A;  3AEF C;  3D6Y A;  2NWF A;  4H13 D;  1O7W A;  2HMK A;  1BCC E;  3CWB E;  1PP9 E;  4I7Z B;  2XSH A;  2FBW C;  3AE8 C;  1EXI A;  3VCA A;  3GMA A;  2A06 E;  4PV1 D;  1Q90 D;  3GOB A;  2NUK A;  2E76 B;  1G8J B;  4H0L C;  2E74 D;  5AEU A;  4R4L A;  2WPV B;  4AAY B;  2E4P A;  2E75 D;  1Y9B A;  3DQY A;  1BE3 E;  1AJY A;  3D71 A;  3RL0 g;  4QDD A;  5M1B A;  4HJL A;  1KTM A;  3T97 B;  1L0N E;  1ULI A;  1OW7 A;  3AED C;  1NDO A;  4NB8 D;  4H44 D;  2K9Y A;  1JM1 A;  1NTZ E;  2ZT9 D;  3CXH E;  3IAO A;  3AE1 C;  3GTS A;  4HKV A;  3H1H E;  2GBX A;  4QUP A;  2E74 B;  3BCC E;  3AE5 C;  4Z1M H;  3Q2Y A;  2H88 C;  1JB0 J;  2HMJ A;  3AEG C;  4HM3 A;  1NYK A;  1VF5 B;  1UUV A;  1FDI A;  4GDO A;  1NTK E;  3GB4 A;  3AE6 C;  2ZT9 B;  1DIP A;  4IL6 X;  4NBF D;  4OGQ D;  2H89 C;  3TGU E;  2D2C C;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...