3DQYA

Crystal structure of toluene 2,3-dioxygenase ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
105
Chain Sequence
TWTYILRQGDLPPGEMQRYEGGPEPVMVCNVDGEFFAVQDTCTHGDWALSDGYLDGDIVECTLHFGKFVRTGKVKALPACKPIKVFPIKVEGDEVHVDLDNGELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene 1,2-dioxygenase system ferredoxin subunit
publication title Structures of the multicomponent Rieske non-heme iron toluene 2,3-dioxygenase enzyme system
pubmed doi rcsb
source organism Pseudomonas putida
total genus 18
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3dqyA00
4P1BH 2BCCE 1EG9A 3L71E 3VMID 2QPZA 2BMOA 3CXHE 2ZYLA 1BCCE 2YFJA 4NBAD 2HMLA 4HM7A 3AZCA 2DE5D 2A06E 2NVFA 4NBHD 1O7PA 3L74E 3GCEA 4HJLA 2NVEA 3H1LE 4QDDA 1PPJE 1NTME 5KLIC 2HMMA 3VCAA 2BMRA 2YFLA 2ZT9D 4HM2A 3VCPA 4QDFB 4H13D 1O7GA 4EMJB 4NBCD 1SQXE 4QDCA 2XSHA 3GZXA 3H1HE 1ZRTE 3GTSA 4QDFA 3C0DA 2E76D 4NBFD 4QURA 5KLVE 3GL2A 2JO6A 2E74D 2YIUC 4H44D 2FYNC 3L75E 1UUWA 2B1XA 3VMGD 4HM8A 1NTKE 4HM5A 4OGQD 3GB4A 1NTZE 1P84E 2YFIA 5KKZC 1BE3E 1NDOA 1FQTA 4NBDD 1VF5D 2NWFA 4AIVA 4NBGD 4P1CH 5AEUA 3GOBA 3L72E 4NBED 2XRXA 3H1KE 2DE6D 1ULJA 4HM4A 3FOUA 2QJPC 3EQQA 3H1JE 1SJGA 3TGUE 2B24A 4HKVA 2Q3WA 4U3FE 5AEWA 2YVJB 2NVGA 1L0LE 1SQVE 1O7MA 2IBZE 3D89A 3BCCE 3H1IE 4HM1A 4NBBD 1O7WA 1RIEA 2NUKA 1G8KB 2GBXA 4QCKA 1UUVA 3CX5E 1O7NA 1JM1A 1G8JB 1O7HA 3N0QA 2HMOA 1NU1E 5HL4A 3EN1A 2QJYC 3VMHD 2HMJA 2JZAA 2E4PA 2E75D 2HMNA 4HM6A 2D2CD 2NUMA 2CKFA 4HM3A 4QUPA 4NB9D 1NYKA 1VCKA 1KYOE 3GL0A 3DQYA 3GTEA 4H0LD 4PV1D 1Q90C 2HMKA 1SQQE 1EZVE 3L70E 1SQBE 2FYUE 1L0NE 3GZYA 2E4QA 2GBWA 1PP9E 1RFSA 2BMQA 3GKEA 4AAYB 2DE7D 4QUQA 2XSOA 2QJKC 4NB8D 3L73E 2I7FA 2XR8A 4PD4E 1SQPE 4HM0A 3CWBE 1WQLA 5CXMA 1VM9A 5BOKA 1ULIA 1KB9E
chains in the Genus database with same CATH superfamily
4P1BH 2BCCE 1EG9A 3L71E 3VMID 2QPZA 2BMOA 3CXHE 2ZYLA 1BCCE 2YFJA 4NBAD 2HMLA 4HM7A 3AZCA 2DE5D 2A06E 2NVFA 4NBHD 1O7PA 3L74E 3GCEA 4HJLA 2NVEA 3H1LE 4QDDA 1PPJE 1NTME 5KLIC 2HMMA 3VCAA 2BMRA 2YFLA 2ZT9D 4HM2A 3VCPA 4QDFB 4H13D 1O7GA 4EMJB 4NBCD 1SQXE 4QDCA 2XSHA 3GZXA 3H1HE 1ZRTE 3GTSA 4QDFA 3C0DA 2E76D 4NBFD 4QURA 5KLVE 3GL2A 2JO6A 2E74D 2YIUC 4H44D 2FYNC 3L75E 1UUWA 2B1XA 3VMGD 4HM8A 1NTKE 4HM5A 4OGQD 3GB4A 1NTZE 1P84E 2YFIA 5KKZC 1BE3E 1NDOA 1FQTA 4NBDD 1VF5D 2NWFA 4AIVA 4NBGD 4P1CH 5AEUA 3GOBA 3L72E 4NBED 2XRXA 3H1KE 2DE6D 1ULJA 4HM4A 3FOUA 2QJPC 3EQQA 3H1JE 1SJGA 3TGUE 2B24A 4HKVA 2Q3WA 4U3FE 5AEWA 2YVJB 2NVGA 1L0LE 1SQVE 1O7MA 2IBZE 3D89A 3BCCE 3H1IE 4HM1A 4NBBD 1O7WA 1RIEA 2NUKA 1G8KB 2GBXA 4QCKA 1UUVA 3CX5E 1O7NA 1JM1A 1G8JB 1O7HA 3N0QA 2HMOA 1NU1E 5HL4A 3EN1A 2QJYC 3VMHD 2HMJA 2JZAA 2E4PA 2E75D 2HMNA 4HM6A 2D2CD 2NUMA 2CKFA 4HM3A 4QUPA 4NB9D 1NYKA 1VCKA 1KYOE 3GL0A 3DQYA 3GTEA 4H0LD 4PV1D 1Q90C 2HMKA 1SQQE 1EZVE 3L70E 1SQBE 2FYUE 1L0NE 3GZYA 2E4QA 2GBWA 1PP9E 1RFSA 2BMQA 3GKEA 4AAYB 2DE7D 4QUQA 2XSOA 2QJKC 4NB8D 3L73E 2I7FA 2XR8A 4PD4E 1SQPE 4HM0A 3CWBE 1WQLA 5CXMA 1VM9A 5BOKA 1ULIA 1KB9E
chains in the Genus database with same CATH topology
4P1BH 2BCCE 1EG9A 3L71E 3VMID 2QPZA 2BMOA 3CXHE 2ZYLA 1BCCE 2YFJA 4NBAD 2HMLA 4HM7A 3AZCA 2DE5D 2A06E 2NVFA 4NBHD 1O7PA 3L74E 3GCEA 4HJLA 2NVEA 3H1LE 4QDDA 1PPJE 1NTME 5KLIC 2HMMA 3VCAA 2BMRA 2YFLA 2ZT9D 4HM2A 3VCPA 4QDFB 4H13D 1O7GA 4EMJB 4NBCD 1SQXE 4QDCA 2XSHA 3GZXA 3H1HE 1ZRTE 3GTSA 4QDFA 3C0DA 2E76D 4NBFD 4QURA 5KLVE 3GL2A 2JO6A 2E74D 2YIUC 4H44D 2FYNC 3L75E 1UUWA 2B1XA 3VMGD 4HM8A 1NTKE 4HM5A 4OGQD 3GB4A 1NTZE 1P84E 2YFIA 5KKZC 1BE3E 1NDOA 1FQTA 4NBDD 1VF5D 2NWFA 4AIVA 4NBGD 4P1CH 5AEUA 3GOBA 3L72E 4NBED 2XRXA 3H1KE 2DE6D 1ULJA 4HM4A 3FOUA 2QJPC 3EQQA 3H1JE 1SJGA 3TGUE 2B24A 4HKVA 2Q3WA 4U3FE 5AEWA 2YVJB 2NVGA 1L0LE 1SQVE 1O7MA 2IBZE 3D89A 3BCCE 3H1IE 4HM1A 4NBBD 1O7WA 1RIEA 2NUKA 1G8KB 2GBXA 4QCKA 1UUVA 3CX5E 1O7NA 1JM1A 1G8JB 1O7HA 3N0QA 2HMOA 1NU1E 5HL4A 3EN1A 2QJYC 3VMHD 2HMJA 2JZAA 2E4PA 2E75D 2HMNA 4HM6A 2D2CD 2NUMA 2CKFA 4HM3A 4QUPA 4NB9D 1NYKA 1VCKA 1KYOE 3GL0A 3DQYA 3GTEA 4H0LD 4PV1D 1Q90C 2HMKA 1SQQE 1EZVE 3L70E 1SQBE 2FYUE 1L0NE 3GZYA 2E4QA 2GBWA 1PP9E 1RFSA 2BMQA 3GKEA 4AAYB 2DE7D 4QUQA 2XSOA 2QJKC 4NB8D 3L73E 2I7FA 2XR8A 4PD4E 1SQPE 4HM0A 3CWBE 1WQLA 5CXMA 1VM9A 5BOKA 1ULIA 1KB9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B H;  2BCC E;  1EG9 A;  3L71 E;  3VMI D;  2QPZ A;  2BMO A;  3CXH E;  2ZYL A;  1BCC E;  2YFJ A;  4NBA D;  2HML A;  4HM7 A;  3AZC A;  2DE5 D;  2A06 E;  2NVF A;  4NBH D;  1O7P A;  3L74 E;  3GCE A;  4HJL A;  2NVE A;  3H1L E;  4QDD A;  1PPJ E;  1NTM E;  5KLI C;  2HMM A;  3VCA A;  2BMR A;  2YFL A;  2ZT9 D;  4HM2 A;  3VCP A;  4QDF B;  4H13 D;  1O7G A;  4EMJ B;  4NBC D;  1SQX E;  4QDC A;  2XSH A;  3GZX A;  3H1H E;  1ZRT E;  3GTS A;  4QDF A;  3C0D A;  2E76 D;  4NBF D;  4QUR A;  5KLV E;  3GL2 A;  2JO6 A;  2E74 D;  2YIU C;  4H44 D;  2FYN C;  3L75 E;  1UUW A;  2B1X A;  3VMG D;  4HM8 A;  1NTK E;  4HM5 A;  4OGQ D;  3GB4 A;  1NTZ E;  1P84 E;  2YFI A;  5KKZ C;  1BE3 E;  1NDO A;  1FQT A;  4NBD D;  1VF5 D;  2NWF A;  4AIV A;  4NBG D;  4P1C H;  5AEU A;  3GOB A;  3L72 E;  4NBE D;  2XRX A;  3H1K E;  2DE6 D;  1ULJ A;  4HM4 A;  3FOU A;  2QJP C;  3EQQ A;  3H1J E;  1SJG A;  3TGU E;  2B24 A;  4HKV A;  2Q3W A;  4U3F E;  5AEW A;  2YVJ B;  2NVG A;  1L0L E;  1SQV E;  1O7M A;  2IBZ E;  3D89 A;  3BCC E;  3H1I E;  4HM1 A;  4NBB D;  1O7W A;  1RIE A;  2NUK A;  1G8K B;  2GBX A;  4QCK A;  1UUV A;  3CX5 E;  1O7N A;  1JM1 A;  1G8J B;  1O7H A;  3N0Q A;  2HMO A;  1NU1 E;  5HL4 A;  3EN1 A;  2QJY C;  3VMH D;  2HMJ A;  2JZA A;  2E4P A;  2E75 D;  2HMN A;  4HM6 A;  2D2C D;  2NUM A;  2CKF A;  4HM3 A;  4QUP A;  4NB9 D;  1NYK A;  1VCK A;  1KYO E;  3GL0 A;  3DQY A;  3GTE A;  4H0L D;  4PV1 D;  1Q90 C;  2HMK A;  1SQQ E;  1EZV E;  3L70 E;  1SQB E;  2FYU E;  1L0N E;  3GZY A;  2E4Q A;  2GBW A;  1PP9 E;  1RFS A;  2BMQ A;  3GKE A;  4AAY B;  2DE7 D;  4QUQ A;  2XSO A;  2QJK C;  4NB8 D;  3L73 E;  2I7F A;  2XR8 A;  4PD4 E;  1SQP E;  4HM0 A;  3CWB E;  1WQL A;  5CXM A;  1VM9 A;  5BOK A;  1ULI A;  1KB9 E; 
#chains in the Genus database with same CATH topology
 4P1B H;  2BCC E;  1EG9 A;  3L71 E;  3VMI D;  2QPZ A;  2BMO A;  3CXH E;  2ZYL A;  1BCC E;  2YFJ A;  4NBA D;  2HML A;  4HM7 A;  3AZC A;  2DE5 D;  2A06 E;  2NVF A;  4NBH D;  1O7P A;  3L74 E;  3GCE A;  4HJL A;  2NVE A;  3H1L E;  4QDD A;  1PPJ E;  1NTM E;  5KLI C;  2HMM A;  3VCA A;  2BMR A;  2YFL A;  2ZT9 D;  4HM2 A;  3VCP A;  4QDF B;  4H13 D;  1O7G A;  4EMJ B;  4NBC D;  1SQX E;  4QDC A;  2XSH A;  3GZX A;  3H1H E;  1ZRT E;  3GTS A;  4QDF A;  3C0D A;  2E76 D;  4NBF D;  4QUR A;  5KLV E;  3GL2 A;  2JO6 A;  2E74 D;  2YIU C;  4H44 D;  2FYN C;  3L75 E;  1UUW A;  2B1X A;  3VMG D;  4HM8 A;  1NTK E;  4HM5 A;  4OGQ D;  3GB4 A;  1NTZ E;  1P84 E;  2YFI A;  5KKZ C;  1BE3 E;  1NDO A;  1FQT A;  4NBD D;  1VF5 D;  2NWF A;  4AIV A;  4NBG D;  4P1C H;  5AEU A;  3GOB A;  3L72 E;  4NBE D;  2XRX A;  3H1K E;  2DE6 D;  1ULJ A;  4HM4 A;  3FOU A;  2QJP C;  3EQQ A;  3H1J E;  1SJG A;  3TGU E;  2B24 A;  4HKV A;  2Q3W A;  4U3F E;  5AEW A;  2YVJ B;  2NVG A;  1L0L E;  1SQV E;  1O7M A;  2IBZ E;  3D89 A;  3BCC E;  3H1I E;  4HM1 A;  4NBB D;  1O7W A;  1RIE A;  2NUK A;  1G8K B;  2GBX A;  4QCK A;  1UUV A;  3CX5 E;  1O7N A;  1JM1 A;  1G8J B;  1O7H A;  3N0Q A;  2HMO A;  1NU1 E;  5HL4 A;  3EN1 A;  2QJY C;  3VMH D;  2HMJ A;  2JZA A;  2E4P A;  2E75 D;  2HMN A;  4HM6 A;  2D2C D;  2NUM A;  2CKF A;  4HM3 A;  4QUP A;  4NB9 D;  1NYK A;  1VCK A;  1KYO E;  3GL0 A;  3DQY A;  3GTE A;  4H0L D;  4PV1 D;  1Q90 C;  2HMK A;  1SQQ E;  1EZV E;  3L70 E;  1SQB E;  2FYU E;  1L0N E;  3GZY A;  2E4Q A;  2GBW A;  1PP9 E;  1RFS A;  2BMQ A;  3GKE A;  4AAY B;  2DE7 D;  4QUQ A;  2XSO A;  2QJK C;  4NB8 D;  3L73 E;  2I7F A;  2XR8 A;  4PD4 E;  1SQP E;  4HM0 A;  3CWB E;  1WQL A;  5CXM A;  1VM9 A;  5BOK A;  1ULI A;  1KB9 E; 
#chains in the Genus database with same CATH homology
 4P1B H;  2BCC E;  1EG9 A;  3L71 E;  3VMI D;  2QPZ A;  2BMO A;  3CXH E;  2ZYL A;  1BCC E;  2YFJ A;  4NBA D;  2HML A;  4HM7 A;  3AZC A;  2DE5 D;  2A06 E;  2NVF A;  4NBH D;  1O7P A;  3L74 E;  3GCE A;  4HJL A;  2NVE A;  3H1L E;  4QDD A;  1PPJ E;  1NTM E;  5KLI C;  2HMM A;  3VCA A;  2BMR A;  2YFL A;  2ZT9 D;  4HM2 A;  3VCP A;  4QDF B;  4H13 D;  1O7G A;  4EMJ B;  4NBC D;  1SQX E;  4QDC A;  2XSH A;  3GZX A;  3H1H E;  1ZRT E;  3GTS A;  4QDF A;  3C0D A;  2E76 D;  4NBF D;  4QUR A;  5KLV E;  3GL2 A;  2JO6 A;  2E74 D;  2YIU C;  4H44 D;  2FYN C;  3L75 E;  1UUW A;  2B1X A;  3VMG D;  4HM8 A;  1NTK E;  4HM5 A;  4OGQ D;  3GB4 A;  1NTZ E;  1P84 E;  2YFI A;  5KKZ C;  1BE3 E;  1NDO A;  1FQT A;  4NBD D;  1VF5 D;  2NWF A;  4AIV A;  4NBG D;  4P1C H;  5AEU A;  3GOB A;  3L72 E;  4NBE D;  2XRX A;  3H1K E;  2DE6 D;  1ULJ A;  4HM4 A;  3FOU A;  2QJP C;  3EQQ A;  3H1J E;  1SJG A;  3TGU E;  2B24 A;  4HKV A;  2Q3W A;  4U3F E;  5AEW A;  2YVJ B;  2NVG A;  1L0L E;  1SQV E;  1O7M A;  2IBZ E;  3D89 A;  3BCC E;  3H1I E;  4HM1 A;  4NBB D;  1O7W A;  1RIE A;  2NUK A;  1G8K B;  2GBX A;  4QCK A;  1UUV A;  3CX5 E;  1O7N A;  1JM1 A;  1G8J B;  1O7H A;  3N0Q A;  2HMO A;  1NU1 E;  5HL4 A;  3EN1 A;  2QJY C;  3VMH D;  2HMJ A;  2JZA A;  2E4P A;  2E75 D;  2HMN A;  4HM6 A;  2D2C D;  2NUM A;  2CKF A;  4HM3 A;  4QUP A;  4NB9 D;  1NYK A;  1VCK A;  1KYO E;  3GL0 A;  3DQY A;  3GTE A;  4H0L D;  4PV1 D;  1Q90 C;  2HMK A;  1SQQ E;  1EZV E;  3L70 E;  1SQB E;  2FYU E;  1L0N E;  3GZY A;  2E4Q A;  2GBW A;  1PP9 E;  1RFS A;  2BMQ A;  3GKE A;  4AAY B;  2DE7 D;  4QUQ A;  2XSO A;  2QJK C;  4NB8 D;  3L73 E;  2I7F A;  2XR8 A;  4PD4 E;  1SQP E;  4HM0 A;  3CWB E;  1WQL A;  5CXM A;  1VM9 A;  5BOK A;  1ULI A;  1KB9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...