3DQYA

Crystal structure of toluene 2,3-dioxygenase ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
105
Chain Sequence
TWTYILRQGDLPPGEMQRYEGGPEPVMVCNVDGEFFAVQDTCTHGDWALSDGYLDGDIVECTLHFGKFVRTGKVKALPACKPIKVFPIKVEGDEVHVDLDNGELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the multicomponent Rieske non-heme iron toluene 2,3-dioxygenase enzyme system
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords Toluene 1,2-dioxygenase system ferredoxin subunit
total genus 18
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3dqyA00
1NTME 1WQLA 2BMQA 4AAYB 1G8JB 2I7FA 1NTKE 2DE5D 3GTSA 2B24A 1SQVE 3AZCA 4NBDD 4QDFB 4NBGD 3H1JE 1BCCE 2JZAA 2QJYC 2HMLA 3GKEA 4P1BH 4H44D 3EN1A 4NBAD 1NDOA 3GOBA 1UUVA 5HL4A 3CXHE 4HM0A 4HM5A 4QDCA 4AIVA 2YIUC 1SQBE 3L70E 3GCEA 4PV1D 4OGQD 2E75D 1VCKA 4NBHD 4QDFA 4H0LD 1PPJE 1SQQE 1O7GA 3VMGD 2JO6A 2Q3WA 3GL2A 4QURA 1KYOE 1O7MA 2YFIA 1PP9E 4NBBD 3GB4A 3C0DA 2CKFA 2BMRA 2GBXA 2HMMA 3D89A 4HM6A 3GZYA 1BE3E 3VCPA 3CWBE 3GZXA 4QUQA 2QPZA 1VF5D 5KLVE 4NB9D 4EMJB 1O7HA 2IBZE 3H1IE 4HM3A 3VMID 3EQQA 4HM8A 1O7NA 3L71E 4HM2A 3L73E 4QUPA 4NB8D 4HM4A 3TGUE 4HM7A 1NYKA 1KB9E 2YFLA 3CX5E 1L0NE 2E74D 2QJPC 3L75E 4QDDA 1SJGA 2HMNA 1VM9A 2FYUE 2HMOA 2XR8A 4QCKA 5KLIC 5AEWA 2NVGA 1G8KB 1UUWA 4U3FE 1O7PA 2XSHA 2NWFA 2NVEA 2XSOA 1EZVE 4H13D 4PD4E 2HMJA 2DE6D 4NBED 2A06E 2B1XA 4HKVA 1SQXE 1NTZE 5AEUA 3H1LE 3GL0A 1O7WA 2BCCE 3BCCE 1JM1A 2NUMA 2E76D 4P1CH 2XRXA 3L74E 2GBWA 2BMOA 1Q90C 2HMKA 3VCAA 1EG9A 3H1KE 4HJLA 2NVFA 1RFSA 1SQPE 2NUKA 2FYNC 4NBCD 1ULIA 4NBFD 3L72E 5BOKA 1ULJA 1RIEA 1FQTA 1NU1E 2E4QA 5CXMA 1L0LE 2D2CD 2QJKC 3VMHD 2ZT9D 1P84E 3GTEA 2DE7D 3N0QA 2YFJA 1ZRTE 2YVJB 3FOUA 4HM1A 5KKZC 3H1HE 2E4PA 2ZYLA 3DQYA
chains in the Genus database with same CATH superfamily
1NTME 1WQLA 2BMQA 4AAYB 1G8JB 2I7FA 1NTKE 2DE5D 3GTSA 2B24A 1SQVE 3AZCA 4NBDD 4QDFB 4NBGD 3H1JE 1BCCE 2JZAA 2QJYC 2HMLA 3GKEA 4P1BH 4H44D 3EN1A 4NBAD 1NDOA 3GOBA 1UUVA 5HL4A 3CXHE 4HM0A 4HM5A 4QDCA 4AIVA 2YIUC 1SQBE 3L70E 3GCEA 4PV1D 4OGQD 2E75D 1VCKA 4NBHD 4QDFA 4H0LD 1PPJE 1SQQE 1O7GA 3VMGD 2JO6A 2Q3WA 3GL2A 4QURA 1KYOE 1O7MA 2YFIA 1PP9E 4NBBD 3GB4A 3C0DA 2CKFA 2BMRA 2GBXA 2HMMA 3D89A 4HM6A 3GZYA 1BE3E 3VCPA 3CWBE 3GZXA 4QUQA 2QPZA 1VF5D 5KLVE 4NB9D 4EMJB 1O7HA 2IBZE 3H1IE 4HM3A 3VMID 3EQQA 4HM8A 1O7NA 3L71E 4HM2A 3L73E 4QUPA 4NB8D 4HM4A 3TGUE 4HM7A 1NYKA 1KB9E 2YFLA 3CX5E 1L0NE 2E74D 2QJPC 3L75E 4QDDA 1SJGA 2HMNA 1VM9A 2FYUE 2HMOA 2XR8A 4QCKA 5KLIC 5AEWA 2NVGA 1G8KB 1UUWA 4U3FE 1O7PA 2XSHA 2NWFA 2NVEA 2XSOA 1EZVE 4H13D 4PD4E 2HMJA 2DE6D 4NBED 2A06E 2B1XA 4HKVA 1SQXE 1NTZE 5AEUA 3H1LE 3GL0A 1O7WA 2BCCE 3BCCE 1JM1A 2NUMA 2E76D 4P1CH 2XRXA 3L74E 2GBWA 2BMOA 1Q90C 2HMKA 3VCAA 1EG9A 3H1KE 4HJLA 2NVFA 1RFSA 1SQPE 2NUKA 2FYNC 4NBCD 1ULIA 4NBFD 3L72E 5BOKA 1ULJA 1RIEA 1FQTA 1NU1E 2E4QA 5CXMA 1L0LE 2D2CD 2QJKC 3VMHD 2ZT9D 1P84E 3GTEA 2DE7D 3N0QA 2YFJA 1ZRTE 2YVJB 3FOUA 4HM1A 5KKZC 3H1HE 2E4PA 2ZYLA 3DQYA
chains in the Genus database with same CATH topology
1NTME 1WQLA 2BMQA 4AAYB 1G8JB 2I7FA 1NTKE 2DE5D 3GTSA 2B24A 1SQVE 3AZCA 4NBDD 4QDFB 4NBGD 3H1JE 1BCCE 2JZAA 2QJYC 2HMLA 3GKEA 4P1BH 4H44D 3EN1A 4NBAD 1NDOA 3GOBA 1UUVA 5HL4A 3CXHE 4HM0A 4HM5A 4QDCA 4AIVA 2YIUC 1SQBE 3L70E 3GCEA 4PV1D 4OGQD 2E75D 1VCKA 4NBHD 4QDFA 4H0LD 1PPJE 1SQQE 1O7GA 3VMGD 2JO6A 2Q3WA 3GL2A 4QURA 1KYOE 1O7MA 2YFIA 1PP9E 4NBBD 3GB4A 3C0DA 2CKFA 2BMRA 2GBXA 2HMMA 3D89A 4HM6A 3GZYA 1BE3E 3VCPA 3CWBE 3GZXA 4QUQA 2QPZA 1VF5D 5KLVE 4NB9D 4EMJB 1O7HA 2IBZE 3H1IE 4HM3A 3VMID 3EQQA 4HM8A 1O7NA 3L71E 4HM2A 3L73E 4QUPA 4NB8D 4HM4A 3TGUE 4HM7A 1NYKA 1KB9E 2YFLA 3CX5E 1L0NE 2E74D 2QJPC 3L75E 4QDDA 1SJGA 2HMNA 1VM9A 2FYUE 2HMOA 2XR8A 4QCKA 5KLIC 5AEWA 2NVGA 1G8KB 1UUWA 4U3FE 1O7PA 2XSHA 2NWFA 2NVEA 2XSOA 1EZVE 4H13D 4PD4E 2HMJA 2DE6D 4NBED 2A06E 2B1XA 4HKVA 1SQXE 1NTZE 5AEUA 3H1LE 3GL0A 1O7WA 2BCCE 3BCCE 1JM1A 2NUMA 2E76D 4P1CH 2XRXA 3L74E 2GBWA 2BMOA 1Q90C 2HMKA 3VCAA 1EG9A 3H1KE 4HJLA 2NVFA 1RFSA 1SQPE 2NUKA 2FYNC 4NBCD 1ULIA 4NBFD 3L72E 5BOKA 1ULJA 1RIEA 1FQTA 1NU1E 2E4QA 5CXMA 1L0LE 2D2CD 2QJKC 3VMHD 2ZT9D 1P84E 3GTEA 2DE7D 3N0QA 2YFJA 1ZRTE 2YVJB 3FOUA 4HM1A 5KKZC 3H1HE 2E4PA 2ZYLA 3DQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM E;  1WQL A;  2BMQ A;  4AAY B;  1G8J B;  2I7F A;  1NTK E;  2DE5 D;  3GTS A;  2B24 A;  1SQV E;  3AZC A;  4NBD D;  4QDF B;  4NBG D;  3H1J E;  1BCC E;  2JZA A;  2QJY C;  2HML A;  3GKE A;  4P1B H;  4H44 D;  3EN1 A;  4NBA D;  1NDO A;  3GOB A;  1UUV A;  5HL4 A;  3CXH E;  4HM0 A;  4HM5 A;  4QDC A;  4AIV A;  2YIU C;  1SQB E;  3L70 E;  3GCE A;  4PV1 D;  4OGQ D;  2E75 D;  1VCK A;  4NBH D;  4QDF A;  4H0L D;  1PPJ E;  1SQQ E;  1O7G A;  3VMG D;  2JO6 A;  2Q3W A;  3GL2 A;  4QUR A;  1KYO E;  1O7M A;  2YFI A;  1PP9 E;  4NBB D;  3GB4 A;  3C0D A;  2CKF A;  2BMR A;  2GBX A;  2HMM A;  3D89 A;  4HM6 A;  3GZY A;  1BE3 E;  3VCP A;  3CWB E;  3GZX A;  4QUQ A;  2QPZ A;  1VF5 D;  5KLV E;  4NB9 D;  4EMJ B;  1O7H A;  2IBZ E;  3H1I E;  4HM3 A;  3VMI D;  3EQQ A;  4HM8 A;  1O7N A;  3L71 E;  4HM2 A;  3L73 E;  4QUP A;  4NB8 D;  4HM4 A;  3TGU E;  4HM7 A;  1NYK A;  1KB9 E;  2YFL A;  3CX5 E;  1L0N E;  2E74 D;  2QJP C;  3L75 E;  4QDD A;  1SJG A;  2HMN A;  1VM9 A;  2FYU E;  2HMO A;  2XR8 A;  4QCK A;  5KLI C;  5AEW A;  2NVG A;  1G8K B;  1UUW A;  4U3F E;  1O7P A;  2XSH A;  2NWF A;  2NVE A;  2XSO A;  1EZV E;  4H13 D;  4PD4 E;  2HMJ A;  2DE6 D;  4NBE D;  2A06 E;  2B1X A;  4HKV A;  1SQX E;  1NTZ E;  5AEU A;  3H1L E;  3GL0 A;  1O7W A;  2BCC E;  3BCC E;  1JM1 A;  2NUM A;  2E76 D;  4P1C H;  2XRX A;  3L74 E;  2GBW A;  2BMO A;  1Q90 C;  2HMK A;  3VCA A;  1EG9 A;  3H1K E;  4HJL A;  2NVF A;  1RFS A;  1SQP E;  2NUK A;  2FYN C;  4NBC D;  1ULI A;  4NBF D;  3L72 E;  5BOK A;  1ULJ A;  1RIE A;  1FQT A;  1NU1 E;  2E4Q A;  5CXM A;  1L0L E;  2D2C D;  2QJK C;  3VMH D;  2ZT9 D;  1P84 E;  3GTE A;  2DE7 D;  3N0Q A;  2YFJ A;  1ZRT E;  2YVJ B;  3FOU A;  4HM1 A;  5KKZ C;  3H1H E;  2E4P A;  2ZYL A;  3DQY A; 
#chains in the Genus database with same CATH topology
 1NTM E;  1WQL A;  2BMQ A;  4AAY B;  1G8J B;  2I7F A;  1NTK E;  2DE5 D;  3GTS A;  2B24 A;  1SQV E;  3AZC A;  4NBD D;  4QDF B;  4NBG D;  3H1J E;  1BCC E;  2JZA A;  2QJY C;  2HML A;  3GKE A;  4P1B H;  4H44 D;  3EN1 A;  4NBA D;  1NDO A;  3GOB A;  1UUV A;  5HL4 A;  3CXH E;  4HM0 A;  4HM5 A;  4QDC A;  4AIV A;  2YIU C;  1SQB E;  3L70 E;  3GCE A;  4PV1 D;  4OGQ D;  2E75 D;  1VCK A;  4NBH D;  4QDF A;  4H0L D;  1PPJ E;  1SQQ E;  1O7G A;  3VMG D;  2JO6 A;  2Q3W A;  3GL2 A;  4QUR A;  1KYO E;  1O7M A;  2YFI A;  1PP9 E;  4NBB D;  3GB4 A;  3C0D A;  2CKF A;  2BMR A;  2GBX A;  2HMM A;  3D89 A;  4HM6 A;  3GZY A;  1BE3 E;  3VCP A;  3CWB E;  3GZX A;  4QUQ A;  2QPZ A;  1VF5 D;  5KLV E;  4NB9 D;  4EMJ B;  1O7H A;  2IBZ E;  3H1I E;  4HM3 A;  3VMI D;  3EQQ A;  4HM8 A;  1O7N A;  3L71 E;  4HM2 A;  3L73 E;  4QUP A;  4NB8 D;  4HM4 A;  3TGU E;  4HM7 A;  1NYK A;  1KB9 E;  2YFL A;  3CX5 E;  1L0N E;  2E74 D;  2QJP C;  3L75 E;  4QDD A;  1SJG A;  2HMN A;  1VM9 A;  2FYU E;  2HMO A;  2XR8 A;  4QCK A;  5KLI C;  5AEW A;  2NVG A;  1G8K B;  1UUW A;  4U3F E;  1O7P A;  2XSH A;  2NWF A;  2NVE A;  2XSO A;  1EZV E;  4H13 D;  4PD4 E;  2HMJ A;  2DE6 D;  4NBE D;  2A06 E;  2B1X A;  4HKV A;  1SQX E;  1NTZ E;  5AEU A;  3H1L E;  3GL0 A;  1O7W A;  2BCC E;  3BCC E;  1JM1 A;  2NUM A;  2E76 D;  4P1C H;  2XRX A;  3L74 E;  2GBW A;  2BMO A;  1Q90 C;  2HMK A;  3VCA A;  1EG9 A;  3H1K E;  4HJL A;  2NVF A;  1RFS A;  1SQP E;  2NUK A;  2FYN C;  4NBC D;  1ULI A;  4NBF D;  3L72 E;  5BOK A;  1ULJ A;  1RIE A;  1FQT A;  1NU1 E;  2E4Q A;  5CXM A;  1L0L E;  2D2C D;  2QJK C;  3VMH D;  2ZT9 D;  1P84 E;  3GTE A;  2DE7 D;  3N0Q A;  2YFJ A;  1ZRT E;  2YVJ B;  3FOU A;  4HM1 A;  5KKZ C;  3H1H E;  2E4P A;  2ZYL A;  3DQY A; 
#chains in the Genus database with same CATH homology
 1NTM E;  1WQL A;  2BMQ A;  4AAY B;  1G8J B;  2I7F A;  1NTK E;  2DE5 D;  3GTS A;  2B24 A;  1SQV E;  3AZC A;  4NBD D;  4QDF B;  4NBG D;  3H1J E;  1BCC E;  2JZA A;  2QJY C;  2HML A;  3GKE A;  4P1B H;  4H44 D;  3EN1 A;  4NBA D;  1NDO A;  3GOB A;  1UUV A;  5HL4 A;  3CXH E;  4HM0 A;  4HM5 A;  4QDC A;  4AIV A;  2YIU C;  1SQB E;  3L70 E;  3GCE A;  4PV1 D;  4OGQ D;  2E75 D;  1VCK A;  4NBH D;  4QDF A;  4H0L D;  1PPJ E;  1SQQ E;  1O7G A;  3VMG D;  2JO6 A;  2Q3W A;  3GL2 A;  4QUR A;  1KYO E;  1O7M A;  2YFI A;  1PP9 E;  4NBB D;  3GB4 A;  3C0D A;  2CKF A;  2BMR A;  2GBX A;  2HMM A;  3D89 A;  4HM6 A;  3GZY A;  1BE3 E;  3VCP A;  3CWB E;  3GZX A;  4QUQ A;  2QPZ A;  1VF5 D;  5KLV E;  4NB9 D;  4EMJ B;  1O7H A;  2IBZ E;  3H1I E;  4HM3 A;  3VMI D;  3EQQ A;  4HM8 A;  1O7N A;  3L71 E;  4HM2 A;  3L73 E;  4QUP A;  4NB8 D;  4HM4 A;  3TGU E;  4HM7 A;  1NYK A;  1KB9 E;  2YFL A;  3CX5 E;  1L0N E;  2E74 D;  2QJP C;  3L75 E;  4QDD A;  1SJG A;  2HMN A;  1VM9 A;  2FYU E;  2HMO A;  2XR8 A;  4QCK A;  5KLI C;  5AEW A;  2NVG A;  1G8K B;  1UUW A;  4U3F E;  1O7P A;  2XSH A;  2NWF A;  2NVE A;  2XSO A;  1EZV E;  4H13 D;  4PD4 E;  2HMJ A;  2DE6 D;  4NBE D;  2A06 E;  2B1X A;  4HKV A;  1SQX E;  1NTZ E;  5AEU A;  3H1L E;  3GL0 A;  1O7W A;  2BCC E;  3BCC E;  1JM1 A;  2NUM A;  2E76 D;  4P1C H;  2XRX A;  3L74 E;  2GBW A;  2BMO A;  1Q90 C;  2HMK A;  3VCA A;  1EG9 A;  3H1K E;  4HJL A;  2NVF A;  1RFS A;  1SQP E;  2NUK A;  2FYN C;  4NBC D;  1ULI A;  4NBF D;  3L72 E;  5BOK A;  1ULJ A;  1RIE A;  1FQT A;  1NU1 E;  2E4Q A;  5CXM A;  1L0L E;  2D2C D;  2QJK C;  3VMH D;  2ZT9 D;  1P84 E;  3GTE A;  2DE7 D;  3N0Q A;  2YFJ A;  1ZRT E;  2YVJ B;  3FOU A;  4HM1 A;  5KKZ C;  3H1H E;  2E4P A;  2ZYL A;  3DQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...