3DQYA

Crystal structure of toluene 2,3-dioxygenase ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
106
structure length
105
Chain Sequence
b'TWTYILRQGDLPPGEMQRYEGGPEPVMVCNVDGEFFAVQDTCTHGDWALSDGYLDGDIVECTLHFGKFVRTGKVKALPACKPIKVFPIKVEGDEVHVDLDNGELK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene 1,2-dioxygenase system ferredoxin subunit
publication title Structures of the multicomponent Rieske non-heme iron toluene 2,3-dioxygenase enzyme system
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 18
structure length 105
sequence length 106
ec nomenclature
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3dqyA00
4NBED 1RFSA 1O7NA 2YVJB 1NTKE 5KKZC 3FOUA 4NBCD 2E4QA 4EMJB 2NVFA 3GZXA 4NBBD 1RIEA 1ULIA 3GL2A 3L74E 2NUKA 3L72E 3GKEA 4HM6A 3CXHE 3VCAA 2BCCE 2XRXA 4HJLA 4H44D 1SQQE 4HM3A 1G8KB 1O7PA 2BMQA 2QJPC 4HM7A 4HM0A 4QDFA 3H1HE 2HMOA 1VM9A 4NB9D 3VCPA 1L0NE 1FQTA 5AEUA 2IBZE 4HM8A 1L0LE 4NB8D 1O7MA 1SQXE 1SQPE 2XR8A 3N0QA 4H13D 4QUQA 5CXMA 2BMRA 2I7FA 2YFJA 3DQYA 3GTSA 4U3FE 1Q90C 1UUWA 1NDOA 2B1XA 3L71E 2HMJA 2QPZA 4P1CH 1EG9A 2XSOA 3D89A 4HM1A 4HM5A 4NBDD 2NVEA 3C0DA 3CX5E 3VMID 2DE5D 3H1KE 3L70E 3EQQA 2FYNC 3EN1A 3CWBE 1SQBE 1SJGA 1O7WA 3GOBA 2XSHA 3H1IE 2YFLA 4NBGD 1ULJA 2GBXA 3H1LE 1NU1E 2JZAA 4OGQD 1PP9E 3L75E 1WQLA 4AAYB 5KLVE 2A06E 2D2CD 4QURA 4QUPA 2YIUC 3GB4A 2BMOA 2HMLA 3BCCE 3GL0A 1O7HA 2HMMA 2E74D 1EZVE 3TGUE 1VCKA 4NBHD 1KYOE 1O7GA 1NYKA 2DE6D 2Q3WA 4HKVA 1BCCE 2ZT9D 4QCKA 2JO6A 1SQVE 2HMNA 2E76D 1NTZE 4QDCA 2DE7D 4HM4A 2GBWA 4HM2A 3L73E 4NBAD 2E75D 2YFIA 5AEWA 3GTEA 3AZCA 1G8JB 3H1JE 2E4PA 4P1BH 4PV1D 4QDFB 1JM1A 2HMKA 4H0LD 4PD4E 2QJYC 2NUMA 4AIVA 2B24A 5BOKA 1P84E 2NWFA 1BE3E 2QJKC 2NVGA 1ZRTE 5HL4A 4QDDA 5KLIC 1VF5D 2ZYLA 3VMHD 4NBFD 2CKFA 3VMGD 2FYUE 3GCEA 1PPJE 1UUVA 1KB9E 1NTME 3GZYA
chains in the Genus database with same CATH superfamily
4NBED 1RFSA 1O7NA 2YVJB 1NTKE 5KKZC 3FOUA 4NBCD 2E4QA 4EMJB 2NVFA 3GZXA 4NBBD 1RIEA 1ULIA 3GL2A 3L74E 2NUKA 3L72E 3GKEA 4HM6A 3CXHE 3VCAA 2BCCE 2XRXA 4HJLA 4H44D 1SQQE 4HM3A 1G8KB 1O7PA 2BMQA 2QJPC 4HM7A 4HM0A 4QDFA 3H1HE 2HMOA 1VM9A 4NB9D 3VCPA 1L0NE 1FQTA 5AEUA 2IBZE 4HM8A 1L0LE 4NB8D 1O7MA 1SQXE 1SQPE 2XR8A 3N0QA 4H13D 4QUQA 5CXMA 2BMRA 2I7FA 2YFJA 3DQYA 3GTSA 4U3FE 1Q90C 1UUWA 1NDOA 2B1XA 3L71E 2HMJA 2QPZA 4P1CH 1EG9A 2XSOA 3D89A 4HM1A 4HM5A 4NBDD 2NVEA 3C0DA 3CX5E 3VMID 2DE5D 3H1KE 3L70E 3EQQA 2FYNC 3EN1A 3CWBE 1SQBE 1SJGA 1O7WA 3GOBA 2XSHA 3H1IE 2YFLA 4NBGD 1ULJA 2GBXA 3H1LE 1NU1E 2JZAA 4OGQD 1PP9E 3L75E 1WQLA 4AAYB 5KLVE 2A06E 2D2CD 4QURA 4QUPA 2YIUC 3GB4A 2BMOA 2HMLA 3BCCE 3GL0A 1O7HA 2HMMA 2E74D 1EZVE 3TGUE 1VCKA 4NBHD 1KYOE 1O7GA 1NYKA 2DE6D 2Q3WA 4HKVA 1BCCE 2ZT9D 4QCKA 2JO6A 1SQVE 2HMNA 2E76D 1NTZE 4QDCA 2DE7D 4HM4A 2GBWA 4HM2A 3L73E 4NBAD 2E75D 2YFIA 5AEWA 3GTEA 3AZCA 1G8JB 3H1JE 2E4PA 4P1BH 4PV1D 4QDFB 1JM1A 2HMKA 4H0LD 4PD4E 2QJYC 2NUMA 4AIVA 2B24A 5BOKA 1P84E 2NWFA 1BE3E 2QJKC 2NVGA 1ZRTE 5HL4A 4QDDA 5KLIC 1VF5D 2ZYLA 3VMHD 4NBFD 2CKFA 3VMGD 2FYUE 3GCEA 1PPJE 1UUVA 1KB9E 1NTME 3GZYA
chains in the Genus database with same CATH topology
4NBED 1RFSA 1O7NA 2YVJB 1NTKE 5KKZC 3FOUA 4NBCD 2E4QA 4EMJB 2NVFA 3GZXA 4NBBD 1RIEA 1ULIA 3GL2A 3L74E 2NUKA 3L72E 3GKEA 4HM6A 3CXHE 3VCAA 2BCCE 2XRXA 4HJLA 4H44D 1SQQE 4HM3A 1G8KB 1O7PA 2BMQA 2QJPC 4HM7A 4HM0A 4QDFA 3H1HE 2HMOA 1VM9A 4NB9D 3VCPA 1L0NE 1FQTA 5AEUA 2IBZE 4HM8A 1L0LE 4NB8D 1O7MA 1SQXE 1SQPE 2XR8A 3N0QA 4H13D 4QUQA 5CXMA 2BMRA 2I7FA 2YFJA 3DQYA 3GTSA 4U3FE 1Q90C 1UUWA 1NDOA 2B1XA 3L71E 2HMJA 2QPZA 4P1CH 1EG9A 2XSOA 3D89A 4HM1A 4HM5A 4NBDD 2NVEA 3C0DA 3CX5E 3VMID 2DE5D 3H1KE 3L70E 3EQQA 2FYNC 3EN1A 3CWBE 1SQBE 1SJGA 1O7WA 3GOBA 2XSHA 3H1IE 2YFLA 4NBGD 1ULJA 2GBXA 3H1LE 1NU1E 2JZAA 4OGQD 1PP9E 3L75E 1WQLA 4AAYB 5KLVE 2A06E 2D2CD 4QURA 4QUPA 2YIUC 3GB4A 2BMOA 2HMLA 3BCCE 3GL0A 1O7HA 2HMMA 2E74D 1EZVE 3TGUE 1VCKA 4NBHD 1KYOE 1O7GA 1NYKA 2DE6D 2Q3WA 4HKVA 1BCCE 2ZT9D 4QCKA 2JO6A 1SQVE 2HMNA 2E76D 1NTZE 4QDCA 2DE7D 4HM4A 2GBWA 4HM2A 3L73E 4NBAD 2E75D 2YFIA 5AEWA 3GTEA 3AZCA 1G8JB 3H1JE 2E4PA 4P1BH 4PV1D 4QDFB 1JM1A 2HMKA 4H0LD 4PD4E 2QJYC 2NUMA 4AIVA 2B24A 5BOKA 1P84E 2NWFA 1BE3E 2QJKC 2NVGA 1ZRTE 5HL4A 4QDDA 5KLIC 1VF5D 2ZYLA 3VMHD 4NBFD 2CKFA 3VMGD 2FYUE 3GCEA 1PPJE 1UUVA 1KB9E 1NTME 3GZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBE D;  1RFS A;  1O7N A;  2YVJ B;  1NTK E;  5KKZ C;  3FOU A;  4NBC D;  2E4Q A;  4EMJ B;  2NVF A;  3GZX A;  4NBB D;  1RIE A;  1ULI A;  3GL2 A;  3L74 E;  2NUK A;  3L72 E;  3GKE A;  4HM6 A;  3CXH E;  3VCA A;  2BCC E;  2XRX A;  4HJL A;  4H44 D;  1SQQ E;  4HM3 A;  1G8K B;  1O7P A;  2BMQ A;  2QJP C;  4HM7 A;  4HM0 A;  4QDF A;  3H1H E;  2HMO A;  1VM9 A;  4NB9 D;  3VCP A;  1L0N E;  1FQT A;  5AEU A;  2IBZ E;  4HM8 A;  1L0L E;  4NB8 D;  1O7M A;  1SQX E;  1SQP E;  2XR8 A;  3N0Q A;  4H13 D;  4QUQ A;  5CXM A;  2BMR A;  2I7F A;  2YFJ A;  3DQY A;  3GTS A;  4U3F E;  1Q90 C;  1UUW A;  1NDO A;  2B1X A;  3L71 E;  2HMJ A;  2QPZ A;  4P1C H;  1EG9 A;  2XSO A;  3D89 A;  4HM1 A;  4HM5 A;  4NBD D;  2NVE A;  3C0D A;  3CX5 E;  3VMI D;  2DE5 D;  3H1K E;  3L70 E;  3EQQ A;  2FYN C;  3EN1 A;  3CWB E;  1SQB E;  1SJG A;  1O7W A;  3GOB A;  2XSH A;  3H1I E;  2YFL A;  4NBG D;  1ULJ A;  2GBX A;  3H1L E;  1NU1 E;  2JZA A;  4OGQ D;  1PP9 E;  3L75 E;  1WQL A;  4AAY B;  5KLV E;  2A06 E;  2D2C D;  4QUR A;  4QUP A;  2YIU C;  3GB4 A;  2BMO A;  2HML A;  3BCC E;  3GL0 A;  1O7H A;  2HMM A;  2E74 D;  1EZV E;  3TGU E;  1VCK A;  4NBH D;  1KYO E;  1O7G A;  1NYK A;  2DE6 D;  2Q3W A;  4HKV A;  1BCC E;  2ZT9 D;  4QCK A;  2JO6 A;  1SQV E;  2HMN A;  2E76 D;  1NTZ E;  4QDC A;  2DE7 D;  4HM4 A;  2GBW A;  4HM2 A;  3L73 E;  4NBA D;  2E75 D;  2YFI A;  5AEW A;  3GTE A;  3AZC A;  1G8J B;  3H1J E;  2E4P A;  4P1B H;  4PV1 D;  4QDF B;  1JM1 A;  2HMK A;  4H0L D;  4PD4 E;  2QJY C;  2NUM A;  4AIV A;  2B24 A;  5BOK A;  1P84 E;  2NWF A;  1BE3 E;  2QJK C;  2NVG A;  1ZRT E;  5HL4 A;  4QDD A;  5KLI C;  1VF5 D;  2ZYL A;  3VMH D;  4NBF D;  2CKF A;  3VMG D;  2FYU E;  3GCE A;  1PPJ E;  1UUV A;  1KB9 E;  1NTM E;  3GZY A; 
#chains in the Genus database with same CATH topology
 4NBE D;  1RFS A;  1O7N A;  2YVJ B;  1NTK E;  5KKZ C;  3FOU A;  4NBC D;  2E4Q A;  4EMJ B;  2NVF A;  3GZX A;  4NBB D;  1RIE A;  1ULI A;  3GL2 A;  3L74 E;  2NUK A;  3L72 E;  3GKE A;  4HM6 A;  3CXH E;  3VCA A;  2BCC E;  2XRX A;  4HJL A;  4H44 D;  1SQQ E;  4HM3 A;  1G8K B;  1O7P A;  2BMQ A;  2QJP C;  4HM7 A;  4HM0 A;  4QDF A;  3H1H E;  2HMO A;  1VM9 A;  4NB9 D;  3VCP A;  1L0N E;  1FQT A;  5AEU A;  2IBZ E;  4HM8 A;  1L0L E;  4NB8 D;  1O7M A;  1SQX E;  1SQP E;  2XR8 A;  3N0Q A;  4H13 D;  4QUQ A;  5CXM A;  2BMR A;  2I7F A;  2YFJ A;  3DQY A;  3GTS A;  4U3F E;  1Q90 C;  1UUW A;  1NDO A;  2B1X A;  3L71 E;  2HMJ A;  2QPZ A;  4P1C H;  1EG9 A;  2XSO A;  3D89 A;  4HM1 A;  4HM5 A;  4NBD D;  2NVE A;  3C0D A;  3CX5 E;  3VMI D;  2DE5 D;  3H1K E;  3L70 E;  3EQQ A;  2FYN C;  3EN1 A;  3CWB E;  1SQB E;  1SJG A;  1O7W A;  3GOB A;  2XSH A;  3H1I E;  2YFL A;  4NBG D;  1ULJ A;  2GBX A;  3H1L E;  1NU1 E;  2JZA A;  4OGQ D;  1PP9 E;  3L75 E;  1WQL A;  4AAY B;  5KLV E;  2A06 E;  2D2C D;  4QUR A;  4QUP A;  2YIU C;  3GB4 A;  2BMO A;  2HML A;  3BCC E;  3GL0 A;  1O7H A;  2HMM A;  2E74 D;  1EZV E;  3TGU E;  1VCK A;  4NBH D;  1KYO E;  1O7G A;  1NYK A;  2DE6 D;  2Q3W A;  4HKV A;  1BCC E;  2ZT9 D;  4QCK A;  2JO6 A;  1SQV E;  2HMN A;  2E76 D;  1NTZ E;  4QDC A;  2DE7 D;  4HM4 A;  2GBW A;  4HM2 A;  3L73 E;  4NBA D;  2E75 D;  2YFI A;  5AEW A;  3GTE A;  3AZC A;  1G8J B;  3H1J E;  2E4P A;  4P1B H;  4PV1 D;  4QDF B;  1JM1 A;  2HMK A;  4H0L D;  4PD4 E;  2QJY C;  2NUM A;  4AIV A;  2B24 A;  5BOK A;  1P84 E;  2NWF A;  1BE3 E;  2QJK C;  2NVG A;  1ZRT E;  5HL4 A;  4QDD A;  5KLI C;  1VF5 D;  2ZYL A;  3VMH D;  4NBF D;  2CKF A;  3VMG D;  2FYU E;  3GCE A;  1PPJ E;  1UUV A;  1KB9 E;  1NTM E;  3GZY A; 
#chains in the Genus database with same CATH homology
 4NBE D;  1RFS A;  1O7N A;  2YVJ B;  1NTK E;  5KKZ C;  3FOU A;  4NBC D;  2E4Q A;  4EMJ B;  2NVF A;  3GZX A;  4NBB D;  1RIE A;  1ULI A;  3GL2 A;  3L74 E;  2NUK A;  3L72 E;  3GKE A;  4HM6 A;  3CXH E;  3VCA A;  2BCC E;  2XRX A;  4HJL A;  4H44 D;  1SQQ E;  4HM3 A;  1G8K B;  1O7P A;  2BMQ A;  2QJP C;  4HM7 A;  4HM0 A;  4QDF A;  3H1H E;  2HMO A;  1VM9 A;  4NB9 D;  3VCP A;  1L0N E;  1FQT A;  5AEU A;  2IBZ E;  4HM8 A;  1L0L E;  4NB8 D;  1O7M A;  1SQX E;  1SQP E;  2XR8 A;  3N0Q A;  4H13 D;  4QUQ A;  5CXM A;  2BMR A;  2I7F A;  2YFJ A;  3DQY A;  3GTS A;  4U3F E;  1Q90 C;  1UUW A;  1NDO A;  2B1X A;  3L71 E;  2HMJ A;  2QPZ A;  4P1C H;  1EG9 A;  2XSO A;  3D89 A;  4HM1 A;  4HM5 A;  4NBD D;  2NVE A;  3C0D A;  3CX5 E;  3VMI D;  2DE5 D;  3H1K E;  3L70 E;  3EQQ A;  2FYN C;  3EN1 A;  3CWB E;  1SQB E;  1SJG A;  1O7W A;  3GOB A;  2XSH A;  3H1I E;  2YFL A;  4NBG D;  1ULJ A;  2GBX A;  3H1L E;  1NU1 E;  2JZA A;  4OGQ D;  1PP9 E;  3L75 E;  1WQL A;  4AAY B;  5KLV E;  2A06 E;  2D2C D;  4QUR A;  4QUP A;  2YIU C;  3GB4 A;  2BMO A;  2HML A;  3BCC E;  3GL0 A;  1O7H A;  2HMM A;  2E74 D;  1EZV E;  3TGU E;  1VCK A;  4NBH D;  1KYO E;  1O7G A;  1NYK A;  2DE6 D;  2Q3W A;  4HKV A;  1BCC E;  2ZT9 D;  4QCK A;  2JO6 A;  1SQV E;  2HMN A;  2E76 D;  1NTZ E;  4QDC A;  2DE7 D;  4HM4 A;  2GBW A;  4HM2 A;  3L73 E;  4NBA D;  2E75 D;  2YFI A;  5AEW A;  3GTE A;  3AZC A;  1G8J B;  3H1J E;  2E4P A;  4P1B H;  4PV1 D;  4QDF B;  1JM1 A;  2HMK A;  4H0L D;  4PD4 E;  2QJY C;  2NUM A;  4AIV A;  2B24 A;  5BOK A;  1P84 E;  2NWF A;  1BE3 E;  2QJK C;  2NVG A;  1ZRT E;  5HL4 A;  4QDD A;  5KLI C;  1VF5 D;  2ZYL A;  3VMH D;  4NBF D;  2CKF A;  3VMG D;  2FYU E;  3GCE A;  1PPJ E;  1UUV A;  1KB9 E;  1NTM E;  3GZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...