2NWFA

Soluble domain of rieske iron sulfur protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHWDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 38
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nwfA00
2NUMA 2DE7D 4QUPA 1RFSA 2B24A 2D2CD 2I7FA 4NBED 1O7MA 1ULIA 5KLVE 2NVEA 2YFLA 3VCAA 2QPZA 2NVGA 1O7PA 2ZT9D 2NVFA 1UUWA 2E75D 3CWBE 4PV1D 2BMOA 3GL2A 4QDFB 3CX5E 1NU1E 4PD4E 1NTKE 1KB9E 1JM1A 2HMNA 1PP9E 4QCKA 2GBWA 1G8JB 3D89A 4P1CH 4H13D 3H1HE 3CXHE 1FQTA 3L71E 4HM5A 1PPJE 3EQQA 1P84E 2IBZE 4HM2A 2HMMA 1NDOA 2ZYLA 4NB9D 4EMJB 3GOBA 3VMGD 1L0LE 1VCKA 2YVJB 4NBDD 1NTME 1ULJA 1WQLA 4HKVA 4QURA 3H1JE 2YIUC 2E76D 2XSHA 5CXMA 4HM3A 4NBGD 2JO6A 2CKFA 5AEWA 4NBHD 3GTSA 1VM9A 3GL0A 3GZXA 4QDDA 2HMLA 3N0QA 2QJPC 4NB8D 2HMOA 2QJYC 4QUQA 3FOUA 5BOKA 1O7WA 4H0LD 1NYKA 1O7GA 1ZRTE 5HL4A 2Q3WA 1L0NE 2FYUE 4HM4A 2E74D 2XR8A 2HMKA 4HJLA 1O7HA 3L75E 3GKEA 3EN1A 2XSOA 2B1XA 4QDCA 4AAYB 3TGUE 4U3FE 2NUKA 1SQBE 1EZVE 3L74E 3VMHD 4HM0A 4AIVA 3GTEA 2BMQA 5KKZC 3C0DA 2QJKC 1SQQE 4QDFA 1RIEA 2E4QA 2JZAA 3VMID 1BCCE 3GZYA 3DQYA 4P1BH 2HMJA 2YFJA 4HM7A 3L73E 4HM8A 3H1LE 1SQVE 1G8KB 1KYOE 2XRXA 2NWFA 1O7NA 5AEUA 4NBAD 3L70E 4H44D 4HM6A 1SQPE 2DE5D 1Q90C 3H1KE 3L72E 5KLIC 2BMRA 4OGQD 4NBFD 2A06E 3GB4A 3VCPA 1EG9A 1VF5D 3BCCE 2E4PA 1SJGA 4HM1A 1NTZE 2DE6D 3GCEA 3AZCA 4NBCD 2FYNC 3H1IE 2GBXA 1UUVA 1BE3E 2BCCE 2YFIA 1SQXE 4NBBD
chains in the Genus database with same CATH superfamily
2NUMA 2DE7D 4QUPA 1RFSA 2B24A 2D2CD 2I7FA 4NBED 1O7MA 1ULIA 5KLVE 2NVEA 2YFLA 3VCAA 2QPZA 2NVGA 1O7PA 2ZT9D 2NVFA 1UUWA 2E75D 3CWBE 4PV1D 2BMOA 3GL2A 4QDFB 3CX5E 1NU1E 4PD4E 1NTKE 1KB9E 1JM1A 2HMNA 1PP9E 4QCKA 2GBWA 1G8JB 3D89A 4P1CH 4H13D 3H1HE 3CXHE 1FQTA 3L71E 4HM5A 1PPJE 3EQQA 1P84E 2IBZE 4HM2A 2HMMA 1NDOA 2ZYLA 4NB9D 4EMJB 3GOBA 3VMGD 1L0LE 1VCKA 2YVJB 4NBDD 1NTME 1ULJA 1WQLA 4HKVA 4QURA 3H1JE 2YIUC 2E76D 2XSHA 5CXMA 4HM3A 4NBGD 2JO6A 2CKFA 5AEWA 4NBHD 3GTSA 1VM9A 3GL0A 3GZXA 4QDDA 2HMLA 3N0QA 2QJPC 4NB8D 2HMOA 2QJYC 4QUQA 3FOUA 5BOKA 1O7WA 4H0LD 1NYKA 1O7GA 1ZRTE 5HL4A 2Q3WA 1L0NE 2FYUE 4HM4A 2E74D 2XR8A 2HMKA 4HJLA 1O7HA 3L75E 3GKEA 3EN1A 2XSOA 2B1XA 4QDCA 4AAYB 3TGUE 4U3FE 2NUKA 1SQBE 1EZVE 3L74E 3VMHD 4HM0A 4AIVA 3GTEA 2BMQA 5KKZC 3C0DA 2QJKC 1SQQE 4QDFA 1RIEA 2E4QA 2JZAA 3VMID 1BCCE 3GZYA 3DQYA 4P1BH 2HMJA 2YFJA 4HM7A 3L73E 4HM8A 3H1LE 1SQVE 1G8KB 1KYOE 2XRXA 2NWFA 1O7NA 5AEUA 4NBAD 3L70E 4H44D 4HM6A 1SQPE 2DE5D 1Q90C 3H1KE 3L72E 5KLIC 2BMRA 4OGQD 4NBFD 2A06E 3GB4A 3VCPA 1EG9A 1VF5D 3BCCE 2E4PA 1SJGA 4HM1A 1NTZE 2DE6D 3GCEA 3AZCA 4NBCD 2FYNC 3H1IE 2GBXA 1UUVA 1BE3E 2BCCE 2YFIA 1SQXE 4NBBD
chains in the Genus database with same CATH topology
2NUMA 2DE7D 4QUPA 1RFSA 2B24A 2D2CD 2I7FA 4NBED 1O7MA 1ULIA 5KLVE 2NVEA 2YFLA 3VCAA 2QPZA 2NVGA 1O7PA 2ZT9D 2NVFA 1UUWA 2E75D 3CWBE 4PV1D 2BMOA 3GL2A 4QDFB 3CX5E 1NU1E 4PD4E 1NTKE 1KB9E 1JM1A 2HMNA 1PP9E 4QCKA 2GBWA 1G8JB 3D89A 4P1CH 4H13D 3H1HE 3CXHE 1FQTA 3L71E 4HM5A 1PPJE 3EQQA 1P84E 2IBZE 4HM2A 2HMMA 1NDOA 2ZYLA 4NB9D 4EMJB 3GOBA 3VMGD 1L0LE 1VCKA 2YVJB 4NBDD 1NTME 1ULJA 1WQLA 4HKVA 4QURA 3H1JE 2YIUC 2E76D 2XSHA 5CXMA 4HM3A 4NBGD 2JO6A 2CKFA 5AEWA 4NBHD 3GTSA 1VM9A 3GL0A 3GZXA 4QDDA 2HMLA 3N0QA 2QJPC 4NB8D 2HMOA 2QJYC 4QUQA 3FOUA 5BOKA 1O7WA 4H0LD 1NYKA 1O7GA 1ZRTE 5HL4A 2Q3WA 1L0NE 2FYUE 4HM4A 2E74D 2XR8A 2HMKA 4HJLA 1O7HA 3L75E 3GKEA 3EN1A 2XSOA 2B1XA 4QDCA 4AAYB 3TGUE 4U3FE 2NUKA 1SQBE 1EZVE 3L74E 3VMHD 4HM0A 4AIVA 3GTEA 2BMQA 5KKZC 3C0DA 2QJKC 1SQQE 4QDFA 1RIEA 2E4QA 2JZAA 3VMID 1BCCE 3GZYA 3DQYA 4P1BH 2HMJA 2YFJA 4HM7A 3L73E 4HM8A 3H1LE 1SQVE 1G8KB 1KYOE 2XRXA 2NWFA 1O7NA 5AEUA 4NBAD 3L70E 4H44D 4HM6A 1SQPE 2DE5D 1Q90C 3H1KE 3L72E 5KLIC 2BMRA 4OGQD 4NBFD 2A06E 3GB4A 3VCPA 1EG9A 1VF5D 3BCCE 2E4PA 1SJGA 4HM1A 1NTZE 2DE6D 3GCEA 3AZCA 4NBCD 2FYNC 3H1IE 2GBXA 1UUVA 1BE3E 2BCCE 2YFIA 1SQXE 4NBBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NUM A;  2DE7 D;  4QUP A;  1RFS A;  2B24 A;  2D2C D;  2I7F A;  4NBE D;  1O7M A;  1ULI A;  5KLV E;  2NVE A;  2YFL A;  3VCA A;  2QPZ A;  2NVG A;  1O7P A;  2ZT9 D;  2NVF A;  1UUW A;  2E75 D;  3CWB E;  4PV1 D;  2BMO A;  3GL2 A;  4QDF B;  3CX5 E;  1NU1 E;  4PD4 E;  1NTK E;  1KB9 E;  1JM1 A;  2HMN A;  1PP9 E;  4QCK A;  2GBW A;  1G8J B;  3D89 A;  4P1C H;  4H13 D;  3H1H E;  3CXH E;  1FQT A;  3L71 E;  4HM5 A;  1PPJ E;  3EQQ A;  1P84 E;  2IBZ E;  4HM2 A;  2HMM A;  1NDO A;  2ZYL A;  4NB9 D;  4EMJ B;  3GOB A;  3VMG D;  1L0L E;  1VCK A;  2YVJ B;  4NBD D;  1NTM E;  1ULJ A;  1WQL A;  4HKV A;  4QUR A;  3H1J E;  2YIU C;  2E76 D;  2XSH A;  5CXM A;  4HM3 A;  4NBG D;  2JO6 A;  2CKF A;  5AEW A;  4NBH D;  3GTS A;  1VM9 A;  3GL0 A;  3GZX A;  4QDD A;  2HML A;  3N0Q A;  2QJP C;  4NB8 D;  2HMO A;  2QJY C;  4QUQ A;  3FOU A;  5BOK A;  1O7W A;  4H0L D;  1NYK A;  1O7G A;  1ZRT E;  5HL4 A;  2Q3W A;  1L0N E;  2FYU E;  4HM4 A;  2E74 D;  2XR8 A;  2HMK A;  4HJL A;  1O7H A;  3L75 E;  3GKE A;  3EN1 A;  2XSO A;  2B1X A;  4QDC A;  4AAY B;  3TGU E;  4U3F E;  2NUK A;  1SQB E;  1EZV E;  3L74 E;  3VMH D;  4HM0 A;  4AIV A;  3GTE A;  2BMQ A;  5KKZ C;  3C0D A;  2QJK C;  1SQQ E;  4QDF A;  1RIE A;  2E4Q A;  2JZA A;  3VMI D;  1BCC E;  3GZY A;  3DQY A;  4P1B H;  2HMJ A;  2YFJ A;  4HM7 A;  3L73 E;  4HM8 A;  3H1L E;  1SQV E;  1G8K B;  1KYO E;  2XRX A;  2NWF A;  1O7N A;  5AEU A;  4NBA D;  3L70 E;  4H44 D;  4HM6 A;  1SQP E;  2DE5 D;  1Q90 C;  3H1K E;  3L72 E;  5KLI C;  2BMR A;  4OGQ D;  4NBF D;  2A06 E;  3GB4 A;  3VCP A;  1EG9 A;  1VF5 D;  3BCC E;  2E4P A;  1SJG A;  4HM1 A;  1NTZ E;  2DE6 D;  3GCE A;  3AZC A;  4NBC D;  2FYN C;  3H1I E;  2GBX A;  1UUV A;  1BE3 E;  2BCC E;  2YFI A;  1SQX E;  4NBB D; 
#chains in the Genus database with same CATH topology
 2NUM A;  2DE7 D;  4QUP A;  1RFS A;  2B24 A;  2D2C D;  2I7F A;  4NBE D;  1O7M A;  1ULI A;  5KLV E;  2NVE A;  2YFL A;  3VCA A;  2QPZ A;  2NVG A;  1O7P A;  2ZT9 D;  2NVF A;  1UUW A;  2E75 D;  3CWB E;  4PV1 D;  2BMO A;  3GL2 A;  4QDF B;  3CX5 E;  1NU1 E;  4PD4 E;  1NTK E;  1KB9 E;  1JM1 A;  2HMN A;  1PP9 E;  4QCK A;  2GBW A;  1G8J B;  3D89 A;  4P1C H;  4H13 D;  3H1H E;  3CXH E;  1FQT A;  3L71 E;  4HM5 A;  1PPJ E;  3EQQ A;  1P84 E;  2IBZ E;  4HM2 A;  2HMM A;  1NDO A;  2ZYL A;  4NB9 D;  4EMJ B;  3GOB A;  3VMG D;  1L0L E;  1VCK A;  2YVJ B;  4NBD D;  1NTM E;  1ULJ A;  1WQL A;  4HKV A;  4QUR A;  3H1J E;  2YIU C;  2E76 D;  2XSH A;  5CXM A;  4HM3 A;  4NBG D;  2JO6 A;  2CKF A;  5AEW A;  4NBH D;  3GTS A;  1VM9 A;  3GL0 A;  3GZX A;  4QDD A;  2HML A;  3N0Q A;  2QJP C;  4NB8 D;  2HMO A;  2QJY C;  4QUQ A;  3FOU A;  5BOK A;  1O7W A;  4H0L D;  1NYK A;  1O7G A;  1ZRT E;  5HL4 A;  2Q3W A;  1L0N E;  2FYU E;  4HM4 A;  2E74 D;  2XR8 A;  2HMK A;  4HJL A;  1O7H A;  3L75 E;  3GKE A;  3EN1 A;  2XSO A;  2B1X A;  4QDC A;  4AAY B;  3TGU E;  4U3F E;  2NUK A;  1SQB E;  1EZV E;  3L74 E;  3VMH D;  4HM0 A;  4AIV A;  3GTE A;  2BMQ A;  5KKZ C;  3C0D A;  2QJK C;  1SQQ E;  4QDF A;  1RIE A;  2E4Q A;  2JZA A;  3VMI D;  1BCC E;  3GZY A;  3DQY A;  4P1B H;  2HMJ A;  2YFJ A;  4HM7 A;  3L73 E;  4HM8 A;  3H1L E;  1SQV E;  1G8K B;  1KYO E;  2XRX A;  2NWF A;  1O7N A;  5AEU A;  4NBA D;  3L70 E;  4H44 D;  4HM6 A;  1SQP E;  2DE5 D;  1Q90 C;  3H1K E;  3L72 E;  5KLI C;  2BMR A;  4OGQ D;  4NBF D;  2A06 E;  3GB4 A;  3VCP A;  1EG9 A;  1VF5 D;  3BCC E;  2E4P A;  1SJG A;  4HM1 A;  1NTZ E;  2DE6 D;  3GCE A;  3AZC A;  4NBC D;  2FYN C;  3H1I E;  2GBX A;  1UUV A;  1BE3 E;  2BCC E;  2YFI A;  1SQX E;  4NBB D; 
#chains in the Genus database with same CATH homology
 2NUM A;  2DE7 D;  4QUP A;  1RFS A;  2B24 A;  2D2C D;  2I7F A;  4NBE D;  1O7M A;  1ULI A;  5KLV E;  2NVE A;  2YFL A;  3VCA A;  2QPZ A;  2NVG A;  1O7P A;  2ZT9 D;  2NVF A;  1UUW A;  2E75 D;  3CWB E;  4PV1 D;  2BMO A;  3GL2 A;  4QDF B;  3CX5 E;  1NU1 E;  4PD4 E;  1NTK E;  1KB9 E;  1JM1 A;  2HMN A;  1PP9 E;  4QCK A;  2GBW A;  1G8J B;  3D89 A;  4P1C H;  4H13 D;  3H1H E;  3CXH E;  1FQT A;  3L71 E;  4HM5 A;  1PPJ E;  3EQQ A;  1P84 E;  2IBZ E;  4HM2 A;  2HMM A;  1NDO A;  2ZYL A;  4NB9 D;  4EMJ B;  3GOB A;  3VMG D;  1L0L E;  1VCK A;  2YVJ B;  4NBD D;  1NTM E;  1ULJ A;  1WQL A;  4HKV A;  4QUR A;  3H1J E;  2YIU C;  2E76 D;  2XSH A;  5CXM A;  4HM3 A;  4NBG D;  2JO6 A;  2CKF A;  5AEW A;  4NBH D;  3GTS A;  1VM9 A;  3GL0 A;  3GZX A;  4QDD A;  2HML A;  3N0Q A;  2QJP C;  4NB8 D;  2HMO A;  2QJY C;  4QUQ A;  3FOU A;  5BOK A;  1O7W A;  4H0L D;  1NYK A;  1O7G A;  1ZRT E;  5HL4 A;  2Q3W A;  1L0N E;  2FYU E;  4HM4 A;  2E74 D;  2XR8 A;  2HMK A;  4HJL A;  1O7H A;  3L75 E;  3GKE A;  3EN1 A;  2XSO A;  2B1X A;  4QDC A;  4AAY B;  3TGU E;  4U3F E;  2NUK A;  1SQB E;  1EZV E;  3L74 E;  3VMH D;  4HM0 A;  4AIV A;  3GTE A;  2BMQ A;  5KKZ C;  3C0D A;  2QJK C;  1SQQ E;  4QDF A;  1RIE A;  2E4Q A;  2JZA A;  3VMI D;  1BCC E;  3GZY A;  3DQY A;  4P1B H;  2HMJ A;  2YFJ A;  4HM7 A;  3L73 E;  4HM8 A;  3H1L E;  1SQV E;  1G8K B;  1KYO E;  2XRX A;  2NWF A;  1O7N A;  5AEU A;  4NBA D;  3L70 E;  4H44 D;  4HM6 A;  1SQP E;  2DE5 D;  1Q90 C;  3H1K E;  3L72 E;  5KLI C;  2BMR A;  4OGQ D;  4NBF D;  2A06 E;  3GB4 A;  3VCP A;  1EG9 A;  1VF5 D;  3BCC E;  2E4P A;  1SJG A;  4HM1 A;  1NTZ E;  2DE6 D;  3GCE A;  3AZC A;  4NBC D;  2FYN C;  3H1I E;  2GBX A;  1UUV A;  1BE3 E;  2BCC E;  2YFI A;  1SQX E;  4NBB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...