2NWFA

Soluble domain of rieske iron sulfur protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHWDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 38
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nwfA00
4NBBD 4NBFD 3CWBE 2B1XA 3GZYA 4H44D 4QDCA 3L75E 5AEWA 3VCAA 4AIVA 4NB9D 1G8JB 4HM7A 1G8KB 3GCEA 2XSOA 3BCCE 2JO6A 2NUKA 3VMID 2NVFA 4HM4A 3DQYA 2YVJB 4QURA 4HJLA 3H1KE 4HM2A 1NTZE 2A06E 1NTKE 4NBED 2XR8A 3GTEA 3GOBA 4QDDA 1ZRTE 2E76D 2XSHA 3VMGD 2BMRA 3H1LE 4NBAD 3L70E 3GB4A 1UUVA 1VCKA 2E74D 2NVEA 2HMNA 3H1HE 4HM1A 1SQVE 4HM8A 2B24A 3FOUA 4HKVA 2YIUC 2FYNC 3CXHE 1O7WA 3L71E 1PPJE 3GTSA 1NDOA 2Q3WA 4NB8D 3H1JE 1SJGA 4OGQD 2ZT9D 5KKZC 2I7FA 5AEUA 1VM9A 2BMOA 2BMQA 3GZXA 3N0QA 2HMJA 1L0LE 3GL2A 1P84E 4QUPA 3EN1A 1SQPE 1Q90C 1L0NE 1EG9A 2D2CD 1SQXE 2HMMA 4QDFB 4AAYB 2FYUE 2HMOA 2IBZE 2JZAA 1NU1E 3L74E 1UUWA 2GBXA 1O7HA 5CXMA 2NWFA 4H0LD 2E4QA 2NVGA 2HMLA 4NBGD 1RIEA 3VCPA 1JM1A 1SQBE 2CKFA 4HM6A 4HM0A 3CX5E 1NTME 3EQQA 5HL4A 1KYOE 2QJPC 1KB9E 3D89A 1ULIA 3L72E 2DE6D 1PP9E 2DE5D 2QJKC 5KLIC 1RFSA 3VMHD 3TGUE 2XRXA 4QDFA 5BOKA 4HM5A 4QCKA 1WQLA 3C0DA 2HMKA 3H1IE 3GKEA 4H13D 4P1BH 1NYKA 3L73E 1O7PA 2BCCE 4EMJB 4PV1D 4U3FE 2QJYC 5KLVE 2YFLA 4NBDD 1O7GA 1O7NA 3AZCA 2E75D 4NBCD 1VF5D 1O7MA 1EZVE 2YFJA 3GL0A 2GBWA 1BE3E 4NBHD 2YFIA 4PD4E 4P1CH 4QUQA 1ULJA 2ZYLA 4HM3A 1FQTA 2DE7D 2NUMA 1SQQE 1BCCE 2QPZA 2E4PA
chains in the Genus database with same CATH superfamily
4NBBD 4NBFD 3CWBE 2B1XA 3GZYA 4H44D 4QDCA 3L75E 5AEWA 3VCAA 4AIVA 4NB9D 1G8JB 4HM7A 1G8KB 3GCEA 2XSOA 3BCCE 2JO6A 2NUKA 3VMID 2NVFA 4HM4A 3DQYA 2YVJB 4QURA 4HJLA 3H1KE 4HM2A 1NTZE 2A06E 1NTKE 4NBED 2XR8A 3GTEA 3GOBA 4QDDA 1ZRTE 2E76D 2XSHA 3VMGD 2BMRA 3H1LE 4NBAD 3L70E 3GB4A 1UUVA 1VCKA 2E74D 2NVEA 2HMNA 3H1HE 4HM1A 1SQVE 4HM8A 2B24A 3FOUA 4HKVA 2YIUC 2FYNC 3CXHE 1O7WA 3L71E 1PPJE 3GTSA 1NDOA 2Q3WA 4NB8D 3H1JE 1SJGA 4OGQD 2ZT9D 5KKZC 2I7FA 5AEUA 1VM9A 2BMOA 2BMQA 3GZXA 3N0QA 2HMJA 1L0LE 3GL2A 1P84E 4QUPA 3EN1A 1SQPE 1Q90C 1L0NE 1EG9A 2D2CD 1SQXE 2HMMA 4QDFB 4AAYB 2FYUE 2HMOA 2IBZE 2JZAA 1NU1E 3L74E 1UUWA 2GBXA 1O7HA 5CXMA 2NWFA 4H0LD 2E4QA 2NVGA 2HMLA 4NBGD 1RIEA 3VCPA 1JM1A 1SQBE 2CKFA 4HM6A 4HM0A 3CX5E 1NTME 3EQQA 5HL4A 1KYOE 2QJPC 1KB9E 3D89A 1ULIA 3L72E 2DE6D 1PP9E 2DE5D 2QJKC 5KLIC 1RFSA 3VMHD 3TGUE 2XRXA 4QDFA 5BOKA 4HM5A 4QCKA 1WQLA 3C0DA 2HMKA 3H1IE 3GKEA 4H13D 4P1BH 1NYKA 3L73E 1O7PA 2BCCE 4EMJB 4PV1D 4U3FE 2QJYC 5KLVE 2YFLA 4NBDD 1O7GA 1O7NA 3AZCA 2E75D 4NBCD 1VF5D 1O7MA 1EZVE 2YFJA 3GL0A 2GBWA 1BE3E 4NBHD 2YFIA 4PD4E 4P1CH 4QUQA 1ULJA 2ZYLA 4HM3A 1FQTA 2DE7D 2NUMA 1SQQE 1BCCE 2QPZA 2E4PA
chains in the Genus database with same CATH topology
4NBBD 4NBFD 3CWBE 2B1XA 3GZYA 4H44D 4QDCA 3L75E 5AEWA 3VCAA 4AIVA 4NB9D 1G8JB 4HM7A 1G8KB 3GCEA 2XSOA 3BCCE 2JO6A 2NUKA 3VMID 2NVFA 4HM4A 3DQYA 2YVJB 4QURA 4HJLA 3H1KE 4HM2A 1NTZE 2A06E 1NTKE 4NBED 2XR8A 3GTEA 3GOBA 4QDDA 1ZRTE 2E76D 2XSHA 3VMGD 2BMRA 3H1LE 4NBAD 3L70E 3GB4A 1UUVA 1VCKA 2E74D 2NVEA 2HMNA 3H1HE 4HM1A 1SQVE 4HM8A 2B24A 3FOUA 4HKVA 2YIUC 2FYNC 3CXHE 1O7WA 3L71E 1PPJE 3GTSA 1NDOA 2Q3WA 4NB8D 3H1JE 1SJGA 4OGQD 2ZT9D 5KKZC 2I7FA 5AEUA 1VM9A 2BMOA 2BMQA 3GZXA 3N0QA 2HMJA 1L0LE 3GL2A 1P84E 4QUPA 3EN1A 1SQPE 1Q90C 1L0NE 1EG9A 2D2CD 1SQXE 2HMMA 4QDFB 4AAYB 2FYUE 2HMOA 2IBZE 2JZAA 1NU1E 3L74E 1UUWA 2GBXA 1O7HA 5CXMA 2NWFA 4H0LD 2E4QA 2NVGA 2HMLA 4NBGD 1RIEA 3VCPA 1JM1A 1SQBE 2CKFA 4HM6A 4HM0A 3CX5E 1NTME 3EQQA 5HL4A 1KYOE 2QJPC 1KB9E 3D89A 1ULIA 3L72E 2DE6D 1PP9E 2DE5D 2QJKC 5KLIC 1RFSA 3VMHD 3TGUE 2XRXA 4QDFA 5BOKA 4HM5A 4QCKA 1WQLA 3C0DA 2HMKA 3H1IE 3GKEA 4H13D 4P1BH 1NYKA 3L73E 1O7PA 2BCCE 4EMJB 4PV1D 4U3FE 2QJYC 5KLVE 2YFLA 4NBDD 1O7GA 1O7NA 3AZCA 2E75D 4NBCD 1VF5D 1O7MA 1EZVE 2YFJA 3GL0A 2GBWA 1BE3E 4NBHD 2YFIA 4PD4E 4P1CH 4QUQA 1ULJA 2ZYLA 4HM3A 1FQTA 2DE7D 2NUMA 1SQQE 1BCCE 2QPZA 2E4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBB D;  4NBF D;  3CWB E;  2B1X A;  3GZY A;  4H44 D;  4QDC A;  3L75 E;  5AEW A;  3VCA A;  4AIV A;  4NB9 D;  1G8J B;  4HM7 A;  1G8K B;  3GCE A;  2XSO A;  3BCC E;  2JO6 A;  2NUK A;  3VMI D;  2NVF A;  4HM4 A;  3DQY A;  2YVJ B;  4QUR A;  4HJL A;  3H1K E;  4HM2 A;  1NTZ E;  2A06 E;  1NTK E;  4NBE D;  2XR8 A;  3GTE A;  3GOB A;  4QDD A;  1ZRT E;  2E76 D;  2XSH A;  3VMG D;  2BMR A;  3H1L E;  4NBA D;  3L70 E;  3GB4 A;  1UUV A;  1VCK A;  2E74 D;  2NVE A;  2HMN A;  3H1H E;  4HM1 A;  1SQV E;  4HM8 A;  2B24 A;  3FOU A;  4HKV A;  2YIU C;  2FYN C;  3CXH E;  1O7W A;  3L71 E;  1PPJ E;  3GTS A;  1NDO A;  2Q3W A;  4NB8 D;  3H1J E;  1SJG A;  4OGQ D;  2ZT9 D;  5KKZ C;  2I7F A;  5AEU A;  1VM9 A;  2BMO A;  2BMQ A;  3GZX A;  3N0Q A;  2HMJ A;  1L0L E;  3GL2 A;  1P84 E;  4QUP A;  3EN1 A;  1SQP E;  1Q90 C;  1L0N E;  1EG9 A;  2D2C D;  1SQX E;  2HMM A;  4QDF B;  4AAY B;  2FYU E;  2HMO A;  2IBZ E;  2JZA A;  1NU1 E;  3L74 E;  1UUW A;  2GBX A;  1O7H A;  5CXM A;  2NWF A;  4H0L D;  2E4Q A;  2NVG A;  2HML A;  4NBG D;  1RIE A;  3VCP A;  1JM1 A;  1SQB E;  2CKF A;  4HM6 A;  4HM0 A;  3CX5 E;  1NTM E;  3EQQ A;  5HL4 A;  1KYO E;  2QJP C;  1KB9 E;  3D89 A;  1ULI A;  3L72 E;  2DE6 D;  1PP9 E;  2DE5 D;  2QJK C;  5KLI C;  1RFS A;  3VMH D;  3TGU E;  2XRX A;  4QDF A;  5BOK A;  4HM5 A;  4QCK A;  1WQL A;  3C0D A;  2HMK A;  3H1I E;  3GKE A;  4H13 D;  4P1B H;  1NYK A;  3L73 E;  1O7P A;  2BCC E;  4EMJ B;  4PV1 D;  4U3F E;  2QJY C;  5KLV E;  2YFL A;  4NBD D;  1O7G A;  1O7N A;  3AZC A;  2E75 D;  4NBC D;  1VF5 D;  1O7M A;  1EZV E;  2YFJ A;  3GL0 A;  2GBW A;  1BE3 E;  4NBH D;  2YFI A;  4PD4 E;  4P1C H;  4QUQ A;  1ULJ A;  2ZYL A;  4HM3 A;  1FQT A;  2DE7 D;  2NUM A;  1SQQ E;  1BCC E;  2QPZ A;  2E4P A; 
#chains in the Genus database with same CATH topology
 4NBB D;  4NBF D;  3CWB E;  2B1X A;  3GZY A;  4H44 D;  4QDC A;  3L75 E;  5AEW A;  3VCA A;  4AIV A;  4NB9 D;  1G8J B;  4HM7 A;  1G8K B;  3GCE A;  2XSO A;  3BCC E;  2JO6 A;  2NUK A;  3VMI D;  2NVF A;  4HM4 A;  3DQY A;  2YVJ B;  4QUR A;  4HJL A;  3H1K E;  4HM2 A;  1NTZ E;  2A06 E;  1NTK E;  4NBE D;  2XR8 A;  3GTE A;  3GOB A;  4QDD A;  1ZRT E;  2E76 D;  2XSH A;  3VMG D;  2BMR A;  3H1L E;  4NBA D;  3L70 E;  3GB4 A;  1UUV A;  1VCK A;  2E74 D;  2NVE A;  2HMN A;  3H1H E;  4HM1 A;  1SQV E;  4HM8 A;  2B24 A;  3FOU A;  4HKV A;  2YIU C;  2FYN C;  3CXH E;  1O7W A;  3L71 E;  1PPJ E;  3GTS A;  1NDO A;  2Q3W A;  4NB8 D;  3H1J E;  1SJG A;  4OGQ D;  2ZT9 D;  5KKZ C;  2I7F A;  5AEU A;  1VM9 A;  2BMO A;  2BMQ A;  3GZX A;  3N0Q A;  2HMJ A;  1L0L E;  3GL2 A;  1P84 E;  4QUP A;  3EN1 A;  1SQP E;  1Q90 C;  1L0N E;  1EG9 A;  2D2C D;  1SQX E;  2HMM A;  4QDF B;  4AAY B;  2FYU E;  2HMO A;  2IBZ E;  2JZA A;  1NU1 E;  3L74 E;  1UUW A;  2GBX A;  1O7H A;  5CXM A;  2NWF A;  4H0L D;  2E4Q A;  2NVG A;  2HML A;  4NBG D;  1RIE A;  3VCP A;  1JM1 A;  1SQB E;  2CKF A;  4HM6 A;  4HM0 A;  3CX5 E;  1NTM E;  3EQQ A;  5HL4 A;  1KYO E;  2QJP C;  1KB9 E;  3D89 A;  1ULI A;  3L72 E;  2DE6 D;  1PP9 E;  2DE5 D;  2QJK C;  5KLI C;  1RFS A;  3VMH D;  3TGU E;  2XRX A;  4QDF A;  5BOK A;  4HM5 A;  4QCK A;  1WQL A;  3C0D A;  2HMK A;  3H1I E;  3GKE A;  4H13 D;  4P1B H;  1NYK A;  3L73 E;  1O7P A;  2BCC E;  4EMJ B;  4PV1 D;  4U3F E;  2QJY C;  5KLV E;  2YFL A;  4NBD D;  1O7G A;  1O7N A;  3AZC A;  2E75 D;  4NBC D;  1VF5 D;  1O7M A;  1EZV E;  2YFJ A;  3GL0 A;  2GBW A;  1BE3 E;  4NBH D;  2YFI A;  4PD4 E;  4P1C H;  4QUQ A;  1ULJ A;  2ZYL A;  4HM3 A;  1FQT A;  2DE7 D;  2NUM A;  1SQQ E;  1BCC E;  2QPZ A;  2E4P A; 
#chains in the Genus database with same CATH homology
 4NBB D;  4NBF D;  3CWB E;  2B1X A;  3GZY A;  4H44 D;  4QDC A;  3L75 E;  5AEW A;  3VCA A;  4AIV A;  4NB9 D;  1G8J B;  4HM7 A;  1G8K B;  3GCE A;  2XSO A;  3BCC E;  2JO6 A;  2NUK A;  3VMI D;  2NVF A;  4HM4 A;  3DQY A;  2YVJ B;  4QUR A;  4HJL A;  3H1K E;  4HM2 A;  1NTZ E;  2A06 E;  1NTK E;  4NBE D;  2XR8 A;  3GTE A;  3GOB A;  4QDD A;  1ZRT E;  2E76 D;  2XSH A;  3VMG D;  2BMR A;  3H1L E;  4NBA D;  3L70 E;  3GB4 A;  1UUV A;  1VCK A;  2E74 D;  2NVE A;  2HMN A;  3H1H E;  4HM1 A;  1SQV E;  4HM8 A;  2B24 A;  3FOU A;  4HKV A;  2YIU C;  2FYN C;  3CXH E;  1O7W A;  3L71 E;  1PPJ E;  3GTS A;  1NDO A;  2Q3W A;  4NB8 D;  3H1J E;  1SJG A;  4OGQ D;  2ZT9 D;  5KKZ C;  2I7F A;  5AEU A;  1VM9 A;  2BMO A;  2BMQ A;  3GZX A;  3N0Q A;  2HMJ A;  1L0L E;  3GL2 A;  1P84 E;  4QUP A;  3EN1 A;  1SQP E;  1Q90 C;  1L0N E;  1EG9 A;  2D2C D;  1SQX E;  2HMM A;  4QDF B;  4AAY B;  2FYU E;  2HMO A;  2IBZ E;  2JZA A;  1NU1 E;  3L74 E;  1UUW A;  2GBX A;  1O7H A;  5CXM A;  2NWF A;  4H0L D;  2E4Q A;  2NVG A;  2HML A;  4NBG D;  1RIE A;  3VCP A;  1JM1 A;  1SQB E;  2CKF A;  4HM6 A;  4HM0 A;  3CX5 E;  1NTM E;  3EQQ A;  5HL4 A;  1KYO E;  2QJP C;  1KB9 E;  3D89 A;  1ULI A;  3L72 E;  2DE6 D;  1PP9 E;  2DE5 D;  2QJK C;  5KLI C;  1RFS A;  3VMH D;  3TGU E;  2XRX A;  4QDF A;  5BOK A;  4HM5 A;  4QCK A;  1WQL A;  3C0D A;  2HMK A;  3H1I E;  3GKE A;  4H13 D;  4P1B H;  1NYK A;  3L73 E;  1O7P A;  2BCC E;  4EMJ B;  4PV1 D;  4U3F E;  2QJY C;  5KLV E;  2YFL A;  4NBD D;  1O7G A;  1O7N A;  3AZC A;  2E75 D;  4NBC D;  1VF5 D;  1O7M A;  1EZV E;  2YFJ A;  3GL0 A;  2GBW A;  1BE3 E;  4NBH D;  2YFI A;  4PD4 E;  4P1C H;  4QUQ A;  1ULJ A;  2ZYL A;  4HM3 A;  1FQT A;  2DE7 D;  2NUM A;  1SQQ E;  1BCC E;  2QPZ A;  2E4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...