2NWFA

Soluble domain of rieske iron sulfur protein
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
b'LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHWDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 38
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nwfA00
2GBXA 1BCCE 3EN1A 2YIUC 4QDFB 3N0QA 3EQQA 4NBFD 2QJKC 2E76D 3DQYA 3GCEA 3VMGD 1SJGA 2HMKA 1NTZE 2XRXA 3L75E 3VMHD 4AIVA 2B1XA 1ULIA 1VM9A 4U3FE 1O7GA 2DE5D 4QDCA 1PP9E 2BMRA 3GZXA 4HM4A 1L0LE 1P84E 1Q90C 3GTEA 1SQQE 1JM1A 4NB9D 2NVEA 2QJYC 1ZRTE 4HM0A 3AZCA 4HJLA 4QUPA 4QCKA 4H13D 2D2CD 3GZYA 2HMNA 1O7HA 2BCCE 1KYOE 2FYUE 4QDFA 1EG9A 4NBAD 5AEWA 4QURA 2XSOA 4HM6A 5KKZC 2QJPC 3GKEA 2HMMA 1UUVA 2XR8A 4HM5A 1NDOA 2BMQA 1NU1E 2E4PA 1NYKA 4EMJB 2NVFA 2QPZA 1NTKE 2YFLA 2ZYLA 4PV1D 4NBDD 2YFJA 4NBED 5BOKA 1O7MA 2B24A 2HMOA 5HL4A 1SQPE 4H44D 2HMJA 4NB8D 2NVGA 1WQLA 1NTME 2ZT9D 4OGQD 4HM8A 2IBZE 3CX5E 3GL2A 2BMOA 4QUQA 4QDDA 3TGUE 3C0DA 2GBWA 3BCCE 1UUWA 3VCAA 1VF5D 2CKFA 1SQBE 1BE3E 4P1CH 4H0LD 3H1IE 3GOBA 2YFIA 1SQXE 1O7WA 1KB9E 3H1JE 4HM1A 1RFSA 4HM3A 1O7NA 3GL0A 2NWFA 3VCPA 4NBBD 5AEUA 2NUKA 4NBHD 2XSHA 2E4QA 3L70E 2E75D 2Q3WA 5KLIC 1G8KB 4HKVA 3GB4A 1FQTA 2DE6D 2HMLA 1G8JB 1EZVE 4HM7A 1SQVE 2DE7D 5CXMA 4PD4E 2FYNC 1ULJA 2YVJB 2JZAA 4P1BH 1O7PA 1L0NE 5KLVE 2I7FA 3L72E 3L71E 2A06E 1VCKA 4NBGD 2JO6A 3L73E 3H1KE 3FOUA 3CWBE 3H1LE 3CXHE 3D89A 1PPJE 2E74D 1RIEA 3GTSA 4HM2A 4NBCD 3VMID 3H1HE 2NUMA 4AAYB 3L74E
chains in the Genus database with same CATH superfamily
2GBXA 1BCCE 3EN1A 2YIUC 4QDFB 3N0QA 3EQQA 4NBFD 2QJKC 2E76D 3DQYA 3GCEA 3VMGD 1SJGA 2HMKA 1NTZE 2XRXA 3L75E 3VMHD 4AIVA 2B1XA 1ULIA 1VM9A 4U3FE 1O7GA 2DE5D 4QDCA 1PP9E 2BMRA 3GZXA 4HM4A 1L0LE 1P84E 1Q90C 3GTEA 1SQQE 1JM1A 4NB9D 2NVEA 2QJYC 1ZRTE 4HM0A 3AZCA 4HJLA 4QUPA 4QCKA 4H13D 2D2CD 3GZYA 2HMNA 1O7HA 2BCCE 1KYOE 2FYUE 4QDFA 1EG9A 4NBAD 5AEWA 4QURA 2XSOA 4HM6A 5KKZC 2QJPC 3GKEA 2HMMA 1UUVA 2XR8A 4HM5A 1NDOA 2BMQA 1NU1E 2E4PA 1NYKA 4EMJB 2NVFA 2QPZA 1NTKE 2YFLA 2ZYLA 4PV1D 4NBDD 2YFJA 4NBED 5BOKA 1O7MA 2B24A 2HMOA 5HL4A 1SQPE 4H44D 2HMJA 4NB8D 2NVGA 1WQLA 1NTME 2ZT9D 4OGQD 4HM8A 2IBZE 3CX5E 3GL2A 2BMOA 4QUQA 4QDDA 3TGUE 3C0DA 2GBWA 3BCCE 1UUWA 3VCAA 1VF5D 2CKFA 1SQBE 1BE3E 4P1CH 4H0LD 3H1IE 3GOBA 2YFIA 1SQXE 1O7WA 1KB9E 3H1JE 4HM1A 1RFSA 4HM3A 1O7NA 3GL0A 2NWFA 3VCPA 4NBBD 5AEUA 2NUKA 4NBHD 2XSHA 2E4QA 3L70E 2E75D 2Q3WA 5KLIC 1G8KB 4HKVA 3GB4A 1FQTA 2DE6D 2HMLA 1G8JB 1EZVE 4HM7A 1SQVE 2DE7D 5CXMA 4PD4E 2FYNC 1ULJA 2YVJB 2JZAA 4P1BH 1O7PA 1L0NE 5KLVE 2I7FA 3L72E 3L71E 2A06E 1VCKA 4NBGD 2JO6A 3L73E 3H1KE 3FOUA 3CWBE 3H1LE 3CXHE 3D89A 1PPJE 2E74D 1RIEA 3GTSA 4HM2A 4NBCD 3VMID 3H1HE 2NUMA 4AAYB 3L74E
chains in the Genus database with same CATH topology
2GBXA 1BCCE 3EN1A 2YIUC 4QDFB 3N0QA 3EQQA 4NBFD 2QJKC 2E76D 3DQYA 3GCEA 3VMGD 1SJGA 2HMKA 1NTZE 2XRXA 3L75E 3VMHD 4AIVA 2B1XA 1ULIA 1VM9A 4U3FE 1O7GA 2DE5D 4QDCA 1PP9E 2BMRA 3GZXA 4HM4A 1L0LE 1P84E 1Q90C 3GTEA 1SQQE 1JM1A 4NB9D 2NVEA 2QJYC 1ZRTE 4HM0A 3AZCA 4HJLA 4QUPA 4QCKA 4H13D 2D2CD 3GZYA 2HMNA 1O7HA 2BCCE 1KYOE 2FYUE 4QDFA 1EG9A 4NBAD 5AEWA 4QURA 2XSOA 4HM6A 5KKZC 2QJPC 3GKEA 2HMMA 1UUVA 2XR8A 4HM5A 1NDOA 2BMQA 1NU1E 2E4PA 1NYKA 4EMJB 2NVFA 2QPZA 1NTKE 2YFLA 2ZYLA 4PV1D 4NBDD 2YFJA 4NBED 5BOKA 1O7MA 2B24A 2HMOA 5HL4A 1SQPE 4H44D 2HMJA 4NB8D 2NVGA 1WQLA 1NTME 2ZT9D 4OGQD 4HM8A 2IBZE 3CX5E 3GL2A 2BMOA 4QUQA 4QDDA 3TGUE 3C0DA 2GBWA 3BCCE 1UUWA 3VCAA 1VF5D 2CKFA 1SQBE 1BE3E 4P1CH 4H0LD 3H1IE 3GOBA 2YFIA 1SQXE 1O7WA 1KB9E 3H1JE 4HM1A 1RFSA 4HM3A 1O7NA 3GL0A 2NWFA 3VCPA 4NBBD 5AEUA 2NUKA 4NBHD 2XSHA 2E4QA 3L70E 2E75D 2Q3WA 5KLIC 1G8KB 4HKVA 3GB4A 1FQTA 2DE6D 2HMLA 1G8JB 1EZVE 4HM7A 1SQVE 2DE7D 5CXMA 4PD4E 2FYNC 1ULJA 2YVJB 2JZAA 4P1BH 1O7PA 1L0NE 5KLVE 2I7FA 3L72E 3L71E 2A06E 1VCKA 4NBGD 2JO6A 3L73E 3H1KE 3FOUA 3CWBE 3H1LE 3CXHE 3D89A 1PPJE 2E74D 1RIEA 3GTSA 4HM2A 4NBCD 3VMID 3H1HE 2NUMA 4AAYB 3L74E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBX A;  1BCC E;  3EN1 A;  2YIU C;  4QDF B;  3N0Q A;  3EQQ A;  4NBF D;  2QJK C;  2E76 D;  3DQY A;  3GCE A;  3VMG D;  1SJG A;  2HMK A;  1NTZ E;  2XRX A;  3L75 E;  3VMH D;  4AIV A;  2B1X A;  1ULI A;  1VM9 A;  4U3F E;  1O7G A;  2DE5 D;  4QDC A;  1PP9 E;  2BMR A;  3GZX A;  4HM4 A;  1L0L E;  1P84 E;  1Q90 C;  3GTE A;  1SQQ E;  1JM1 A;  4NB9 D;  2NVE A;  2QJY C;  1ZRT E;  4HM0 A;  3AZC A;  4HJL A;  4QUP A;  4QCK A;  4H13 D;  2D2C D;  3GZY A;  2HMN A;  1O7H A;  2BCC E;  1KYO E;  2FYU E;  4QDF A;  1EG9 A;  4NBA D;  5AEW A;  4QUR A;  2XSO A;  4HM6 A;  5KKZ C;  2QJP C;  3GKE A;  2HMM A;  1UUV A;  2XR8 A;  4HM5 A;  1NDO A;  2BMQ A;  1NU1 E;  2E4P A;  1NYK A;  4EMJ B;  2NVF A;  2QPZ A;  1NTK E;  2YFL A;  2ZYL A;  4PV1 D;  4NBD D;  2YFJ A;  4NBE D;  5BOK A;  1O7M A;  2B24 A;  2HMO A;  5HL4 A;  1SQP E;  4H44 D;  2HMJ A;  4NB8 D;  2NVG A;  1WQL A;  1NTM E;  2ZT9 D;  4OGQ D;  4HM8 A;  2IBZ E;  3CX5 E;  3GL2 A;  2BMO A;  4QUQ A;  4QDD A;  3TGU E;  3C0D A;  2GBW A;  3BCC E;  1UUW A;  3VCA A;  1VF5 D;  2CKF A;  1SQB E;  1BE3 E;  4P1C H;  4H0L D;  3H1I E;  3GOB A;  2YFI A;  1SQX E;  1O7W A;  1KB9 E;  3H1J E;  4HM1 A;  1RFS A;  4HM3 A;  1O7N A;  3GL0 A;  2NWF A;  3VCP A;  4NBB D;  5AEU A;  2NUK A;  4NBH D;  2XSH A;  2E4Q A;  3L70 E;  2E75 D;  2Q3W A;  5KLI C;  1G8K B;  4HKV A;  3GB4 A;  1FQT A;  2DE6 D;  2HML A;  1G8J B;  1EZV E;  4HM7 A;  1SQV E;  2DE7 D;  5CXM A;  4PD4 E;  2FYN C;  1ULJ A;  2YVJ B;  2JZA A;  4P1B H;  1O7P A;  1L0N E;  5KLV E;  2I7F A;  3L72 E;  3L71 E;  2A06 E;  1VCK A;  4NBG D;  2JO6 A;  3L73 E;  3H1K E;  3FOU A;  3CWB E;  3H1L E;  3CXH E;  3D89 A;  1PPJ E;  2E74 D;  1RIE A;  3GTS A;  4HM2 A;  4NBC D;  3VMI D;  3H1H E;  2NUM A;  4AAY B;  3L74 E; 
#chains in the Genus database with same CATH topology
 2GBX A;  1BCC E;  3EN1 A;  2YIU C;  4QDF B;  3N0Q A;  3EQQ A;  4NBF D;  2QJK C;  2E76 D;  3DQY A;  3GCE A;  3VMG D;  1SJG A;  2HMK A;  1NTZ E;  2XRX A;  3L75 E;  3VMH D;  4AIV A;  2B1X A;  1ULI A;  1VM9 A;  4U3F E;  1O7G A;  2DE5 D;  4QDC A;  1PP9 E;  2BMR A;  3GZX A;  4HM4 A;  1L0L E;  1P84 E;  1Q90 C;  3GTE A;  1SQQ E;  1JM1 A;  4NB9 D;  2NVE A;  2QJY C;  1ZRT E;  4HM0 A;  3AZC A;  4HJL A;  4QUP A;  4QCK A;  4H13 D;  2D2C D;  3GZY A;  2HMN A;  1O7H A;  2BCC E;  1KYO E;  2FYU E;  4QDF A;  1EG9 A;  4NBA D;  5AEW A;  4QUR A;  2XSO A;  4HM6 A;  5KKZ C;  2QJP C;  3GKE A;  2HMM A;  1UUV A;  2XR8 A;  4HM5 A;  1NDO A;  2BMQ A;  1NU1 E;  2E4P A;  1NYK A;  4EMJ B;  2NVF A;  2QPZ A;  1NTK E;  2YFL A;  2ZYL A;  4PV1 D;  4NBD D;  2YFJ A;  4NBE D;  5BOK A;  1O7M A;  2B24 A;  2HMO A;  5HL4 A;  1SQP E;  4H44 D;  2HMJ A;  4NB8 D;  2NVG A;  1WQL A;  1NTM E;  2ZT9 D;  4OGQ D;  4HM8 A;  2IBZ E;  3CX5 E;  3GL2 A;  2BMO A;  4QUQ A;  4QDD A;  3TGU E;  3C0D A;  2GBW A;  3BCC E;  1UUW A;  3VCA A;  1VF5 D;  2CKF A;  1SQB E;  1BE3 E;  4P1C H;  4H0L D;  3H1I E;  3GOB A;  2YFI A;  1SQX E;  1O7W A;  1KB9 E;  3H1J E;  4HM1 A;  1RFS A;  4HM3 A;  1O7N A;  3GL0 A;  2NWF A;  3VCP A;  4NBB D;  5AEU A;  2NUK A;  4NBH D;  2XSH A;  2E4Q A;  3L70 E;  2E75 D;  2Q3W A;  5KLI C;  1G8K B;  4HKV A;  3GB4 A;  1FQT A;  2DE6 D;  2HML A;  1G8J B;  1EZV E;  4HM7 A;  1SQV E;  2DE7 D;  5CXM A;  4PD4 E;  2FYN C;  1ULJ A;  2YVJ B;  2JZA A;  4P1B H;  1O7P A;  1L0N E;  5KLV E;  2I7F A;  3L72 E;  3L71 E;  2A06 E;  1VCK A;  4NBG D;  2JO6 A;  3L73 E;  3H1K E;  3FOU A;  3CWB E;  3H1L E;  3CXH E;  3D89 A;  1PPJ E;  2E74 D;  1RIE A;  3GTS A;  4HM2 A;  4NBC D;  3VMI D;  3H1H E;  2NUM A;  4AAY B;  3L74 E; 
#chains in the Genus database with same CATH homology
 2GBX A;  1BCC E;  3EN1 A;  2YIU C;  4QDF B;  3N0Q A;  3EQQ A;  4NBF D;  2QJK C;  2E76 D;  3DQY A;  3GCE A;  3VMG D;  1SJG A;  2HMK A;  1NTZ E;  2XRX A;  3L75 E;  3VMH D;  4AIV A;  2B1X A;  1ULI A;  1VM9 A;  4U3F E;  1O7G A;  2DE5 D;  4QDC A;  1PP9 E;  2BMR A;  3GZX A;  4HM4 A;  1L0L E;  1P84 E;  1Q90 C;  3GTE A;  1SQQ E;  1JM1 A;  4NB9 D;  2NVE A;  2QJY C;  1ZRT E;  4HM0 A;  3AZC A;  4HJL A;  4QUP A;  4QCK A;  4H13 D;  2D2C D;  3GZY A;  2HMN A;  1O7H A;  2BCC E;  1KYO E;  2FYU E;  4QDF A;  1EG9 A;  4NBA D;  5AEW A;  4QUR A;  2XSO A;  4HM6 A;  5KKZ C;  2QJP C;  3GKE A;  2HMM A;  1UUV A;  2XR8 A;  4HM5 A;  1NDO A;  2BMQ A;  1NU1 E;  2E4P A;  1NYK A;  4EMJ B;  2NVF A;  2QPZ A;  1NTK E;  2YFL A;  2ZYL A;  4PV1 D;  4NBD D;  2YFJ A;  4NBE D;  5BOK A;  1O7M A;  2B24 A;  2HMO A;  5HL4 A;  1SQP E;  4H44 D;  2HMJ A;  4NB8 D;  2NVG A;  1WQL A;  1NTM E;  2ZT9 D;  4OGQ D;  4HM8 A;  2IBZ E;  3CX5 E;  3GL2 A;  2BMO A;  4QUQ A;  4QDD A;  3TGU E;  3C0D A;  2GBW A;  3BCC E;  1UUW A;  3VCA A;  1VF5 D;  2CKF A;  1SQB E;  1BE3 E;  4P1C H;  4H0L D;  3H1I E;  3GOB A;  2YFI A;  1SQX E;  1O7W A;  1KB9 E;  3H1J E;  4HM1 A;  1RFS A;  4HM3 A;  1O7N A;  3GL0 A;  2NWF A;  3VCP A;  4NBB D;  5AEU A;  2NUK A;  4NBH D;  2XSH A;  2E4Q A;  3L70 E;  2E75 D;  2Q3W A;  5KLI C;  1G8K B;  4HKV A;  3GB4 A;  1FQT A;  2DE6 D;  2HML A;  1G8J B;  1EZV E;  4HM7 A;  1SQV E;  2DE7 D;  5CXM A;  4PD4 E;  2FYN C;  1ULJ A;  2YVJ B;  2JZA A;  4P1B H;  1O7P A;  1L0N E;  5KLV E;  2I7F A;  3L72 E;  3L71 E;  2A06 E;  1VCK A;  4NBG D;  2JO6 A;  3L73 E;  3H1K E;  3FOU A;  3CWB E;  3H1L E;  3CXH E;  3D89 A;  1PPJ E;  2E74 D;  1RIE A;  3GTS A;  4HM2 A;  4NBC D;  3VMI D;  3H1H E;  2NUM A;  4AAY B;  3L74 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...