4AAYB

Crystal structure of the arsenite oxidase protein complex from rhizobium species strain nt-26
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
b'AAGVEYPANRLANISELTLNEPLDVAYPDEDAAGVLLKLGTRVEGGVGPDGDIVGFSTICPHKGFPLSYSADNKTFNCPGHFSVFDPEKGGQQVWGQATQNLPQYVLRVADNGDIFAEGVDELIYGRLSNVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROA
publication title The Respiratory Arsenite Oxidase: Structure and the Role of Residues Surrounding the Rieske Cluster.
pubmed doi rcsb
source organism Arsenite-oxidising bacterium nt-26
molecule tags Oxidoreductase
total genus 26
structure length 132
sequence length 132
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4aayB00
2DE7D 2B24A 3H1IE 4U3FE 4NBFD 2YVJB 1O7PA 4NB9D 3C0DA 2QPZA 5CXMA 3CXHE 1SJGA 1PP9E 1SQXE 1JM1A 3N0QA 4QDFA 2HMNA 2QJPC 2HMLA 2B1XA 5KLIC 2GBXA 1VCKA 2NVGA 2E74D 1O7GA 2XRXA 1L0LE 1WQLA 1ZRTE 1KB9E 4H0LD 4NB8D 4OGQD 2Q3WA 5HL4A 4P1CH 4QUQA 1RIEA 1SQVE 1G8KB 3L73E 4HM5A 3AZCA 4H13D 3VMID 4HM2A 1PPJE 4NBBD 3GZYA 4QDDA 4P1BH 3GCEA 5KKZC 1EG9A 1ULJA 2GBWA 3BCCE 2ZT9D 2NWFA 1O7WA 1NYKA 2HMKA 3H1JE 3DQYA 4AAYB 2BCCE 4QCKA 2DE5D 4NBAD 3VMGD 4NBDD 5AEWA 3GOBA 2NVFA 2A06E 2E76D 5BOKA 2E4QA 3D89A 2D2CD 3H1KE 2XR8A 4HKVA 3GTEA 3L72E 4EMJB 2JO6A 4HM1A 4PV1D 1NTME 1VM9A 1NDOA 1O7HA 3CWBE 3CX5E 3GKEA 4HM3A 4HM0A 4NBED 3FOUA 2FYUE 2NUMA 4QDCA 2HMJA 2YFIA 3L70E 2BMRA 4QUPA 1G8JB 1NTKE 1NU1E 2YFJA 1O7NA 3GL0A 3VMHD 4HM7A 1SQBE 2ZYLA 5KLVE 2CKFA 3EN1A 2HMOA 2E75D 2XSHA 2YIUC 4QDFB 5AEUA 1SQPE 1O7MA 1SQQE 1Q90C 2XSOA 2DE6D 4NBCD 3TGUE 3GTSA 4NBHD 3L75E 3EQQA 2E4PA 1BE3E 1L0NE 3H1LE 4HM8A 3VCPA 1UUVA 3H1HE 3L71E 1UUWA 2NUKA 2QJKC 2BMOA 2JZAA 2QJYC 4H44D 2I7FA 3GB4A 4PD4E 1VF5D 3GL2A 2HMMA 1BCCE 4HM6A 1EZVE 3L74E 2NVEA 3VCAA 2BMQA 2YFLA 4HJLA 1NTZE 2IBZE 1ULIA 3GZXA 4NBGD 1P84E 4QURA 1RFSA 2FYNC 4HM4A 1FQTA 4AIVA 1KYOE
chains in the Genus database with same CATH superfamily
2DE7D 2B24A 3H1IE 4U3FE 4NBFD 2YVJB 1O7PA 4NB9D 3C0DA 2QPZA 5CXMA 3CXHE 1SJGA 1PP9E 1SQXE 1JM1A 3N0QA 4QDFA 2HMNA 2QJPC 2HMLA 2B1XA 5KLIC 2GBXA 1VCKA 2NVGA 2E74D 1O7GA 2XRXA 1L0LE 1WQLA 1ZRTE 1KB9E 4H0LD 4NB8D 4OGQD 2Q3WA 5HL4A 4P1CH 4QUQA 1RIEA 1SQVE 1G8KB 3L73E 4HM5A 3AZCA 4H13D 3VMID 4HM2A 1PPJE 4NBBD 3GZYA 4QDDA 4P1BH 3GCEA 5KKZC 1EG9A 1ULJA 2GBWA 3BCCE 2ZT9D 2NWFA 1O7WA 1NYKA 2HMKA 3H1JE 3DQYA 4AAYB 2BCCE 4QCKA 2DE5D 4NBAD 3VMGD 4NBDD 5AEWA 3GOBA 2NVFA 2A06E 2E76D 5BOKA 2E4QA 3D89A 2D2CD 3H1KE 2XR8A 4HKVA 3GTEA 3L72E 4EMJB 2JO6A 4HM1A 4PV1D 1NTME 1VM9A 1NDOA 1O7HA 3CWBE 3CX5E 3GKEA 4HM3A 4HM0A 4NBED 3FOUA 2FYUE 2NUMA 4QDCA 2HMJA 2YFIA 3L70E 2BMRA 4QUPA 1G8JB 1NTKE 1NU1E 2YFJA 1O7NA 3GL0A 3VMHD 4HM7A 1SQBE 2ZYLA 5KLVE 2CKFA 3EN1A 2HMOA 2E75D 2XSHA 2YIUC 4QDFB 5AEUA 1SQPE 1O7MA 1SQQE 1Q90C 2XSOA 2DE6D 4NBCD 3TGUE 3GTSA 4NBHD 3L75E 3EQQA 2E4PA 1BE3E 1L0NE 3H1LE 4HM8A 3VCPA 1UUVA 3H1HE 3L71E 1UUWA 2NUKA 2QJKC 2BMOA 2JZAA 2QJYC 4H44D 2I7FA 3GB4A 4PD4E 1VF5D 3GL2A 2HMMA 1BCCE 4HM6A 1EZVE 3L74E 2NVEA 3VCAA 2BMQA 2YFLA 4HJLA 1NTZE 2IBZE 1ULIA 3GZXA 4NBGD 1P84E 4QURA 1RFSA 2FYNC 4HM4A 1FQTA 4AIVA 1KYOE
chains in the Genus database with same CATH topology
2DE7D 2B24A 3H1IE 4U3FE 4NBFD 2YVJB 1O7PA 4NB9D 3C0DA 2QPZA 5CXMA 3CXHE 1SJGA 1PP9E 1SQXE 1JM1A 3N0QA 4QDFA 2HMNA 2QJPC 2HMLA 2B1XA 5KLIC 2GBXA 1VCKA 2NVGA 2E74D 1O7GA 2XRXA 1L0LE 1WQLA 1ZRTE 1KB9E 4H0LD 4NB8D 4OGQD 2Q3WA 5HL4A 4P1CH 4QUQA 1RIEA 1SQVE 1G8KB 3L73E 4HM5A 3AZCA 4H13D 3VMID 4HM2A 1PPJE 4NBBD 3GZYA 4QDDA 4P1BH 3GCEA 5KKZC 1EG9A 1ULJA 2GBWA 3BCCE 2ZT9D 2NWFA 1O7WA 1NYKA 2HMKA 3H1JE 3DQYA 4AAYB 2BCCE 4QCKA 2DE5D 4NBAD 3VMGD 4NBDD 5AEWA 3GOBA 2NVFA 2A06E 2E76D 5BOKA 2E4QA 3D89A 2D2CD 3H1KE 2XR8A 4HKVA 3GTEA 3L72E 4EMJB 2JO6A 4HM1A 4PV1D 1NTME 1VM9A 1NDOA 1O7HA 3CWBE 3CX5E 3GKEA 4HM3A 4HM0A 4NBED 3FOUA 2FYUE 2NUMA 4QDCA 2HMJA 2YFIA 3L70E 2BMRA 4QUPA 1G8JB 1NTKE 1NU1E 2YFJA 1O7NA 3GL0A 3VMHD 4HM7A 1SQBE 2ZYLA 5KLVE 2CKFA 3EN1A 2HMOA 2E75D 2XSHA 2YIUC 4QDFB 5AEUA 1SQPE 1O7MA 1SQQE 1Q90C 2XSOA 2DE6D 4NBCD 3TGUE 3GTSA 4NBHD 3L75E 3EQQA 2E4PA 1BE3E 1L0NE 3H1LE 4HM8A 3VCPA 1UUVA 3H1HE 3L71E 1UUWA 2NUKA 2QJKC 2BMOA 2JZAA 2QJYC 4H44D 2I7FA 3GB4A 4PD4E 1VF5D 3GL2A 2HMMA 1BCCE 4HM6A 1EZVE 3L74E 2NVEA 3VCAA 2BMQA 2YFLA 4HJLA 1NTZE 2IBZE 1ULIA 3GZXA 4NBGD 1P84E 4QURA 1RFSA 2FYNC 4HM4A 1FQTA 4AIVA 1KYOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 D;  2B24 A;  3H1I E;  4U3F E;  4NBF D;  2YVJ B;  1O7P A;  4NB9 D;  3C0D A;  2QPZ A;  5CXM A;  3CXH E;  1SJG A;  1PP9 E;  1SQX E;  1JM1 A;  3N0Q A;  4QDF A;  2HMN A;  2QJP C;  2HML A;  2B1X A;  5KLI C;  2GBX A;  1VCK A;  2NVG A;  2E74 D;  1O7G A;  2XRX A;  1L0L E;  1WQL A;  1ZRT E;  1KB9 E;  4H0L D;  4NB8 D;  4OGQ D;  2Q3W A;  5HL4 A;  4P1C H;  4QUQ A;  1RIE A;  1SQV E;  1G8K B;  3L73 E;  4HM5 A;  3AZC A;  4H13 D;  3VMI D;  4HM2 A;  1PPJ E;  4NBB D;  3GZY A;  4QDD A;  4P1B H;  3GCE A;  5KKZ C;  1EG9 A;  1ULJ A;  2GBW A;  3BCC E;  2ZT9 D;  2NWF A;  1O7W A;  1NYK A;  2HMK A;  3H1J E;  3DQY A;  4AAY B;  2BCC E;  4QCK A;  2DE5 D;  4NBA D;  3VMG D;  4NBD D;  5AEW A;  3GOB A;  2NVF A;  2A06 E;  2E76 D;  5BOK A;  2E4Q A;  3D89 A;  2D2C D;  3H1K E;  2XR8 A;  4HKV A;  3GTE A;  3L72 E;  4EMJ B;  2JO6 A;  4HM1 A;  4PV1 D;  1NTM E;  1VM9 A;  1NDO A;  1O7H A;  3CWB E;  3CX5 E;  3GKE A;  4HM3 A;  4HM0 A;  4NBE D;  3FOU A;  2FYU E;  2NUM A;  4QDC A;  2HMJ A;  2YFI A;  3L70 E;  2BMR A;  4QUP A;  1G8J B;  1NTK E;  1NU1 E;  2YFJ A;  1O7N A;  3GL0 A;  3VMH D;  4HM7 A;  1SQB E;  2ZYL A;  5KLV E;  2CKF A;  3EN1 A;  2HMO A;  2E75 D;  2XSH A;  2YIU C;  4QDF B;  5AEU A;  1SQP E;  1O7M A;  1SQQ E;  1Q90 C;  2XSO A;  2DE6 D;  4NBC D;  3TGU E;  3GTS A;  4NBH D;  3L75 E;  3EQQ A;  2E4P A;  1BE3 E;  1L0N E;  3H1L E;  4HM8 A;  3VCP A;  1UUV A;  3H1H E;  3L71 E;  1UUW A;  2NUK A;  2QJK C;  2BMO A;  2JZA A;  2QJY C;  4H44 D;  2I7F A;  3GB4 A;  4PD4 E;  1VF5 D;  3GL2 A;  2HMM A;  1BCC E;  4HM6 A;  1EZV E;  3L74 E;  2NVE A;  3VCA A;  2BMQ A;  2YFL A;  4HJL A;  1NTZ E;  2IBZ E;  1ULI A;  3GZX A;  4NBG D;  1P84 E;  4QUR A;  1RFS A;  2FYN C;  4HM4 A;  1FQT A;  4AIV A;  1KYO E; 
#chains in the Genus database with same CATH topology
 2DE7 D;  2B24 A;  3H1I E;  4U3F E;  4NBF D;  2YVJ B;  1O7P A;  4NB9 D;  3C0D A;  2QPZ A;  5CXM A;  3CXH E;  1SJG A;  1PP9 E;  1SQX E;  1JM1 A;  3N0Q A;  4QDF A;  2HMN A;  2QJP C;  2HML A;  2B1X A;  5KLI C;  2GBX A;  1VCK A;  2NVG A;  2E74 D;  1O7G A;  2XRX A;  1L0L E;  1WQL A;  1ZRT E;  1KB9 E;  4H0L D;  4NB8 D;  4OGQ D;  2Q3W A;  5HL4 A;  4P1C H;  4QUQ A;  1RIE A;  1SQV E;  1G8K B;  3L73 E;  4HM5 A;  3AZC A;  4H13 D;  3VMI D;  4HM2 A;  1PPJ E;  4NBB D;  3GZY A;  4QDD A;  4P1B H;  3GCE A;  5KKZ C;  1EG9 A;  1ULJ A;  2GBW A;  3BCC E;  2ZT9 D;  2NWF A;  1O7W A;  1NYK A;  2HMK A;  3H1J E;  3DQY A;  4AAY B;  2BCC E;  4QCK A;  2DE5 D;  4NBA D;  3VMG D;  4NBD D;  5AEW A;  3GOB A;  2NVF A;  2A06 E;  2E76 D;  5BOK A;  2E4Q A;  3D89 A;  2D2C D;  3H1K E;  2XR8 A;  4HKV A;  3GTE A;  3L72 E;  4EMJ B;  2JO6 A;  4HM1 A;  4PV1 D;  1NTM E;  1VM9 A;  1NDO A;  1O7H A;  3CWB E;  3CX5 E;  3GKE A;  4HM3 A;  4HM0 A;  4NBE D;  3FOU A;  2FYU E;  2NUM A;  4QDC A;  2HMJ A;  2YFI A;  3L70 E;  2BMR A;  4QUP A;  1G8J B;  1NTK E;  1NU1 E;  2YFJ A;  1O7N A;  3GL0 A;  3VMH D;  4HM7 A;  1SQB E;  2ZYL A;  5KLV E;  2CKF A;  3EN1 A;  2HMO A;  2E75 D;  2XSH A;  2YIU C;  4QDF B;  5AEU A;  1SQP E;  1O7M A;  1SQQ E;  1Q90 C;  2XSO A;  2DE6 D;  4NBC D;  3TGU E;  3GTS A;  4NBH D;  3L75 E;  3EQQ A;  2E4P A;  1BE3 E;  1L0N E;  3H1L E;  4HM8 A;  3VCP A;  1UUV A;  3H1H E;  3L71 E;  1UUW A;  2NUK A;  2QJK C;  2BMO A;  2JZA A;  2QJY C;  4H44 D;  2I7F A;  3GB4 A;  4PD4 E;  1VF5 D;  3GL2 A;  2HMM A;  1BCC E;  4HM6 A;  1EZV E;  3L74 E;  2NVE A;  3VCA A;  2BMQ A;  2YFL A;  4HJL A;  1NTZ E;  2IBZ E;  1ULI A;  3GZX A;  4NBG D;  1P84 E;  4QUR A;  1RFS A;  2FYN C;  4HM4 A;  1FQT A;  4AIV A;  1KYO E; 
#chains in the Genus database with same CATH homology
 2DE7 D;  2B24 A;  3H1I E;  4U3F E;  4NBF D;  2YVJ B;  1O7P A;  4NB9 D;  3C0D A;  2QPZ A;  5CXM A;  3CXH E;  1SJG A;  1PP9 E;  1SQX E;  1JM1 A;  3N0Q A;  4QDF A;  2HMN A;  2QJP C;  2HML A;  2B1X A;  5KLI C;  2GBX A;  1VCK A;  2NVG A;  2E74 D;  1O7G A;  2XRX A;  1L0L E;  1WQL A;  1ZRT E;  1KB9 E;  4H0L D;  4NB8 D;  4OGQ D;  2Q3W A;  5HL4 A;  4P1C H;  4QUQ A;  1RIE A;  1SQV E;  1G8K B;  3L73 E;  4HM5 A;  3AZC A;  4H13 D;  3VMI D;  4HM2 A;  1PPJ E;  4NBB D;  3GZY A;  4QDD A;  4P1B H;  3GCE A;  5KKZ C;  1EG9 A;  1ULJ A;  2GBW A;  3BCC E;  2ZT9 D;  2NWF A;  1O7W A;  1NYK A;  2HMK A;  3H1J E;  3DQY A;  4AAY B;  2BCC E;  4QCK A;  2DE5 D;  4NBA D;  3VMG D;  4NBD D;  5AEW A;  3GOB A;  2NVF A;  2A06 E;  2E76 D;  5BOK A;  2E4Q A;  3D89 A;  2D2C D;  3H1K E;  2XR8 A;  4HKV A;  3GTE A;  3L72 E;  4EMJ B;  2JO6 A;  4HM1 A;  4PV1 D;  1NTM E;  1VM9 A;  1NDO A;  1O7H A;  3CWB E;  3CX5 E;  3GKE A;  4HM3 A;  4HM0 A;  4NBE D;  3FOU A;  2FYU E;  2NUM A;  4QDC A;  2HMJ A;  2YFI A;  3L70 E;  2BMR A;  4QUP A;  1G8J B;  1NTK E;  1NU1 E;  2YFJ A;  1O7N A;  3GL0 A;  3VMH D;  4HM7 A;  1SQB E;  2ZYL A;  5KLV E;  2CKF A;  3EN1 A;  2HMO A;  2E75 D;  2XSH A;  2YIU C;  4QDF B;  5AEU A;  1SQP E;  1O7M A;  1SQQ E;  1Q90 C;  2XSO A;  2DE6 D;  4NBC D;  3TGU E;  3GTS A;  4NBH D;  3L75 E;  3EQQ A;  2E4P A;  1BE3 E;  1L0N E;  3H1L E;  4HM8 A;  3VCP A;  1UUV A;  3H1H E;  3L71 E;  1UUW A;  2NUK A;  2QJK C;  2BMO A;  2JZA A;  2QJY C;  4H44 D;  2I7F A;  3GB4 A;  4PD4 E;  1VF5 D;  3GL2 A;  2HMM A;  1BCC E;  4HM6 A;  1EZV E;  3L74 E;  2NVE A;  3VCA A;  2BMQ A;  2YFL A;  4HJL A;  1NTZ E;  2IBZ E;  1ULI A;  3GZX A;  4NBG D;  1P84 E;  4QUR A;  1RFS A;  2FYN C;  4HM4 A;  1FQT A;  4AIV A;  1KYO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...