4AAYB

Crystal structure of the arsenite oxidase protein complex from rhizobium species strain nt-26
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
132
structure length
132
Chain Sequence
AAGVEYPANRLANISELTLNEPLDVAYPDEDAAGVLLKLGTRVEGGVGPDGDIVGFSTICPHKGFPLSYSADNKTFNCPGHFSVFDPEKGGQQVWGQATQNLPQYVLRVADNGDIFAEGVDELIYGRLSNVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROA
publication title The Respiratory Arsenite Oxidase: Structure and the Role of Residues Surrounding the Rieske Cluster.
pubmed doi rcsb
source organism Arsenite-oxidising bacterium nt-26
total genus 26
structure length 132
sequence length 132
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4aayB00
4AAYB 2E76D 4U3FE 2NVGA 3GTSA 3GB4A 2XSOA 2HMNA 2YFIA 1NTKE 3EQQA 5KLIC 1G8KB 1SQXE 3GZYA 2DE6D 3L75E 3L73E 1SQPE 3GL0A 3H1HE 2DE5D 3AZCA 3TGUE 2A06E 3D89A 2NVFA 1FQTA 1L0NE 2I7FA 2QJPC 3GL2A 4NBBD 4PV1D 1JM1A 4QDFA 3CWBE 1PP9E 2NUKA 3VCPA 1NYKA 4QCKA 4QDCA 2ZT9D 3GOBA 3CXHE 1O7MA 2B24A 2DE7D 1RIEA 4QUPA 1NU1E 3H1IE 5BOKA 2GBXA 2HMMA 4OGQD 2FYNC 2BMQA 2GBWA 3DQYA 3H1JE 4P1CH 4HKVA 3VMGD 1NDOA 3C0DA 3FOUA 4H13D 1SQQE 5KKZC 1KYOE 3GCEA 2FYUE 2XSHA 4NBCD 1P84E 5CXMA 1L0LE 4NBFD 3VMID 1SQBE 2Q3WA 1RFSA 2ZYLA 1ULIA 2JZAA 4HM5A 4AIVA 1ZRTE 2BMRA 2YFLA 4PD4E 2JO6A 4HJLA 4QDFB 3CX5E 3GZXA 4HM7A 3VCAA 3L72E 2XR8A 3N0QA 2E4PA 1EZVE 1SQVE 4QURA 1G8JB 1Q90C 3H1KE 2NWFA 3L74E 1BE3E 1VM9A 4HM8A 1O7GA 2D2CD 2NUMA 4NB8D 3VMHD 1SJGA 1NTZE 5AEWA 4HM6A 4HM1A 2BCCE 4NBDD 4NBHD 2E75D 4QDDA 1O7PA 2YVJB 3BCCE 4NB9D 2QJKC 1WQLA 3L71E 4H0LD 2E74D 4H44D 4HM4A 1UUVA 3EN1A 1O7HA 1ULJA 1BCCE 1O7WA 3GKEA 1UUWA 1EG9A 1VCKA 4NBGD 1O7NA 2HMLA 3H1LE 2QJYC 1NTME 5KLVE 4HM0A 2HMKA 4NBAD 4P1BH 1VF5D 2E4QA 2HMOA 2HMJA 2NVEA 2QPZA 4NBED 2XRXA 2B1XA 3L70E 2CKFA 5HL4A 5AEUA 2BMOA 2YFJA 1PPJE 2YIUC 4EMJB 2IBZE 4HM2A 3GTEA 4QUQA 1KB9E 4HM3A
chains in the Genus database with same CATH superfamily
4AAYB 2E76D 4U3FE 2NVGA 3GTSA 3GB4A 2XSOA 2HMNA 2YFIA 1NTKE 3EQQA 5KLIC 1G8KB 1SQXE 3GZYA 2DE6D 3L75E 3L73E 1SQPE 3GL0A 3H1HE 2DE5D 3AZCA 3TGUE 2A06E 3D89A 2NVFA 1FQTA 1L0NE 2I7FA 2QJPC 3GL2A 4NBBD 4PV1D 1JM1A 4QDFA 3CWBE 1PP9E 2NUKA 3VCPA 1NYKA 4QCKA 4QDCA 2ZT9D 3GOBA 3CXHE 1O7MA 2B24A 2DE7D 1RIEA 4QUPA 1NU1E 3H1IE 5BOKA 2GBXA 2HMMA 4OGQD 2FYNC 2BMQA 2GBWA 3DQYA 3H1JE 4P1CH 4HKVA 3VMGD 1NDOA 3C0DA 3FOUA 4H13D 1SQQE 5KKZC 1KYOE 3GCEA 2FYUE 2XSHA 4NBCD 1P84E 5CXMA 1L0LE 4NBFD 3VMID 1SQBE 2Q3WA 1RFSA 2ZYLA 1ULIA 2JZAA 4HM5A 4AIVA 1ZRTE 2BMRA 2YFLA 4PD4E 2JO6A 4HJLA 4QDFB 3CX5E 3GZXA 4HM7A 3VCAA 3L72E 2XR8A 3N0QA 2E4PA 1EZVE 1SQVE 4QURA 1G8JB 1Q90C 3H1KE 2NWFA 3L74E 1BE3E 1VM9A 4HM8A 1O7GA 2D2CD 2NUMA 4NB8D 3VMHD 1SJGA 1NTZE 5AEWA 4HM6A 4HM1A 2BCCE 4NBDD 4NBHD 2E75D 4QDDA 1O7PA 2YVJB 3BCCE 4NB9D 2QJKC 1WQLA 3L71E 4H0LD 2E74D 4H44D 4HM4A 1UUVA 3EN1A 1O7HA 1ULJA 1BCCE 1O7WA 3GKEA 1UUWA 1EG9A 1VCKA 4NBGD 1O7NA 2HMLA 3H1LE 2QJYC 1NTME 5KLVE 4HM0A 2HMKA 4NBAD 4P1BH 1VF5D 2E4QA 2HMOA 2HMJA 2NVEA 2QPZA 4NBED 2XRXA 2B1XA 3L70E 2CKFA 5HL4A 5AEUA 2BMOA 2YFJA 1PPJE 2YIUC 4EMJB 2IBZE 4HM2A 3GTEA 4QUQA 1KB9E 4HM3A
chains in the Genus database with same CATH topology
4AAYB 2E76D 4U3FE 2NVGA 3GTSA 3GB4A 2XSOA 2HMNA 2YFIA 1NTKE 3EQQA 5KLIC 1G8KB 1SQXE 3GZYA 2DE6D 3L75E 3L73E 1SQPE 3GL0A 3H1HE 2DE5D 3AZCA 3TGUE 2A06E 3D89A 2NVFA 1FQTA 1L0NE 2I7FA 2QJPC 3GL2A 4NBBD 4PV1D 1JM1A 4QDFA 3CWBE 1PP9E 2NUKA 3VCPA 1NYKA 4QCKA 4QDCA 2ZT9D 3GOBA 3CXHE 1O7MA 2B24A 2DE7D 1RIEA 4QUPA 1NU1E 3H1IE 5BOKA 2GBXA 2HMMA 4OGQD 2FYNC 2BMQA 2GBWA 3DQYA 3H1JE 4P1CH 4HKVA 3VMGD 1NDOA 3C0DA 3FOUA 4H13D 1SQQE 5KKZC 1KYOE 3GCEA 2FYUE 2XSHA 4NBCD 1P84E 5CXMA 1L0LE 4NBFD 3VMID 1SQBE 2Q3WA 1RFSA 2ZYLA 1ULIA 2JZAA 4HM5A 4AIVA 1ZRTE 2BMRA 2YFLA 4PD4E 2JO6A 4HJLA 4QDFB 3CX5E 3GZXA 4HM7A 3VCAA 3L72E 2XR8A 3N0QA 2E4PA 1EZVE 1SQVE 4QURA 1G8JB 1Q90C 3H1KE 2NWFA 3L74E 1BE3E 1VM9A 4HM8A 1O7GA 2D2CD 2NUMA 4NB8D 3VMHD 1SJGA 1NTZE 5AEWA 4HM6A 4HM1A 2BCCE 4NBDD 4NBHD 2E75D 4QDDA 1O7PA 2YVJB 3BCCE 4NB9D 2QJKC 1WQLA 3L71E 4H0LD 2E74D 4H44D 4HM4A 1UUVA 3EN1A 1O7HA 1ULJA 1BCCE 1O7WA 3GKEA 1UUWA 1EG9A 1VCKA 4NBGD 1O7NA 2HMLA 3H1LE 2QJYC 1NTME 5KLVE 4HM0A 2HMKA 4NBAD 4P1BH 1VF5D 2E4QA 2HMOA 2HMJA 2NVEA 2QPZA 4NBED 2XRXA 2B1XA 3L70E 2CKFA 5HL4A 5AEUA 2BMOA 2YFJA 1PPJE 2YIUC 4EMJB 2IBZE 4HM2A 3GTEA 4QUQA 1KB9E 4HM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAY B;  2E76 D;  4U3F E;  2NVG A;  3GTS A;  3GB4 A;  2XSO A;  2HMN A;  2YFI A;  1NTK E;  3EQQ A;  5KLI C;  1G8K B;  1SQX E;  3GZY A;  2DE6 D;  3L75 E;  3L73 E;  1SQP E;  3GL0 A;  3H1H E;  2DE5 D;  3AZC A;  3TGU E;  2A06 E;  3D89 A;  2NVF A;  1FQT A;  1L0N E;  2I7F A;  2QJP C;  3GL2 A;  4NBB D;  4PV1 D;  1JM1 A;  4QDF A;  3CWB E;  1PP9 E;  2NUK A;  3VCP A;  1NYK A;  4QCK A;  4QDC A;  2ZT9 D;  3GOB A;  3CXH E;  1O7M A;  2B24 A;  2DE7 D;  1RIE A;  4QUP A;  1NU1 E;  3H1I E;  5BOK A;  2GBX A;  2HMM A;  4OGQ D;  2FYN C;  2BMQ A;  2GBW A;  3DQY A;  3H1J E;  4P1C H;  4HKV A;  3VMG D;  1NDO A;  3C0D A;  3FOU A;  4H13 D;  1SQQ E;  5KKZ C;  1KYO E;  3GCE A;  2FYU E;  2XSH A;  4NBC D;  1P84 E;  5CXM A;  1L0L E;  4NBF D;  3VMI D;  1SQB E;  2Q3W A;  1RFS A;  2ZYL A;  1ULI A;  2JZA A;  4HM5 A;  4AIV A;  1ZRT E;  2BMR A;  2YFL A;  4PD4 E;  2JO6 A;  4HJL A;  4QDF B;  3CX5 E;  3GZX A;  4HM7 A;  3VCA A;  3L72 E;  2XR8 A;  3N0Q A;  2E4P A;  1EZV E;  1SQV E;  4QUR A;  1G8J B;  1Q90 C;  3H1K E;  2NWF A;  3L74 E;  1BE3 E;  1VM9 A;  4HM8 A;  1O7G A;  2D2C D;  2NUM A;  4NB8 D;  3VMH D;  1SJG A;  1NTZ E;  5AEW A;  4HM6 A;  4HM1 A;  2BCC E;  4NBD D;  4NBH D;  2E75 D;  4QDD A;  1O7P A;  2YVJ B;  3BCC E;  4NB9 D;  2QJK C;  1WQL A;  3L71 E;  4H0L D;  2E74 D;  4H44 D;  4HM4 A;  1UUV A;  3EN1 A;  1O7H A;  1ULJ A;  1BCC E;  1O7W A;  3GKE A;  1UUW A;  1EG9 A;  1VCK A;  4NBG D;  1O7N A;  2HML A;  3H1L E;  2QJY C;  1NTM E;  5KLV E;  4HM0 A;  2HMK A;  4NBA D;  4P1B H;  1VF5 D;  2E4Q A;  2HMO A;  2HMJ A;  2NVE A;  2QPZ A;  4NBE D;  2XRX A;  2B1X A;  3L70 E;  2CKF A;  5HL4 A;  5AEU A;  2BMO A;  2YFJ A;  1PPJ E;  2YIU C;  4EMJ B;  2IBZ E;  4HM2 A;  3GTE A;  4QUQ A;  1KB9 E;  4HM3 A; 
#chains in the Genus database with same CATH topology
 4AAY B;  2E76 D;  4U3F E;  2NVG A;  3GTS A;  3GB4 A;  2XSO A;  2HMN A;  2YFI A;  1NTK E;  3EQQ A;  5KLI C;  1G8K B;  1SQX E;  3GZY A;  2DE6 D;  3L75 E;  3L73 E;  1SQP E;  3GL0 A;  3H1H E;  2DE5 D;  3AZC A;  3TGU E;  2A06 E;  3D89 A;  2NVF A;  1FQT A;  1L0N E;  2I7F A;  2QJP C;  3GL2 A;  4NBB D;  4PV1 D;  1JM1 A;  4QDF A;  3CWB E;  1PP9 E;  2NUK A;  3VCP A;  1NYK A;  4QCK A;  4QDC A;  2ZT9 D;  3GOB A;  3CXH E;  1O7M A;  2B24 A;  2DE7 D;  1RIE A;  4QUP A;  1NU1 E;  3H1I E;  5BOK A;  2GBX A;  2HMM A;  4OGQ D;  2FYN C;  2BMQ A;  2GBW A;  3DQY A;  3H1J E;  4P1C H;  4HKV A;  3VMG D;  1NDO A;  3C0D A;  3FOU A;  4H13 D;  1SQQ E;  5KKZ C;  1KYO E;  3GCE A;  2FYU E;  2XSH A;  4NBC D;  1P84 E;  5CXM A;  1L0L E;  4NBF D;  3VMI D;  1SQB E;  2Q3W A;  1RFS A;  2ZYL A;  1ULI A;  2JZA A;  4HM5 A;  4AIV A;  1ZRT E;  2BMR A;  2YFL A;  4PD4 E;  2JO6 A;  4HJL A;  4QDF B;  3CX5 E;  3GZX A;  4HM7 A;  3VCA A;  3L72 E;  2XR8 A;  3N0Q A;  2E4P A;  1EZV E;  1SQV E;  4QUR A;  1G8J B;  1Q90 C;  3H1K E;  2NWF A;  3L74 E;  1BE3 E;  1VM9 A;  4HM8 A;  1O7G A;  2D2C D;  2NUM A;  4NB8 D;  3VMH D;  1SJG A;  1NTZ E;  5AEW A;  4HM6 A;  4HM1 A;  2BCC E;  4NBD D;  4NBH D;  2E75 D;  4QDD A;  1O7P A;  2YVJ B;  3BCC E;  4NB9 D;  2QJK C;  1WQL A;  3L71 E;  4H0L D;  2E74 D;  4H44 D;  4HM4 A;  1UUV A;  3EN1 A;  1O7H A;  1ULJ A;  1BCC E;  1O7W A;  3GKE A;  1UUW A;  1EG9 A;  1VCK A;  4NBG D;  1O7N A;  2HML A;  3H1L E;  2QJY C;  1NTM E;  5KLV E;  4HM0 A;  2HMK A;  4NBA D;  4P1B H;  1VF5 D;  2E4Q A;  2HMO A;  2HMJ A;  2NVE A;  2QPZ A;  4NBE D;  2XRX A;  2B1X A;  3L70 E;  2CKF A;  5HL4 A;  5AEU A;  2BMO A;  2YFJ A;  1PPJ E;  2YIU C;  4EMJ B;  2IBZ E;  4HM2 A;  3GTE A;  4QUQ A;  1KB9 E;  4HM3 A; 
#chains in the Genus database with same CATH homology
 4AAY B;  2E76 D;  4U3F E;  2NVG A;  3GTS A;  3GB4 A;  2XSO A;  2HMN A;  2YFI A;  1NTK E;  3EQQ A;  5KLI C;  1G8K B;  1SQX E;  3GZY A;  2DE6 D;  3L75 E;  3L73 E;  1SQP E;  3GL0 A;  3H1H E;  2DE5 D;  3AZC A;  3TGU E;  2A06 E;  3D89 A;  2NVF A;  1FQT A;  1L0N E;  2I7F A;  2QJP C;  3GL2 A;  4NBB D;  4PV1 D;  1JM1 A;  4QDF A;  3CWB E;  1PP9 E;  2NUK A;  3VCP A;  1NYK A;  4QCK A;  4QDC A;  2ZT9 D;  3GOB A;  3CXH E;  1O7M A;  2B24 A;  2DE7 D;  1RIE A;  4QUP A;  1NU1 E;  3H1I E;  5BOK A;  2GBX A;  2HMM A;  4OGQ D;  2FYN C;  2BMQ A;  2GBW A;  3DQY A;  3H1J E;  4P1C H;  4HKV A;  3VMG D;  1NDO A;  3C0D A;  3FOU A;  4H13 D;  1SQQ E;  5KKZ C;  1KYO E;  3GCE A;  2FYU E;  2XSH A;  4NBC D;  1P84 E;  5CXM A;  1L0L E;  4NBF D;  3VMI D;  1SQB E;  2Q3W A;  1RFS A;  2ZYL A;  1ULI A;  2JZA A;  4HM5 A;  4AIV A;  1ZRT E;  2BMR A;  2YFL A;  4PD4 E;  2JO6 A;  4HJL A;  4QDF B;  3CX5 E;  3GZX A;  4HM7 A;  3VCA A;  3L72 E;  2XR8 A;  3N0Q A;  2E4P A;  1EZV E;  1SQV E;  4QUR A;  1G8J B;  1Q90 C;  3H1K E;  2NWF A;  3L74 E;  1BE3 E;  1VM9 A;  4HM8 A;  1O7G A;  2D2C D;  2NUM A;  4NB8 D;  3VMH D;  1SJG A;  1NTZ E;  5AEW A;  4HM6 A;  4HM1 A;  2BCC E;  4NBD D;  4NBH D;  2E75 D;  4QDD A;  1O7P A;  2YVJ B;  3BCC E;  4NB9 D;  2QJK C;  1WQL A;  3L71 E;  4H0L D;  2E74 D;  4H44 D;  4HM4 A;  1UUV A;  3EN1 A;  1O7H A;  1ULJ A;  1BCC E;  1O7W A;  3GKE A;  1UUW A;  1EG9 A;  1VCK A;  4NBG D;  1O7N A;  2HML A;  3H1L E;  2QJY C;  1NTM E;  5KLV E;  4HM0 A;  2HMK A;  4NBA D;  4P1B H;  1VF5 D;  2E4Q A;  2HMO A;  2HMJ A;  2NVE A;  2QPZ A;  4NBE D;  2XRX A;  2B1X A;  3L70 E;  2CKF A;  5HL4 A;  5AEU A;  2BMO A;  2YFJ A;  1PPJ E;  2YIU C;  4EMJ B;  2IBZ E;  4HM2 A;  3GTE A;  4QUQ A;  1KB9 E;  4HM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...