2NVFA

Soluble domain of rieske iron-sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGCHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvfA00
3L74E 2NVEA 4NBHD 2BMQA 1UUVA 1O7GA 4HM7A 2ZYLA 2NUMA 3L72E 2XRXA 2YFLA 2ZT9D 5AEUA 2A06E 1NU1E 2BCCE 1O7HA 2IBZE 4NBAD 3FOUA 1EZVE 2HMMA 1BCCE 1P84E 1G8JB 2XR8A 2DE6D 4NBFD 2GBXA 1RIEA 2B1XA 2HMOA 2E75D 4U3FE 1PP9E 5KLVE 4QCKA 4NBDD 3VCPA 1ULIA 4QUQA 2XSOA 3DQYA 3H1KE 4QUPA 1L0NE 4NB8D 1SQXE 3CX5E 2HMLA 4HM6A 4HJLA 3GTSA 4NB9D 2E4QA 1L0LE 4NBED 1FQTA 2DE5D 3GZXA 3H1HE 4QDCA 3TGUE 3GCEA 4HM4A 3CXHE 3AZCA 1ULJA 2NVGA 1SQPE 2FYUE 3H1JE 5KLIC 4HM5A 3GZYA 2NVFA 4HM1A 2I7FA 1SJGA 3GL0A 2DE7D 5BOKA 1VM9A 1SQBE 2QJPC 3GTEA 1EG9A 2QJYC 1NTZE 1Q90C 4HM8A 1O7WA 1UUWA 3GOBA 3EQQA 3H1LE 3VMHD 4HM2A 2XSHA 1O7PA 1NYKA 1JM1A 4H13D 1ZRTE 2BMOA 1KB9E 2NUKA 1VF5D 2NWFA 3VMID 4NBBD 4QDFA 3N0QA 3C0DA 2BMRA 2HMNA 3EN1A 3L75E 3D89A 2YFIA 4QURA 1NTME 4NBCD 3BCCE 2QPZA 2HMKA 4AAYB 1WQLA 3CWBE 3GKEA 1BE3E 4OGQD 1NTKE 1SQVE 2HMJA 2CKFA 4H44D 2GBWA 2YIUC 4QDFB 1NDOA 2E74D 4H0LD 1SQQE 2JZAA 3L73E 3VMGD 2E4PA 4P1CH 3L70E 4P1BH 5HL4A 4HKVA 3GL2A 1VCKA 2JO6A 2E76D 2Q3WA 1O7NA 4EMJB 4NBGD 3H1IE 1O7MA 1G8KB 1RFSA 2B24A 3L71E 3VCAA 3GB4A 2FYNC 4PD4E 1PPJE 4PV1D 4AIVA 2YVJB 2YFJA 5AEWA 4HM0A 2D2CD 5KKZC 4QDDA 4HM3A 1KYOE 2QJKC 5CXMA
chains in the Genus database with same CATH superfamily
3L74E 2NVEA 4NBHD 2BMQA 1UUVA 1O7GA 4HM7A 2ZYLA 2NUMA 3L72E 2XRXA 2YFLA 2ZT9D 5AEUA 2A06E 1NU1E 2BCCE 1O7HA 2IBZE 4NBAD 3FOUA 1EZVE 2HMMA 1BCCE 1P84E 1G8JB 2XR8A 2DE6D 4NBFD 2GBXA 1RIEA 2B1XA 2HMOA 2E75D 4U3FE 1PP9E 5KLVE 4QCKA 4NBDD 3VCPA 1ULIA 4QUQA 2XSOA 3DQYA 3H1KE 4QUPA 1L0NE 4NB8D 1SQXE 3CX5E 2HMLA 4HM6A 4HJLA 3GTSA 4NB9D 2E4QA 1L0LE 4NBED 1FQTA 2DE5D 3GZXA 3H1HE 4QDCA 3TGUE 3GCEA 4HM4A 3CXHE 3AZCA 1ULJA 2NVGA 1SQPE 2FYUE 3H1JE 5KLIC 4HM5A 3GZYA 2NVFA 4HM1A 2I7FA 1SJGA 3GL0A 2DE7D 5BOKA 1VM9A 1SQBE 2QJPC 3GTEA 1EG9A 2QJYC 1NTZE 1Q90C 4HM8A 1O7WA 1UUWA 3GOBA 3EQQA 3H1LE 3VMHD 4HM2A 2XSHA 1O7PA 1NYKA 1JM1A 4H13D 1ZRTE 2BMOA 1KB9E 2NUKA 1VF5D 2NWFA 3VMID 4NBBD 4QDFA 3N0QA 3C0DA 2BMRA 2HMNA 3EN1A 3L75E 3D89A 2YFIA 4QURA 1NTME 4NBCD 3BCCE 2QPZA 2HMKA 4AAYB 1WQLA 3CWBE 3GKEA 1BE3E 4OGQD 1NTKE 1SQVE 2HMJA 2CKFA 4H44D 2GBWA 2YIUC 4QDFB 1NDOA 2E74D 4H0LD 1SQQE 2JZAA 3L73E 3VMGD 2E4PA 4P1CH 3L70E 4P1BH 5HL4A 4HKVA 3GL2A 1VCKA 2JO6A 2E76D 2Q3WA 1O7NA 4EMJB 4NBGD 3H1IE 1O7MA 1G8KB 1RFSA 2B24A 3L71E 3VCAA 3GB4A 2FYNC 4PD4E 1PPJE 4PV1D 4AIVA 2YVJB 2YFJA 5AEWA 4HM0A 2D2CD 5KKZC 4QDDA 4HM3A 1KYOE 2QJKC 5CXMA
chains in the Genus database with same CATH topology
3L74E 2NVEA 4NBHD 2BMQA 1UUVA 1O7GA 4HM7A 2ZYLA 2NUMA 3L72E 2XRXA 2YFLA 2ZT9D 5AEUA 2A06E 1NU1E 2BCCE 1O7HA 2IBZE 4NBAD 3FOUA 1EZVE 2HMMA 1BCCE 1P84E 1G8JB 2XR8A 2DE6D 4NBFD 2GBXA 1RIEA 2B1XA 2HMOA 2E75D 4U3FE 1PP9E 5KLVE 4QCKA 4NBDD 3VCPA 1ULIA 4QUQA 2XSOA 3DQYA 3H1KE 4QUPA 1L0NE 4NB8D 1SQXE 3CX5E 2HMLA 4HM6A 4HJLA 3GTSA 4NB9D 2E4QA 1L0LE 4NBED 1FQTA 2DE5D 3GZXA 3H1HE 4QDCA 3TGUE 3GCEA 4HM4A 3CXHE 3AZCA 1ULJA 2NVGA 1SQPE 2FYUE 3H1JE 5KLIC 4HM5A 3GZYA 2NVFA 4HM1A 2I7FA 1SJGA 3GL0A 2DE7D 5BOKA 1VM9A 1SQBE 2QJPC 3GTEA 1EG9A 2QJYC 1NTZE 1Q90C 4HM8A 1O7WA 1UUWA 3GOBA 3EQQA 3H1LE 3VMHD 4HM2A 2XSHA 1O7PA 1NYKA 1JM1A 4H13D 1ZRTE 2BMOA 1KB9E 2NUKA 1VF5D 2NWFA 3VMID 4NBBD 4QDFA 3N0QA 3C0DA 2BMRA 2HMNA 3EN1A 3L75E 3D89A 2YFIA 4QURA 1NTME 4NBCD 3BCCE 2QPZA 2HMKA 4AAYB 1WQLA 3CWBE 3GKEA 1BE3E 4OGQD 1NTKE 1SQVE 2HMJA 2CKFA 4H44D 2GBWA 2YIUC 4QDFB 1NDOA 2E74D 4H0LD 1SQQE 2JZAA 3L73E 3VMGD 2E4PA 4P1CH 3L70E 4P1BH 5HL4A 4HKVA 3GL2A 1VCKA 2JO6A 2E76D 2Q3WA 1O7NA 4EMJB 4NBGD 3H1IE 1O7MA 1G8KB 1RFSA 2B24A 3L71E 3VCAA 3GB4A 2FYNC 4PD4E 1PPJE 4PV1D 4AIVA 2YVJB 2YFJA 5AEWA 4HM0A 2D2CD 5KKZC 4QDDA 4HM3A 1KYOE 2QJKC 5CXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 E;  2NVE A;  4NBH D;  2BMQ A;  1UUV A;  1O7G A;  4HM7 A;  2ZYL A;  2NUM A;  3L72 E;  2XRX A;  2YFL A;  2ZT9 D;  5AEU A;  2A06 E;  1NU1 E;  2BCC E;  1O7H A;  2IBZ E;  4NBA D;  3FOU A;  1EZV E;  2HMM A;  1BCC E;  1P84 E;  1G8J B;  2XR8 A;  2DE6 D;  4NBF D;  2GBX A;  1RIE A;  2B1X A;  2HMO A;  2E75 D;  4U3F E;  1PP9 E;  5KLV E;  4QCK A;  4NBD D;  3VCP A;  1ULI A;  4QUQ A;  2XSO A;  3DQY A;  3H1K E;  4QUP A;  1L0N E;  4NB8 D;  1SQX E;  3CX5 E;  2HML A;  4HM6 A;  4HJL A;  3GTS A;  4NB9 D;  2E4Q A;  1L0L E;  4NBE D;  1FQT A;  2DE5 D;  3GZX A;  3H1H E;  4QDC A;  3TGU E;  3GCE A;  4HM4 A;  3CXH E;  3AZC A;  1ULJ A;  2NVG A;  1SQP E;  2FYU E;  3H1J E;  5KLI C;  4HM5 A;  3GZY A;  2NVF A;  4HM1 A;  2I7F A;  1SJG A;  3GL0 A;  2DE7 D;  5BOK A;  1VM9 A;  1SQB E;  2QJP C;  3GTE A;  1EG9 A;  2QJY C;  1NTZ E;  1Q90 C;  4HM8 A;  1O7W A;  1UUW A;  3GOB A;  3EQQ A;  3H1L E;  3VMH D;  4HM2 A;  2XSH A;  1O7P A;  1NYK A;  1JM1 A;  4H13 D;  1ZRT E;  2BMO A;  1KB9 E;  2NUK A;  1VF5 D;  2NWF A;  3VMI D;  4NBB D;  4QDF A;  3N0Q A;  3C0D A;  2BMR A;  2HMN A;  3EN1 A;  3L75 E;  3D89 A;  2YFI A;  4QUR A;  1NTM E;  4NBC D;  3BCC E;  2QPZ A;  2HMK A;  4AAY B;  1WQL A;  3CWB E;  3GKE A;  1BE3 E;  4OGQ D;  1NTK E;  1SQV E;  2HMJ A;  2CKF A;  4H44 D;  2GBW A;  2YIU C;  4QDF B;  1NDO A;  2E74 D;  4H0L D;  1SQQ E;  2JZA A;  3L73 E;  3VMG D;  2E4P A;  4P1C H;  3L70 E;  4P1B H;  5HL4 A;  4HKV A;  3GL2 A;  1VCK A;  2JO6 A;  2E76 D;  2Q3W A;  1O7N A;  4EMJ B;  4NBG D;  3H1I E;  1O7M A;  1G8K B;  1RFS A;  2B24 A;  3L71 E;  3VCA A;  3GB4 A;  2FYN C;  4PD4 E;  1PPJ E;  4PV1 D;  4AIV A;  2YVJ B;  2YFJ A;  5AEW A;  4HM0 A;  2D2C D;  5KKZ C;  4QDD A;  4HM3 A;  1KYO E;  2QJK C;  5CXM A; 
#chains in the Genus database with same CATH topology
 3L74 E;  2NVE A;  4NBH D;  2BMQ A;  1UUV A;  1O7G A;  4HM7 A;  2ZYL A;  2NUM A;  3L72 E;  2XRX A;  2YFL A;  2ZT9 D;  5AEU A;  2A06 E;  1NU1 E;  2BCC E;  1O7H A;  2IBZ E;  4NBA D;  3FOU A;  1EZV E;  2HMM A;  1BCC E;  1P84 E;  1G8J B;  2XR8 A;  2DE6 D;  4NBF D;  2GBX A;  1RIE A;  2B1X A;  2HMO A;  2E75 D;  4U3F E;  1PP9 E;  5KLV E;  4QCK A;  4NBD D;  3VCP A;  1ULI A;  4QUQ A;  2XSO A;  3DQY A;  3H1K E;  4QUP A;  1L0N E;  4NB8 D;  1SQX E;  3CX5 E;  2HML A;  4HM6 A;  4HJL A;  3GTS A;  4NB9 D;  2E4Q A;  1L0L E;  4NBE D;  1FQT A;  2DE5 D;  3GZX A;  3H1H E;  4QDC A;  3TGU E;  3GCE A;  4HM4 A;  3CXH E;  3AZC A;  1ULJ A;  2NVG A;  1SQP E;  2FYU E;  3H1J E;  5KLI C;  4HM5 A;  3GZY A;  2NVF A;  4HM1 A;  2I7F A;  1SJG A;  3GL0 A;  2DE7 D;  5BOK A;  1VM9 A;  1SQB E;  2QJP C;  3GTE A;  1EG9 A;  2QJY C;  1NTZ E;  1Q90 C;  4HM8 A;  1O7W A;  1UUW A;  3GOB A;  3EQQ A;  3H1L E;  3VMH D;  4HM2 A;  2XSH A;  1O7P A;  1NYK A;  1JM1 A;  4H13 D;  1ZRT E;  2BMO A;  1KB9 E;  2NUK A;  1VF5 D;  2NWF A;  3VMI D;  4NBB D;  4QDF A;  3N0Q A;  3C0D A;  2BMR A;  2HMN A;  3EN1 A;  3L75 E;  3D89 A;  2YFI A;  4QUR A;  1NTM E;  4NBC D;  3BCC E;  2QPZ A;  2HMK A;  4AAY B;  1WQL A;  3CWB E;  3GKE A;  1BE3 E;  4OGQ D;  1NTK E;  1SQV E;  2HMJ A;  2CKF A;  4H44 D;  2GBW A;  2YIU C;  4QDF B;  1NDO A;  2E74 D;  4H0L D;  1SQQ E;  2JZA A;  3L73 E;  3VMG D;  2E4P A;  4P1C H;  3L70 E;  4P1B H;  5HL4 A;  4HKV A;  3GL2 A;  1VCK A;  2JO6 A;  2E76 D;  2Q3W A;  1O7N A;  4EMJ B;  4NBG D;  3H1I E;  1O7M A;  1G8K B;  1RFS A;  2B24 A;  3L71 E;  3VCA A;  3GB4 A;  2FYN C;  4PD4 E;  1PPJ E;  4PV1 D;  4AIV A;  2YVJ B;  2YFJ A;  5AEW A;  4HM0 A;  2D2C D;  5KKZ C;  4QDD A;  4HM3 A;  1KYO E;  2QJK C;  5CXM A; 
#chains in the Genus database with same CATH homology
 3L74 E;  2NVE A;  4NBH D;  2BMQ A;  1UUV A;  1O7G A;  4HM7 A;  2ZYL A;  2NUM A;  3L72 E;  2XRX A;  2YFL A;  2ZT9 D;  5AEU A;  2A06 E;  1NU1 E;  2BCC E;  1O7H A;  2IBZ E;  4NBA D;  3FOU A;  1EZV E;  2HMM A;  1BCC E;  1P84 E;  1G8J B;  2XR8 A;  2DE6 D;  4NBF D;  2GBX A;  1RIE A;  2B1X A;  2HMO A;  2E75 D;  4U3F E;  1PP9 E;  5KLV E;  4QCK A;  4NBD D;  3VCP A;  1ULI A;  4QUQ A;  2XSO A;  3DQY A;  3H1K E;  4QUP A;  1L0N E;  4NB8 D;  1SQX E;  3CX5 E;  2HML A;  4HM6 A;  4HJL A;  3GTS A;  4NB9 D;  2E4Q A;  1L0L E;  4NBE D;  1FQT A;  2DE5 D;  3GZX A;  3H1H E;  4QDC A;  3TGU E;  3GCE A;  4HM4 A;  3CXH E;  3AZC A;  1ULJ A;  2NVG A;  1SQP E;  2FYU E;  3H1J E;  5KLI C;  4HM5 A;  3GZY A;  2NVF A;  4HM1 A;  2I7F A;  1SJG A;  3GL0 A;  2DE7 D;  5BOK A;  1VM9 A;  1SQB E;  2QJP C;  3GTE A;  1EG9 A;  2QJY C;  1NTZ E;  1Q90 C;  4HM8 A;  1O7W A;  1UUW A;  3GOB A;  3EQQ A;  3H1L E;  3VMH D;  4HM2 A;  2XSH A;  1O7P A;  1NYK A;  1JM1 A;  4H13 D;  1ZRT E;  2BMO A;  1KB9 E;  2NUK A;  1VF5 D;  2NWF A;  3VMI D;  4NBB D;  4QDF A;  3N0Q A;  3C0D A;  2BMR A;  2HMN A;  3EN1 A;  3L75 E;  3D89 A;  2YFI A;  4QUR A;  1NTM E;  4NBC D;  3BCC E;  2QPZ A;  2HMK A;  4AAY B;  1WQL A;  3CWB E;  3GKE A;  1BE3 E;  4OGQ D;  1NTK E;  1SQV E;  2HMJ A;  2CKF A;  4H44 D;  2GBW A;  2YIU C;  4QDF B;  1NDO A;  2E74 D;  4H0L D;  1SQQ E;  2JZA A;  3L73 E;  3VMG D;  2E4P A;  4P1C H;  3L70 E;  4P1B H;  5HL4 A;  4HKV A;  3GL2 A;  1VCK A;  2JO6 A;  2E76 D;  2Q3W A;  1O7N A;  4EMJ B;  4NBG D;  3H1I E;  1O7M A;  1G8K B;  1RFS A;  2B24 A;  3L71 E;  3VCA A;  3GB4 A;  2FYN C;  4PD4 E;  1PPJ E;  4PV1 D;  4AIV A;  2YVJ B;  2YFJ A;  5AEW A;  4HM0 A;  2D2C D;  5KKZ C;  4QDD A;  4HM3 A;  1KYO E;  2QJK C;  5CXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...