2NVFA

Soluble domain of rieske iron-sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGCHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvfA00
2FYNC 1BE3E 1UUVA 3L71E 2XSHA 5KLIC 2XR8A 2BCCE 4NBED 2YIUC 4NBCD 4NBFD 4U3FE 1NTZE 2NVFA 2HMMA 2GBXA 3BCCE 3H1JE 4PD4E 3GZXA 4QCKA 1ULIA 3EQQA 1EZVE 3FOUA 4OGQD 1O7WA 2NVGA 2GBWA 4HJLA 2E75D 3GOBA 2XRXA 1L0NE 4NBBD 3L72E 5AEUA 4AIVA 4HM3A 1UUWA 3GZYA 4QDCA 4QUPA 2CKFA 2BMRA 1ZRTE 5HL4A 5KKZC 2YFLA 4QUQA 3VCPA 1P84E 1NTME 2I7FA 1SQVE 2B24A 2E76D 4PV1D 2BMOA 3GL2A 1G8KB 1SQQE 3L75E 3GKEA 2HMNA 3GCEA 1KYOE 1PPJE 1NU1E 2D2CD 5CXMA 1RFSA 4QDDA 2B1XA 4H44D 4QURA 4P1CH 4HM0A 2XSOA 4NBHD 4NBDD 1VM9A 2DE5D 4NB9D 3CX5E 3N0QA 3VCAA 1NYKA 1JM1A 1O7PA 1SQXE 2NUMA 4HM7A 1L0LE 1BCCE 3GB4A 4NB8D 2QPZA 3D89A 3CWBE 3C0DA 3H1HE 2IBZE 4HM5A 1G8JB 3VMGD 2HMKA 4HM1A 1PP9E 3GTSA 2QJYC 1ULJA 4NBGD 1O7MA 2DE7D 1Q90C 1SQBE 3H1KE 1RIEA 1VCKA 2E4QA 2QJKC 3H1LE 3L74E 1NDOA 1FQTA 4HM8A 2JO6A 2HMLA 4HM4A 3VMID 1KB9E 1SQPE 2E4PA 2NVEA 3GTEA 2YFJA 4H13D 5BOKA 3DQYA 3EN1A 4QDFB 3VMHD 4AAYB 3TGUE 2HMJA 5KLVE 2NWFA 3L73E 4HM6A 1VF5D 1NTKE 4H0LD 2ZT9D 3CXHE 4NBAD 2JZAA 1SJGA 1WQLA 2YVJB 3GL0A 1EG9A 2BMQA 4HKVA 4HM2A 1O7GA 4EMJB 2E74D 3L70E 4QDFA 2YFIA 2Q3WA 2DE6D 3AZCA 2NUKA 1O7HA 2FYUE 4P1BH 5AEWA 2QJPC 1O7NA 2A06E 2ZYLA 2HMOA 3H1IE
chains in the Genus database with same CATH superfamily
2FYNC 1BE3E 1UUVA 3L71E 2XSHA 5KLIC 2XR8A 2BCCE 4NBED 2YIUC 4NBCD 4NBFD 4U3FE 1NTZE 2NVFA 2HMMA 2GBXA 3BCCE 3H1JE 4PD4E 3GZXA 4QCKA 1ULIA 3EQQA 1EZVE 3FOUA 4OGQD 1O7WA 2NVGA 2GBWA 4HJLA 2E75D 3GOBA 2XRXA 1L0NE 4NBBD 3L72E 5AEUA 4AIVA 4HM3A 1UUWA 3GZYA 4QDCA 4QUPA 2CKFA 2BMRA 1ZRTE 5HL4A 5KKZC 2YFLA 4QUQA 3VCPA 1P84E 1NTME 2I7FA 1SQVE 2B24A 2E76D 4PV1D 2BMOA 3GL2A 1G8KB 1SQQE 3L75E 3GKEA 2HMNA 3GCEA 1KYOE 1PPJE 1NU1E 2D2CD 5CXMA 1RFSA 4QDDA 2B1XA 4H44D 4QURA 4P1CH 4HM0A 2XSOA 4NBHD 4NBDD 1VM9A 2DE5D 4NB9D 3CX5E 3N0QA 3VCAA 1NYKA 1JM1A 1O7PA 1SQXE 2NUMA 4HM7A 1L0LE 1BCCE 3GB4A 4NB8D 2QPZA 3D89A 3CWBE 3C0DA 3H1HE 2IBZE 4HM5A 1G8JB 3VMGD 2HMKA 4HM1A 1PP9E 3GTSA 2QJYC 1ULJA 4NBGD 1O7MA 2DE7D 1Q90C 1SQBE 3H1KE 1RIEA 1VCKA 2E4QA 2QJKC 3H1LE 3L74E 1NDOA 1FQTA 4HM8A 2JO6A 2HMLA 4HM4A 3VMID 1KB9E 1SQPE 2E4PA 2NVEA 3GTEA 2YFJA 4H13D 5BOKA 3DQYA 3EN1A 4QDFB 3VMHD 4AAYB 3TGUE 2HMJA 5KLVE 2NWFA 3L73E 4HM6A 1VF5D 1NTKE 4H0LD 2ZT9D 3CXHE 4NBAD 2JZAA 1SJGA 1WQLA 2YVJB 3GL0A 1EG9A 2BMQA 4HKVA 4HM2A 1O7GA 4EMJB 2E74D 3L70E 4QDFA 2YFIA 2Q3WA 2DE6D 3AZCA 2NUKA 1O7HA 2FYUE 4P1BH 5AEWA 2QJPC 1O7NA 2A06E 2ZYLA 2HMOA 3H1IE
chains in the Genus database with same CATH topology
2FYNC 1BE3E 1UUVA 3L71E 2XSHA 5KLIC 2XR8A 2BCCE 4NBED 2YIUC 4NBCD 4NBFD 4U3FE 1NTZE 2NVFA 2HMMA 2GBXA 3BCCE 3H1JE 4PD4E 3GZXA 4QCKA 1ULIA 3EQQA 1EZVE 3FOUA 4OGQD 1O7WA 2NVGA 2GBWA 4HJLA 2E75D 3GOBA 2XRXA 1L0NE 4NBBD 3L72E 5AEUA 4AIVA 4HM3A 1UUWA 3GZYA 4QDCA 4QUPA 2CKFA 2BMRA 1ZRTE 5HL4A 5KKZC 2YFLA 4QUQA 3VCPA 1P84E 1NTME 2I7FA 1SQVE 2B24A 2E76D 4PV1D 2BMOA 3GL2A 1G8KB 1SQQE 3L75E 3GKEA 2HMNA 3GCEA 1KYOE 1PPJE 1NU1E 2D2CD 5CXMA 1RFSA 4QDDA 2B1XA 4H44D 4QURA 4P1CH 4HM0A 2XSOA 4NBHD 4NBDD 1VM9A 2DE5D 4NB9D 3CX5E 3N0QA 3VCAA 1NYKA 1JM1A 1O7PA 1SQXE 2NUMA 4HM7A 1L0LE 1BCCE 3GB4A 4NB8D 2QPZA 3D89A 3CWBE 3C0DA 3H1HE 2IBZE 4HM5A 1G8JB 3VMGD 2HMKA 4HM1A 1PP9E 3GTSA 2QJYC 1ULJA 4NBGD 1O7MA 2DE7D 1Q90C 1SQBE 3H1KE 1RIEA 1VCKA 2E4QA 2QJKC 3H1LE 3L74E 1NDOA 1FQTA 4HM8A 2JO6A 2HMLA 4HM4A 3VMID 1KB9E 1SQPE 2E4PA 2NVEA 3GTEA 2YFJA 4H13D 5BOKA 3DQYA 3EN1A 4QDFB 3VMHD 4AAYB 3TGUE 2HMJA 5KLVE 2NWFA 3L73E 4HM6A 1VF5D 1NTKE 4H0LD 2ZT9D 3CXHE 4NBAD 2JZAA 1SJGA 1WQLA 2YVJB 3GL0A 1EG9A 2BMQA 4HKVA 4HM2A 1O7GA 4EMJB 2E74D 3L70E 4QDFA 2YFIA 2Q3WA 2DE6D 3AZCA 2NUKA 1O7HA 2FYUE 4P1BH 5AEWA 2QJPC 1O7NA 2A06E 2ZYLA 2HMOA 3H1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  1BE3 E;  1UUV A;  3L71 E;  2XSH A;  5KLI C;  2XR8 A;  2BCC E;  4NBE D;  2YIU C;  4NBC D;  4NBF D;  4U3F E;  1NTZ E;  2NVF A;  2HMM A;  2GBX A;  3BCC E;  3H1J E;  4PD4 E;  3GZX A;  4QCK A;  1ULI A;  3EQQ A;  1EZV E;  3FOU A;  4OGQ D;  1O7W A;  2NVG A;  2GBW A;  4HJL A;  2E75 D;  3GOB A;  2XRX A;  1L0N E;  4NBB D;  3L72 E;  5AEU A;  4AIV A;  4HM3 A;  1UUW A;  3GZY A;  4QDC A;  4QUP A;  2CKF A;  2BMR A;  1ZRT E;  5HL4 A;  5KKZ C;  2YFL A;  4QUQ A;  3VCP A;  1P84 E;  1NTM E;  2I7F A;  1SQV E;  2B24 A;  2E76 D;  4PV1 D;  2BMO A;  3GL2 A;  1G8K B;  1SQQ E;  3L75 E;  3GKE A;  2HMN A;  3GCE A;  1KYO E;  1PPJ E;  1NU1 E;  2D2C D;  5CXM A;  1RFS A;  4QDD A;  2B1X A;  4H44 D;  4QUR A;  4P1C H;  4HM0 A;  2XSO A;  4NBH D;  4NBD D;  1VM9 A;  2DE5 D;  4NB9 D;  3CX5 E;  3N0Q A;  3VCA A;  1NYK A;  1JM1 A;  1O7P A;  1SQX E;  2NUM A;  4HM7 A;  1L0L E;  1BCC E;  3GB4 A;  4NB8 D;  2QPZ A;  3D89 A;  3CWB E;  3C0D A;  3H1H E;  2IBZ E;  4HM5 A;  1G8J B;  3VMG D;  2HMK A;  4HM1 A;  1PP9 E;  3GTS A;  2QJY C;  1ULJ A;  4NBG D;  1O7M A;  2DE7 D;  1Q90 C;  1SQB E;  3H1K E;  1RIE A;  1VCK A;  2E4Q A;  2QJK C;  3H1L E;  3L74 E;  1NDO A;  1FQT A;  4HM8 A;  2JO6 A;  2HML A;  4HM4 A;  3VMI D;  1KB9 E;  1SQP E;  2E4P A;  2NVE A;  3GTE A;  2YFJ A;  4H13 D;  5BOK A;  3DQY A;  3EN1 A;  4QDF B;  3VMH D;  4AAY B;  3TGU E;  2HMJ A;  5KLV E;  2NWF A;  3L73 E;  4HM6 A;  1VF5 D;  1NTK E;  4H0L D;  2ZT9 D;  3CXH E;  4NBA D;  2JZA A;  1SJG A;  1WQL A;  2YVJ B;  3GL0 A;  1EG9 A;  2BMQ A;  4HKV A;  4HM2 A;  1O7G A;  4EMJ B;  2E74 D;  3L70 E;  4QDF A;  2YFI A;  2Q3W A;  2DE6 D;  3AZC A;  2NUK A;  1O7H A;  2FYU E;  4P1B H;  5AEW A;  2QJP C;  1O7N A;  2A06 E;  2ZYL A;  2HMO A;  3H1I E; 
#chains in the Genus database with same CATH topology
 2FYN C;  1BE3 E;  1UUV A;  3L71 E;  2XSH A;  5KLI C;  2XR8 A;  2BCC E;  4NBE D;  2YIU C;  4NBC D;  4NBF D;  4U3F E;  1NTZ E;  2NVF A;  2HMM A;  2GBX A;  3BCC E;  3H1J E;  4PD4 E;  3GZX A;  4QCK A;  1ULI A;  3EQQ A;  1EZV E;  3FOU A;  4OGQ D;  1O7W A;  2NVG A;  2GBW A;  4HJL A;  2E75 D;  3GOB A;  2XRX A;  1L0N E;  4NBB D;  3L72 E;  5AEU A;  4AIV A;  4HM3 A;  1UUW A;  3GZY A;  4QDC A;  4QUP A;  2CKF A;  2BMR A;  1ZRT E;  5HL4 A;  5KKZ C;  2YFL A;  4QUQ A;  3VCP A;  1P84 E;  1NTM E;  2I7F A;  1SQV E;  2B24 A;  2E76 D;  4PV1 D;  2BMO A;  3GL2 A;  1G8K B;  1SQQ E;  3L75 E;  3GKE A;  2HMN A;  3GCE A;  1KYO E;  1PPJ E;  1NU1 E;  2D2C D;  5CXM A;  1RFS A;  4QDD A;  2B1X A;  4H44 D;  4QUR A;  4P1C H;  4HM0 A;  2XSO A;  4NBH D;  4NBD D;  1VM9 A;  2DE5 D;  4NB9 D;  3CX5 E;  3N0Q A;  3VCA A;  1NYK A;  1JM1 A;  1O7P A;  1SQX E;  2NUM A;  4HM7 A;  1L0L E;  1BCC E;  3GB4 A;  4NB8 D;  2QPZ A;  3D89 A;  3CWB E;  3C0D A;  3H1H E;  2IBZ E;  4HM5 A;  1G8J B;  3VMG D;  2HMK A;  4HM1 A;  1PP9 E;  3GTS A;  2QJY C;  1ULJ A;  4NBG D;  1O7M A;  2DE7 D;  1Q90 C;  1SQB E;  3H1K E;  1RIE A;  1VCK A;  2E4Q A;  2QJK C;  3H1L E;  3L74 E;  1NDO A;  1FQT A;  4HM8 A;  2JO6 A;  2HML A;  4HM4 A;  3VMI D;  1KB9 E;  1SQP E;  2E4P A;  2NVE A;  3GTE A;  2YFJ A;  4H13 D;  5BOK A;  3DQY A;  3EN1 A;  4QDF B;  3VMH D;  4AAY B;  3TGU E;  2HMJ A;  5KLV E;  2NWF A;  3L73 E;  4HM6 A;  1VF5 D;  1NTK E;  4H0L D;  2ZT9 D;  3CXH E;  4NBA D;  2JZA A;  1SJG A;  1WQL A;  2YVJ B;  3GL0 A;  1EG9 A;  2BMQ A;  4HKV A;  4HM2 A;  1O7G A;  4EMJ B;  2E74 D;  3L70 E;  4QDF A;  2YFI A;  2Q3W A;  2DE6 D;  3AZC A;  2NUK A;  1O7H A;  2FYU E;  4P1B H;  5AEW A;  2QJP C;  1O7N A;  2A06 E;  2ZYL A;  2HMO A;  3H1I E; 
#chains in the Genus database with same CATH homology
 2FYN C;  1BE3 E;  1UUV A;  3L71 E;  2XSH A;  5KLI C;  2XR8 A;  2BCC E;  4NBE D;  2YIU C;  4NBC D;  4NBF D;  4U3F E;  1NTZ E;  2NVF A;  2HMM A;  2GBX A;  3BCC E;  3H1J E;  4PD4 E;  3GZX A;  4QCK A;  1ULI A;  3EQQ A;  1EZV E;  3FOU A;  4OGQ D;  1O7W A;  2NVG A;  2GBW A;  4HJL A;  2E75 D;  3GOB A;  2XRX A;  1L0N E;  4NBB D;  3L72 E;  5AEU A;  4AIV A;  4HM3 A;  1UUW A;  3GZY A;  4QDC A;  4QUP A;  2CKF A;  2BMR A;  1ZRT E;  5HL4 A;  5KKZ C;  2YFL A;  4QUQ A;  3VCP A;  1P84 E;  1NTM E;  2I7F A;  1SQV E;  2B24 A;  2E76 D;  4PV1 D;  2BMO A;  3GL2 A;  1G8K B;  1SQQ E;  3L75 E;  3GKE A;  2HMN A;  3GCE A;  1KYO E;  1PPJ E;  1NU1 E;  2D2C D;  5CXM A;  1RFS A;  4QDD A;  2B1X A;  4H44 D;  4QUR A;  4P1C H;  4HM0 A;  2XSO A;  4NBH D;  4NBD D;  1VM9 A;  2DE5 D;  4NB9 D;  3CX5 E;  3N0Q A;  3VCA A;  1NYK A;  1JM1 A;  1O7P A;  1SQX E;  2NUM A;  4HM7 A;  1L0L E;  1BCC E;  3GB4 A;  4NB8 D;  2QPZ A;  3D89 A;  3CWB E;  3C0D A;  3H1H E;  2IBZ E;  4HM5 A;  1G8J B;  3VMG D;  2HMK A;  4HM1 A;  1PP9 E;  3GTS A;  2QJY C;  1ULJ A;  4NBG D;  1O7M A;  2DE7 D;  1Q90 C;  1SQB E;  3H1K E;  1RIE A;  1VCK A;  2E4Q A;  2QJK C;  3H1L E;  3L74 E;  1NDO A;  1FQT A;  4HM8 A;  2JO6 A;  2HML A;  4HM4 A;  3VMI D;  1KB9 E;  1SQP E;  2E4P A;  2NVE A;  3GTE A;  2YFJ A;  4H13 D;  5BOK A;  3DQY A;  3EN1 A;  4QDF B;  3VMH D;  4AAY B;  3TGU E;  2HMJ A;  5KLV E;  2NWF A;  3L73 E;  4HM6 A;  1VF5 D;  1NTK E;  4H0L D;  2ZT9 D;  3CXH E;  4NBA D;  2JZA A;  1SJG A;  1WQL A;  2YVJ B;  3GL0 A;  1EG9 A;  2BMQ A;  4HKV A;  4HM2 A;  1O7G A;  4EMJ B;  2E74 D;  3L70 E;  4QDF A;  2YFI A;  2Q3W A;  2DE6 D;  3AZC A;  2NUK A;  1O7H A;  2FYU E;  4P1B H;  5AEW A;  2QJP C;  1O7N A;  2A06 E;  2ZYL A;  2HMO A;  3H1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...