3TGUE

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3tguE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3tguE02
2YFIA 5HL4A 3CX5E 2JZAA 3GCEA 1VCKA 1L0NE 3VCAA 4NBHD 4NB9D 2HMLA 3DQYA 1G8KB 4EMJB 1BCCE 2E75D 2GBWA 3D89A 4H13D 2HMOA 1ZRTE 3TGUE 4NBDD 3H1JE 2CKFA 2FYUE 1SQBE 3GZYA 2E4PA 1VM9A 1WQLA 2BMRA 3L70E 3H1IE 1PPJE 1O7PA 1EG9A 5KKZC 4NB8D 3VMID 5CXMA 1JM1A 2JO6A 3FOUA 4NBFD 4NBAD 2HMKA 2XSOA 4HM6A 1SQXE 2NVEA 1EZVE 1UUWA 5KLVE 4H44D 2D2CD 2DE6D 4OGQD 4HM0A 4QDDA 2YFJA 2E76D 2I7FA 3GOBA 4NBCD 1ULIA 1SQQE 2B1XA 3C0DA 3L71E 2A06E 1G8JB 2DE5D 2DE7D 4NBGD 4NBBD 1SJGA 4HM4A 1VF5D 1FQTA 2ZT9D 4QDFA 5AEUA 3GTEA 3EQQA 4QCKA 2E4QA 4P1CH 4HM1A 4NBED 1NTZE 2NUMA 3GL0A 2QJPC 2HMMA 3EN1A 2QJKC 2YIUC 4HM8A 1O7WA 4QDCA 2HMJA 2NVFA 2BMQA 4P1BH 1SQVE 4HM2A 3N0QA 4QUQA 1NU1E 3CXHE 1NYKA 3L73E 1NTKE 3GTSA 1O7GA 3BCCE 2BMOA 2YVJB 2HMNA 3VCPA 4D6TE 2NVGA 4HJLA 2QPZA 1P84E 2NWFA 1ULJA 4QURA 1L0LE 1O7HA 1SQPE 2GBXA 2IBZE 1NTME 3H1HE 2XRXA 4HM3A 4HKVA 4HM7A 4PD4E 4HM5A 5BOKA 3L74E 2B24A 2QJYC 2FYNC 3VMGD 2XSHA 2YFLA 1NDOA 2NUKA 3H1LE 4U3FE 3GB4A 4AIVA 3H1KE 1PP9E 2Q3WA 2XR8A 4PV1D 1RIEA 3AZCA 3GL2A 4QUPA 1KB9E 3CWBE 4AAYB 1BGYE 3GKEA 1KYOE 4QDFB 3GZXA 5KLIC 2ZYLA 4H0LD 3L75E 1Q90C 1O7MA 1BE3E 1RFSA 3L72E 5AEWA 1O7NA 2BCCE 1UUVA 2E74D 3VMHD
chains in the Genus database with same CATH superfamily
1U57A 4IL6H 1T2KC 1OW7A 4NBHD 4DZOA 4W7ZA 3L71J 5KAIE 3H1KJ 3V2QA 2OQQA 2N1TA 3CWBJ 2ZYGA 1TU3F 5BU5A 1SQQK 1S4XA 4HH2A 2R32A 1SQXE 2M5AB 2NVEA 1VQOP 1FZCC 3GG2A 5APVA 2DE6D 3SFEC 2ZT9B 2ZAEB 2NPSB 5KTBA 5DJTB 1ZR2A 3WUVA 2Y0DA 3H32A 4HM4A 1AA0A 2R5BA 1SQBK 4PD4D 3H1HD 1NTZE 1L0NG 1K8AQ 1AV1A 2HMMA 2YIUC 4C7NB 3H1LD 2ITAA 1URQC 1OMIA 4HM2A 2V7QJ 2I1KA 4DOJA 1PV3A 5CCGD 1L0LD 1NTME 2H8PD 4HKVA 1W2EA 2XU6A 1E5WA 1JO5A 4BWNA 1VPCA 3L73D 5TJHA 2WT7A 2B24A 3TK1A 1KD1Q 1S2EA 3HD7A 1YQ3C 3QH9A 2CPBA 1KB9E 2WSCH 1KYOE 1URQA 1KZUB 4UB8H 1N7SC 2L5GB 4OVNF 3CD6P 4I7ZB 5AW3B 1EDKA 1L4AB 3RL0B 3UIAA 1HGZA 1FBMA 4PD4H 3AEDC 1G8KB 1HGVA 1L0ND 2Q3EA 1LTJC 2CKFA 3KZIH 3V5BA 3A0HH 1LTBC 1X9VA 4KHXA 1XTGB 1SQXJ 2HMKA 2N1TB 1T8ZA 3L74J 3IFMA 2O01H 2YO3A 2JP3A 4U3FD 3HD7D 3IAOA 5AVSB 2FY8A 3L71E 2A06E 1ZLLA 3B4SA 2KLVA 1MUUA 3PH0A 2NPSA 3GTEA 1G2CB 1SQBG 3L75J 1AVOA 3U1CA 1UIXA 3G9RA 2AXTH 1NU1E 2P67A 1NTKE 3TGUD 3U59A 1RHZB 2ZVOB 1LTJA 5AW1B 4ZKUA 2D2CB 1LWUA 3L70J 2WVRA 4MN4C 2LXBA 2Y0CA 5DJUB 4N78D 1DX7A 1PL5A 3AE6C 3L71D 1NDOA 4U3FE 4C46A 3CWBD 2FBWC 2L91A 1YJWP 3GF3A 3CCRP 2IX7C 1AJYA 3GZXA 3EFFK 3MUDC 3I55P 2KZJA 4K35A 4JQ0D 3TF5A 1FDIA 3GCEA 4ASVA 2H88C 3Q5PA 1X0TA 1P84D 3O6QB 5AVWB 4Y28J 1RE3C 1FZBA 1BDCA 1EG9A 5KLIB 5CCHA 1QL1A 3B71A 1ZXGA 4PV1B 2HPCB 1IO4A 3GF7A 3AEBC 1YHQP 3M0DC 1VQLP 4AUWA 2XNDH 1HBWA 3A0BE 2HYNA 1SQBJ 2WPSA 3II6A 3NFQA 1USEA 2XZRA 1WRGA 4TT3H 1NTKK 1JB0J 4H44C 1KC8Q 2YVJB 3O6QA 2HR3A 2IBZG 2QPZA 3S9OA 2K88A 3KPEA 2KXPB 4GIFA 2QJYB 2OGUA 1N7SD 1PGJA 3L74E 1L0NJ 2IYOA 1SQPG 1BGYD 1K04A 1M1JC 3CCUP 2Q5UA 3H32B 1SQPK 3Q5RA 1CZQA 3VOPA 1A02J 1P84I 3E7KA 3RL0g 4BXLA 1LNQA 1LTAC 3VMYA 5AEWA 2YMKA 3V6IA 1RF0C 2QJKB 1HUCA 4GDOA 2E43A 1J2JB 3B5ND 2HMOA 1NAFA 2OTLP 5AW8B 3L71G 1RE4A 3L70E 1SQQG 1FAVA 2Q6QA 1X8YA 5AVZB 1FZFA 3H1KD 2I7FA 4EI2A 1FDOA 3K5BA 3PTZA 1EZVI 3R4YA 2HPCA 3L75G 1GL2B 1FJKA 4HM1A 1LJ2A 1SQPD 1KTMA 1JEKA 3PLNA 4HJGH 2HMJA 1MKMA 3L72D 2HODA 4P1BH 3SWYA 4OH8B 1NYKA 3H1JJ 3VCPA 4D6TE 2NVGA 4QURA 2IZ0A 1T2KD 3H1HE 1N8RQ 4ASWA 1FC2C 4UB8E 5AW5B 3G3ZA 1DD4A 2W27A 2AEFA 3M9QA 2YXRB 3GL2A 4KT0J 1ZN5A 3OA7A 1QVFO 3FWLA 4IOIH 1M90Q 4Y99C 1G2CA 1M1KQ 2WTYA 4WY4B 2YIUB 1U7MA 2IBZD 5AVQB 1D7MA 1ZRTD 2FXMA 3LW5J 1KB9I 2J58A 2XV5A 1SQXK 2E75D 4H13D 2GUSA 1NTKD 3TGUE 3RK2D 1NU1D 3GZYA 4ZKPA 2KI7B 3C1LA 4GT1A 1AQTA 3FXDA 4C7RA 3EWKA 3M9HA 2Y0EA 3RL0C 2B88A 1L0LG 2A45I 1LT9C 2QEXP 1IFIA 2WSFJ 5APTA 4AYCA 2ZT9D 4P1CH 1DEBA 3V2PA 1BE3J 3GL0A 5AVYB 2GUVA 3TNUB 1N7SA 2O1KA 3HUSA 4HB1A 4IFDK 1IFMA 5BVZA 2QSIA 2KSEA 4WY4D 4B86A 2O01N 4JYBA 3W68A 4A7PA 1LTGC 4UB6H 1RIEA 4R4LA 3L72G 2ZYDA 1QX8A 2R3SA 1BGYE 4ZMDA 2C9LY 2Q3IA 2QRXA 1BE3E 3PP5A 1FS0E 1IK7A 2LR2A 2A06G 1J1DC 3V4QA 3TNUA 1N7SB 3S4RA 3CCSP 1S9KE 1GD2E 5KLVG 4YXDC 1SS1A 3H1KG 3KQGA 4U3FG 1WQLA 1SQPJ 1QEXA 2FYUD 2OYHB 4RJTA 3RGUA 4NBAD 4HM6A 1EZVE 2YNYA 2H89C 1N73C 4HM0A 1IK9A 1SQQJ 2QIWA 3H1IG 3A7OA 1L4AA 1M1JB 1T3UA 5APQA 5E79H 2DE7D 1FZCB 5APYA 1VF5D 1SQVG 1QVGO 3U1AA 1NTMJ 1K9MQ 1IZNB 3RK3B 2HG5D 2D2CC 2QJKC 3CCQP 1RH5B 3N0QA 1ZOYC 3CXHE 1KMIZ 3P7KA 1DD3A 1SQBD 1LT9A 4IL6E 1P84E 2NWFA 1SFCD 1VL2A 3CWBG 3L37A 3B5NC 2FYUK 2FYNC 1N73B 2N1TC 1NU1J 1HVVA 2YMYA 1E79H 2W83C 2QM7A 3CWBE 2W6AA 1K05A 3L4FA 3L75E 3H1ID 3TDKA 5CBNA 1RFSA 3NMDA 2NPSD 1USDA 2E5TA 5APWA 2XKMA 1VCKA 4NB9D 2HMLA 1MZ9A 1YYCA 4I6MC 1L4AC 5H2FH 1XTCC 3Q1MA 3H1IE 1BE3D 1O7PA 1PZQA 3WUUA 1ZR4A 4XE5B 1ZW0A 2E76D 3GOBA 1Y9BA 1DH3A 3JCUH 4Y99B 2Y9YA 4H44B 4NBGD 4U7JA 3AECC 4NBED 1FZCA 3EN1A 2IFNA 3BATA 3VN0A 3D70A 2NVFA 1R5SA 1FZEA 1H0TB 5KLVJ 3EFGA 5AW6B 2K9YA 1JNMA 2JEEA 2HMNA 3SFDC 1M1JA 2N1TD 3KZIE 1NOHA 3C8VA 3OJAB 3H25A 2ZXEB 1CI6A 1L4AD 2WSEH 2E75B 4GKGA 4LC1A 4LLHA 2FFDA 5AW9B 3L72J 2WITA 3CX5H 3AE8C 4NPDA 3AEFC 3L70G 3CCEP 1CW5A 1R5LA 3AE4C 3H1JD 2NPSC 1S1CX 1PP9E 1KFMA 3MHVA 1EXIA 2WSCJ 4AAYB 2JWAA 4YXWH 4QDFB 1G1JA 2H43A 1SQQD 2IYPA 2MKVA 3HTKA 3P8MC 4OGQC 1ZRTE 1PPJD 1S3JA 2BMRA 3CPWO 1AFOA 2XSOA 1YJNP 3EQ2A 5KLVE 3ABVC 2B89A 3GHGB 1X22A 2O3JA 5AVTB 1NVOA 1NYHA 4NBCD 1NTKJ 3A0BH 4H0LB 1VQ8P 1SQVK 2KIKA 2P7JA 2P58A 2YO2A 3GW6A 1LTSC 2E4QA 2E76C 3IF4A 2J59M 1OW8A 2WWWA 4QDCA 1VDFA 2FFDC 3VP9A 1DIPA 3GTSA 4QMAA 4L76A 1KYOI 3H1IJ 1ULJA 4WY4A 1SQPE 1IFDA 3AE2C 1KV4A 2M5AA 1VQPP 2A45H 1NU1G 1KB9H 4WY4C 3VMZA 3H1KE 2BEZF 1VQNP 2CPSA 3AE3C 2K3RA 2OYIA 2E42A 2QVAA 2QJPB 5AVXB 4H13B 1BE3G 3AEGC 4BRYB 1GW4A 2KS1B 3RK3D 1NTMK 2WT7B 2P2UA 1SQVJ 5KKZB 2W6BA 1JUNA 2RH0A 1Q82Q 3Q3DA 1FE6A 2BEQD 2C0XA 2WPRA 1YBKA 2PFXA 1NTZJ 5GTHH 5CCGC 1OIPA 4NB8D 2B9BA 1JY3P 3HRNA 4JPZB 4WBAA 5KLVD 1GU4A 2OARA 1ZMEC 4R4MA 4EOTA 1PGOA 1NTKG 2OYHA 1HWTC 2P1JA 3F89A 3V4WA 1K73Q 1LT1A 3LIDA 1G8JB 1SJGA 2FYUJ 1EXJA 1HF9A 1FQTA 1URQB 1H88A 5AVUB 2OYHC 1QGKB 3GMAA 1KQLA 5GTHE 4HM8A 1JCCA 2FKWB 2BMQA 1BDDA 3A0HE 1SQVE 3L73E 2ZVNB 2RKLA 1NTMD 4DJGA 1L0LE 1IFNA 1EZVD 2XRXA 1AVYA 1EC5A 1RQVA 1KQFB 5B5EH 1GMJA 1M7LA 3NTNA 2AEJA 2WSFH 4AIVA 2Q3WA 2M3BA 2QE7H 2VRSA 4QUPA 1OWAA 2PAJA 1PP9D 2PGDA 1LGHB 3KDPB 4D6TJ 5KLIC 3D6YA 1O7MA 4K3AA 1QL2A 2QM8A 3AE5C 2OYOA 4C7NA 2IPPA 1VQ9P 2YKQA 1NWQA 2GBWA 3D89A 1KN7A 2JDIH 1Y47A 2IZ1A 1L2PA 2KB7P 2E4PA 3FGAD 1T3JA 5M1BA 1NJIQ 1IJDB 2FXOA 2W6JH 2JO6A 1OZHA 1JM0A 1UUWA 4IFFA 4YPCA 2K9JA 2FYNB 1KFNA 2M3EA 1J1DB 5CMZA 4JBZA 2YKOA 1S5LE 3JCUE 1KB9D 4HYTB 1JMMA 2YXQB 3WU2E 1T6AA 2KNCA 1OFCX 1OW6A 5KAFH 4HKZH 3RK2B 3O8ZA 2WSEJ 1SFCA 2ZYAA 1NHLA 1Q2NA 2LKMA 2C0WA 4RKUJ 3M0AA 2Z5IA 4H13C 2PRRA 5CJ4A 1JTHA 2YKPA 1O7HA 2GBXA 2JJLA 2IBZE 3N7NA 1SLQA 2I8DA 1SQVD 2AEMA 2QJYC 3FX0A 2QG4A 2NUKA 2B87A 3H1LE 1NTMG 5B66H 3PJSK 5AW7B 3I56P 1NTZD 3TYYA 5KJ7C 2N9BA 3AZCA 2E74B 1MV8A 5GTIH 2KUBA 4H0LD 3AEEC 3P32A 2JR8A 2YFIA 3AE7C 5AW2B 1L0NE 2PP6A 1CSBA 1GDTA 1BCCE 2K37A 5KJ7A 1SQBE 2G8YA 1NAYA 3B8EB 3W67A 3MTUE 2ZFCA 1LWUB 4IL6X 1BGYG 1KILC 5K5GB 2AXTE 1OX3A 1KILE 3H1HG 2HFED 3BCCG 4H44D 1OVUA 1YITP 1LTJB 1NU1K 1SQQE 3SSUA 3Q2YA 3LW5H 1RF0A 3AE1C 1NKZB 1M57D 3EQQA 1NTZK 2OYIB 4I7ZC 1BCCG 1JCDA 2MJZA 1FU1A 1J1EC 2RN0A 1FJPA 2KNCB 4IFMA 2JWDA 1IC2A 5H2FE 3AEAC 1HJBA 3WUTA 1NKNA 1JY2N 5KLVK 1ZV8A 1N73A 4HM3A 4PD4E 3VMGD 2K1AA 3BRTB 4EIJA 3G6EP 1GZLA 1SP4A 3BCCD 2B87B 3GKEA 4D6TG 5B66E 2NZ2A 2KYVA 4PJ0H 2E74C 4O9BA 4I2LC 1NO4A 1O7NA 1RF1C 2H7HA 2HODB 3IR9A 1FOSE 3VCAA 4JYCA 4W7YA 3VTPC 2OTKE 3RK3E 3CCVP 1VF5B 4M3LA 1LT9B 1VQ7P 3HD7C 2Z4EA 1N7LA 3CMAP 1PPJE 3WMM0 5APSA 1IFPA 3CXHH 4DCKA 1VQKP 1KORA 1JM1A 3P8CD 1VQ6P 1NGMB 1GTWA 1GL2C 1M56D 2BCCD 1M8OB 3C0DA 3HE4B 3HTKB 1Q86Q 5E79E 3NXSA 3HUSC 4H0LC 4N3YB 3E1IA 3CI9A 4NPEA 2QJPC 2HLOA 3IN6A 3FXEA 4Z1MH 2OTJP 4I1LA 1RE4C 3MIWA 4QUQA 3GHGA 2FFDB 2Z5HA 4HJLA 4OGQB 3H1LG 3BVHA 3L74G 5GTIE 4PV1C 1KYOH 4JF7A 3V2NA 1PIXA 1RE3A 3GHGC 2KLUA 1SQXG 2O01J 3CCMP 3HD7B 5CJ0A 1U7JA 2QA4P 3L72E 1UUVA 2RMZA 5TISE 3PRJA 2E76B 2R3CA 1Q90D 2JZAA 2O1JA 2Y9ZA 3HE5B 3DQYA 1L0LK 4EMJB 1PP9J 1RF1B 4D6TD 4YTPC 2IFMA 1EDLA 4WWIA 3VYIA 1YIJP 5APUA 1CI6B 1SVFA 4N78E 3VMID 1LTTC 5CXMA 1PGPA 3FWNA 1N86A 1QLED 2D2CD 1S5LH 4EDFA 3CX5D 3R2PA 1URQD 2YFJA 2A06D 5APXA 1JOCA 2WPQA 3BRVB 3L35A 3M06A 2C9NY 1WT6A 2IBZI 2KOGA 1S5LX 2SPZA 1BSHA 1L0NK 5KAIH 2IDBA 3A2AA 1O7GA 3BCCE 2J5UA 1S72P 3CX5I 2NRGA 1GL2A 5TISH 2WZ7A 3HE5A 2BASA 2GM4A 1PPJG 4UB6E 1W5CE 2YFLA 1IFJA 4GOEA 2UWJE 1GW3A 1EZVG 1N2DC 4PV1D 1EDIA 1JY2P 2WMMA 3AE9C 1R8EA 2KS1A 2K9JB 1Q90C 2AXCA 1H89A 3VMXA 2R44A 3H1JG 1KYOD 1FZAA 5CHXA 1HH0A 3CX5E 3VP8A 1GK6A 1X79B 1LTIC 3LIEA 3N4XA 3RL0D 1JMBA 4NBDD 2FYUE 3RBZA 3VMAA 3CCLP 4TLFA 4EYYQ 2Q7CA 5KKZC 1GK4A 1RF1A 2LXCB 2DW3A 3GLMA 1Q7YQ 2FYZA 2POHA 3ITKA 3H1LJ 3M9BA 3CC7P 3RK3C 1ULIA 1AQ5A 2ZT9C 1YJ9P 3PHLA 2KZIA 1ZP0C 3ZDMA 2Q9IA 5L8RJ 4L73A 5C39A 1RQUA 2NUMA 1BSNA 1KILD 2FXPA 3MUDA 1GU5A 3L73J 3CXHD 5CCHD 1OVRA 1H8AA 1LP1B 3RK2C 1MFTA 1BCCD 2M8RA 3D6ZA 1GL2D 2JKVA 1OXZA 1PP9G 5CCGA 1KILA 4PJ0E 3OW2O 2FYUG 3HUSB 2A45G 1YI2P 3KXDA 1FOSF 4WB4A 1YTZI 3CMEP 1DEEG 3S1KA 3CLQA 2E74D 5HL4A 1J1EB 1NTZG 1JY2O 1EQ7A 1S9KD 3F5HA 3BCCJ 1WMKA 4U3FJ 5AW0B 2WQYC 4GOFA 2KK7A 2W8ZA 3A3YB 3FOUA 4N6JA 4OGQD 3BASA 1JY3N 1EDJA 1KILB 2P10A 1LP1A 3WU2H 3I5CA 1KQSO 4ZNCA 3RBXA 3TGUJ 1FZGA 4NBBD 2N9YB 3CXHI 3MP7B 4QDFA 5AEUA 4QCKA 1JY3O 1SFCC 1SFCB 1RY3A 4RESB 3B5NA 2BCCJ 2JO1A 2G3AA 4PD4I 4W80A 3D71A 1PGQA 1VQ4P 2BMOA 1PFIA 1A02F 1G1IA 3QWOC 3E1RA 3JC22 2KSJA 4OWFA 4HM7A 3MD0A 3H1HJ 4GODA 4HM5A 5KJ7D 3V2RA 5BOKA 4WVZA 1HTLC 2M0BA 2E5YA 3USSA 2OYIC 2WPVB 4LGDE 3GB4A 5EFWB 3C9IA 4RO0A 3CC4P 1FDMA 3H6PA 1Q81Q 3Q5SA 3L73G 5AW4B 2ZYLA 2BCCG 3CL3D 2ZJSE 1L0LJ 1VQ5P 2BCCE 3VMHD 3HE4A 3KYQA 3G4SP 3TSIA 1LWUC 2CK3H 3L36A 5AVRB 1P84H 2ZXXA 3H1JE 4L74A 1OVVA 2W90A 1VM9A 3M0DA 1W2BO 3T97B 3SWKA 3B5NB 3TGUG 1Y8AA 4NBFD 4CPGA 5CCHC 5KAFE 4QDDA 2KP8A 1MFZA 4BRYA 4KJMA 1JTHB 4AQRD 2B1XA 2WSSH 1BCCJ 5BU8B 2DE5D 3SWFA 4XFJA 1KQGB 3G71P 1O7WA 1SQXD 3CCJP 2GA1A 3L74D 2E75C 4NPFX 3JSVC 1BGYJ 2XDJA 1H0TA 2R5DA 3OAKA 2I1JA 4L75A 1VQMP 1NH4A 1YQ4C 3L75D 2Q1KA 2V7QH 2XNXA 2XSHA 1Z56A 3CC2P 3M91A 4DT0A 2XR8A 3A5TA 3T97A 1UIIA 3P8CE 4XA4A 3MZWB 5B5EE 3KHUA 1YTZT 1HJ0A 1VF5C 3L70D 5CBOA 5AVVB 2V4HA 3MGNA
chains in the Genus database with same CATH topology
2YFIA 5HL4A 3CX5E 2JZAA 3GCEA 1VCKA 1L0NE 3VCAA 4NBHD 4NB9D 2HMLA 3DQYA 1G8KB 4EMJB 1BCCE 2E75D 2GBWA 3D89A 4H13D 2HMOA 1ZRTE 3TGUE 4NBDD 3H1JE 2CKFA 2FYUE 1SQBE 3GZYA 2E4PA 1VM9A 1WQLA 2BMRA 3L70E 3H1IE 1PPJE 1O7PA 1EG9A 5KKZC 4NB8D 3VMID 5CXMA 1JM1A 2JO6A 3FOUA 4NBFD 4NBAD 2HMKA 2XSOA 4HM6A 1SQXE 2NVEA 1EZVE 1UUWA 5KLVE 4H44D 2D2CD 2DE6D 4OGQD 4HM0A 4QDDA 2YFJA 2E76D 2I7FA 3GOBA 4NBCD 1ULIA 1SQQE 2B1XA 3C0DA 3L71E 2A06E 1G8JB 2DE5D 2DE7D 4NBGD 4NBBD 1SJGA 4HM4A 1VF5D 1FQTA 2ZT9D 4QDFA 5AEUA 3GTEA 3EQQA 4QCKA 2E4QA 4P1CH 4HM1A 4NBED 1NTZE 2NUMA 3GL0A 2QJPC 2HMMA 3EN1A 2QJKC 2YIUC 4HM8A 1O7WA 4QDCA 2HMJA 2NVFA 2BMQA 4P1BH 1SQVE 4HM2A 3N0QA 4QUQA 1NU1E 3CXHE 1NYKA 3L73E 1NTKE 3GTSA 1O7GA 3BCCE 2BMOA 2YVJB 2HMNA 3VCPA 4D6TE 2NVGA 4HJLA 2QPZA 1P84E 2NWFA 1ULJA 4QURA 1L0LE 1O7HA 1SQPE 2GBXA 2IBZE 1NTME 3H1HE 2XRXA 4HM3A 4HKVA 4HM7A 4PD4E 4HM5A 5BOKA 3L74E 2B24A 2QJYC 2FYNC 3VMGD 2XSHA 2YFLA 1NDOA 2NUKA 3H1LE 4U3FE 3GB4A 4AIVA 3H1KE 1PP9E 2Q3WA 2XR8A 4PV1D 1RIEA 3AZCA 3GL2A 4QUPA 1KB9E 3CWBE 4AAYB 1BGYE 3GKEA 1KYOE 4QDFB 3GZXA 5KLIC 2ZYLA 4H0LD 3L75E 1Q90C 1O7MA 1BE3E 1RFSA 3L72E 5AEWA 1O7NA 2BCCE 1UUVA 2E74D 3VMHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFI A;  5HL4 A;  3CX5 E;  2JZA A;  3GCE A;  1VCK A;  1L0N E;  3VCA A;  4NBH D;  4NB9 D;  2HML A;  3DQY A;  1G8K B;  4EMJ B;  1BCC E;  2E75 D;  2GBW A;  3D89 A;  4H13 D;  2HMO A;  1ZRT E;  3TGU E;  4NBD D;  3H1J E;  2CKF A;  2FYU E;  1SQB E;  3GZY A;  2E4P A;  1VM9 A;  1WQL A;  2BMR A;  3L70 E;  3H1I E;  1PPJ E;  1O7P A;  1EG9 A;  5KKZ C;  4NB8 D;  3VMI D;  5CXM A;  1JM1 A;  2JO6 A;  3FOU A;  4NBF D;  4NBA D;  2HMK A;  2XSO A;  4HM6 A;  1SQX E;  2NVE A;  1EZV E;  1UUW A;  5KLV E;  4H44 D;  2D2C D;  2DE6 D;  4OGQ D;  4HM0 A;  4QDD A;  2YFJ A;  2E76 D;  2I7F A;  3GOB A;  4NBC D;  1ULI A;  1SQQ E;  2B1X A;  3C0D A;  3L71 E;  2A06 E;  1G8J B;  2DE5 D;  2DE7 D;  4NBG D;  4NBB D;  1SJG A;  4HM4 A;  1VF5 D;  1FQT A;  2ZT9 D;  4QDF A;  5AEU A;  3GTE A;  3EQQ A;  4QCK A;  2E4Q A;  4P1C H;  4HM1 A;  4NBE D;  1NTZ E;  2NUM A;  3GL0 A;  2QJP C;  2HMM A;  3EN1 A;  2QJK C;  2YIU C;  4HM8 A;  1O7W A;  4QDC A;  2HMJ A;  2NVF A;  2BMQ A;  4P1B H;  1SQV E;  4HM2 A;  3N0Q A;  4QUQ A;  1NU1 E;  3CXH E;  1NYK A;  3L73 E;  1NTK E;  3GTS A;  1O7G A;  3BCC E;  2BMO A;  2YVJ B;  2HMN A;  3VCP A;  4D6T E;  2NVG A;  4HJL A;  2QPZ A;  1P84 E;  2NWF A;  1ULJ A;  4QUR A;  1L0L E;  1O7H A;  1SQP E;  2GBX A;  2IBZ E;  1NTM E;  3H1H E;  2XRX A;  4HM3 A;  4HKV A;  4HM7 A;  4PD4 E;  4HM5 A;  5BOK A;  3L74 E;  2B24 A;  2QJY C;  2FYN C;  3VMG D;  2XSH A;  2YFL A;  1NDO A;  2NUK A;  3H1L E;  4U3F E;  3GB4 A;  4AIV A;  3H1K E;  1PP9 E;  2Q3W A;  2XR8 A;  4PV1 D;  1RIE A;  3AZC A;  3GL2 A;  4QUP A;  1KB9 E;  3CWB E;  4AAY B;  1BGY E;  3GKE A;  1KYO E;  4QDF B;  3GZX A;  5KLI C;  2ZYL A;  4H0L D;  3L75 E;  1Q90 C;  1O7M A;  1BE3 E;  1RFS A;  3L72 E;  5AEW A;  1O7N A;  2BCC E;  1UUV A;  2E74 D;  3VMH D; 
#chains in the Genus database with same CATH topology
 1U57 A;  4IL6 H;  1T2K C;  1OW7 A;  4NBH D;  4DZO A;  4W7Z A;  3L71 J;  5KAI E;  3H1K J;  3V2Q A;  2OQQ A;  2N1T A;  3CWB J;  2ZYG A;  1TU3 F;  5BU5 A;  1SQQ K;  1S4X A;  4HH2 A;  2R32 A;  1SQX E;  2M5A B;  2NVE A;  1VQO P;  1FZC C;  3GG2 A;  5APV A;  2DE6 D;  3SFE C;  2ZT9 B;  2ZAE B;  2NPS B;  5KTB A;  5DJT B;  1ZR2 A;  3WUV A;  2Y0D A;  3H32 A;  4HM4 A;  1AA0 A;  2R5B A;  1SQB K;  4PD4 D;  3H1H D;  1NTZ E;  1L0N G;  1K8A Q;  1AV1 A;  2HMM A;  2YIU C;  4C7N B;  3H1L D;  2ITA A;  1URQ C;  1OMI A;  4HM2 A;  2V7Q J;  2I1K A;  4DOJ A;  1PV3 A;  5CCG D;  1L0L D;  1NTM E;  2H8P D;  4HKV A;  1W2E A;  2XU6 A;  1E5W A;  1JO5 A;  4BWN A;  1VPC A;  3L73 D;  5TJH A;  2WT7 A;  2B24 A;  3TK1 A;  1KD1 Q;  1S2E A;  3HD7 A;  1YQ3 C;  3QH9 A;  2CPB A;  1KB9 E;  2WSC H;  1KYO E;  1URQ A;  1KZU B;  4UB8 H;  1N7S C;  2L5G B;  4OVN F;  3CD6 P;  4I7Z B;  5AW3 B;  1EDK A;  1L4A B;  3RL0 B;  3UIA A;  1HGZ A;  1FBM A;  4PD4 H;  3AED C;  1G8K B;  1HGV A;  1L0N D;  2Q3E A;  1LTJ C;  2CKF A;  3KZI H;  3V5B A;  3A0H H;  1LTB C;  1X9V A;  4KHX A;  1XTG B;  1SQX J;  2HMK A;  2N1T B;  1T8Z A;  3L74 J;  3IFM A;  2O01 H;  2YO3 A;  2JP3 A;  4U3F D;  3HD7 D;  3IAO A;  5AVS B;  2FY8 A;  3L71 E;  2A06 E;  1ZLL A;  3B4S A;  2KLV A;  1MUU A;  3PH0 A;  2NPS A;  3GTE A;  1G2C B;  1SQB G;  3L75 J;  1AVO A;  3U1C A;  1UIX A;  3G9R A;  2AXT H;  1NU1 E;  2P67 A;  1NTK E;  3TGU D;  3U59 A;  1RHZ B;  2ZVO B;  1LTJ A;  5AW1 B;  4ZKU A;  2D2C B;  1LWU A;  3L70 J;  2WVR A;  4MN4 C;  2LXB A;  2Y0C A;  5DJU B;  4N78 D;  1DX7 A;  1PL5 A;  3AE6 C;  3L71 D;  1NDO A;  4U3F E;  4C46 A;  3CWB D;  2FBW C;  2L91 A;  1YJW P;  3GF3 A;  3CCR P;  2IX7 C;  1AJY A;  3GZX A;  3EFF K;  3MUD C;  3I55 P;  2KZJ A;  4K35 A;  4JQ0 D;  3TF5 A;  1FDI A;  3GCE A;  4ASV A;  2H88 C;  3Q5P A;  1X0T A;  1P84 D;  3O6Q B;  5AVW B;  4Y28 J;  1RE3 C;  1FZB A;  1BDC A;  1EG9 A;  5KLI B;  5CCH A;  1QL1 A;  3B71 A;  1ZXG A;  4PV1 B;  2HPC B;  1IO4 A;  3GF7 A;  3AEB C;  1YHQ P;  3M0D C;  1VQL P;  4AUW A;  2XND H;  1HBW A;  3A0B E;  2HYN A;  1SQB J;  2WPS A;  3II6 A;  3NFQ A;  1USE A;  2XZR A;  1WRG A;  4TT3 H;  1NTK K;  1JB0 J;  4H44 C;  1KC8 Q;  2YVJ B;  3O6Q A;  2HR3 A;  2IBZ G;  2QPZ A;  3S9O A;  2K88 A;  3KPE A;  2KXP B;  4GIF A;  2QJY B;  2OGU A;  1N7S D;  1PGJ A;  3L74 E;  1L0N J;  2IYO A;  1SQP G;  1BGY D;  1K04 A;  1M1J C;  3CCU P;  2Q5U A;  3H32 B;  1SQP K;  3Q5R A;  1CZQ A;  3VOP A;  1A02 J;  1P84 I;  3E7K A;  3RL0 g;  4BXL A;  1LNQ A;  1LTA C;  3VMY A;  5AEW A;  2YMK A;  3V6I A;  1RF0 C;  2QJK B;  1HUC A;  4GDO A;  2E43 A;  1J2J B;  3B5N D;  2HMO A;  1NAF A;  2OTL P;  5AW8 B;  3L71 G;  1RE4 A;  3L70 E;  1SQQ G;  1FAV A;  2Q6Q A;  1X8Y A;  5AVZ B;  1FZF A;  3H1K D;  2I7F A;  4EI2 A;  1FDO A;  3K5B A;  3PTZ A;  1EZV I;  3R4Y A;  2HPC A;  3L75 G;  1GL2 B;  1FJK A;  4HM1 A;  1LJ2 A;  1SQP D;  1KTM A;  1JEK A;  3PLN A;  4HJG H;  2HMJ A;  1MKM A;  3L72 D;  2HOD A;  4P1B H;  3SWY A;  4OH8 B;  1NYK A;  3H1J J;  3VCP A;  4D6T E;  2NVG A;  4QUR A;  2IZ0 A;  1T2K D;  3H1H E;  1N8R Q;  4ASW A;  1FC2 C;  4UB8 E;  5AW5 B;  3G3Z A;  1DD4 A;  2W27 A;  2AEF A;  3M9Q A;  2YXR B;  3GL2 A;  4KT0 J;  1ZN5 A;  3OA7 A;  1QVF O;  3FWL A;  4IOI H;  1M90 Q;  4Y99 C;  1G2C A;  1M1K Q;  2WTY A;  4WY4 B;  2YIU B;  1U7M A;  2IBZ D;  5AVQ B;  1D7M A;  1ZRT D;  2FXM A;  3LW5 J;  1KB9 I;  2J58 A;  2XV5 A;  1SQX K;  2E75 D;  4H13 D;  2GUS A;  1NTK D;  3TGU E;  3RK2 D;  1NU1 D;  3GZY A;  4ZKP A;  2KI7 B;  3C1L A;  4GT1 A;  1AQT A;  3FXD A;  4C7R A;  3EWK A;  3M9H A;  2Y0E A;  3RL0 C;  2B88 A;  1L0L G;  2A45 I;  1LT9 C;  2QEX P;  1IFI A;  2WSF J;  5APT A;  4AYC A;  2ZT9 D;  4P1C H;  1DEB A;  3V2P A;  1BE3 J;  3GL0 A;  5AVY B;  2GUV A;  3TNU B;  1N7S A;  2O1K A;  3HUS A;  4HB1 A;  4IFD K;  1IFM A;  5BVZ A;  2QSI A;  2KSE A;  4WY4 D;  4B86 A;  2O01 N;  4JYB A;  3W68 A;  4A7P A;  1LTG C;  4UB6 H;  1RIE A;  4R4L A;  3L72 G;  2ZYD A;  1QX8 A;  2R3S A;  1BGY E;  4ZMD A;  2C9L Y;  2Q3I A;  2QRX A;  1BE3 E;  3PP5 A;  1FS0 E;  1IK7 A;  2LR2 A;  2A06 G;  1J1D C;  3V4Q A;  3TNU A;  1N7S B;  3S4R A;  3CCS P;  1S9K E;  1GD2 E;  5KLV G;  4YXD C;  1SS1 A;  3H1K G;  3KQG A;  4U3F G;  1WQL A;  1SQP J;  1QEX A;  2FYU D;  2OYH B;  4RJT A;  3RGU A;  4NBA D;  4HM6 A;  1EZV E;  2YNY A;  2H89 C;  1N73 C;  4HM0 A;  1IK9 A;  1SQQ J;  2QIW A;  3H1I G;  3A7O A;  1L4A A;  1M1J B;  1T3U A;  5APQ A;  5E79 H;  2DE7 D;  1FZC B;  5APY A;  1VF5 D;  1SQV G;  1QVG O;  3U1A A;  1NTM J;  1K9M Q;  1IZN B;  3RK3 B;  2HG5 D;  2D2C C;  2QJK C;  3CCQ P;  1RH5 B;  3N0Q A;  1ZOY C;  3CXH E;  1KMI Z;  3P7K A;  1DD3 A;  1SQB D;  1LT9 A;  4IL6 E;  1P84 E;  2NWF A;  1SFC D;  1VL2 A;  3CWB G;  3L37 A;  3B5N C;  2FYU K;  2FYN C;  1N73 B;  2N1T C;  1NU1 J;  1HVV A;  2YMY A;  1E79 H;  2W83 C;  2QM7 A;  3CWB E;  2W6A A;  1K05 A;  3L4F A;  3L75 E;  3H1I D;  3TDK A;  5CBN A;  1RFS A;  3NMD A;  2NPS D;  1USD A;  2E5T A;  5APW A;  2XKM A;  1VCK A;  4NB9 D;  2HML A;  1MZ9 A;  1YYC A;  4I6M C;  1L4A C;  5H2F H;  1XTC C;  3Q1M A;  3H1I E;  1BE3 D;  1O7P A;  1PZQ A;  3WUU A;  1ZR4 A;  4XE5 B;  1ZW0 A;  2E76 D;  3GOB A;  1Y9B A;  1DH3 A;  3JCU H;  4Y99 B;  2Y9Y A;  4H44 B;  4NBG D;  4U7J A;  3AEC C;  4NBE D;  1FZC A;  3EN1 A;  2IFN A;  3BAT A;  3VN0 A;  3D70 A;  2NVF A;  1R5S A;  1FZE A;  1H0T B;  5KLV J;  3EFG A;  5AW6 B;  2K9Y A;  1JNM A;  2JEE A;  2HMN A;  3SFD C;  1M1J A;  2N1T D;  3KZI E;  1NOH A;  3C8V A;  3OJA B;  3H25 A;  2ZXE B;  1CI6 A;  1L4A D;  2WSE H;  2E75 B;  4GKG A;  4LC1 A;  4LLH A;  2FFD A;  5AW9 B;  3L72 J;  2WIT A;  3CX5 H;  3AE8 C;  4NPD A;  3AEF C;  3L70 G;  3CCE P;  1CW5 A;  1R5L A;  3AE4 C;  3H1J D;  2NPS C;  1S1C X;  1PP9 E;  1KFM A;  3MHV A;  1EXI A;  2WSC J;  4AAY B;  2JWA A;  4YXW H;  4QDF B;  1G1J A;  2H43 A;  1SQQ D;  2IYP A;  2MKV A;  3HTK A;  3P8M C;  4OGQ C;  1ZRT E;  1PPJ D;  1S3J A;  2BMR A;  3CPW O;  1AFO A;  2XSO A;  1YJN P;  3EQ2 A;  5KLV E;  3ABV C;  2B89 A;  3GHG B;  1X22 A;  2O3J A;  5AVT B;  1NVO A;  1NYH A;  4NBC D;  1NTK J;  3A0B H;  4H0L B;  1VQ8 P;  1SQV K;  2KIK A;  2P7J A;  2P58 A;  2YO2 A;  3GW6 A;  1LTS C;  2E4Q A;  2E76 C;  3IF4 A;  2J59 M;  1OW8 A;  2WWW A;  4QDC A;  1VDF A;  2FFD C;  3VP9 A;  1DIP A;  3GTS A;  4QMA A;  4L76 A;  1KYO I;  3H1I J;  1ULJ A;  4WY4 A;  1SQP E;  1IFD A;  3AE2 C;  1KV4 A;  2M5A A;  1VQP P;  2A45 H;  1NU1 G;  1KB9 H;  4WY4 C;  3VMZ A;  3H1K E;  2BEZ F;  1VQN P;  2CPS A;  3AE3 C;  2K3R A;  2OYI A;  2E42 A;  2QVA A;  2QJP B;  5AVX B;  4H13 B;  1BE3 G;  3AEG C;  4BRY B;  1GW4 A;  2KS1 B;  3RK3 D;  1NTM K;  2WT7 B;  2P2U A;  1SQV J;  5KKZ B;  2W6B A;  1JUN A;  2RH0 A;  1Q82 Q;  3Q3D A;  1FE6 A;  2BEQ D;  2C0X A;  2WPR A;  1YBK A;  2PFX A;  1NTZ J;  5GTH H;  5CCG C;  1OIP A;  4NB8 D;  2B9B A;  1JY3 P;  3HRN A;  4JPZ B;  4WBA A;  5KLV D;  1GU4 A;  2OAR A;  1ZME C;  4R4M A;  4EOT A;  1PGO A;  1NTK G;  2OYH A;  1HWT C;  2P1J A;  3F89 A;  3V4W A;  1K73 Q;  1LT1 A;  3LID A;  1G8J B;  1SJG A;  2FYU J;  1EXJ A;  1HF9 A;  1FQT A;  1URQ B;  1H88 A;  5AVU B;  2OYH C;  1QGK B;  3GMA A;  1KQL A;  5GTH E;  4HM8 A;  1JCC A;  2FKW B;  2BMQ A;  1BDD A;  3A0H E;  1SQV E;  3L73 E;  2ZVN B;  2RKL A;  1NTM D;  4DJG A;  1L0L E;  1IFN A;  1EZV D;  2XRX A;  1AVY A;  1EC5 A;  1RQV A;  1KQF B;  5B5E H;  1GMJ A;  1M7L A;  3NTN A;  2AEJ A;  2WSF H;  4AIV A;  2Q3W A;  2M3B A;  2QE7 H;  2VRS A;  4QUP A;  1OWA A;  2PAJ A;  1PP9 D;  2PGD A;  1LGH B;  3KDP B;  4D6T J;  5KLI C;  3D6Y A;  1O7M A;  4K3A A;  1QL2 A;  2QM8 A;  3AE5 C;  2OYO A;  4C7N A;  2IPP A;  1VQ9 P;  2YKQ A;  1NWQ A;  2GBW A;  3D89 A;  1KN7 A;  2JDI H;  1Y47 A;  2IZ1 A;  1L2P A;  2KB7 P;  2E4P A;  3FGA D;  1T3J A;  5M1B A;  1NJI Q;  1IJD B;  2FXO A;  2W6J H;  2JO6 A;  1OZH A;  1JM0 A;  1UUW A;  4IFF A;  4YPC A;  2K9J A;  2FYN B;  1KFN A;  2M3E A;  1J1D B;  5CMZ A;  4JBZ A;  2YKO A;  1S5L E;  3JCU E;  1KB9 D;  4HYT B;  1JMM A;  2YXQ B;  3WU2 E;  1T6A A;  2KNC A;  1OFC X;  1OW6 A;  5KAF H;  4HKZ H;  3RK2 B;  3O8Z A;  2WSE J;  1SFC A;  2ZYA A;  1NHL A;  1Q2N A;  2LKM A;  2C0W A;  4RKU J;  3M0A A;  2Z5I A;  4H13 C;  2PRR A;  5CJ4 A;  1JTH A;  2YKP A;  1O7H A;  2GBX A;  2JJL A;  2IBZ E;  3N7N A;  1SLQ A;  2I8D A;  1SQV D;  2AEM A;  2QJY C;  3FX0 A;  2QG4 A;  2NUK A;  2B87 A;  3H1L E;  1NTM G;  5B66 H;  3PJS K;  5AW7 B;  3I56 P;  1NTZ D;  3TYY A;  5KJ7 C;  2N9B A;  3AZC A;  2E74 B;  1MV8 A;  5GTI H;  2KUB A;  4H0L D;  3AEE C;  3P32 A;  2JR8 A;  2YFI A;  3AE7 C;  5AW2 B;  1L0N E;  2PP6 A;  1CSB A;  1GDT A;  1BCC E;  2K37 A;  5KJ7 A;  1SQB E;  2G8Y A;  1NAY A;  3B8E B;  3W67 A;  3MTU E;  2ZFC A;  1LWU B;  4IL6 X;  1BGY G;  1KIL C;  5K5G B;  2AXT E;  1OX3 A;  1KIL E;  3H1H G;  2HFE D;  3BCC G;  4H44 D;  1OVU A;  1YIT P;  1LTJ B;  1NU1 K;  1SQQ E;  3SSU A;  3Q2Y A;  3LW5 H;  1RF0 A;  3AE1 C;  1NKZ B;  1M57 D;  3EQQ A;  1NTZ K;  2OYI B;  4I7Z C;  1BCC G;  1JCD A;  2MJZ A;  1FU1 A;  1J1E C;  2RN0 A;  1FJP A;  2KNC B;  4IFM A;  2JWD A;  1IC2 A;  5H2F E;  3AEA C;  1HJB A;  3WUT A;  1NKN A;  1JY2 N;  5KLV K;  1ZV8 A;  1N73 A;  4HM3 A;  4PD4 E;  3VMG D;  2K1A A;  3BRT B;  4EIJ A;  3G6E P;  1GZL A;  1SP4 A;  3BCC D;  2B87 B;  3GKE A;  4D6T G;  5B66 E;  2NZ2 A;  2KYV A;  4PJ0 H;  2E74 C;  4O9B A;  4I2L C;  1NO4 A;  1O7N A;  1RF1 C;  2H7H A;  2HOD B;  3IR9 A;  1FOS E;  3VCA A;  4JYC A;  4W7Y A;  3VTP C;  2OTK E;  3RK3 E;  3CCV P;  1VF5 B;  4M3L A;  1LT9 B;  1VQ7 P;  3HD7 C;  2Z4E A;  1N7L A;  3CMA P;  1PPJ E;  3WMM 0;  5APS A;  1IFP A;  3CXH H;  4DCK A;  1VQK P;  1KOR A;  1JM1 A;  3P8C D;  1VQ6 P;  1NGM B;  1GTW A;  1GL2 C;  1M56 D;  2BCC D;  1M8O B;  3C0D A;  3HE4 B;  3HTK B;  1Q86 Q;  5E79 E;  3NXS A;  3HUS C;  4H0L C;  4N3Y B;  3E1I A;  3CI9 A;  4NPE A;  2QJP C;  2HLO A;  3IN6 A;  3FXE A;  4Z1M H;  2OTJ P;  4I1L A;  1RE4 C;  3MIW A;  4QUQ A;  3GHG A;  2FFD B;  2Z5H A;  4HJL A;  4OGQ B;  3H1L G;  3BVH A;  3L74 G;  5GTI E;  4PV1 C;  1KYO H;  4JF7 A;  3V2N A;  1PIX A;  1RE3 A;  3GHG C;  2KLU A;  1SQX G;  2O01 J;  3CCM P;  3HD7 B;  5CJ0 A;  1U7J A;  2QA4 P;  3L72 E;  1UUV A;  2RMZ A;  5TIS E;  3PRJ A;  2E76 B;  2R3C A;  1Q90 D;  2JZA A;  2O1J A;  2Y9Z A;  3HE5 B;  3DQY A;  1L0L K;  4EMJ B;  1PP9 J;  1RF1 B;  4D6T D;  4YTP C;  2IFM A;  1EDL A;  4WWI A;  3VYI A;  1YIJ P;  5APU A;  1CI6 B;  1SVF A;  4N78 E;  3VMI D;  1LTT C;  5CXM A;  1PGP A;  3FWN A;  1N86 A;  1QLE D;  2D2C D;  1S5L H;  4EDF A;  3CX5 D;  3R2P A;  1URQ D;  2YFJ A;  2A06 D;  5APX A;  1JOC A;  2WPQ A;  3BRV B;  3L35 A;  3M06 A;  2C9N Y;  1WT6 A;  2IBZ I;  2KOG A;  1S5L X;  2SPZ A;  1BSH A;  1L0N K;  5KAI H;  2IDB A;  3A2A A;  1O7G A;  3BCC E;  2J5U A;  1S72 P;  3CX5 I;  2NRG A;  1GL2 A;  5TIS H;  2WZ7 A;  3HE5 A;  2BAS A;  2GM4 A;  1PPJ G;  4UB6 E;  1W5C E;  2YFL A;  1IFJ A;  4GOE A;  2UWJ E;  1GW3 A;  1EZV G;  1N2D C;  4PV1 D;  1EDI A;  1JY2 P;  2WMM A;  3AE9 C;  1R8E A;  2KS1 A;  2K9J B;  1Q90 C;  2AXC A;  1H89 A;  3VMX A;  2R44 A;  3H1J G;  1KYO D;  1FZA A;  5CHX A;  1HH0 A;  3CX5 E;  3VP8 A;  1GK6 A;  1X79 B;  1LTI C;  3LIE A;  3N4X A;  3RL0 D;  1JMB A;  4NBD D;  2FYU E;  3RBZ A;  3VMA A;  3CCL P;  4TLF A;  4EYY Q;  2Q7C A;  5KKZ C;  1GK4 A;  1RF1 A;  2LXC B;  2DW3 A;  3GLM A;  1Q7Y Q;  2FYZ A;  2POH A;  3ITK A;  3H1L J;  3M9B A;  3CC7 P;  3RK3 C;  1ULI A;  1AQ5 A;  2ZT9 C;  1YJ9 P;  3PHL A;  2KZI A;  1ZP0 C;  3ZDM A;  2Q9I A;  5L8R J;  4L73 A;  5C39 A;  1RQU A;  2NUM A;  1BSN A;  1KIL D;  2FXP A;  3MUD A;  1GU5 A;  3L73 J;  3CXH D;  5CCH D;  1OVR A;  1H8A A;  1LP1 B;  3RK2 C;  1MFT A;  1BCC D;  2M8R A;  3D6Z A;  1GL2 D;  2JKV A;  1OXZ A;  1PP9 G;  5CCG A;  1KIL A;  4PJ0 E;  3OW2 O;  2FYU G;  3HUS B;  2A45 G;  1YI2 P;  3KXD A;  1FOS F;  4WB4 A;  1YTZ I;  3CME P;  1DEE G;  3S1K A;  3CLQ A;  2E74 D;  5HL4 A;  1J1E B;  1NTZ G;  1JY2 O;  1EQ7 A;  1S9K D;  3F5H A;  3BCC J;  1WMK A;  4U3F J;  5AW0 B;  2WQY C;  4GOF A;  2KK7 A;  2W8Z A;  3A3Y B;  3FOU A;  4N6J A;  4OGQ D;  3BAS A;  1JY3 N;  1EDJ A;  1KIL B;  2P10 A;  1LP1 A;  3WU2 H;  3I5C A;  1KQS O;  4ZNC A;  3RBX A;  3TGU J;  1FZG A;  4NBB D;  2N9Y B;  3CXH I;  3MP7 B;  4QDF A;  5AEU A;  4QCK A;  1JY3 O;  1SFC C;  1SFC B;  1RY3 A;  4RES B;  3B5N A;  2BCC J;  2JO1 A;  2G3A A;  4PD4 I;  4W80 A;  3D71 A;  1PGQ A;  1VQ4 P;  2BMO A;  1PFI A;  1A02 F;  1G1I A;  3QWO C;  3E1R A;  3JC2 2;  2KSJ A;  4OWF A;  4HM7 A;  3MD0 A;  3H1H J;  4GOD A;  4HM5 A;  5KJ7 D;  3V2R A;  5BOK A;  4WVZ A;  1HTL C;  2M0B A;  2E5Y A;  3USS A;  2OYI C;  2WPV B;  4LGD E;  3GB4 A;  5EFW B;  3C9I A;  4RO0 A;  3CC4 P;  1FDM A;  3H6P A;  1Q81 Q;  3Q5S A;  3L73 G;  5AW4 B;  2ZYL A;  2BCC G;  3CL3 D;  2ZJS E;  1L0L J;  1VQ5 P;  2BCC E;  3VMH D;  3HE4 A;  3KYQ A;  3G4S P;  3TSI A;  1LWU C;  2CK3 H;  3L36 A;  5AVR B;  1P84 H;  2ZXX A;  3H1J E;  4L74 A;  1OVV A;  2W90 A;  1VM9 A;  3M0D A;  1W2B O;  3T97 B;  3SWK A;  3B5N B;  3TGU G;  1Y8A A;  4NBF D;  4CPG A;  5CCH C;  5KAF E;  4QDD A;  2KP8 A;  1MFZ A;  4BRY A;  4KJM A;  1JTH B;  4AQR D;  2B1X A;  2WSS H;  1BCC J;  5BU8 B;  2DE5 D;  3SWF A;  4XFJ A;  1KQG B;  3G71 P;  1O7W A;  1SQX D;  3CCJ P;  2GA1 A;  3L74 D;  2E75 C;  4NPF X;  3JSV C;  1BGY J;  2XDJ A;  1H0T A;  2R5D A;  3OAK A;  2I1J A;  4L75 A;  1VQM P;  1NH4 A;  1YQ4 C;  3L75 D;  2Q1K A;  2V7Q H;  2XNX A;  2XSH A;  1Z56 A;  3CC2 P;  3M91 A;  4DT0 A;  2XR8 A;  3A5T A;  3T97 A;  1UII A;  3P8C E;  4XA4 A;  3MZW B;  5B5E E;  3KHU A;  1YTZ T;  1HJ0 A;  1VF5 C;  3L70 D;  5CBO A;  5AVV B;  2V4H A;  3MGN A; 
#chains in the Genus database with same CATH homology
 2YFI A;  5HL4 A;  3CX5 E;  2JZA A;  3GCE A;  1VCK A;  1L0N E;  3VCA A;  4NBH D;  4NB9 D;  2HML A;  3DQY A;  1G8K B;  4EMJ B;  1BCC E;  2E75 D;  2GBW A;  3D89 A;  4H13 D;  2HMO A;  1ZRT E;  3TGU E;  4NBD D;  3H1J E;  2CKF A;  2FYU E;  1SQB E;  3GZY A;  2E4P A;  1VM9 A;  1WQL A;  2BMR A;  3L70 E;  3H1I E;  1PPJ E;  1O7P A;  1EG9 A;  5KKZ C;  4NB8 D;  3VMI D;  5CXM A;  1JM1 A;  2JO6 A;  3FOU A;  4NBF D;  4NBA D;  2HMK A;  2XSO A;  4HM6 A;  1SQX E;  2NVE A;  1EZV E;  1UUW A;  5KLV E;  4H44 D;  2D2C D;  2DE6 D;  4OGQ D;  4HM0 A;  4QDD A;  2YFJ A;  2E76 D;  2I7F A;  3GOB A;  4NBC D;  1ULI A;  1SQQ E;  2B1X A;  3C0D A;  3L71 E;  2A06 E;  1G8J B;  2DE5 D;  2DE7 D;  4NBG D;  4NBB D;  1SJG A;  4HM4 A;  1VF5 D;  1FQT A;  2ZT9 D;  4QDF A;  5AEU A;  3GTE A;  3EQQ A;  4QCK A;  2E4Q A;  4P1C H;  4HM1 A;  4NBE D;  1NTZ E;  2NUM A;  3GL0 A;  2QJP C;  2HMM A;  3EN1 A;  2QJK C;  2YIU C;  4HM8 A;  1O7W A;  4QDC A;  2HMJ A;  2NVF A;  2BMQ A;  4P1B H;  1SQV E;  4HM2 A;  3N0Q A;  4QUQ A;  1NU1 E;  3CXH E;  1NYK A;  3L73 E;  1NTK E;  3GTS A;  1O7G A;  3BCC E;  2BMO A;  2YVJ B;  2HMN A;  3VCP A;  4D6T E;  2NVG A;  4HJL A;  2QPZ A;  1P84 E;  2NWF A;  1ULJ A;  4QUR A;  1L0L E;  1O7H A;  1SQP E;  2GBX A;  2IBZ E;  1NTM E;  3H1H E;  2XRX A;  4HM3 A;  4HKV A;  4HM7 A;  4PD4 E;  4HM5 A;  5BOK A;  3L74 E;  2B24 A;  2QJY C;  2FYN C;  3VMG D;  2XSH A;  2YFL A;  1NDO A;  2NUK A;  3H1L E;  4U3F E;  3GB4 A;  4AIV A;  3H1K E;  1PP9 E;  2Q3W A;  2XR8 A;  4PV1 D;  1RIE A;  3AZC A;  3GL2 A;  4QUP A;  1KB9 E;  3CWB E;  4AAY B;  1BGY E;  3GKE A;  1KYO E;  4QDF B;  3GZX A;  5KLI C;  2ZYL A;  4H0L D;  3L75 E;  1Q90 C;  1O7M A;  1BE3 E;  1RFS A;  3L72 E;  5AEW A;  1O7N A;  2BCC E;  1UUV A;  2E74 D;  3VMH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...