3TGUE

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3tguE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3tguE02
3GKEA 4NBAD 2CKFA 2ZT9D 2YFIA 5BOKA 5AEWA 2NVEA 4HM5A 2I7FA 4NBDD 1BCCE 4P1BH 4NBED 1O7WA 1UUWA 2QJKC 4QDDA 2NUMA 4H0LD 2BMOA 3EQQA 2HMMA 3GL2A 1PP9E 1NYKA 4HM4A 1O7MA 4PD4E 2GBWA 2XSHA 2IBZE 5CXMA 1ULIA 1KYOE 1WQLA 2HMOA 4P1CH 1VCKA 2D2CD 4H13D 2XR8A 2QJPC 1BGYE 3BCCE 4NBFD 4QUQA 2E4PA 2DE7D 2DE5D 4H44D 2XSOA 3H1LE 2E75D 4HM0A 4OGQD 4HJLA 1NU1E 4NBCD 3C0DA 3GTEA 3H1IE 3GTSA 2YFLA 3TGUE 1NTZE 1SQXE 3L70E 2B24A 2XRXA 2E76D 1SQVE 4NBGD 3GZXA 4NBHD 4QCKA 4HM6A 4HKVA 3L72E 3H1KE 4QDCA 4HM1A 2YIUC 2FYUE 3GOBA 3H1JE 1RIEA 1Q90C 1ZRTE 2JO6A 1O7NA 4NBBD 2GBXA 2HMNA 2NVGA 2NVFA 1PPJE 4QDFB 3VCPA 5AEUA 3GB4A 1G8JB 4NB8D 5KLIC 1NDOA 3VMHD 1KB9E 3CX5E 4QUPA 1O7PA 3GL0A 3VCAA 1VF5D 4HM7A 2HMLA 5HL4A 1NTKE 4QURA 1UUVA 4HM3A 3CXHE 4HM2A 5KLVE 1SJGA 2Q3WA 3GZYA 1VM9A 1P84E 2DE6D 3AZCA 2NWFA 1NTME 4NB9D 4U3FE 2QJYC 1L0LE 4EMJB 1SQQE 1O7HA 3VMGD 2A06E 1SQPE 1FQTA 2BMQA 3DQYA 4PV1D 2FYNC 2E4QA 2JZAA 4HM8A 3L73E 1RFSA 3L71E 4QDFA 4AAYB 2E74D 3GCEA 3N0QA 3L74E 5KKZC 2YFJA 4D6TE 2B1XA 2BMRA 1G8KB 1EG9A 3VMID 3D89A 1BE3E 3H1HE 3L75E 2BCCE 1O7GA 2QPZA 2NUKA 2HMKA 3CWBE 2YVJB 2ZYLA 2HMJA 3EN1A 1JM1A 3FOUA 4AIVA 1ULJA 1EZVE 1L0NE 1SQBE
chains in the Genus database with same CATH superfamily
3M9HA 4N78D 1RQUA 3U1AA 1M1JC 5AEWA 4NBDD 1EZVD 1VL2A 1LJ2A 4HM4A 3Q1MA 3RK2B 3KZIH 1OW8A 2IBZE 2FBWC 4L73A 3CD6P 2ZYAA 1LT9A 4DJGA 2E75B 1QLED 5GTIE 1N73A 2AEFA 5B5EH 3G71P 2WVRA 3FWNA 1YIJP 2GUVA 4HH2A 1ZOYC 1YQ3C 2XNDH 1RIEA 1KQGB 1Q90C 2JO6A 5GTHE 1RF0C 2GBXA 4UB8E 1EDLA 4H44B 3B4SA 4IOIH 2FYUD 3CX5I 3G4SP 3A3YB 3WU2E 4QURA 2QM7A 1UUVA 1SQBG 2DE6D 1EQ7A 3BCCJ 2AXTE 2A06E 4PV1D 4OWFA 4I6MC 4AAYB 1RE3A 3KYQA 1WT6A 3L73D 3A2AA 3NMDA 1O7GA 3FXEA 1GL2B 5L8RJ 1L2PA 4B86A 2KSJA 1NKZB 4WWIA 1URQB 1NJIQ 2NVEA 5AW2B 1NGMB 3TGUJ 2FFDB 1O7WA 1UUWA 1SQVJ 4JBZA 2OYOA 3RK2C 1KYOE 2KB7P 3HE5B 2QJPC 5M1BA 2OTLP 3H1LE 4OGQD 2E75C 4W7ZA 2Q9IA 2XNXA 1YJWP 1NTMG 4D6TJ 1YQ4C 2I1JA 2Q5UA 1BE3J 2BCCJ 2WPVB 1VDFA 4U3FJ 1LTAC 2OYIC 3AEFC 2KP8A 3I5CA 1PIXA 1PP9G 1IC2A 3A0HE 4H44C 1NDOA 1KB9E 3VCAA 2AXCA 2Z5HA 3JC22 2E76B 3O6QB 2ZAEB 1P84I 1JB0J 3U59A 1O7HA 3VMGD 4NPFX 3HD7B 1VQ7P 1U7MA 2JZAA 3VOPA 2QVAA 4QDFA 1SFCD 5APUA 1N7SB 1FOSE 2YO2A 3CCUP 1OMIA 2JKVA 1MFZA 2WSEH 2NPSC 2YXRB 3L74D 1NO4A 2W90A 5AVYB 4R4MA 1GL2C 1Q81Q 2J5UA 1PZQA 1H0TB 2ZT9D 2Y0CA 1URQC 4L75A 2FXOA 4H0LD 2FFDC 3EQQA 1M1KQ 2Y9YA 3RK3B 1NAYA 2O01H 1L0LK 1USEA 3OJAB 2IBZD 2DE5D 1JY2N 3A0BH 1S5LX 3H1IE 1NTZE 1SQXE 1K73Q 3L75J 1JUNA 3HUSB 1ZMEC 1OVVA 3H1KE 2OGUA 1H89A 4DOJA 5KLVD 1ZRTE 1O7NA 2R3CA 1FZCB 2JWDA 1T2KC 2JR8A 4WY4D 1AV1A 2B87A 5CJ4A 2HMLA 3Q3DA 1OIPA 1XTGB 3JCUE 2E76C 2HFED 1VQ5P 3GHGB 3LW5H 1X8YA 4EI2A 2FKWB 5EFWB 4A7PA 1SQPE 3RL0B 3HD7C 2E4QA 1G1JA 2PRRA 2K9YA 3GCEA 4IFMA 1S3JA 1N7SC 1TU3F 3CWBE 5AVQB 2HMJA 1VQ9P 3MUDA 1GK4A 3B8EB 3CPWO 4PV1B 3RK3E 2I7FA 1KILA 3L72G 4HYTB 2LXBA 3RK3C 3H32A 3L70D 1L0LJ 3PTZA 3NTNA 2E4PA 1KYOD 1JMMA 2E75D 2P67A 1PFIA 4I7ZB 3AEAC 1LP1B 1PPJD 2M3BA 3H1HJ 1L4AB 4I1LA 3HUSC 3IN6A 2WT7A 5CBOA 2C0XA 4EOTA 2FXPA 2KOGA 1Q86Q 2JP3A 4D6TG 1FZCC 1Y8AA 1Q82Q 4OGQB 3VMHD 3CX5E 1BE3G 2BCCG 2RMZA 2JJLA 2W6AA 3CXHI 1IK7A 3GHGC 2C9LY 1RE4C 3V6IA 1M8OB 2IZ0A 4C7RA 1KMIZ 1SQBJ 2POHA 1OFCX 3Q5RA 3RL0C 1NOHA 5KKZB 5KJ7A 4YXWH 1OX3A 4OH8B 3C1LA 3M91A 3R2PA 3L4FA 1EG9A 1CZQA 3M9BA 2KNCA 5APVA 4N6JA 2FYUK 2WPRA 2HMKA 3GF7A 4IL6X 5CHXA 4PV1C 4HM5A 2KS1B 3GLMA 1IO4A 2WSCH 1EXIA 3D71A 2N9YB 2AEMA 1KZUB 3PHLA 1K05A 4WB4A 2WQYC 3VN0A 4HM0A 2IZ1A 3C0DA 4UB8H 4GT1A 4I7ZC 1FBMA 2OYHB 4H0LB 3WU2H 3Q5SA 4HKVA 1L4AC 2N9BA 1NTMJ 1NTZD 3IAOA 3B5NA 1L0NK 3LIEA 2N1TD 3D6ZA 2UWJE 3CLQA 2YMKA 3Q5PA 3H1KD 3R4YA 4GKGA 1ZW0A 3WMM0 2IYPA 2P10A 2AXTH 3QH9A 4OGQC 1DH3A 2JEEA 1ZRTD 1E5WA 2WSEJ 1PP9J 1X0TA 3M0DA 3GZYA 1JY3O 1P84E 3D6YA 2H89C 4L74A 1DEBA 1SQQE 3SFEC 1JTHA 3BASA 5CCHD 1IZNB 3DQYA 2K88A 3HE4A 4HM8A 4WY4B 2O01J 4BRYA 5KKZC 1HVVA 1SQPD 2B9BA 3S4RA 4C7NB 3O8ZA 3N7NA 5B66H 2FYUJ 1PGQA 2YVJB 4BXLA 3ZDMA 1OVRA 3V2RA 2V4HA 5AVVB 2GM4A 3CWBD 1IK9A 1LWUA 4RO0A 1BCCE 2WSFJ 3CL3D 3CCVP 2HMMA 3RK3D 1RY3A 4PD4I 3AE4C 1PGPA 5CXMA 1J1DC 1AVOA 3CC7P 2B89A 3IR9A 2O3JA 4RKUJ 3RGUA 4Z1MH 3L73J 1CI6A 2KLUA 2ZT9C 3GTEA 3TGUE 1RH5B 3LW5J 2XRXA 1L0LG 1SQVE 1KB9H 2OYHC 4H0LC 1YTZT 4DZOA 2W83C 4AUWA 3CCJP 1JY2P 1L0NJ 4M3LA 4K35A 3HTKB 4QDFB 3H6PA 3QWOC 5KLIB 1G8JB 3H1HG 5CCGA 1O7PA 1NYHA 3B71A 3GG2A 3G6EP 2ITAA 3WUUA 1AA0A 2YXQB 5KLVE 1SJGA 3CX5D 1A02J 1LTTC 2QJYB 4NB9D 4U3FE 5K5GB 1FAVA 3EFGA 4RESB 2OTKE 5KAFE 3RL0D 1KQLA 3L71E 5AW1B 4WY4C 1IFJA 1SFCA 1LTJA 2YFJA 2BMRA 1BGYG 1ZR2A 1IFPA 4C46A 1JCCA 2K9JA 3C9IA 3GKEA 4HKZH 1M1JA 1CSBA 1GTWA 1NTKJ 3H1JG 3GW6A 4YPCA 3WUVA 3L72J 4YXDC 2P7JA 2XR8A 1Z56A 2KLVA 3K5BA 3BRVB 2O1JA 1HF9A 2NZ2A 1GU4A 3L70E 1N2DC 4NBHD 1L4AD 1SVFA 4QDCA 3JCUH 1D7MA 3L37A 3P32A 5APYA 4PJ0E 1RF0A 4GOEA 1PPJE 2WZ7A 5KLIC 1JM0A 2HPCA 3GMAA 3CXHE 1EZVG 2QEXP 3FWLA 4MN4C 2QJYC 2E42A 1OWAA 2N1TB 2FYZA 1P84D 3EFFK 2WSCJ 4OVNF 1SQQD 4WVZA 1JY3P 3TNUA 1RQVA 1EDIA 1VQ6P 3NFQA 4GIFA 5AW9B 1GDTA 1SLQA 3F89A 3M06A 2O01N 2IX7C 2IDBA 2KSEA 1WMKA 3E1IA 2L91A 1QL2A 5AVXB 3BCCD 3PRJA 1N86A 4NBED 1JEKA 2FYUG 1FJKA 1M90Q 1BCCD 2I8DA 1WRGA 4W7YA 3TK1A 2ZYDA 4AYCA 1NU1E 3BRTB 2I1KA 1K04A 5DJUB 3CX5H 2KZJA 4HM1A 1YTZI 1ZP0C 3TGUD 2M5AB 3L73G 5KTBA 1SQVD 2OYIA 2CK3H 2OARA 4NBBD 2NVFA 1HWTC 1HH0A 2ZXXA 3FXDA 4K3AA 2HODB 1R5SA 1QVFO 1L0NG 3S9OA 1FZAA 2WSFH 1NAFA 3VMXA 4D6TD 1GU5A 3AE5C 2BEZF 1FZGA 3PJSK 2N1TC 1BE3D 2BCCD 3H1LJ 3PH0A 4U3FD 1NTZK 1SQXK 3SWKA 3T97B 3VMID 3L71D 1J2JB 2NPSA 2Q3EA 4W80A 3EN1A 3P8MC 1GL2A 1SQBE 1KFNA 5CCHC 5TISH 2Z4EA 2LXCB 1URQA 5APQA 4JF7A 2FFDA 3CCSP 1GZLA 3L35A 4PD4E 3B5NB 2PAJA 1X79B 2ZJSE 2HMOA 4GODA 1VCKA 1SQPK 4H13B 1FS0E 3HE5A 1NTKG 3OW2O 4LC1A 3USSA 2CPBA 3A5TA 3CCEP 3KQGA 2PP6A 2XKMA 3KXDA 2A45G 1QL1A 3EQ2A 3L74G 2WMMA 1JOCA 1HUCA 2FY8A 1JY2O 3AEBC 5KAIE 4ZNCA 2BEQD 3VMZA 3O6QA 1G2CB 1NTME 3CXHD 3L75D 1DX7A 4JQ0D 1LWUB 3MIWA 3HD7A 4R4LA 3H1IJ 2IBZG 1LTGC 1SQXJ 2J58A 2Y0EA 1N7SA 4YTPC 2A45H 4I2LC 1GW3A 3N4XA 1BGYJ 1ULJA 2E5YA 2Q3IA 2GA1A 3AE2C 1RF1A 4JYCA 2XV5A 4IFFA 1N8RQ 2KYVA 1SS1A 1W5CE 1W2BO 3V5BA 1S9KD 2H43A 4U7JA 1WQLA 4GOFA 3H1JJ 3HRNA 5AVZB 2D2CD 1LT9B 4QUQA 1SQPJ 1MFTA 2DE7D 3E7KA 1N73B 1KB9I 5BVZA 2AEJA 3C8VA 2ZVNB 2LR2A 5GTIH 4QCKA 5C39A 1NU1D 2A06G 3AEEC 3CWBJ 3HUSA 2RKLA 1EDKA 2JDIH 4JYBA 1GK6A 2DW3A 2NVGA 4UB6E 1FZCA 3SWYA 2HR3A 4QUPA 5GTHH 5HL4A 1S72P 2QM8A 2Q3WA 1U57A 1FDIA 2YMYA 3WUTA 2HYNA 2W6BA 1RE4A 3AE6C 1KTMA 4XE5B 1EXJA 1S5LE 1FQTA 1LWUC 1KILD 5AVUB 3BVHA 5H2FE 3GF3A 3CCQP 2E74D 2RH0A 3N0QA 2K1AA 1JCDA 1QVGO 2W8ZA 2WPQA 3G3ZA 5APTA 2Q7CA 2KXPB 3H1LG 4HB1A 3I55P 1N7LA 1UIIA 1HBWA 3FOUA 1BSHA 1LT1A 2K3RA 2CKFA 1KQSO 1HJ0A 1SQBD 4P1BH 1A02F 1U7JA 2PGDA 5TJHA 1O7MA 1LTSC 1SQQK 5BU5A 2R3SA 1MUUA 1KN7A 1JMBA 1DIPA 1VQLP 4P1CH 3BCCE 4PD4D 1LT9C 5E79E 1KYOH 2RN0A 1VQKP 2R44A 5CCGC 1N73C 3F5HA 2IPPA 2HPCB 3V2QA 4RJTA 4DCKA 1W2EA 4N3YB 1VQNP 1LP1A 4WBAA 3L72E 1L4AA 3VP8A 3VTPC 2ZFCA 1KFMA 1FE6A 4EIJA 3AE7C 5KJ7D 3H25A 3A0HH 2QRXA 2M8RA 1MV8A 4ASVA 3AZCA 3FX0A 1DD3A 4Y99B 2FXMA 3CMEP 1SP4A 1NTMD 1DEEG 1SQVK 1RE3C 2Q1KA 3OA7A 1VQ4P 3BATA 2KI7B 4D6TE 1S2EA 3P8CD 3Q2YA 2C9NY 1BE3E 1FZBA 2BCCE 4LGDE 1AJYA 3PLNA 2P58A 1K8AQ 2QJPB 1PP9D 3EWKA 2K37A 1EZVI 3H1IG 2ZXEB 1T6AA 2O1KA 2W6JH 2YKQA 1NTZG 1SQXG 1QX8A 4EDFA 1NWQA 3MTUE 3H1KG 2KS1A 5KLVK 1BSNA 3GL2A 1NYKA 2HG5D 3B5ND 1SQQJ 1PGJA 4DT0A 2MKVA 2OYIB 4H13D 3LIDA 1YJNP 3VMYA 3AEGC 1NVOA 2YFLA 3M0AA 3ITKA 1M56D 1YHQP 2OYHA 3VYIA 1SQPG 1T8ZA 5AVSB 1YBKA 4IL6E 4O9BA 2D2CB 1YI2P 3CCRP 2WTYA 3S1KA 4NB8D 2B87B 1BCCJ 1M57D 3MD0A 3L74J 3CWBG 2WWWA 5BU8B 3CC2P 1YITP 2NPSB 1HJBA 1VQPP 4HJGH 1IFIA 4Y99C 5AW8B 2J59M 2P1JA 3RBXA 1RFSA 1L0ND 2M0BA 4WY4A 5B66E 2B88A 2WPSA 3FGAD 2B1XA 1G8KB 2XDJA 2HLOA 4C7NA 3D89A 3L75E 3VMAA 2NUKA 2YNYA 2V7QH 1MZ9A 4PD4H 4KJMA 1FZFA 5CBNA 2C0WA 1KILB 1EC5A 1AQ5A 2E74B 5KLVJ 2BMOA 3AE1C 2QIWA 4XFJA 2Y9ZA 3H32B 4XA4A 1H8AA 3NXSA 1T3JA 2IFMA 4KT0J 1AVYA 5CCGD 3L71J 1VQ8P 4AQRD 2GUSA 2R32A 1S9KE 3GTSA 3KZIE 5KAIH 4HM6A 2WT7B 1NTKD 1PL5A 2YIUB 2KK7A 1X22A 3L72D 2D2CC 3PP5A 5B5EE 3GB4A 3HTKA 5APWA 1OXZA 2VRSA 1VF5D 1R8EA 4HM2A 2MJZA 4Y28J 4TT3H 5AW0B 4IFDK 1VM9A 3CI9A 2NWFA 4ASWA 2G8YA 1L0LE 4EMJB 2WSSH 1FDOA 2Z5IA 1YYCA 1RF1B 1NU1K 1FOSF 3CCLP 1GMJA 5AW5B 2A45I 3L70J 4KHXA 2KZIA 1USDA 1FZEA 2KNCB 4GDOA 3H1HE 1Q2NA 1IFDA 1KILE 1JM1A 3MUDC 4NBAD 4ZKPA 1KILC 2H8PD 3RBZA 1NHLA 2QJKB 2ZVOB 2NUMA 2E74C 1J1EB 2IBZI 1Q90D 1T3UA 1GW4A 1BGYE 2LKMA 1ZV8A 1GD2E 3U1CA 2QSIA 1PV3A 3D70A 4JPZB 4UB6H 1SQQG 1JNMA 3MGNA 1Y47A 2YIUC 1ZR4A 1VQOP 2CPSA 1SQBK 2M3EA 3H1JE 2OTJP 3P7KA 2HMNA 2QG4A 2WITA 1M7LA 3E1RA 3CCMP 2OQQA 1S5LH 2A06D 3GL0A 3AE9C 1FJPA 1EDJA 5H2FH 3BCCG 1NKNA 5APXA 1PGOA 5AVRB 5APSA 1JTHB 1BCCG 2XZRA 1P84H 2N1TA 5DJTB 3HE4B 1RF1C 2FYNB 1CW5A 1NU1J 1G1IA 1S4XA 3VP9A 1BDCA 1IJDB 4BRYB 5KJ7C 3KDPB 3RK2D 1E79H 3W67A 1H88A 4N78E 4ZKUA 1HGVA 4AIVA 1FDMA 1EZVE 3TGUG 1AFOA 1SQVG 3V4QA 3G9RA 1DD4A 3ABVC 5CCHA 3P8CE 1YJ9P 2YFIA 5BOKA 5E79H 3IF4A 3I56P 1NTZJ 1R5LA 2QA4P 3W68A 2QJKC 3H1LD 4QDDA 5AW7B 2NRGA 1X9VA 2XU6A 1PP9E 1J1EC 1NTMK 3H1KJ 3CMAP 1KYOI 1ULIA 1VPCA 2JO1A 5AVWB 2Y0DA 4H44D 5CJ0A 5KLVG 1CI6B 4HJLA 1QEXA 1H0TA 1NH4A 2B24A 4U3FG 1KC8Q 1JY3N 3M9QA 4NBGD 4NPEA 1KB9D 4CPGA 2KUBA 1OZHA 3B5NC 2FYUE 3L71G 2M5AA 3MP7B 3OAKA 3GOBA 2SPZA 2YKPA 3RL0g 3A0BE 2QE7H 4H13C 3AECC 3TF5A 1XTCC 1ZLLA 3VCPA 5AEUA 1Q7YQ 1AQTA 4BWNA 3II6A 4HM7A 5AW3B 2HODA 3KPEA 2V7QJ 4HM3A 3M0DC 3IFMA 4L76A 2NPSD 2G3AA 2H7HA 1ZXGA 4LLHA 3SWFA 1GL2D 2P2UA 3AE8C 1JO5A 2H88C 2BASA 2FYNC 1URQD 5AW6B 1L0LD 3L73E 3JSVC 1KORA 1SFCB 1LTJB 3TDKA 1VF5B 3TSIA 5KAFH 1KQFB 1KV4A 1RHZB 1J1DB 3T97A 2PFXA 2K9JB 3GHGA 3MZWB 2ZYLA 5TISE 5AVTB 3MHVA 1L0NE 3L70G 3H1HD 2KIKA 1UIXA 2E43A 1M1JB 1OVUA 2R5BA 2ZT9B 2IFNA 2ZYGA 1IFMA 4TLFA 2GBWA 2XSHA 3H1ID 2JWAA 1SQXD 1PPJG 4EYYQ 4NPDA 4NBFD 3AE3C 1T2KD 2YO3A 4IL6H 2XSOA 2YKOA 2Q6QA 3V2NA 3L75G 1LGHB 4NBCD 1MKMA 1BGYD 2W27A 1QGKB 4ZMDA 2E76D 3SFDC 3GZXA 1LTBC 2IYOA 1LNQA 1Y9BA 3HD7D 3AEDC 3SSUA 3A7OA 3H1JD 3CC4P 1LTIC 1N7SD 1S1CX 4PJ0H 1NTKE 5AW4B 3V4WA 1ZN5A 3CXHH 2E5TA 1G2CA 2L5GB 4QMAA 1KD1Q 2BMQA 1FU1A 1NTKK 3TNUB 1IFNA 5CMZA 1SFCC 1LTJC 1BDDA 3L74E 1VF5C 1K9MQ 3TYYA 2R5DA 3UIAA 1OW6A 2QPZA 1OW7A 3V2PA 1NU1G 1VQMP 1FC2C 1HGZA 1HTLC 3KHUA 3L36A
chains in the Genus database with same CATH topology
3GKEA 4NBAD 2CKFA 2ZT9D 2YFIA 5BOKA 5AEWA 2NVEA 4HM5A 2I7FA 4NBDD 1BCCE 4P1BH 4NBED 1O7WA 1UUWA 2QJKC 4QDDA 2NUMA 4H0LD 2BMOA 3EQQA 2HMMA 3GL2A 1PP9E 1NYKA 4HM4A 1O7MA 4PD4E 2GBWA 2XSHA 2IBZE 5CXMA 1ULIA 1KYOE 1WQLA 2HMOA 4P1CH 1VCKA 2D2CD 4H13D 2XR8A 2QJPC 1BGYE 3BCCE 4NBFD 4QUQA 2E4PA 2DE7D 2DE5D 4H44D 2XSOA 3H1LE 2E75D 4HM0A 4OGQD 4HJLA 1NU1E 4NBCD 3C0DA 3GTEA 3H1IE 3GTSA 2YFLA 3TGUE 1NTZE 1SQXE 3L70E 2B24A 2XRXA 2E76D 1SQVE 4NBGD 3GZXA 4NBHD 4QCKA 4HM6A 4HKVA 3L72E 3H1KE 4QDCA 4HM1A 2YIUC 2FYUE 3GOBA 3H1JE 1RIEA 1Q90C 1ZRTE 2JO6A 1O7NA 4NBBD 2GBXA 2HMNA 2NVGA 2NVFA 1PPJE 4QDFB 3VCPA 5AEUA 3GB4A 1G8JB 4NB8D 5KLIC 1NDOA 3VMHD 1KB9E 3CX5E 4QUPA 1O7PA 3GL0A 3VCAA 1VF5D 4HM7A 2HMLA 5HL4A 1NTKE 4QURA 1UUVA 4HM3A 3CXHE 4HM2A 5KLVE 1SJGA 2Q3WA 3GZYA 1VM9A 1P84E 2DE6D 3AZCA 2NWFA 1NTME 4NB9D 4U3FE 2QJYC 1L0LE 4EMJB 1SQQE 1O7HA 3VMGD 2A06E 1SQPE 1FQTA 2BMQA 3DQYA 4PV1D 2FYNC 2E4QA 2JZAA 4HM8A 3L73E 1RFSA 3L71E 4QDFA 4AAYB 2E74D 3GCEA 3N0QA 3L74E 5KKZC 2YFJA 4D6TE 2B1XA 2BMRA 1G8KB 1EG9A 3VMID 3D89A 1BE3E 3H1HE 3L75E 2BCCE 1O7GA 2QPZA 2NUKA 2HMKA 3CWBE 2YVJB 2ZYLA 2HMJA 3EN1A 1JM1A 3FOUA 4AIVA 1ULJA 1EZVE 1L0NE 1SQBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKE A;  4NBA D;  2CKF A;  2ZT9 D;  2YFI A;  5BOK A;  5AEW A;  2NVE A;  4HM5 A;  2I7F A;  4NBD D;  1BCC E;  4P1B H;  4NBE D;  1O7W A;  1UUW A;  2QJK C;  4QDD A;  2NUM A;  4H0L D;  2BMO A;  3EQQ A;  2HMM A;  3GL2 A;  1PP9 E;  1NYK A;  4HM4 A;  1O7M A;  4PD4 E;  2GBW A;  2XSH A;  2IBZ E;  5CXM A;  1ULI A;  1KYO E;  1WQL A;  2HMO A;  4P1C H;  1VCK A;  2D2C D;  4H13 D;  2XR8 A;  2QJP C;  1BGY E;  3BCC E;  4NBF D;  4QUQ A;  2E4P A;  2DE7 D;  2DE5 D;  4H44 D;  2XSO A;  3H1L E;  2E75 D;  4HM0 A;  4OGQ D;  4HJL A;  1NU1 E;  4NBC D;  3C0D A;  3GTE A;  3H1I E;  3GTS A;  2YFL A;  3TGU E;  1NTZ E;  1SQX E;  3L70 E;  2B24 A;  2XRX A;  2E76 D;  1SQV E;  4NBG D;  3GZX A;  4NBH D;  4QCK A;  4HM6 A;  4HKV A;  3L72 E;  3H1K E;  4QDC A;  4HM1 A;  2YIU C;  2FYU E;  3GOB A;  3H1J E;  1RIE A;  1Q90 C;  1ZRT E;  2JO6 A;  1O7N A;  4NBB D;  2GBX A;  2HMN A;  2NVG A;  2NVF A;  1PPJ E;  4QDF B;  3VCP A;  5AEU A;  3GB4 A;  1G8J B;  4NB8 D;  5KLI C;  1NDO A;  3VMH D;  1KB9 E;  3CX5 E;  4QUP A;  1O7P A;  3GL0 A;  3VCA A;  1VF5 D;  4HM7 A;  2HML A;  5HL4 A;  1NTK E;  4QUR A;  1UUV A;  4HM3 A;  3CXH E;  4HM2 A;  5KLV E;  1SJG A;  2Q3W A;  3GZY A;  1VM9 A;  1P84 E;  2DE6 D;  3AZC A;  2NWF A;  1NTM E;  4NB9 D;  4U3F E;  2QJY C;  1L0L E;  4EMJ B;  1SQQ E;  1O7H A;  3VMG D;  2A06 E;  1SQP E;  1FQT A;  2BMQ A;  3DQY A;  4PV1 D;  2FYN C;  2E4Q A;  2JZA A;  4HM8 A;  3L73 E;  1RFS A;  3L71 E;  4QDF A;  4AAY B;  2E74 D;  3GCE A;  3N0Q A;  3L74 E;  5KKZ C;  2YFJ A;  4D6T E;  2B1X A;  2BMR A;  1G8K B;  1EG9 A;  3VMI D;  3D89 A;  1BE3 E;  3H1H E;  3L75 E;  2BCC E;  1O7G A;  2QPZ A;  2NUK A;  2HMK A;  3CWB E;  2YVJ B;  2ZYL A;  2HMJ A;  3EN1 A;  1JM1 A;  3FOU A;  4AIV A;  1ULJ A;  1EZV E;  1L0N E;  1SQB E; 
#chains in the Genus database with same CATH topology
 3M9H A;  4N78 D;  1RQU A;  3U1A A;  1M1J C;  5AEW A;  4NBD D;  1EZV D;  1VL2 A;  1LJ2 A;  4HM4 A;  3Q1M A;  3RK2 B;  3KZI H;  1OW8 A;  2IBZ E;  2FBW C;  4L73 A;  3CD6 P;  2ZYA A;  1LT9 A;  4DJG A;  2E75 B;  1QLE D;  5GTI E;  1N73 A;  2AEF A;  5B5E H;  3G71 P;  2WVR A;  3FWN A;  1YIJ P;  2GUV A;  4HH2 A;  1ZOY C;  1YQ3 C;  2XND H;  1RIE A;  1KQG B;  1Q90 C;  2JO6 A;  5GTH E;  1RF0 C;  2GBX A;  4UB8 E;  1EDL A;  4H44 B;  3B4S A;  4IOI H;  2FYU D;  3CX5 I;  3G4S P;  3A3Y B;  3WU2 E;  4QUR A;  2QM7 A;  1UUV A;  1SQB G;  2DE6 D;  1EQ7 A;  3BCC J;  2AXT E;  2A06 E;  4PV1 D;  4OWF A;  4I6M C;  4AAY B;  1RE3 A;  3KYQ A;  1WT6 A;  3L73 D;  3A2A A;  3NMD A;  1O7G A;  3FXE A;  1GL2 B;  5L8R J;  1L2P A;  4B86 A;  2KSJ A;  1NKZ B;  4WWI A;  1URQ B;  1NJI Q;  2NVE A;  5AW2 B;  1NGM B;  3TGU J;  2FFD B;  1O7W A;  1UUW A;  1SQV J;  4JBZ A;  2OYO A;  3RK2 C;  1KYO E;  2KB7 P;  3HE5 B;  2QJP C;  5M1B A;  2OTL P;  3H1L E;  4OGQ D;  2E75 C;  4W7Z A;  2Q9I A;  2XNX A;  1YJW P;  1NTM G;  4D6T J;  1YQ4 C;  2I1J A;  2Q5U A;  1BE3 J;  2BCC J;  2WPV B;  1VDF A;  4U3F J;  1LTA C;  2OYI C;  3AEF C;  2KP8 A;  3I5C A;  1PIX A;  1PP9 G;  1IC2 A;  3A0H E;  4H44 C;  1NDO A;  1KB9 E;  3VCA A;  2AXC A;  2Z5H A;  3JC2 2;  2E76 B;  3O6Q B;  2ZAE B;  1P84 I;  1JB0 J;  3U59 A;  1O7H A;  3VMG D;  4NPF X;  3HD7 B;  1VQ7 P;  1U7M A;  2JZA A;  3VOP A;  2QVA A;  4QDF A;  1SFC D;  5APU A;  1N7S B;  1FOS E;  2YO2 A;  3CCU P;  1OMI A;  2JKV A;  1MFZ A;  2WSE H;  2NPS C;  2YXR B;  3L74 D;  1NO4 A;  2W90 A;  5AVY B;  4R4M A;  1GL2 C;  1Q81 Q;  2J5U A;  1PZQ A;  1H0T B;  2ZT9 D;  2Y0C A;  1URQ C;  4L75 A;  2FXO A;  4H0L D;  2FFD C;  3EQQ A;  1M1K Q;  2Y9Y A;  3RK3 B;  1NAY A;  2O01 H;  1L0L K;  1USE A;  3OJA B;  2IBZ D;  2DE5 D;  1JY2 N;  3A0B H;  1S5L X;  3H1I E;  1NTZ E;  1SQX E;  1K73 Q;  3L75 J;  1JUN A;  3HUS B;  1ZME C;  1OVV A;  3H1K E;  2OGU A;  1H89 A;  4DOJ A;  5KLV D;  1ZRT E;  1O7N A;  2R3C A;  1FZC B;  2JWD A;  1T2K C;  2JR8 A;  4WY4 D;  1AV1 A;  2B87 A;  5CJ4 A;  2HML A;  3Q3D A;  1OIP A;  1XTG B;  3JCU E;  2E76 C;  2HFE D;  1VQ5 P;  3GHG B;  3LW5 H;  1X8Y A;  4EI2 A;  2FKW B;  5EFW B;  4A7P A;  1SQP E;  3RL0 B;  3HD7 C;  2E4Q A;  1G1J A;  2PRR A;  2K9Y A;  3GCE A;  4IFM A;  1S3J A;  1N7S C;  1TU3 F;  3CWB E;  5AVQ B;  2HMJ A;  1VQ9 P;  3MUD A;  1GK4 A;  3B8E B;  3CPW O;  4PV1 B;  3RK3 E;  2I7F A;  1KIL A;  3L72 G;  4HYT B;  2LXB A;  3RK3 C;  3H32 A;  3L70 D;  1L0L J;  3PTZ A;  3NTN A;  2E4P A;  1KYO D;  1JMM A;  2E75 D;  2P67 A;  1PFI A;  4I7Z B;  3AEA C;  1LP1 B;  1PPJ D;  2M3B A;  3H1H J;  1L4A B;  4I1L A;  3HUS C;  3IN6 A;  2WT7 A;  5CBO A;  2C0X A;  4EOT A;  2FXP A;  2KOG A;  1Q86 Q;  2JP3 A;  4D6T G;  1FZC C;  1Y8A A;  1Q82 Q;  4OGQ B;  3VMH D;  3CX5 E;  1BE3 G;  2BCC G;  2RMZ A;  2JJL A;  2W6A A;  3CXH I;  1IK7 A;  3GHG C;  2C9L Y;  1RE4 C;  3V6I A;  1M8O B;  2IZ0 A;  4C7R A;  1KMI Z;  1SQB J;  2POH A;  1OFC X;  3Q5R A;  3RL0 C;  1NOH A;  5KKZ B;  5KJ7 A;  4YXW H;  1OX3 A;  4OH8 B;  3C1L A;  3M91 A;  3R2P A;  3L4F A;  1EG9 A;  1CZQ A;  3M9B A;  2KNC A;  5APV A;  4N6J A;  2FYU K;  2WPR A;  2HMK A;  3GF7 A;  4IL6 X;  5CHX A;  4PV1 C;  4HM5 A;  2KS1 B;  3GLM A;  1IO4 A;  2WSC H;  1EXI A;  3D71 A;  2N9Y B;  2AEM A;  1KZU B;  3PHL A;  1K05 A;  4WB4 A;  2WQY C;  3VN0 A;  4HM0 A;  2IZ1 A;  3C0D A;  4UB8 H;  4GT1 A;  4I7Z C;  1FBM A;  2OYH B;  4H0L B;  3WU2 H;  3Q5S A;  4HKV A;  1L4A C;  2N9B A;  1NTM J;  1NTZ D;  3IAO A;  3B5N A;  1L0N K;  3LIE A;  2N1T D;  3D6Z A;  2UWJ E;  3CLQ A;  2YMK A;  3Q5P A;  3H1K D;  3R4Y A;  4GKG A;  1ZW0 A;  3WMM 0;  2IYP A;  2P10 A;  2AXT H;  3QH9 A;  4OGQ C;  1DH3 A;  2JEE A;  1ZRT D;  1E5W A;  2WSE J;  1PP9 J;  1X0T A;  3M0D A;  3GZY A;  1JY3 O;  1P84 E;  3D6Y A;  2H89 C;  4L74 A;  1DEB A;  1SQQ E;  3SFE C;  1JTH A;  3BAS A;  5CCH D;  1IZN B;  3DQY A;  2K88 A;  3HE4 A;  4HM8 A;  4WY4 B;  2O01 J;  4BRY A;  5KKZ C;  1HVV A;  1SQP D;  2B9B A;  3S4R A;  4C7N B;  3O8Z A;  3N7N A;  5B66 H;  2FYU J;  1PGQ A;  2YVJ B;  4BXL A;  3ZDM A;  1OVR A;  3V2R A;  2V4H A;  5AVV B;  2GM4 A;  3CWB D;  1IK9 A;  1LWU A;  4RO0 A;  1BCC E;  2WSF J;  3CL3 D;  3CCV P;  2HMM A;  3RK3 D;  1RY3 A;  4PD4 I;  3AE4 C;  1PGP A;  5CXM A;  1J1D C;  1AVO A;  3CC7 P;  2B89 A;  3IR9 A;  2O3J A;  4RKU J;  3RGU A;  4Z1M H;  3L73 J;  1CI6 A;  2KLU A;  2ZT9 C;  3GTE A;  3TGU E;  1RH5 B;  3LW5 J;  2XRX A;  1L0L G;  1SQV E;  1KB9 H;  2OYH C;  4H0L C;  1YTZ T;  4DZO A;  2W83 C;  4AUW A;  3CCJ P;  1JY2 P;  1L0N J;  4M3L A;  4K35 A;  3HTK B;  4QDF B;  3H6P A;  3QWO C;  5KLI B;  1G8J B;  3H1H G;  5CCG A;  1O7P A;  1NYH A;  3B71 A;  3GG2 A;  3G6E P;  2ITA A;  3WUU A;  1AA0 A;  2YXQ B;  5KLV E;  1SJG A;  3CX5 D;  1A02 J;  1LTT C;  2QJY B;  4NB9 D;  4U3F E;  5K5G B;  1FAV A;  3EFG A;  4RES B;  2OTK E;  5KAF E;  3RL0 D;  1KQL A;  3L71 E;  5AW1 B;  4WY4 C;  1IFJ A;  1SFC A;  1LTJ A;  2YFJ A;  2BMR A;  1BGY G;  1ZR2 A;  1IFP A;  4C46 A;  1JCC A;  2K9J A;  3C9I A;  3GKE A;  4HKZ H;  1M1J A;  1CSB A;  1GTW A;  1NTK J;  3H1J G;  3GW6 A;  4YPC A;  3WUV A;  3L72 J;  4YXD C;  2P7J A;  2XR8 A;  1Z56 A;  2KLV A;  3K5B A;  3BRV B;  2O1J A;  1HF9 A;  2NZ2 A;  1GU4 A;  3L70 E;  1N2D C;  4NBH D;  1L4A D;  1SVF A;  4QDC A;  3JCU H;  1D7M A;  3L37 A;  3P32 A;  5APY A;  4PJ0 E;  1RF0 A;  4GOE A;  1PPJ E;  2WZ7 A;  5KLI C;  1JM0 A;  2HPC A;  3GMA A;  3CXH E;  1EZV G;  2QEX P;  3FWL A;  4MN4 C;  2QJY C;  2E42 A;  1OWA A;  2N1T B;  2FYZ A;  1P84 D;  3EFF K;  2WSC J;  4OVN F;  1SQQ D;  4WVZ A;  1JY3 P;  3TNU A;  1RQV A;  1EDI A;  1VQ6 P;  3NFQ A;  4GIF A;  5AW9 B;  1GDT A;  1SLQ A;  3F89 A;  3M06 A;  2O01 N;  2IX7 C;  2IDB A;  2KSE A;  1WMK A;  3E1I A;  2L91 A;  1QL2 A;  5AVX B;  3BCC D;  3PRJ A;  1N86 A;  4NBE D;  1JEK A;  2FYU G;  1FJK A;  1M90 Q;  1BCC D;  2I8D A;  1WRG A;  4W7Y A;  3TK1 A;  2ZYD A;  4AYC A;  1NU1 E;  3BRT B;  2I1K A;  1K04 A;  5DJU B;  3CX5 H;  2KZJ A;  4HM1 A;  1YTZ I;  1ZP0 C;  3TGU D;  2M5A B;  3L73 G;  5KTB A;  1SQV D;  2OYI A;  2CK3 H;  2OAR A;  4NBB D;  2NVF A;  1HWT C;  1HH0 A;  2ZXX A;  3FXD A;  4K3A A;  2HOD B;  1R5S A;  1QVF O;  1L0N G;  3S9O A;  1FZA A;  2WSF H;  1NAF A;  3VMX A;  4D6T D;  1GU5 A;  3AE5 C;  2BEZ F;  1FZG A;  3PJS K;  2N1T C;  1BE3 D;  2BCC D;  3H1L J;  3PH0 A;  4U3F D;  1NTZ K;  1SQX K;  3SWK A;  3T97 B;  3VMI D;  3L71 D;  1J2J B;  2NPS A;  2Q3E A;  4W80 A;  3EN1 A;  3P8M C;  1GL2 A;  1SQB E;  1KFN A;  5CCH C;  5TIS H;  2Z4E A;  2LXC B;  1URQ A;  5APQ A;  4JF7 A;  2FFD A;  3CCS P;  1GZL A;  3L35 A;  4PD4 E;  3B5N B;  2PAJ A;  1X79 B;  2ZJS E;  2HMO A;  4GOD A;  1VCK A;  1SQP K;  4H13 B;  1FS0 E;  3HE5 A;  1NTK G;  3OW2 O;  4LC1 A;  3USS A;  2CPB A;  3A5T A;  3CCE P;  3KQG A;  2PP6 A;  2XKM A;  3KXD A;  2A45 G;  1QL1 A;  3EQ2 A;  3L74 G;  2WMM A;  1JOC A;  1HUC A;  2FY8 A;  1JY2 O;  3AEB C;  5KAI E;  4ZNC A;  2BEQ D;  3VMZ A;  3O6Q A;  1G2C B;  1NTM E;  3CXH D;  3L75 D;  1DX7 A;  4JQ0 D;  1LWU B;  3MIW A;  3HD7 A;  4R4L A;  3H1I J;  2IBZ G;  1LTG C;  1SQX J;  2J58 A;  2Y0E A;  1N7S A;  4YTP C;  2A45 H;  4I2L C;  1GW3 A;  3N4X A;  1BGY J;  1ULJ A;  2E5Y A;  2Q3I A;  2GA1 A;  3AE2 C;  1RF1 A;  4JYC A;  2XV5 A;  4IFF A;  1N8R Q;  2KYV A;  1SS1 A;  1W5C E;  1W2B O;  3V5B A;  1S9K D;  2H43 A;  4U7J A;  1WQL A;  4GOF A;  3H1J J;  3HRN A;  5AVZ B;  2D2C D;  1LT9 B;  4QUQ A;  1SQP J;  1MFT A;  2DE7 D;  3E7K A;  1N73 B;  1KB9 I;  5BVZ A;  2AEJ A;  3C8V A;  2ZVN B;  2LR2 A;  5GTI H;  4QCK A;  5C39 A;  1NU1 D;  2A06 G;  3AEE C;  3CWB J;  3HUS A;  2RKL A;  1EDK A;  2JDI H;  4JYB A;  1GK6 A;  2DW3 A;  2NVG A;  4UB6 E;  1FZC A;  3SWY A;  2HR3 A;  4QUP A;  5GTH H;  5HL4 A;  1S72 P;  2QM8 A;  2Q3W A;  1U57 A;  1FDI A;  2YMY A;  3WUT A;  2HYN A;  2W6B A;  1RE4 A;  3AE6 C;  1KTM A;  4XE5 B;  1EXJ A;  1S5L E;  1FQT A;  1LWU C;  1KIL D;  5AVU B;  3BVH A;  5H2F E;  3GF3 A;  3CCQ P;  2E74 D;  2RH0 A;  3N0Q A;  2K1A A;  1JCD A;  1QVG O;  2W8Z A;  2WPQ A;  3G3Z A;  5APT A;  2Q7C A;  2KXP B;  3H1L G;  4HB1 A;  3I55 P;  1N7L A;  1UII A;  1HBW A;  3FOU A;  1BSH A;  1LT1 A;  2K3R A;  2CKF A;  1KQS O;  1HJ0 A;  1SQB D;  4P1B H;  1A02 F;  1U7J A;  2PGD A;  5TJH A;  1O7M A;  1LTS C;  1SQQ K;  5BU5 A;  2R3S A;  1MUU A;  1KN7 A;  1JMB A;  1DIP A;  1VQL P;  4P1C H;  3BCC E;  4PD4 D;  1LT9 C;  5E79 E;  1KYO H;  2RN0 A;  1VQK P;  2R44 A;  5CCG C;  1N73 C;  3F5H A;  2IPP A;  2HPC B;  3V2Q A;  4RJT A;  4DCK A;  1W2E A;  4N3Y B;  1VQN P;  1LP1 A;  4WBA A;  3L72 E;  1L4A A;  3VP8 A;  3VTP C;  2ZFC A;  1KFM A;  1FE6 A;  4EIJ A;  3AE7 C;  5KJ7 D;  3H25 A;  3A0H H;  2QRX A;  2M8R A;  1MV8 A;  4ASV A;  3AZC A;  3FX0 A;  1DD3 A;  4Y99 B;  2FXM A;  3CME P;  1SP4 A;  1NTM D;  1DEE G;  1SQV K;  1RE3 C;  2Q1K A;  3OA7 A;  1VQ4 P;  3BAT A;  2KI7 B;  4D6T E;  1S2E A;  3P8C D;  3Q2Y A;  2C9N Y;  1BE3 E;  1FZB A;  2BCC E;  4LGD E;  1AJY A;  3PLN A;  2P58 A;  1K8A Q;  2QJP B;  1PP9 D;  3EWK A;  2K37 A;  1EZV I;  3H1I G;  2ZXE B;  1T6A A;  2O1K A;  2W6J H;  2YKQ A;  1NTZ G;  1SQX G;  1QX8 A;  4EDF A;  1NWQ A;  3MTU E;  3H1K G;  2KS1 A;  5KLV K;  1BSN A;  3GL2 A;  1NYK A;  2HG5 D;  3B5N D;  1SQQ J;  1PGJ A;  4DT0 A;  2MKV A;  2OYI B;  4H13 D;  3LID A;  1YJN P;  3VMY A;  3AEG C;  1NVO A;  2YFL A;  3M0A A;  3ITK A;  1M56 D;  1YHQ P;  2OYH A;  3VYI A;  1SQP G;  1T8Z A;  5AVS B;  1YBK A;  4IL6 E;  4O9B A;  2D2C B;  1YI2 P;  3CCR P;  2WTY A;  3S1K A;  4NB8 D;  2B87 B;  1BCC J;  1M57 D;  3MD0 A;  3L74 J;  3CWB G;  2WWW A;  5BU8 B;  3CC2 P;  1YIT P;  2NPS B;  1HJB A;  1VQP P;  4HJG H;  1IFI A;  4Y99 C;  5AW8 B;  2J59 M;  2P1J A;  3RBX A;  1RFS A;  1L0N D;  2M0B A;  4WY4 A;  5B66 E;  2B88 A;  2WPS A;  3FGA D;  2B1X A;  1G8K B;  2XDJ A;  2HLO A;  4C7N A;  3D89 A;  3L75 E;  3VMA A;  2NUK A;  2YNY A;  2V7Q H;  1MZ9 A;  4PD4 H;  4KJM A;  1FZF A;  5CBN A;  2C0W A;  1KIL B;  1EC5 A;  1AQ5 A;  2E74 B;  5KLV J;  2BMO A;  3AE1 C;  2QIW A;  4XFJ A;  2Y9Z A;  3H32 B;  4XA4 A;  1H8A A;  3NXS A;  1T3J A;  2IFM A;  4KT0 J;  1AVY A;  5CCG D;  3L71 J;  1VQ8 P;  4AQR D;  2GUS A;  2R32 A;  1S9K E;  3GTS A;  3KZI E;  5KAI H;  4HM6 A;  2WT7 B;  1NTK D;  1PL5 A;  2YIU B;  2KK7 A;  1X22 A;  3L72 D;  2D2C C;  3PP5 A;  5B5E E;  3GB4 A;  3HTK A;  5APW A;  1OXZ A;  2VRS A;  1VF5 D;  1R8E A;  4HM2 A;  2MJZ A;  4Y28 J;  4TT3 H;  5AW0 B;  4IFD K;  1VM9 A;  3CI9 A;  2NWF A;  4ASW A;  2G8Y A;  1L0L E;  4EMJ B;  2WSS H;  1FDO A;  2Z5I A;  1YYC A;  1RF1 B;  1NU1 K;  1FOS F;  3CCL P;  1GMJ A;  5AW5 B;  2A45 I;  3L70 J;  4KHX A;  2KZI A;  1USD A;  1FZE A;  2KNC B;  4GDO A;  3H1H E;  1Q2N A;  1IFD A;  1KIL E;  1JM1 A;  3MUD C;  4NBA D;  4ZKP A;  1KIL C;  2H8P D;  3RBZ A;  1NHL A;  2QJK B;  2ZVO B;  2NUM A;  2E74 C;  1J1E B;  2IBZ I;  1Q90 D;  1T3U A;  1GW4 A;  1BGY E;  2LKM A;  1ZV8 A;  1GD2 E;  3U1C A;  2QSI A;  1PV3 A;  3D70 A;  4JPZ B;  4UB6 H;  1SQQ G;  1JNM A;  3MGN A;  1Y47 A;  2YIU C;  1ZR4 A;  1VQO P;  2CPS A;  1SQB K;  2M3E A;  3H1J E;  2OTJ P;  3P7K A;  2HMN A;  2QG4 A;  2WIT A;  1M7L A;  3E1R A;  3CCM P;  2OQQ A;  1S5L H;  2A06 D;  3GL0 A;  3AE9 C;  1FJP A;  1EDJ A;  5H2F H;  3BCC G;  1NKN A;  5APX A;  1PGO A;  5AVR B;  5APS A;  1JTH B;  1BCC G;  2XZR A;  1P84 H;  2N1T A;  5DJT B;  3HE4 B;  1RF1 C;  2FYN B;  1CW5 A;  1NU1 J;  1G1I A;  1S4X A;  3VP9 A;  1BDC A;  1IJD B;  4BRY B;  5KJ7 C;  3KDP B;  3RK2 D;  1E79 H;  3W67 A;  1H88 A;  4N78 E;  4ZKU A;  1HGV A;  4AIV A;  1FDM A;  1EZV E;  3TGU G;  1AFO A;  1SQV G;  3V4Q A;  3G9R A;  1DD4 A;  3ABV C;  5CCH A;  3P8C E;  1YJ9 P;  2YFI A;  5BOK A;  5E79 H;  3IF4 A;  3I56 P;  1NTZ J;  1R5L A;  2QA4 P;  3W68 A;  2QJK C;  3H1L D;  4QDD A;  5AW7 B;  2NRG A;  1X9V A;  2XU6 A;  1PP9 E;  1J1E C;  1NTM K;  3H1K J;  3CMA P;  1KYO I;  1ULI A;  1VPC A;  2JO1 A;  5AVW B;  2Y0D A;  4H44 D;  5CJ0 A;  5KLV G;  1CI6 B;  4HJL A;  1QEX A;  1H0T A;  1NH4 A;  2B24 A;  4U3F G;  1KC8 Q;  1JY3 N;  3M9Q A;  4NBG D;  4NPE A;  1KB9 D;  4CPG A;  2KUB A;  1OZH A;  3B5N C;  2FYU E;  3L71 G;  2M5A A;  3MP7 B;  3OAK A;  3GOB A;  2SPZ A;  2YKP A;  3RL0 g;  3A0B E;  2QE7 H;  4H13 C;  3AEC C;  3TF5 A;  1XTC C;  1ZLL A;  3VCP A;  5AEU A;  1Q7Y Q;  1AQT A;  4BWN A;  3II6 A;  4HM7 A;  5AW3 B;  2HOD A;  3KPE A;  2V7Q J;  4HM3 A;  3M0D C;  3IFM A;  4L76 A;  2NPS D;  2G3A A;  2H7H A;  1ZXG A;  4LLH A;  3SWF A;  1GL2 D;  2P2U A;  3AE8 C;  1JO5 A;  2H88 C;  2BAS A;  2FYN C;  1URQ D;  5AW6 B;  1L0L D;  3L73 E;  3JSV C;  1KOR A;  1SFC B;  1LTJ B;  3TDK A;  1VF5 B;  3TSI A;  5KAF H;  1KQF B;  1KV4 A;  1RHZ B;  1J1D B;  3T97 A;  2PFX A;  2K9J B;  3GHG A;  3MZW B;  2ZYL A;  5TIS E;  5AVT B;  3MHV A;  1L0N E;  3L70 G;  3H1H D;  2KIK A;  1UIX A;  2E43 A;  1M1J B;  1OVU A;  2R5B A;  2ZT9 B;  2IFN A;  2ZYG A;  1IFM A;  4TLF A;  2GBW A;  2XSH A;  3H1I D;  2JWA A;  1SQX D;  1PPJ G;  4EYY Q;  4NPD A;  4NBF D;  3AE3 C;  1T2K D;  2YO3 A;  4IL6 H;  2XSO A;  2YKO A;  2Q6Q A;  3V2N A;  3L75 G;  1LGH B;  4NBC D;  1MKM A;  1BGY D;  2W27 A;  1QGK B;  4ZMD A;  2E76 D;  3SFD C;  3GZX A;  1LTB C;  2IYO A;  1LNQ A;  1Y9B A;  3HD7 D;  3AED C;  3SSU A;  3A7O A;  3H1J D;  3CC4 P;  1LTI C;  1N7S D;  1S1C X;  4PJ0 H;  1NTK E;  5AW4 B;  3V4W A;  1ZN5 A;  3CXH H;  2E5T A;  1G2C A;  2L5G B;  4QMA A;  1KD1 Q;  2BMQ A;  1FU1 A;  1NTK K;  3TNU B;  1IFN A;  5CMZ A;  1SFC C;  1LTJ C;  1BDD A;  3L74 E;  1VF5 C;  1K9M Q;  3TYY A;  2R5D A;  3UIA A;  1OW6 A;  2QPZ A;  1OW7 A;  3V2P A;  1NU1 G;  1VQM P;  1FC2 C;  1HGZ A;  1HTL C;  3KHU A;  3L36 A; 
#chains in the Genus database with same CATH homology
 3GKE A;  4NBA D;  2CKF A;  2ZT9 D;  2YFI A;  5BOK A;  5AEW A;  2NVE A;  4HM5 A;  2I7F A;  4NBD D;  1BCC E;  4P1B H;  4NBE D;  1O7W A;  1UUW A;  2QJK C;  4QDD A;  2NUM A;  4H0L D;  2BMO A;  3EQQ A;  2HMM A;  3GL2 A;  1PP9 E;  1NYK A;  4HM4 A;  1O7M A;  4PD4 E;  2GBW A;  2XSH A;  2IBZ E;  5CXM A;  1ULI A;  1KYO E;  1WQL A;  2HMO A;  4P1C H;  1VCK A;  2D2C D;  4H13 D;  2XR8 A;  2QJP C;  1BGY E;  3BCC E;  4NBF D;  4QUQ A;  2E4P A;  2DE7 D;  2DE5 D;  4H44 D;  2XSO A;  3H1L E;  2E75 D;  4HM0 A;  4OGQ D;  4HJL A;  1NU1 E;  4NBC D;  3C0D A;  3GTE A;  3H1I E;  3GTS A;  2YFL A;  3TGU E;  1NTZ E;  1SQX E;  3L70 E;  2B24 A;  2XRX A;  2E76 D;  1SQV E;  4NBG D;  3GZX A;  4NBH D;  4QCK A;  4HM6 A;  4HKV A;  3L72 E;  3H1K E;  4QDC A;  4HM1 A;  2YIU C;  2FYU E;  3GOB A;  3H1J E;  1RIE A;  1Q90 C;  1ZRT E;  2JO6 A;  1O7N A;  4NBB D;  2GBX A;  2HMN A;  2NVG A;  2NVF A;  1PPJ E;  4QDF B;  3VCP A;  5AEU A;  3GB4 A;  1G8J B;  4NB8 D;  5KLI C;  1NDO A;  3VMH D;  1KB9 E;  3CX5 E;  4QUP A;  1O7P A;  3GL0 A;  3VCA A;  1VF5 D;  4HM7 A;  2HML A;  5HL4 A;  1NTK E;  4QUR A;  1UUV A;  4HM3 A;  3CXH E;  4HM2 A;  5KLV E;  1SJG A;  2Q3W A;  3GZY A;  1VM9 A;  1P84 E;  2DE6 D;  3AZC A;  2NWF A;  1NTM E;  4NB9 D;  4U3F E;  2QJY C;  1L0L E;  4EMJ B;  1SQQ E;  1O7H A;  3VMG D;  2A06 E;  1SQP E;  1FQT A;  2BMQ A;  3DQY A;  4PV1 D;  2FYN C;  2E4Q A;  2JZA A;  4HM8 A;  3L73 E;  1RFS A;  3L71 E;  4QDF A;  4AAY B;  2E74 D;  3GCE A;  3N0Q A;  3L74 E;  5KKZ C;  2YFJ A;  4D6T E;  2B1X A;  2BMR A;  1G8K B;  1EG9 A;  3VMI D;  3D89 A;  1BE3 E;  3H1H E;  3L75 E;  2BCC E;  1O7G A;  2QPZ A;  2NUK A;  2HMK A;  3CWB E;  2YVJ B;  2ZYL A;  2HMJ A;  3EN1 A;  1JM1 A;  3FOU A;  4AIV A;  1ULJ A;  1EZV E;  1L0N E;  1SQB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...