3TGUE

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 39
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3tguE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3tguE02
3VCAA 3H1LE 3AZCA 4QDDA 2QJPC 2YFJA 5BOKA 4AAYB 2HMKA 1UUWA 4HJLA 4HM4A 1ULIA 2HMMA 4D6TE 2YFIA 4EMJB 2XRXA 2HMLA 3CXHE 4NBGD 2DE6D 1O7HA 4NBAD 1BGYE 1L0NE 2JZAA 3GKEA 2NWFA 2E4PA 4NB8D 1VCKA 4HM7A 1NTKE 2XSOA 2CKFA 4HM3A 2IBZE 2XR8A 1NDOA 1VF5D 4HKVA 4P1CH 1BCCE 2E4QA 4H44D 3DQYA 1G8JB 1O7MA 4QDFB 4NBHD 3EN1A 2HMNA 1SQPE 4HM8A 4HM5A 4QUQA 3GCEA 2QJKC 1ZRTE 1O7WA 2FYNC 2QPZA 1NU1E 1NTME 1O7GA 1Q90C 3L73E 2I7FA 4HM0A 1NTZE 3H1IE 1PPJE 4HM2A 2BCCE 2JO6A 1UUVA 2Q3WA 3GOBA 3GZXA 3EQQA 4NBED 2NVEA 1KB9E 3GL0A 3VMID 1KYOE 1NYKA 4U3FE 2QJYC 3D89A 2A06E 3GTSA 4OGQD 4P1BH 3VCPA 5KLIC 3GL2A 3C0DA 2BMRA 3BCCE 1RFSA 1EZVE 4HM1A 4QUPA 3VMHD 1JM1A 4QDFA 4H13D 3GTEA 1EG9A 3FOUA 2BMQA 2E76D 4PD4E 5CXMA 1O7NA 3GZYA 3H1KE 1O7PA 4NBFD 3L74E 5KLVE 1SQQE 1WQLA 2D2CD 1L0LE 1SQBE 2GBWA 2NVFA 4QDCA 2B24A 2DE7D 3CWBE 3H1JE 4H0LD 4NBDD 4QCKA 1G8KB 2NVGA 2FYUE 3L71E 2ZYLA 2HMJA 1FQTA 1RIEA 2GBXA 3VMGD 2YFLA 1ULJA 2HMOA 3CX5E 2DE5D 5AEWA 3TGUE 2XSHA 3L75E 4PV1D 3H1HE 5HL4A 1PP9E 4AIVA 2YIUC 3GB4A 1VM9A 4HM6A 1SJGA 4QURA 3L70E 2NUMA 4NBBD 2E74D 1SQXE 2E75D 3L72E 4NBCD 1P84E 3N0QA 5AEUA 2BMOA 2NUKA 2YVJB 5KKZC 2B1XA 1SQVE 2ZT9D 4NB9D 1BE3E
chains in the Genus database with same CATH superfamily
3MTUE 2O01N 3PP5A 2FXPA 2IYPA 1X79B 5BOKA 2Y0EA 2YXRB 1SQBJ 4IFDK 4D6TE 1VQ9P 3HTKA 4YXWH 2O1KA 3PJSK 4HH2A 4DCKA 3AE4C 5APWA 1YTZT 3PH0A 1Q81Q 4NPDA 1CZQA 2D2CC 2K88A 3GF7A 1G2CA 4B86A 2KS1A 3HD7D 2Q3WA 3GOBA 3LIDA 3GZXA 3MP7B 4NBED 3P8CD 1FDMA 1PPJD 2FYUG 4OH8B 3GW6A 1L4AC 3E1RA 1JY2N 2LXCB 2AXTH 2NPSA 4QUPA 3VMHD 4YTPC 1JM1A 4Y99B 1PZQA 1RF1A 1BSHA 3M0AA 4R4LA 3L72G 1O7PA 1NAYA 4JPZB 2NVFA 2B24A 5B66E 5KJ7C 1S9KD 2E5YA 3CX5H 1KQSO 3M0DC 1PGJA 2YO2A 3CWBJ 2R5BA 4N6JA 1NYHA 1VM9A 3CX5D 2IPPA 4OGQB 5CCHA 1PGPA 3LW5J 3O6QB 3CC7P 2IBZD 2LR2A 1SQBG 2ZT9D 1CI6B 1BGYD 1RQUA 2O01J 3IN6A 4ZKUA 2R5DA 2HMMA 5AVUB 3M9HA 2BEQD 2DE6D 3CCUP 5AVZB 3QH9A 1Q82Q 1FE6A 2NWFA 3TDKA 1U7MA 1NTKD 2VRSA 1NKNA 3S4RA 3C9IA 3RK2C 1IJDB 1BCCE 2E76B 4PJ0E 5AW4B 2Q5UA 3RL0C 3DQYA 2SPZA 4WY4C 2ZYDA 4HM8A 4OVNF 1NU1E 1S1CX 2YNYA 3Q3DA 1SQQG 3C1LA 2M3EA 3CWBG 3FWLA 3TGUJ 3GL0A 3A2AA 2IZ0A 4OGQD 4ZMDA 4JF7A 4ZKPA 1NTMD 2ZYGA 1P84H 2WSFH 4C7RA 1FJKA 2WVRA 4K35A 3D71A 3L72J 1KD1Q 3L71D 2H88C 5GTHH 2D2CB 2ZVOB 1WQLA 2RH0A 2PFXA 1YYCA 4H44B 3S9OA 3H1LG 4C46A 1HUCA 1AA0A 5AEWA 3TGUE 3HE5B 1CI6A 5AW5B 1NTZK 4M3LA 4YPCA 1LTJC 1GDTA 2O1JA 2QM7A 3CC4P 2KUBA 2A45G 2Q1KA 1OVVA 2C9LY 3KZIH 1OWAA 1OX3A 5CMZA 4BXLA 4AQRD 1X9VA 3B5NB 4PV1B 2HMLA 2YO3A 1R8EA 1KMIZ 1L0NE 1KQLA 3AECC 4D6TJ 2KNCA 1ZR4A 4U3FG 1GL2B 2W8ZA 1L4AB 1Q90C 1JY2O 3T97A 1NTZE 3TYYA 1KQGB 2BCCD 1SQXK 1EZVD 1G1IA 2QJYC 2ZXXA 2W27A 4EIJA 2K9JB 1LWUA 2BASA 5CBNA 2BMRA 1ZW0A 1RFSA 3HD7B 4LGDE 1HJBA 1PP9G 1KILB 3T97B 1EG9A 1HGVA 2KOGA 2M0BA 3L73G 2C9NY 2WSEJ 4HB1A 1W2BO 4WB4A 3CPWO 1EDIA 1FAVA 1N7SD 1EDJA 3MUDA 2YFLA 2XV5A 3G3ZA 1VDFA 1GU4A 3V4QA 1H89A 4ASWA 1LTBC 4L76A 2E43A 4DOJA 2FFDB 1LTGC 2NUMA 2A45I 1M90Q 1PP9D 4NBCD 1RE4A 1FU1A 2NRGA 4RO0A 2IBZG 2KYVA 2AEJA 3LW5H 1ZLLA 4AAYB 2WTYA 1T2KC 2WPRA 4GIFA 3HD7A 3RK3D 1SQQK 1PL5A 2WITA 3AEDC 1L2PA 1GL2D 4JBZA 1SQXG 2BCCG 2E4PA 5AVQB 3AE6C 1JMBA 3OA7A 2KNCB 1NGMB 1GW3A 3CLQA 1VPCA 1FZEA 1JY2P 1ZN5A 1H0TB 1HF9A 4QUQA 1ZRTE 2QPZA 2E74B 1R5SA 2I7FA 1KZUB 2WSCH 1N7LA 4W7YA 3CD6P 3N7NA 2RN0A 3H1KD 4OGQC 2XZRA 1L4AA 1LGHB 1SQPK 4QDFA 2H89C 1W5CE 4PD4E 1P84I 1JOCA 5B5EE 5KLVD 2OTKE 1BDCA 2H43A 2P1JA 2WSEH 1OW8A 4ASVA 1DD3A 1NU1K 4JYBA 3I55P 2PGDA 3L75E 2V7QH 2POHA 1YBKA 4NBBD 1S4XA 2M3BA 2O01H 5AW1B 2M5AA 1SQVE 3H1JG 2WQYC 5APSA 3GMAA 2Y0CA 4W7ZA 1U7JA 2J58A 1XTCC 5AW6B 3A0BE 2JKVA 1G1JA 3VMZA 3L70J 1N8RQ 2OYHC 1NTKE 3AE5C 2NPSD 1BE3G 4L75A 3KXDA 1S5LH 2P2UA 5BVZA 4H44D 5KJ7D 1SFCD 1KILD 2HG5D 4UB6H 5KLVJ 1FZFA 2R3SA 1RY3A 2B87A 2N1TC 3N4XA 4OWFA 1URQD 3H1IE 5KLVK 3AEFC 1JY3O 3D89A 1LJ2A 1IC2A 4HM1A 1NOHA 3P7KA 2Z5IA 1IFNA 3KQGA 1PPJG 2FYUD 3A0HE 3V2NA 3G9RA 2GBWA 1MUUA 4IFFA 4GKGA 2B89A 2FYUJ 1NHLA 1VQ4P 1QLED 3GHGB 3KDPB 5KAIH 2E75D 3L72E 2OYHA 5APVA 3RK3C 3H25A 5C39A 2B1XA 1T2KD 3LIEA 2QJKB 1BCCG 3O8ZA 1KN7A 1IFJA 2DW3A 2IX7C 3CXHE 2YMKA 5B66H 4I1LA 1KQFB 4A7PA 4HM7A 1KC8Q 3KZIE 2XSOA 2I1KA 1K04A 5DJTB 1DH3A 1URQC 1FJPA 2YKOA 4DZOA 1QEXA 2HPCA 3SFEC 3L73E 1YQ4C 2QA4P 1JM0A 2NPSC 2QE7H 3GG2A 1AQTA 2KLUA 3P8CE 3KPEA 2KP8A 1KYOE 1IFIA 1X0TA 1J1EB 1GW4A 1VQ6P 1DD4A 3WUTA 3CXHI 3V5BA 1LNQA 5CBOA 3BRTB 1KB9I 1Z56A 2L91A 3VYIA 4RJTA 3L71E 5CCHC 2JR8A 2QIWA 2XNXA 1FQTA 3SFDC 3CCMP 4D6TD 3KYQA 3M0DA 5HL4A 1VQPP 4PJ0H 4EDFA 1NWQA 2XKMA 1L0NG 2OYHB 3H1LD 1OXZA 3PHLA 3JCUH 4I2LC 1VQOP 3CL3D 2E75B 3A5TA 2YFJA 1OW6A 1EC5A 3U1AA 5GTHE 2C0XA 3JSVC 2N1TB 2WSCJ 1NTMG 3AE7C 2YKQA 1PFIA 2A45H 4WBAA 1IFDA 1EDLA 2CKFA 1QGKB 3JC22 1L0ND 1VF5D 2G3AA 5KLIB 1AQ5A 3ITKA 3V2QA 1G8JB 5TISH 1JY3N 1Q7YQ 1PV3A 1E79H 1AVYA 1RH5B 1SQVK 1VF5C 3FWNA 5H2FE 3HE4B 1K9MQ 3A0HH 1UUVA 2KZIA 3WU2H 3PRJA 3E1IA 3GTSA 2IFNA 3VCPA 3CX5I 1GK6A 5M1BA 1EZVE 1PP9J 2QSIA 2J5UA 3FOUA 3AE1C 1SQQE 2LKMA 4QDCA 1S3JA 3H1JE 3H32B 1FZAA 1FZBA 2HFED 2FKWB 2HMOA 1BDDA 3SWFA 2FY8A 5CCHD 1LWUB 2YVJB 3G71P 2I8DA 3H1HD 1BSNA 4IL6E 3RK3E 1N2DC 2K3RA 1JEKA 1VQ7P 1X8YA 1T6AA 1SQPD 2BCCJ 2YMYA 2PAJA 1N86A 3WU2E 1AFOA 1AV1A 1ZOYC 3CCRP 2FYUK 2AXTE 3OW2O 2HYNA 2IBZE 3Q5PA 3Q5RA 1NAFA 3S1KA 2N1TD 3BCCD 3HE4A 4H13B 4NBHD 1RF1C 4WY4D 1SFCC 4QMAA 5AW8B 2Q7CA 3RK2D 1Y9BA 2BCCE 1PIXA 2KLVA 3CMAP 4GOFA 2V7QJ 4GODA 2A06E 5CJ0A 3Q5SA 1DEEG 1ZXGA 2GM4A 3NFQA 2YIUB 1QVGO 2P7JA 1LTJB 3L70D 3CCEP 2OYOA 1LP1A 5AVTB 4HJGH 1YJWP 2D2CD 1EXIA 1FDIA 3EQ2A 3TF5A 5CHXA 1K8AQ 2OARA 3NXSA 1HGZA 1ULJA 2FBWC 1HTLC 3L71J 2IZ1A 2JP3A 4AIVA 1RHZB 4JYCA 2KZJA 3RK2B 3EFFK 1OW7A 2E74D 3AEBC 3B4SA 4WY4B 4EOTA 2KB7P 3OAKA 2FXOA 3R2PA 1VQLP 3MGNA 5B5EH 2R44A 2AEFA 2WWWA 1ZMEC 2YFIA 2P58A 4NBGD 1T3JA 1UIXA 1JY3P 1NTZJ 1NTZD 2B88A 1BGYE 3GKEA 3BATA 1VCKA 5AVXB 1FZCA 3A3YB 4DJGA 3I5CA 1KILA 4IFMA 3BASA 1NTKK 2QRXA 3RL0g 3IAOA 3CCQP 2Z4EA 1YJNP 4H44C 3IR9A 1YITP 4O9BA 3V6IA 4HM0A 2H7HA 2HODA 2K1AA 3WUVA 2Z5HA 1L0LG 4YXDC 3VMID 1NYKA 2Q6QA 2YXQB 1GL2C 5AW9B 5KLIC 3KHUA 2JWAA 2QEXP 1IO4A 2W90A 3RBXA 4XA4A 2QVAA 4PD4D 2J59M 2W6JH 1VF5B 3H1IJ 1OFCX 3D6ZA 5KKZB 3B5NC 1KV4A 4BRYA 1G8KB 1T3UA 4JQ0D 3VMGD 3CX5E 1SQQJ 4TLFA 2DE5D 3HTKB 3VOPA 2XDJA 1N7SC 3L74G 1H0TA 2V4HA 2AXCA 1IZNB 5CJ4A 1M56D 2IYOA 5K5GB 3WMM0 2W83C 1HBWA 1SFCB 2W6BA 2WMMA 3CXHD 2KIKA 2QM8A 1UIIA 3HD7C 2XR8A 5APQA 1GMJA 2QJPB 1D7MA 4D6TG 2ITAA 3V2RA 1N73A 1JTHA 1BGYG 3D6YA 2P67A 4GT1A 3V4WA 1KB9D 4HKZH 1SQBK 2JJLA 2N9BA 4P1BH 1ZP0C 5AVVB 1FZCC 3BCCE 1TU3F 3TGUG 1QL2A 1OIPA 1SVFA 3AE3C 1RF1B 1SQVJ 1OVUA 1ZRTD 3OJAB 2NZ2A 4H0LB 4RKUJ 4LLHA 1L0LE 1KB9H 4EYYQ 1S9KE 3U59A 3L37A 1LTIC 2O3JA 2ZXEB 2YIUC 1BE3J 2Y0DA 4Z1MH 1N73B 3L70E 2K9YA 4AYCA 1RF0C 2WPVB 1X22A 1CW5A 5KAFE 3FGAD 1USEA 5AEUA 2ZJSE 3H1LE 3ZDMA 3ABVC 1AJYA 3AZCA 1EZVI 1L0NJ 2ZVNB 2HMKA 1J1DB 4W80A 3H6PA 4NBAD 3HUSC 1HVVA 1NTZG 1A02J 1S2EA 4HM3A 2WT7A 1NDOA 2AEMA 1YI2P 4P1CH 4PD4H 3RK3B 1GD2E 1FOSF 1JCCA 3AEGC 2MKVA 3H1LJ 3GCEA 2QJKC 4UB8H 3A0BH 1MZ9A 3H1KG 2KI7B 1RE3C 3CCLP 2MJZA 2L5GB 3IF4A 1LTTC 3C8VA 3GL2A 3EWKA 2OYIC 3AE9C 3M9QA 2BEZF 3GTEA 1RQVA 1Q86Q 4L74A 3H1KE 1VQMP 1EDKA 3CCVP 1L0LD 1M1KQ 1VL2A 1A02F 2NVGA 2HMJA 2HODB 2K37A 2E5TA 1OZHA 1PP9E 1S5LE 1S5LX 3AE8C 2FYZA 1Q90D 2ZAEB 4XFJA 4L73A 1E5WA 3M91A 2GA1A 3MHVA 1JNMA 1GZLA 2E76C 3RL0B 3VCAA 2QJPC 1FOSE 3CI9A 1JCDA 4UB6E 4EMJB 3B71A 1KYOH 2FYNB 1OMIA 5AVWB 1BE3D 1M1JC 1H8AA 3NTNA 5CCGD 2CPSA 2M5AB 1J1EC 3F5HA 4HKVA 4WWIA 1Q2NA 4LC1A 3EN1A 5DJUB 2E75C 3CMEP 5E79E 1J1DC 1U57A 2KXPB 3Q2YA 4U3FE 2Q9IA 3UIAA 1BCCD 3H1JD 4KT0J 3VP8A 3M9BA 3VTPC 3L74D 1DIPA 4K3AA 3FXDA 5CXMA 5APXA 3A7OA 1SQVG 3BVHA 2DE7D 3Q1MA 4H0LD 4QCKA 4U7JA 1MV8A 5E79H 2PRRA 1R5LA 5AVYB 1W2EA 4PV1C 1KFMA 1L0LJ 1FZCB 1QVFO 1MFTA 1EQ7A 3B8EB 1SJGA 3HUSB 1MFZA 1T8ZA 3L75J 4GOEA 1BE3E 1KILC 2N1TA 2I1JA 1PGQA 3L36A 3RL0D 5APYA 1YTZI 3PTZA 1NJIQ 1UUWA 4HJLA 3QWOC 1SQPG 2OYIA 1NTKJ 2XRXA 1P84D 1O7HA 1HWTC 3SWKA 4N78E 2JZAA 4NB8D 3E7KA 2N9YB 5BU5A 1RE3A 2FXMA 2LXBA 1NKZB 1WMKA 4NPEA 5KTBA 1G2CB 3GLMA 5AW3B 4H0LC 2OYIB 3BCCG 4QDFB 3H1ID 1LT9C 2RMZA 2HPCB 3VMYA 2YKPA 2R3CA 4ZNCA 1O7GA 1LTAC 3HUSA 1NU1D 3SWYA 3L74J 4GDOA 1GTWA 1PPJE 1KFNA 5H2FH 5AW0B 2B9BA 2JO6A 2ZYAA 2XU6A 2OGUA 3CWBD 3H1JJ 3TSIA 1KB9E 3P32A 3VMAA 3H32A 3MUDC 1M8OB 2OQQA 2KK7A 4H13D 2WT7B 2FFDC 1JUNA 1RF0A 3EFGA 1LWUC 3H1IG 1XTGB 4NBDD 1SFCA 4KHXA 4EI2A 2FYUE 5AW7B 2ZYLA 3BRVB 2QJYB 3TNUB 3H1KJ 2PP6A 1SQXJ 2C0WA 1PGOA 2XSHA 5L8RJ 5CCGC 1K73Q 1YJ9P 2WPSA 1P84E 2BMOA 2NUKA 3MIWA 4I7ZC 1EXJA 4N78D 3AEEC 4N3YB 4UB8E 1WRGA 2ZT9B 1H88A 4H13C 1ULIA 1HH0A 2CK3H 4C7NB 1NU1J 1KILE 2E74C 1NU1G 1M7LA 1NVOA 4IOIH 4PD4I 3IFMA 2IFMA 2IBZI 5APTA 1KTMA 1LT1A 1HJ0A 3K5BA 4RESB 1GU5A 1O7MA 3GF3A 3SSUA 1M1JA 3MD0A 1KORA 1SQPE 2W6AA 4HM5A 2HR3A 3W68A 1DX7A 2FYNC 1LTJA 4HM2A 4WY4A 3VMXA 4R4MA 3L71G 1LT9A 1Y47A 1FZGA 3AE2C 5GTIE 3L35A 5EFWB 3TK1A 1IK7A 1VQKP 3G6EP 3L75D 2XNDH 3GHGA 2OTLP 1NO4A 4C7NA 1SS1A 1AVOA 1O7NA 3NMDA 3PLNA 2Y9ZA 3GZYA 1GK4A 1WT6A 1LT9B 1SQQD 3CXHH 3HE5A 1N7SA 2FFDA 3F89A 3CCSP 3AEAC 1M1JB 1BGYJ 2KSJA 4WVZA 1JO5A 4PV1D 1JB0J 4BRYB 1DEBA 3GB4A 4HM6A 4QURA 2Q3EA 2Q3IA 1IFMA 1QX8A 3P8MC 1FC2C 4TT3H 3N0QA 3VN0A 3B5NA 4HYTB 2GUVA 1BCCJ 1S72P 5BU8B 2JEEA 3FXEA 3M06A 5KJ7A 4QDDA 5TISE 3TNUA 2P10A 1YIJP 4XE5B 2K9JA 3I56P 3L70G 1GL2A 5GTIH 1SLQA 1ZV8A 3D70A 1Y8AA 1JMMA 2M8RA 1L0NK 4Y28J 1VQ8P 1ZR2A 3VP9A 2E4QA 3W67A 2HMNA 3R4YA 5AW2B 1NTME 1URQA 1J2JB 1YHQP 3EQQA 2B87B 2NVEA 2JWDA 3WUUA 4U3FD 2A06D 5KAIE 3C0DA 2Y9YA 3U1CA 3H1HG 3GHGC 5CCGA 1URQB 5AVRB 1N7SB 2E76D 1NTMK 3L72D 3CC2P 2WSFJ 1VQNP 5KLVE 1RE4C 4I7ZB 3CWBE 1IK9A 1SQBD 1NTMJ 3V2PA 2JO1A 3RGUA 1RIEA 4U3FJ 4CPGA 3TGUD 3L4FA 1FBMA 2HLOA 4Y99C 1LTSC 5AVSB 3HRNA 3CCJP 1SQXE 2G8YA 1LP1B 1NTKG 3JCUE 5KKZC 2E42A 3FX0A 4NB9D 1VQ5P 1SQXD 4MN4C 1KYOI 3USSA 2OTJP 4HM4A 4AUWA 1FS0E 3L73D 1CSBA 1SP4A 2RKLA 3RBZA 3BCCJ 1QL1A 2A06G 2WSSH 1JTHB 2ZFCA 4KJMA 2H8PD 2ZT9C 1USDA 1IFPA 5KAFH 3B5ND 4IL6X 2IDBA 2WZ7A 1O7WA 2WPQA 1M57D 2KS1B 1SQPJ 2CPBA 3H1HJ 5TJHA 2UWJE 4NPFX 2QG4A 4I6MC 1NH4A 4DT0A 3L75G 1K05A 3G4SP 1N73C 2BMQA 3L73J 1OVRA 4NBFD 3L74E 3MZWB 2NPSB 1SQBE 1L4AD 1FDOA 1KYOD 3II6A 4IL6H 2GBXA 1EZVG 2GUSA 3H1HE 2R32A 2KSEA 1SQVD 1MKMA 5KLVG 1L0LK 4BWNA 2JDIH 5APUA 3O6QA 1YQ3C
chains in the Genus database with same CATH topology
3VCAA 3H1LE 3AZCA 4QDDA 2QJPC 2YFJA 5BOKA 4AAYB 2HMKA 1UUWA 4HJLA 4HM4A 1ULIA 2HMMA 4D6TE 2YFIA 4EMJB 2XRXA 2HMLA 3CXHE 4NBGD 2DE6D 1O7HA 4NBAD 1BGYE 1L0NE 2JZAA 3GKEA 2NWFA 2E4PA 4NB8D 1VCKA 4HM7A 1NTKE 2XSOA 2CKFA 4HM3A 2IBZE 2XR8A 1NDOA 1VF5D 4HKVA 4P1CH 1BCCE 2E4QA 4H44D 3DQYA 1G8JB 1O7MA 4QDFB 4NBHD 3EN1A 2HMNA 1SQPE 4HM8A 4HM5A 4QUQA 3GCEA 2QJKC 1ZRTE 1O7WA 2FYNC 2QPZA 1NU1E 1NTME 1O7GA 1Q90C 3L73E 2I7FA 4HM0A 1NTZE 3H1IE 1PPJE 4HM2A 2BCCE 2JO6A 1UUVA 2Q3WA 3GOBA 3GZXA 3EQQA 4NBED 2NVEA 1KB9E 3GL0A 3VMID 1KYOE 1NYKA 4U3FE 2QJYC 3D89A 2A06E 3GTSA 4OGQD 4P1BH 3VCPA 5KLIC 3GL2A 3C0DA 2BMRA 3BCCE 1RFSA 1EZVE 4HM1A 4QUPA 3VMHD 1JM1A 4QDFA 4H13D 3GTEA 1EG9A 3FOUA 2BMQA 2E76D 4PD4E 5CXMA 1O7NA 3GZYA 3H1KE 1O7PA 4NBFD 3L74E 5KLVE 1SQQE 1WQLA 2D2CD 1L0LE 1SQBE 2GBWA 2NVFA 4QDCA 2B24A 2DE7D 3CWBE 3H1JE 4H0LD 4NBDD 4QCKA 1G8KB 2NVGA 2FYUE 3L71E 2ZYLA 2HMJA 1FQTA 1RIEA 2GBXA 3VMGD 2YFLA 1ULJA 2HMOA 3CX5E 2DE5D 5AEWA 3TGUE 2XSHA 3L75E 4PV1D 3H1HE 5HL4A 1PP9E 4AIVA 2YIUC 3GB4A 1VM9A 4HM6A 1SJGA 4QURA 3L70E 2NUMA 4NBBD 2E74D 1SQXE 2E75D 3L72E 4NBCD 1P84E 3N0QA 5AEUA 2BMOA 2NUKA 2YVJB 5KKZC 2B1XA 1SQVE 2ZT9D 4NB9D 1BE3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VCA A;  3H1L E;  3AZC A;  4QDD A;  2QJP C;  2YFJ A;  5BOK A;  4AAY B;  2HMK A;  1UUW A;  4HJL A;  4HM4 A;  1ULI A;  2HMM A;  4D6T E;  2YFI A;  4EMJ B;  2XRX A;  2HML A;  3CXH E;  4NBG D;  2DE6 D;  1O7H A;  4NBA D;  1BGY E;  1L0N E;  2JZA A;  3GKE A;  2NWF A;  2E4P A;  4NB8 D;  1VCK A;  4HM7 A;  1NTK E;  2XSO A;  2CKF A;  4HM3 A;  2IBZ E;  2XR8 A;  1NDO A;  1VF5 D;  4HKV A;  4P1C H;  1BCC E;  2E4Q A;  4H44 D;  3DQY A;  1G8J B;  1O7M A;  4QDF B;  4NBH D;  3EN1 A;  2HMN A;  1SQP E;  4HM8 A;  4HM5 A;  4QUQ A;  3GCE A;  2QJK C;  1ZRT E;  1O7W A;  2FYN C;  2QPZ A;  1NU1 E;  1NTM E;  1O7G A;  1Q90 C;  3L73 E;  2I7F A;  4HM0 A;  1NTZ E;  3H1I E;  1PPJ E;  4HM2 A;  2BCC E;  2JO6 A;  1UUV A;  2Q3W A;  3GOB A;  3GZX A;  3EQQ A;  4NBE D;  2NVE A;  1KB9 E;  3GL0 A;  3VMI D;  1KYO E;  1NYK A;  4U3F E;  2QJY C;  3D89 A;  2A06 E;  3GTS A;  4OGQ D;  4P1B H;  3VCP A;  5KLI C;  3GL2 A;  3C0D A;  2BMR A;  3BCC E;  1RFS A;  1EZV E;  4HM1 A;  4QUP A;  3VMH D;  1JM1 A;  4QDF A;  4H13 D;  3GTE A;  1EG9 A;  3FOU A;  2BMQ A;  2E76 D;  4PD4 E;  5CXM A;  1O7N A;  3GZY A;  3H1K E;  1O7P A;  4NBF D;  3L74 E;  5KLV E;  1SQQ E;  1WQL A;  2D2C D;  1L0L E;  1SQB E;  2GBW A;  2NVF A;  4QDC A;  2B24 A;  2DE7 D;  3CWB E;  3H1J E;  4H0L D;  4NBD D;  4QCK A;  1G8K B;  2NVG A;  2FYU E;  3L71 E;  2ZYL A;  2HMJ A;  1FQT A;  1RIE A;  2GBX A;  3VMG D;  2YFL A;  1ULJ A;  2HMO A;  3CX5 E;  2DE5 D;  5AEW A;  3TGU E;  2XSH A;  3L75 E;  4PV1 D;  3H1H E;  5HL4 A;  1PP9 E;  4AIV A;  2YIU C;  3GB4 A;  1VM9 A;  4HM6 A;  1SJG A;  4QUR A;  3L70 E;  2NUM A;  4NBB D;  2E74 D;  1SQX E;  2E75 D;  3L72 E;  4NBC D;  1P84 E;  3N0Q A;  5AEU A;  2BMO A;  2NUK A;  2YVJ B;  5KKZ C;  2B1X A;  1SQV E;  2ZT9 D;  4NB9 D;  1BE3 E; 
#chains in the Genus database with same CATH topology
 3MTU E;  2O01 N;  3PP5 A;  2FXP A;  2IYP A;  1X79 B;  5BOK A;  2Y0E A;  2YXR B;  1SQB J;  4IFD K;  4D6T E;  1VQ9 P;  3HTK A;  4YXW H;  2O1K A;  3PJS K;  4HH2 A;  4DCK A;  3AE4 C;  5APW A;  1YTZ T;  3PH0 A;  1Q81 Q;  4NPD A;  1CZQ A;  2D2C C;  2K88 A;  3GF7 A;  1G2C A;  4B86 A;  2KS1 A;  3HD7 D;  2Q3W A;  3GOB A;  3LID A;  3GZX A;  3MP7 B;  4NBE D;  3P8C D;  1FDM A;  1PPJ D;  2FYU G;  4OH8 B;  3GW6 A;  1L4A C;  3E1R A;  1JY2 N;  2LXC B;  2AXT H;  2NPS A;  4QUP A;  3VMH D;  4YTP C;  1JM1 A;  4Y99 B;  1PZQ A;  1RF1 A;  1BSH A;  3M0A A;  4R4L A;  3L72 G;  1O7P A;  1NAY A;  4JPZ B;  2NVF A;  2B24 A;  5B66 E;  5KJ7 C;  1S9K D;  2E5Y A;  3CX5 H;  1KQS O;  3M0D C;  1PGJ A;  2YO2 A;  3CWB J;  2R5B A;  4N6J A;  1NYH A;  1VM9 A;  3CX5 D;  2IPP A;  4OGQ B;  5CCH A;  1PGP A;  3LW5 J;  3O6Q B;  3CC7 P;  2IBZ D;  2LR2 A;  1SQB G;  2ZT9 D;  1CI6 B;  1BGY D;  1RQU A;  2O01 J;  3IN6 A;  4ZKU A;  2R5D A;  2HMM A;  5AVU B;  3M9H A;  2BEQ D;  2DE6 D;  3CCU P;  5AVZ B;  3QH9 A;  1Q82 Q;  1FE6 A;  2NWF A;  3TDK A;  1U7M A;  1NTK D;  2VRS A;  1NKN A;  3S4R A;  3C9I A;  3RK2 C;  1IJD B;  1BCC E;  2E76 B;  4PJ0 E;  5AW4 B;  2Q5U A;  3RL0 C;  3DQY A;  2SPZ A;  4WY4 C;  2ZYD A;  4HM8 A;  4OVN F;  1NU1 E;  1S1C X;  2YNY A;  3Q3D A;  1SQQ G;  3C1L A;  2M3E A;  3CWB G;  3FWL A;  3TGU J;  3GL0 A;  3A2A A;  2IZ0 A;  4OGQ D;  4ZMD A;  4JF7 A;  4ZKP A;  1NTM D;  2ZYG A;  1P84 H;  2WSF H;  4C7R A;  1FJK A;  2WVR A;  4K35 A;  3D71 A;  3L72 J;  1KD1 Q;  3L71 D;  2H88 C;  5GTH H;  2D2C B;  2ZVO B;  1WQL A;  2RH0 A;  2PFX A;  1YYC A;  4H44 B;  3S9O A;  3H1L G;  4C46 A;  1HUC A;  1AA0 A;  5AEW A;  3TGU E;  3HE5 B;  1CI6 A;  5AW5 B;  1NTZ K;  4M3L A;  4YPC A;  1LTJ C;  1GDT A;  2O1J A;  2QM7 A;  3CC4 P;  2KUB A;  2A45 G;  2Q1K A;  1OVV A;  2C9L Y;  3KZI H;  1OWA A;  1OX3 A;  5CMZ A;  4BXL A;  4AQR D;  1X9V A;  3B5N B;  4PV1 B;  2HML A;  2YO3 A;  1R8E A;  1KMI Z;  1L0N E;  1KQL A;  3AEC C;  4D6T J;  2KNC A;  1ZR4 A;  4U3F G;  1GL2 B;  2W8Z A;  1L4A B;  1Q90 C;  1JY2 O;  3T97 A;  1NTZ E;  3TYY A;  1KQG B;  2BCC D;  1SQX K;  1EZV D;  1G1I A;  2QJY C;  2ZXX A;  2W27 A;  4EIJ A;  2K9J B;  1LWU A;  2BAS A;  5CBN A;  2BMR A;  1ZW0 A;  1RFS A;  3HD7 B;  4LGD E;  1HJB A;  1PP9 G;  1KIL B;  3T97 B;  1EG9 A;  1HGV A;  2KOG A;  2M0B A;  3L73 G;  2C9N Y;  2WSE J;  4HB1 A;  1W2B O;  4WB4 A;  3CPW O;  1EDI A;  1FAV A;  1N7S D;  1EDJ A;  3MUD A;  2YFL A;  2XV5 A;  3G3Z A;  1VDF A;  1GU4 A;  3V4Q A;  1H89 A;  4ASW A;  1LTB C;  4L76 A;  2E43 A;  4DOJ A;  2FFD B;  1LTG C;  2NUM A;  2A45 I;  1M90 Q;  1PP9 D;  4NBC D;  1RE4 A;  1FU1 A;  2NRG A;  4RO0 A;  2IBZ G;  2KYV A;  2AEJ A;  3LW5 H;  1ZLL A;  4AAY B;  2WTY A;  1T2K C;  2WPR A;  4GIF A;  3HD7 A;  3RK3 D;  1SQQ K;  1PL5 A;  2WIT A;  3AED C;  1L2P A;  1GL2 D;  4JBZ A;  1SQX G;  2BCC G;  2E4P A;  5AVQ B;  3AE6 C;  1JMB A;  3OA7 A;  2KNC B;  1NGM B;  1GW3 A;  3CLQ A;  1VPC A;  1FZE A;  1JY2 P;  1ZN5 A;  1H0T B;  1HF9 A;  4QUQ A;  1ZRT E;  2QPZ A;  2E74 B;  1R5S A;  2I7F A;  1KZU B;  2WSC H;  1N7L A;  4W7Y A;  3CD6 P;  3N7N A;  2RN0 A;  3H1K D;  4OGQ C;  2XZR A;  1L4A A;  1LGH B;  1SQP K;  4QDF A;  2H89 C;  1W5C E;  4PD4 E;  1P84 I;  1JOC A;  5B5E E;  5KLV D;  2OTK E;  1BDC A;  2H43 A;  2P1J A;  2WSE H;  1OW8 A;  4ASV A;  1DD3 A;  1NU1 K;  4JYB A;  3I55 P;  2PGD A;  3L75 E;  2V7Q H;  2POH A;  1YBK A;  4NBB D;  1S4X A;  2M3B A;  2O01 H;  5AW1 B;  2M5A A;  1SQV E;  3H1J G;  2WQY C;  5APS A;  3GMA A;  2Y0C A;  4W7Z A;  1U7J A;  2J58 A;  1XTC C;  5AW6 B;  3A0B E;  2JKV A;  1G1J A;  3VMZ A;  3L70 J;  1N8R Q;  2OYH C;  1NTK E;  3AE5 C;  2NPS D;  1BE3 G;  4L75 A;  3KXD A;  1S5L H;  2P2U A;  5BVZ A;  4H44 D;  5KJ7 D;  1SFC D;  1KIL D;  2HG5 D;  4UB6 H;  5KLV J;  1FZF A;  2R3S A;  1RY3 A;  2B87 A;  2N1T C;  3N4X A;  4OWF A;  1URQ D;  3H1I E;  5KLV K;  3AEF C;  1JY3 O;  3D89 A;  1LJ2 A;  1IC2 A;  4HM1 A;  1NOH A;  3P7K A;  2Z5I A;  1IFN A;  3KQG A;  1PPJ G;  2FYU D;  3A0H E;  3V2N A;  3G9R A;  2GBW A;  1MUU A;  4IFF A;  4GKG A;  2B89 A;  2FYU J;  1NHL A;  1VQ4 P;  1QLE D;  3GHG B;  3KDP B;  5KAI H;  2E75 D;  3L72 E;  2OYH A;  5APV A;  3RK3 C;  3H25 A;  5C39 A;  2B1X A;  1T2K D;  3LIE A;  2QJK B;  1BCC G;  3O8Z A;  1KN7 A;  1IFJ A;  2DW3 A;  2IX7 C;  3CXH E;  2YMK A;  5B66 H;  4I1L A;  1KQF B;  4A7P A;  4HM7 A;  1KC8 Q;  3KZI E;  2XSO A;  2I1K A;  1K04 A;  5DJT B;  1DH3 A;  1URQ C;  1FJP A;  2YKO A;  4DZO A;  1QEX A;  2HPC A;  3SFE C;  3L73 E;  1YQ4 C;  2QA4 P;  1JM0 A;  2NPS C;  2QE7 H;  3GG2 A;  1AQT A;  2KLU A;  3P8C E;  3KPE A;  2KP8 A;  1KYO E;  1IFI A;  1X0T A;  1J1E B;  1GW4 A;  1VQ6 P;  1DD4 A;  3WUT A;  3CXH I;  3V5B A;  1LNQ A;  5CBO A;  3BRT B;  1KB9 I;  1Z56 A;  2L91 A;  3VYI A;  4RJT A;  3L71 E;  5CCH C;  2JR8 A;  2QIW A;  2XNX A;  1FQT A;  3SFD C;  3CCM P;  4D6T D;  3KYQ A;  3M0D A;  5HL4 A;  1VQP P;  4PJ0 H;  4EDF A;  1NWQ A;  2XKM A;  1L0N G;  2OYH B;  3H1L D;  1OXZ A;  3PHL A;  3JCU H;  4I2L C;  1VQO P;  3CL3 D;  2E75 B;  3A5T A;  2YFJ A;  1OW6 A;  1EC5 A;  3U1A A;  5GTH E;  2C0X A;  3JSV C;  2N1T B;  2WSC J;  1NTM G;  3AE7 C;  2YKQ A;  1PFI A;  2A45 H;  4WBA A;  1IFD A;  1EDL A;  2CKF A;  1QGK B;  3JC2 2;  1L0N D;  1VF5 D;  2G3A A;  5KLI B;  1AQ5 A;  3ITK A;  3V2Q A;  1G8J B;  5TIS H;  1JY3 N;  1Q7Y Q;  1PV3 A;  1E79 H;  1AVY A;  1RH5 B;  1SQV K;  1VF5 C;  3FWN A;  5H2F E;  3HE4 B;  1K9M Q;  3A0H H;  1UUV A;  2KZI A;  3WU2 H;  3PRJ A;  3E1I A;  3GTS A;  2IFN A;  3VCP A;  3CX5 I;  1GK6 A;  5M1B A;  1EZV E;  1PP9 J;  2QSI A;  2J5U A;  3FOU A;  3AE1 C;  1SQQ E;  2LKM A;  4QDC A;  1S3J A;  3H1J E;  3H32 B;  1FZA A;  1FZB A;  2HFE D;  2FKW B;  2HMO A;  1BDD A;  3SWF A;  2FY8 A;  5CCH D;  1LWU B;  2YVJ B;  3G71 P;  2I8D A;  3H1H D;  1BSN A;  4IL6 E;  3RK3 E;  1N2D C;  2K3R A;  1JEK A;  1VQ7 P;  1X8Y A;  1T6A A;  1SQP D;  2BCC J;  2YMY A;  2PAJ A;  1N86 A;  3WU2 E;  1AFO A;  1AV1 A;  1ZOY C;  3CCR P;  2FYU K;  2AXT E;  3OW2 O;  2HYN A;  2IBZ E;  3Q5P A;  3Q5R A;  1NAF A;  3S1K A;  2N1T D;  3BCC D;  3HE4 A;  4H13 B;  4NBH D;  1RF1 C;  4WY4 D;  1SFC C;  4QMA A;  5AW8 B;  2Q7C A;  3RK2 D;  1Y9B A;  2BCC E;  1PIX A;  2KLV A;  3CMA P;  4GOF A;  2V7Q J;  4GOD A;  2A06 E;  5CJ0 A;  3Q5S A;  1DEE G;  1ZXG A;  2GM4 A;  3NFQ A;  2YIU B;  1QVG O;  2P7J A;  1LTJ B;  3L70 D;  3CCE P;  2OYO A;  1LP1 A;  5AVT B;  4HJG H;  1YJW P;  2D2C D;  1EXI A;  1FDI A;  3EQ2 A;  3TF5 A;  5CHX A;  1K8A Q;  2OAR A;  3NXS A;  1HGZ A;  1ULJ A;  2FBW C;  1HTL C;  3L71 J;  2IZ1 A;  2JP3 A;  4AIV A;  1RHZ B;  4JYC A;  2KZJ A;  3RK2 B;  3EFF K;  1OW7 A;  2E74 D;  3AEB C;  3B4S A;  4WY4 B;  4EOT A;  2KB7 P;  3OAK A;  2FXO A;  3R2P A;  1VQL P;  3MGN A;  5B5E H;  2R44 A;  2AEF A;  2WWW A;  1ZME C;  2YFI A;  2P58 A;  4NBG D;  1T3J A;  1UIX A;  1JY3 P;  1NTZ J;  1NTZ D;  2B88 A;  1BGY E;  3GKE A;  3BAT A;  1VCK A;  5AVX B;  1FZC A;  3A3Y B;  4DJG A;  3I5C A;  1KIL A;  4IFM A;  3BAS A;  1NTK K;  2QRX A;  3RL0 g;  3IAO A;  3CCQ P;  2Z4E A;  1YJN P;  4H44 C;  3IR9 A;  1YIT P;  4O9B A;  3V6I A;  4HM0 A;  2H7H A;  2HOD A;  2K1A A;  3WUV A;  2Z5H A;  1L0L G;  4YXD C;  3VMI D;  1NYK A;  2Q6Q A;  2YXQ B;  1GL2 C;  5AW9 B;  5KLI C;  3KHU A;  2JWA A;  2QEX P;  1IO4 A;  2W90 A;  3RBX A;  4XA4 A;  2QVA A;  4PD4 D;  2J59 M;  2W6J H;  1VF5 B;  3H1I J;  1OFC X;  3D6Z A;  5KKZ B;  3B5N C;  1KV4 A;  4BRY A;  1G8K B;  1T3U A;  4JQ0 D;  3VMG D;  3CX5 E;  1SQQ J;  4TLF A;  2DE5 D;  3HTK B;  3VOP A;  2XDJ A;  1N7S C;  3L74 G;  1H0T A;  2V4H A;  2AXC A;  1IZN B;  5CJ4 A;  1M56 D;  2IYO A;  5K5G B;  3WMM 0;  2W83 C;  1HBW A;  1SFC B;  2W6B A;  2WMM A;  3CXH D;  2KIK A;  2QM8 A;  1UII A;  3HD7 C;  2XR8 A;  5APQ A;  1GMJ A;  2QJP B;  1D7M A;  4D6T G;  2ITA A;  3V2R A;  1N73 A;  1JTH A;  1BGY G;  3D6Y A;  2P67 A;  4GT1 A;  3V4W A;  1KB9 D;  4HKZ H;  1SQB K;  2JJL A;  2N9B A;  4P1B H;  1ZP0 C;  5AVV B;  1FZC C;  3BCC E;  1TU3 F;  3TGU G;  1QL2 A;  1OIP A;  1SVF A;  3AE3 C;  1RF1 B;  1SQV J;  1OVU A;  1ZRT D;  3OJA B;  2NZ2 A;  4H0L B;  4RKU J;  4LLH A;  1L0L E;  1KB9 H;  4EYY Q;  1S9K E;  3U59 A;  3L37 A;  1LTI C;  2O3J A;  2ZXE B;  2YIU C;  1BE3 J;  2Y0D A;  4Z1M H;  1N73 B;  3L70 E;  2K9Y A;  4AYC A;  1RF0 C;  2WPV B;  1X22 A;  1CW5 A;  5KAF E;  3FGA D;  1USE A;  5AEU A;  2ZJS E;  3H1L E;  3ZDM A;  3ABV C;  1AJY A;  3AZC A;  1EZV I;  1L0N J;  2ZVN B;  2HMK A;  1J1D B;  4W80 A;  3H6P A;  4NBA D;  3HUS C;  1HVV A;  1NTZ G;  1A02 J;  1S2E A;  4HM3 A;  2WT7 A;  1NDO A;  2AEM A;  1YI2 P;  4P1C H;  4PD4 H;  3RK3 B;  1GD2 E;  1FOS F;  1JCC A;  3AEG C;  2MKV A;  3H1L J;  3GCE A;  2QJK C;  4UB8 H;  3A0B H;  1MZ9 A;  3H1K G;  2KI7 B;  1RE3 C;  3CCL P;  2MJZ A;  2L5G B;  3IF4 A;  1LTT C;  3C8V A;  3GL2 A;  3EWK A;  2OYI C;  3AE9 C;  3M9Q A;  2BEZ F;  3GTE A;  1RQV A;  1Q86 Q;  4L74 A;  3H1K E;  1VQM P;  1EDK A;  3CCV P;  1L0L D;  1M1K Q;  1VL2 A;  1A02 F;  2NVG A;  2HMJ A;  2HOD B;  2K37 A;  2E5T A;  1OZH A;  1PP9 E;  1S5L E;  1S5L X;  3AE8 C;  2FYZ A;  1Q90 D;  2ZAE B;  4XFJ A;  4L73 A;  1E5W A;  3M91 A;  2GA1 A;  3MHV A;  1JNM A;  1GZL A;  2E76 C;  3RL0 B;  3VCA A;  2QJP C;  1FOS E;  3CI9 A;  1JCD A;  4UB6 E;  4EMJ B;  3B71 A;  1KYO H;  2FYN B;  1OMI A;  5AVW B;  1BE3 D;  1M1J C;  1H8A A;  3NTN A;  5CCG D;  2CPS A;  2M5A B;  1J1E C;  3F5H A;  4HKV A;  4WWI A;  1Q2N A;  4LC1 A;  3EN1 A;  5DJU B;  2E75 C;  3CME P;  5E79 E;  1J1D C;  1U57 A;  2KXP B;  3Q2Y A;  4U3F E;  2Q9I A;  3UIA A;  1BCC D;  3H1J D;  4KT0 J;  3VP8 A;  3M9B A;  3VTP C;  3L74 D;  1DIP A;  4K3A A;  3FXD A;  5CXM A;  5APX A;  3A7O A;  1SQV G;  3BVH A;  2DE7 D;  3Q1M A;  4H0L D;  4QCK A;  4U7J A;  1MV8 A;  5E79 H;  2PRR A;  1R5L A;  5AVY B;  1W2E A;  4PV1 C;  1KFM A;  1L0L J;  1FZC B;  1QVF O;  1MFT A;  1EQ7 A;  3B8E B;  1SJG A;  3HUS B;  1MFZ A;  1T8Z A;  3L75 J;  4GOE A;  1BE3 E;  1KIL C;  2N1T A;  2I1J A;  1PGQ A;  3L36 A;  3RL0 D;  5APY A;  1YTZ I;  3PTZ A;  1NJI Q;  1UUW A;  4HJL A;  3QWO C;  1SQP G;  2OYI A;  1NTK J;  2XRX A;  1P84 D;  1O7H A;  1HWT C;  3SWK A;  4N78 E;  2JZA A;  4NB8 D;  3E7K A;  2N9Y B;  5BU5 A;  1RE3 A;  2FXM A;  2LXB A;  1NKZ B;  1WMK A;  4NPE A;  5KTB A;  1G2C B;  3GLM A;  5AW3 B;  4H0L C;  2OYI B;  3BCC G;  4QDF B;  3H1I D;  1LT9 C;  2RMZ A;  2HPC B;  3VMY A;  2YKP A;  2R3C A;  4ZNC A;  1O7G A;  1LTA C;  3HUS A;  1NU1 D;  3SWY A;  3L74 J;  4GDO A;  1GTW A;  1PPJ E;  1KFN A;  5H2F H;  5AW0 B;  2B9B A;  2JO6 A;  2ZYA A;  2XU6 A;  2OGU A;  3CWB D;  3H1J J;  3TSI A;  1KB9 E;  3P32 A;  3VMA A;  3H32 A;  3MUD C;  1M8O B;  2OQQ A;  2KK7 A;  4H13 D;  2WT7 B;  2FFD C;  1JUN A;  1RF0 A;  3EFG A;  1LWU C;  3H1I G;  1XTG B;  4NBD D;  1SFC A;  4KHX A;  4EI2 A;  2FYU E;  5AW7 B;  2ZYL A;  3BRV B;  2QJY B;  3TNU B;  3H1K J;  2PP6 A;  1SQX J;  2C0W A;  1PGO A;  2XSH A;  5L8R J;  5CCG C;  1K73 Q;  1YJ9 P;  2WPS A;  1P84 E;  2BMO A;  2NUK A;  3MIW A;  4I7Z C;  1EXJ A;  4N78 D;  3AEE C;  4N3Y B;  4UB8 E;  1WRG A;  2ZT9 B;  1H88 A;  4H13 C;  1ULI A;  1HH0 A;  2CK3 H;  4C7N B;  1NU1 J;  1KIL E;  2E74 C;  1NU1 G;  1M7L A;  1NVO A;  4IOI H;  4PD4 I;  3IFM A;  2IFM A;  2IBZ I;  5APT A;  1KTM A;  1LT1 A;  1HJ0 A;  3K5B A;  4RES B;  1GU5 A;  1O7M A;  3GF3 A;  3SSU A;  1M1J A;  3MD0 A;  1KOR A;  1SQP E;  2W6A A;  4HM5 A;  2HR3 A;  3W68 A;  1DX7 A;  2FYN C;  1LTJ A;  4HM2 A;  4WY4 A;  3VMX A;  4R4M A;  3L71 G;  1LT9 A;  1Y47 A;  1FZG A;  3AE2 C;  5GTI E;  3L35 A;  5EFW B;  3TK1 A;  1IK7 A;  1VQK P;  3G6E P;  3L75 D;  2XND H;  3GHG A;  2OTL P;  1NO4 A;  4C7N A;  1SS1 A;  1AVO A;  1O7N A;  3NMD A;  3PLN A;  2Y9Z A;  3GZY A;  1GK4 A;  1WT6 A;  1LT9 B;  1SQQ D;  3CXH H;  3HE5 A;  1N7S A;  2FFD A;  3F89 A;  3CCS P;  3AEA C;  1M1J B;  1BGY J;  2KSJ A;  4WVZ A;  1JO5 A;  4PV1 D;  1JB0 J;  4BRY B;  1DEB A;  3GB4 A;  4HM6 A;  4QUR A;  2Q3E A;  2Q3I A;  1IFM A;  1QX8 A;  3P8M C;  1FC2 C;  4TT3 H;  3N0Q A;  3VN0 A;  3B5N A;  4HYT B;  2GUV A;  1BCC J;  1S72 P;  5BU8 B;  2JEE A;  3FXE A;  3M06 A;  5KJ7 A;  4QDD A;  5TIS E;  3TNU A;  2P10 A;  1YIJ P;  4XE5 B;  2K9J A;  3I56 P;  3L70 G;  1GL2 A;  5GTI H;  1SLQ A;  1ZV8 A;  3D70 A;  1Y8A A;  1JMM A;  2M8R A;  1L0N K;  4Y28 J;  1VQ8 P;  1ZR2 A;  3VP9 A;  2E4Q A;  3W67 A;  2HMN A;  3R4Y A;  5AW2 B;  1NTM E;  1URQ A;  1J2J B;  1YHQ P;  3EQQ A;  2B87 B;  2NVE A;  2JWD A;  3WUU A;  4U3F D;  2A06 D;  5KAI E;  3C0D A;  2Y9Y A;  3U1C A;  3H1H G;  3GHG C;  5CCG A;  1URQ B;  5AVR B;  1N7S B;  2E76 D;  1NTM K;  3L72 D;  3CC2 P;  2WSF J;  1VQN P;  5KLV E;  1RE4 C;  4I7Z B;  3CWB E;  1IK9 A;  1SQB D;  1NTM J;  3V2P A;  2JO1 A;  3RGU A;  1RIE A;  4U3F J;  4CPG A;  3TGU D;  3L4F A;  1FBM A;  2HLO A;  4Y99 C;  1LTS C;  5AVS B;  3HRN A;  3CCJ P;  1SQX E;  2G8Y A;  1LP1 B;  1NTK G;  3JCU E;  5KKZ C;  2E42 A;  3FX0 A;  4NB9 D;  1VQ5 P;  1SQX D;  4MN4 C;  1KYO I;  3USS A;  2OTJ P;  4HM4 A;  4AUW A;  1FS0 E;  3L73 D;  1CSB A;  1SP4 A;  2RKL A;  3RBZ A;  3BCC J;  1QL1 A;  2A06 G;  2WSS H;  1JTH B;  2ZFC A;  4KJM A;  2H8P D;  2ZT9 C;  1USD A;  1IFP A;  5KAF H;  3B5N D;  4IL6 X;  2IDB A;  2WZ7 A;  1O7W A;  2WPQ A;  1M57 D;  2KS1 B;  1SQP J;  2CPB A;  3H1H J;  5TJH A;  2UWJ E;  4NPF X;  2QG4 A;  4I6M C;  1NH4 A;  4DT0 A;  3L75 G;  1K05 A;  3G4S P;  1N73 C;  2BMQ A;  3L73 J;  1OVR A;  4NBF D;  3L74 E;  3MZW B;  2NPS B;  1SQB E;  1L4A D;  1FDO A;  1KYO D;  3II6 A;  4IL6 H;  2GBX A;  1EZV G;  2GUS A;  3H1H E;  2R32 A;  2KSE A;  1SQV D;  1MKM A;  5KLV G;  1L0L K;  4BWN A;  2JDI H;  5APU A;  3O6Q A;  1YQ3 C; 
#chains in the Genus database with same CATH homology
 3VCA A;  3H1L E;  3AZC A;  4QDD A;  2QJP C;  2YFJ A;  5BOK A;  4AAY B;  2HMK A;  1UUW A;  4HJL A;  4HM4 A;  1ULI A;  2HMM A;  4D6T E;  2YFI A;  4EMJ B;  2XRX A;  2HML A;  3CXH E;  4NBG D;  2DE6 D;  1O7H A;  4NBA D;  1BGY E;  1L0N E;  2JZA A;  3GKE A;  2NWF A;  2E4P A;  4NB8 D;  1VCK A;  4HM7 A;  1NTK E;  2XSO A;  2CKF A;  4HM3 A;  2IBZ E;  2XR8 A;  1NDO A;  1VF5 D;  4HKV A;  4P1C H;  1BCC E;  2E4Q A;  4H44 D;  3DQY A;  1G8J B;  1O7M A;  4QDF B;  4NBH D;  3EN1 A;  2HMN A;  1SQP E;  4HM8 A;  4HM5 A;  4QUQ A;  3GCE A;  2QJK C;  1ZRT E;  1O7W A;  2FYN C;  2QPZ A;  1NU1 E;  1NTM E;  1O7G A;  1Q90 C;  3L73 E;  2I7F A;  4HM0 A;  1NTZ E;  3H1I E;  1PPJ E;  4HM2 A;  2BCC E;  2JO6 A;  1UUV A;  2Q3W A;  3GOB A;  3GZX A;  3EQQ A;  4NBE D;  2NVE A;  1KB9 E;  3GL0 A;  3VMI D;  1KYO E;  1NYK A;  4U3F E;  2QJY C;  3D89 A;  2A06 E;  3GTS A;  4OGQ D;  4P1B H;  3VCP A;  5KLI C;  3GL2 A;  3C0D A;  2BMR A;  3BCC E;  1RFS A;  1EZV E;  4HM1 A;  4QUP A;  3VMH D;  1JM1 A;  4QDF A;  4H13 D;  3GTE A;  1EG9 A;  3FOU A;  2BMQ A;  2E76 D;  4PD4 E;  5CXM A;  1O7N A;  3GZY A;  3H1K E;  1O7P A;  4NBF D;  3L74 E;  5KLV E;  1SQQ E;  1WQL A;  2D2C D;  1L0L E;  1SQB E;  2GBW A;  2NVF A;  4QDC A;  2B24 A;  2DE7 D;  3CWB E;  3H1J E;  4H0L D;  4NBD D;  4QCK A;  1G8K B;  2NVG A;  2FYU E;  3L71 E;  2ZYL A;  2HMJ A;  1FQT A;  1RIE A;  2GBX A;  3VMG D;  2YFL A;  1ULJ A;  2HMO A;  3CX5 E;  2DE5 D;  5AEW A;  3TGU E;  2XSH A;  3L75 E;  4PV1 D;  3H1H E;  5HL4 A;  1PP9 E;  4AIV A;  2YIU C;  3GB4 A;  1VM9 A;  4HM6 A;  1SJG A;  4QUR A;  3L70 E;  2NUM A;  4NBB D;  2E74 D;  1SQX E;  2E75 D;  3L72 E;  4NBC D;  1P84 E;  3N0Q A;  5AEU A;  2BMO A;  2NUK A;  2YVJ B;  5KKZ C;  2B1X A;  1SQV E;  2ZT9 D;  4NB9 D;  1BE3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...