3L75E

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l75E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l75E02
1O7HA 3CWBE 2B24A 3L71E 3H1HE 3L73E 1NTZE 1ZRTE 1NYKA 2HMMA 2BCCE 2E4PA 5KKZC 2A06E 2E76D 4HM0A 3GOBA 4EMJB 2ZYLA 1BE3E 1G8JB 2NVFA 1FQTA 1L0NE 3L75E 4QDFB 2D2CD 4QUPA 4D6TE 4QCKA 1PP9E 1BGYE 1SQPE 3GTSA 3BCCE 1NTME 1PPJE 4NBGD 3EN1A 1NU1E 1VCKA 1WQLA 4NB9D 3TGUE 4HM2A 1JM1A 3GL2A 2QJPC 2NWFA 1UUVA 1NDOA 2NUMA 4HM8A 1SQQE 2YFLA 1EZVE 1BCCE 1P84E 2XSHA 2HMOA 3GCEA 1UUWA 4H44D 1SQBE 3L70E 1O7MA 2NVGA 2NUKA 5AEUA 4QDDA 2QJYC 3CX5E 4NBDD 4HM3A 3GL0A 3D89A 4NBFD 4P1BH 3H1JE 2Q3WA 1G8KB 1Q90C 2HMJA 1EG9A 2E74D 4HM6A 5KLIC 2DE5D 1KB9E 2BMQA 2FYNC 2YFIA 2DE6D 2GBWA 3AZCA 2QJKC 1VF5D 3VMID 3L72E 1O7WA 1ULJA 4P1CH 2XR8A 4QURA 4HM4A 1RFSA 4NBHD 4U3FE 2B1XA 2ZT9D 4HKVA 4AAYB 5HL4A 5KLVE 2I7FA 2YIUC 3VCPA 2BMOA 2GBXA 2QPZA 4H13D 5BOKA 4QUQA 4H0LD 1NTKE 2BMRA 1RIEA 4HM5A 4QDFA 4NBED 1SQVE 4HM7A 3VCAA 3FOUA 1L0LE 1O7NA 2IBZE 2NVEA 2XSOA 1ULIA 4NB8D 4NBCD 1KYOE 2CKFA 3EQQA 5CXMA 1O7PA 4QDCA 2YFJA 2YVJB 4HJLA 3H1LE 1SQXE 3H1KE 3GKEA 1O7GA 3C0DA 5AEWA 3GZYA 2E4QA 3VMGD 3GB4A 2HMLA 2FYUE 3GTEA 2HMKA 3N0QA 4NBBD 4OGQD 3CXHE 4AIVA 3H1IE 2JO6A 2DE7D 3DQYA 3GZXA 2E75D 4HM1A 4PV1D 4NBAD 3L74E 2JZAA 4PD4E 1VM9A 3VMHD 1SJGA 2HMNA 2XRXA
chains in the Genus database with same CATH superfamily
3B5NB 3L73E 1NTZE 3CPWO 2FKWB 4H0LC 2R5DA 3A0HH 1FZCA 1BSNA 4KJMA 1GD2E 2XDJA 4JYBA 1GU4A 3H1ID 1L0NJ 3L75J 5APUA 1S9KE 3V4QA 1JY3O 3T97A 1GL2D 1RY3A 3QWOC 1N7SA 1ZRTD 4H44D 4IOIH 1S3JA 5AEUA 5B5EH 3CX5E 1ZR4A 1H88A 2ZXXA 3M06A 1LP1A 3V2NA 1U7JA 5KJ7C 1ZN5A 5CJ0A 2BMQA 1LWUB 5AW7B 1YJWP 3B4SA 1YBKA 3B5NA 1SQQG 2ZT9D 3P8MC 4I1LA 1N73B 4HM5A 5EFWB 2KP8A 1HBWA 2QG4A 1JY3P 1GL2C 3A5TA 1A02J 4DCKA 1ULIA 3U1AA 5KAFE 2CKFA 4H44C 2P10A 1J1EC 1ZV8A 2KOGA 2N1TB 4GODA 5KLVG 2ZJSE 1R5SA 3GHGA 3SWYA 3PRJA 4DZOA 3HD7B 2ZT9C 3O6QB 3IAOA 1R5LA 3CWBE 1MKMA 3H1LG 5AW1B 2CPSA 2L5GB 1N73A 2P2UA 5CCGA 1N86A 1X9VA 1JY2O 3I5CA 3H32B 3S9OA 1RQVA 1BE3J 1BGYE 5KAIH 4UB8H 2M3BA 4LLHA 1KTMA 1PP9J 1NU1E 1WQLA 2P67A 4RESB 3WUVA 1SVFA 2MJZA 3CC4P 2Y0CA 2YFLA 3A0BE 1L0NK 5AVWB 1HGZA 3D6YA 3L73G 1NTZG 4NBDD 2Z5HA 1L0ND 3L75D 1PZQA 1NAFA 1LTBC 5M1BA 3PP5A 1NVOA 2Y9YA 3D71A 1EZVD 3O6QA 3OJAB 1D7MA 5AW8B 3USSA 2XR8A 4NBHD 1NKNA 2K3RA 2GM4A 1JY2P 3D6ZA 2J58A 3RL0D 2WPVB 1LTTC 1ZOYC 1RH5B 2FXPA 1PPJG 1FAVA 4I7ZC 1KB9I 3WU2H 4YXDC 1VQ4P 2Z4EA 4QMAA 1YIJP 2KUBA 2K88A 3KZIE 2IYPA 1VQ7P 4I2LC 2XV5A 1Y9BA 4PD4H 2I8DA 2B87B 3L71E 2ZYGA 1LTIC 3CLQA 2BEQD 1GDTA 5AVVB 3RL0C 2XKMA 1LTJB 3AE6C 2WPSA 1J2JB 3BCCE 2IBZG 3TGUE 1JM1A 1M57D 3GL2A 3EFFK 1M1JC 4RJTA 3V2QA 4ASVA 3N4XA 1LT9B 3GLMA 1RQUA 1RF1C 2PRRA 3CWBG 2NPSB 4BRYB 3SWFA 1BE3D 1N2DC 1PP9D 4HH2A 1PIXA 1BGYG 1KC8Q 1GK6A 1FOSE 1NU1G 1VL2A 3Q5SA 4U3FD 1YYCA 1URQA 1FS0E 4C7NA 2B1XA 4AAYB 5CCHC 3TF5A 2RMZA 1NTKD 1LTJA 3PTZA 2HR3A 1L0LE 4PJ0H 2QJPB 1K73Q 4DJGA 4LGDE 2FBWC 3H1KJ 4R4MA 2M5AB 4BRYA 5KKZB 4Y28J 3MD0A 1S5LX 2O3JA 3SSUA 4HM1A 4PV1D 1Q7YQ 1AQ5A 3RK2B 3KQGA 3CC7P 2QVAA 4WBAA 1FOSF 2P7JA 2E75B 2QIWA 1GW3A 3Q2YA 1LTSC 3FWNA 2NWFA 2IX7C 4AYCA 2M3EA 2OGUA 3CCMP 4PD4I 1GK4A 1KFNA 2FY8A 1NHLA 2V4HA 2ZVOB 3L71G 1SFCA 4HM3A 2AEFA 5B5EE 2Q3WA 2OTLP 1ZMEC 1KB9E 2W8ZA 3BCCG 4WB4A 3MIWA 1IK7A 4W7YA 2GBWA 2ZFCA 3TGUG 5KTBA 1E5WA 2C0XA 2A45H 3L72J 1RE4C 3LIEA 3FWLA 2KS1B 3WMM0 2E42A 1CSBA 2WZ7A 1EDIA 3CXHH 1NKZB 2HPCB 2Q3EA 2JO1A 4IL6H 2QM7A 1JTHA 2UWJE 4NB8D 4XE5B 3EQQA 5B66E 1W2EA 3BVHA 1S72P 2YNYA 1NTZJ 3GZYA 2HMLA 3L36A 3CX5I 3P7KA 1L0LG 4N3YB 5APSA 4I6MC 1J1DC 4HKZH 1K9MQ 1PL5A 3AEFC 3D70A 3H1KD 4WVZA 1KQGB 1LTGC 5CBOA 2KS1A 2O01H 2MKVA 4KHXA 1JMBA 5AVSB 4B86A 4EMJB 2B88A 1OMIA 1WMKA 1SQPE 1Y47A 3E1IA 1KILD 3KPEA 1L4AA 4NBGD 1GL2B 3V4WA 1IFNA 1OW8A 1NTMJ 1VDFA 3AECC 1OIPA 1JCDA 1BCCE 5AW3B 1J1EB 2KLVA 4JPZB 2A06D 2FFDB 5APTA 3CCRP 3D89A 3ABVC 2OYIC 1NYHA 2HLOA 2OTJP 3CMAP 3HUSB 2C9LY 1OW6A 3AEGC 1O7WA 1HTLC 3KDPB 3P32A 3FXDA 1NOHA 1KILC 3U1CA 4L75A 1MFZA 1SQVJ 1YQ3C 2IZ0A 1VQMP 3L72D 4GOFA 4HJLA 3VMXA 1TU3F 2WT7B 3CC2P 1XTGB 2FFDA 3VOPA 3RK3D 2A45I 2FYUE 3NMDA 4WY4A 5AVUB 4N6JA 1JM0A 2R5BA 2AXTH 3HUSA 1H0TB 2WPQA 4LC1A 1QVFO 4M3LA 3VMAA 2JZAA 1T3UA 4PD4E 3GF3A 2KNCA 1NTZD 5BVZA 3WUTA 3KHUA 1PFIA 2YXQB 2M0BA 2HMMA 2BCCE 2GUSA 3AE4C 3SWKA 3AEBC 3CCLP 4D6TJ 5E79E 1VQ8P 2WTYA 2ZVNB 4I7ZB 1EDJA 3M91A 3H25A 1OX3A 2P1JA 3AEAC 1VQ6P 1X22A 2WT7A 1ZR2A 3B71A 1PGPA 1NTMK 2IPPA 3HE4B 3GL0A 1M7LA 4C46A 5AVYB 2O01J 1RE3A 1OWAA 3H1JE 5AVQB 1HJBA 1NTMD 1PPJD 1H0TA 2Q3IA 1SP4A 2YFIA 2QJKC 1P84D 3ZDMA 3AE7C 1RFSA 3M9HA 2YIUC 1R8EA 1HWTC 2JEEA 2DW3A 1YTZT 3GG2A 3VTPC 5C39A 3VCAA 4JYCA 3GF7A 4PJ0E 3F89A 1T2KD 3PH0A 2YFJA 1SQXE 1SQVK 1MV8A 1UIIA 1RF1B 2KLUA 2E4QA 3GB4A 5TISH 1SQVD 3G71P 2HMKA 1OZHA 2GA1A 2IBZD 1AVOA 4EDFA 4EOTA 5APYA 5GTIH 1SS1A 3H1IE 3CCQP 1BDCA 3OAKA 3L74J 1BDDA 1N7LA 3E7KA 1M8OB 5CMZA 1S5LE 2B24A 1ZRTE 3H1HJ 1LGHB 4HM0A 3S4RA 1AFOA 1IC2A 1G8JB 2FYUG 3CXHD 1DEEG 3EN1A 1T2KC 1LWUA 1UUVA 3H6PA 5AVRB 3IFMA 5GTHH 2H43A 3L70E 2E76B 2PGDA 1EDKA 3R2PA 2BCCG 1W5CE 4NBFD 3FGAD 2D2CB 3AE5C 4D6TD 1X79B 2HMJA 4HM6A 1EC5A 4YPCA 1VF5D 1FBMA 1ZW0A 4P1CH 5CCHA 1N7SD 4U3FJ 2N1TA 1YHQP 4H13D 2QPZA 1U57A 1X8YA 1IZNB 3H1JG 1NTKJ 1HVVA 2PP6A 1OVRA 2O01N 2LKMA 3CCEP 2YMKA 3HD7A 2IFMA 2YVJB 1YITP 1EXIA 2O1KA 3B5ND 3TK1A 1FZCC 2I1JA 3H32A 1KZUB 1QX8A 1VF5C 5AW2B 4N78D 4NPFX 1IFIA 3JCUE 1K8AQ 3K5BA 1N7SC 2L91A 3M0DA 4H13C 1SQXG 1FDMA 1NYKA 2K1AA 1NO4A 1NH4A 3G6EP 4OGQB 3CMEP 3I55P 1L0NE 3L75E 5CBNA 1IFMA 1ZXGA 3L74D 1RF0A 3H1IG 2KZJA 4A7PA 2NUMA 1EZVE 3IR9A 3B5NC 2XSHA 3H1HD 3MUDA 3GCEA 4ZNCA 1PGQA 2B89A 5K5GB 1SQBJ 3PLNA 3L37A 2RN0A 5CCGD 5BU8B 1H8AA 1MZ9A 2E74D 1QVGO 2IDBA 4TLFA 1KYOH 1J1DB 3Q5RA 4GDOA 2W6AA 1DX7A 1GW4A 3VCPA 3L70G 2N1TD 5BOKA 3GHGC 1RIEA 1FJKA 3VP8A 1E79H 4GOEA 2NZ2A 2XSOA 1YI2P 4Z1MH 1Q86Q 2B87A 1RHZB 4QDCA 1NTKK 2A45G 2YKOA 3GKEA 2LXCB 2WQYC 4JQ0D 3EFGA 2WSFH 3HRNA 3GTEA 2P58A 4TT3H 2E74C 2OYIB 3O8ZA 5DJUB 1LT1A 2AXTE 3DQYA 4ZKPA 1PV3A 2HMNA 1LT9A 3GW6A 3CCVP 2NPSA 4CPGA 1KQSO 3P8CD 1BE3E 2WSSH 1KILB 2NVFA 1FQTA 2W83C 4QCKA 1PP9E 1Z56A 4JF7A 1VQNP 1P84H 3CI9A 2R44A 1SQQJ 3AE1C 2NUKA 2OYIA 1A02F 2H8PD 2Q7CA 4IFFA 3A0HE 1L0NG 3L75G 5KLIC 1CW5A 1Y8AA 3V2RA 1SQBK 2YXRB 2KK7A 1SQBD 2KSJA 1VQLP 2M5AA 2OYHC 2GBXA 5KLVJ 1VQKP 4IFMA 3A3YB 2QEXP 4PV1C 2K37A 2KIKA 2M8RA 5AW9B 1URQD 1KQFB 3H1LJ 1JB0J 4IL6X 2WSEJ 4H0LB 2E5YA 4K3AA 3N0QA 5TISE 3TYYA 5AVXB 2JO6A 2XNXA 3MHVA 4KT0J 2JWAA 1OXZA 2QJKB 3II6A 3A0BH 3V5BA 1XTCC 1LNQA 5L8RJ 3L73J 2E4PA 2NPSD 2AEMA 1L2PA 2ZYLA 1CI6B 2WSFJ 3JC22 1S4XA 2H88C 2XU6A 2NRGA 1URQC 4HM8A 5GTHE 4L74A 3Q5PA 2HMOA 3U59A 3NTNA 1O7MA 1MFTA 2NVGA 3AEDC 4QDDA 2QJYC 1LTJC 3AE8C 4OVNF 1G1IA 2HPCA 1SQQK 1PP9G 5KAIE 4UB8E 3W68A 1SQQD 3LIDA 1KQLA 4H44B 1IFPA 4BWNA 1P84I 1WRGA 3TNUB 1KD1Q 4QUQA 1KFMA 1SFCD 5KJ7A 4NBED 1CI6A 4OWFA 2WPRA 2NVEA 3C1LA 1Q81Q 1U7MA 4ASWA 4K35A 4AQRD 5KLVK 1H89A 3IN6A 2ZT9B 5APVA 1S2EA 3VMYA 1G2CB 5KLVD 3H1KE 2XNDH 3RK2D 1NAYA 4GIFA 1GL2A 1KILE 2E75D 1KYOD 1DD4A 3H1LD 3WU2E 2H89C 1O7HA 3CWBJ 3HE5B 1SFCC 5KKZC 2A06E 3AE2C 3G3ZA 1PGJA 1KORA 4ZKUA 1FE6A 1BGYJ 3CXHI 1Q2NA 4HM2A 1NTZK 1NU1J 1NDOA 2BEZF 2QA4P 3L73D 4HB1A 1X0TA 1LTAC 1FZCB 3Q3DA 5AW5B 1S9KD 2N9BA 2FYNC 1VF5B 3KXDA 1L4AD 3VMID 3L72E 1N7SB 2ZYDA 3M9BA 3HTKB 5AVZB 3RK3C 4HKVA 4H13B 3HE5A 2C0WA 3CX5D 3RK3E 1VQ9P 1LP1B 3G4SP 3M0AA 3BRTB 1UIXA 2K9JB 1SQPG 2WSCJ 1AVYA 1K05A 3A7OA 1O7PA 1LJ2A 3RBZA 5APXA 1BCCG 3AE3C 1EZVI 3GMAA 2WMMA 1HJ0A 3RL0B 2QE7H 4DT0A 1JEKA 1L4AC 2R32A 2JJLA 1M1JB 5AW4B 1K04A 3HTKA 2YKPA 3H1KG 3LW5H 3L71J 3HE4A 4RO0A 3GHGB 1AV1A 1KB9H 4WY4D 3S1KA 3NXSA 1NTME 1PPJE 1HF9A 2K9JA 3BCCJ 1FJPA 2ZYAA 5H2FH 1OVVA 3TGUJ 2HODB 2JKVA 3CWBD 1FDIA 1P84E 3L70D 3OA7A 1FU1A 1VQ5P 3E1RA 2YKQA 1NU1K 2E74B 2A06G 4Y99C 2R3CA 1BGYD 1G8KB 1NU1D 5B66H 3MZWB 1YJ9P 1YJNP 1M1JA 2W27A 1T3JA 2RH0A 3EQ2A 1DD3A 2Y9ZA 1RF1A 1FZGA 2FFDC 2BMOA 3VP9A 4WY4C 1S1CX 1SQVE 3FOUA 2YO2A 2QM8A 2IBZE 3HUSC 3N7NA 1L0LJ 3SFDC 2HODA 4ZMDA 1GZLA 1YTZI 3L72G 4EYYQ 3C0DA 4BXLA 2ITAA 3VMGD 5AEWA 2G8YA 3CXHE 5KLIB 1USDA 1BSHA 4OH8B 3AEEC 4IL6E 3QH9A 2V7QJ 2JDIH 1NGMB 1HUCA 2OYHB 4W80A 3GOBA 4XA4A 1AQTA 1RE3C 4L76A 4D6TE 2AEJA 2HFED 4GT1A 3GTSA 4PV1B 2VRSA 4RKUJ 4NB9D 1QL2A 4GKGA 3L71D 1UUWA 2IZ1A 4HYTB 1JO5A 2WWWA 3V6IA 3LW5J 1VPCA 3BCCD 1DIPA 2Q6QA 2DE5D 4IFDK 1IFDA 3TGUD 1NTMG 3AZCA 3I56P 1ULJA 2YMYA 4HM4A 4XFJA 2PAJA 5HL4A 4MN4C 2OYHA 3MGNA 2W6JH 4HM7A 2Q1KA 2IFNA 2RKLA 4N78E 1M90Q 3CD6P 1URQB 4C7NB 4UB6H 1RE4A 2WSEH 2J5UA 1L0LK 4YTPC 2QJYB 5CCHD 5AVTB 1QLED 2YO3A 1L0LD 2R3SA 5E79H 1SQVG 3TSIA 1PGOA 3GZXA 1LWUC 3VYIA 4NBAD 3L74E 3VMHD 1SJGA 2Q9IA 3HD7D 3BASA 3WUUA 2JR8A 2CPBA 3H1HE 3CCJP 1Q82Q 3A2AA 1N73C 2E76D 5CCGC 1FC2C 2D2CD 2KXPB 4WWIA 1SQPJ 2B9BA 4AUWA 2C9NY 1KMIZ 4NPEA 2XZRA 5AW0B 1JMMA 4EI2A 1T6AA 2N9YB 1BCCJ 2LR2A 1FZFA 2N1TC 3CX5H 1ZP0C 4JBZA 3RBXA 1ZLLA 1HGVA 1EQ7A 2E5TA 1DH3A 2K9YA 4D6TG 2JWDA 3CCUP 2QRXA 3PJSK 3G9RA 3HD7C 3RGUA 3F5HA 1AJYA 3C8VA 4QURA 4U3FE 3KYQA 2E76C 1SFCB 2W90A 2D2CC 1NTKE 1KB9D 1JY3N 3EWKA 5KAFH 2HYNA 1QL1A 3FXEA 1S5LH 5CXMA 1NJIQ 1FZEA 3M0DC 1EZVG 1O7GA 1GMJA 1KILA 2FYUJ 4NBBD 4OGQD 3P8CE 3FX0A 1KV4A 2FYNB 1N8RQ 1JTHB 1RF0C 1FDOA 5AW6B 1WT6A 1VM9A 1KYOI 4C7RA 3MUDC 3RK3B 2ZXEB 3TDKA 1OW7A 4O9BA 3UIAA 2BCCJ 1YQ4C 4DOJA 2KI7B 2Q5UA 3RL0g 2OARA 5GTIE 1EXJA 1EDLA 3L74G 5H2FE 1VQOP 5APQA 2FXOA 1VQPP 1SQBE 1SQPK 3H1HG 2YIUB 4OGQC 4P1BH 5BU5A 2KYVA 1SQPD 2HG5D 3H1JJ 1EG9A 3OW2O 1L4AB 1OVUA 2OYOA 1AA0A 1FZAA 1DEBA 1BCCD 2J59M 1KN7A 1JOCA 2BASA 2SPZA 3CCSP 4NPDA 2JP3A 2KZIA 1GU5A 2FYZA 2KSEA 1JY2N 3IF4A 3VMZA 5CJ4A 3AE9C 1QGKB 2BMRA 4EIJA 1BE3G 2WSCH 1OFCX 2OQQA 3JCUH 2W6BA 4NBCD 4W7ZA 5CHXA 1LT9C 2OTKE 2AXCA 4R4LA 1SQXJ 2NPSC 4U3FG 1CZQA 3KZIH 2WVRA 4Y99B 2GUVA 1GTWA 1NTKG 1QEXA 3C9IA 1Q90D 3H1IJ 2CK3H 2FYUK 3NFQA 1IJDB 2FYUD 2WITA 3BRVB 4WY4B 4QDFB 4QUPA 4PD4D 1VCKA 2QJPC 2IBZI 2KNCB 2KB7P 1SQQE 2FXMA 3MP7B 2G3AA 2BCCD 3L4FA 1USEA 3BATA 3Q1MA 3L70J 3TNUA 2POHA 3PHLA 2LXBA 3MTUE 4U7JA 1Q90C 1JUNA 3R4YA 1T8ZA 5DJTB 1JCCA 2DE6D 1SLQA 3CL3D 4YXWH 3ITKA 3RK2C 2IYOA 1G2CA 3L35A 5KLVE 2I7FA 2QSIA 1SQBG 2I1KA 2E43A 1M56D 3H1JD 3JSVC 4H0LD 5TJHA 4QDFA 2PFXA 1O7NA 1NWQA 2E75C 1M1KQ 1G1JA 2Y0DA 2ZAEB 3T97B 1KYOE 2Y0EA 4L73A 1IFJA 3H1LE 5APWA 4UB6E 3V2PA 1W2BO 2H7HA 1HH0A 1MUUA 1JNMA 2Z5IA 3VN0A 1IO4A 1IK9A 4AIVA 5KJ7D 2V7QH 3B8EB 2DE7D 1SQXK 2O1JA 3SFEC 4HJGH 3W67A 3M9QA 1SQXD 1FZBA 2XRXA
chains in the Genus database with same CATH topology
1O7HA 3CWBE 2B24A 3L71E 3H1HE 3L73E 1NTZE 1ZRTE 1NYKA 2HMMA 2BCCE 2E4PA 5KKZC 2A06E 2E76D 4HM0A 3GOBA 4EMJB 2ZYLA 1BE3E 1G8JB 2NVFA 1FQTA 1L0NE 3L75E 4QDFB 2D2CD 4QUPA 4D6TE 4QCKA 1PP9E 1BGYE 1SQPE 3GTSA 3BCCE 1NTME 1PPJE 4NBGD 3EN1A 1NU1E 1VCKA 1WQLA 4NB9D 3TGUE 4HM2A 1JM1A 3GL2A 2QJPC 2NWFA 1UUVA 1NDOA 2NUMA 4HM8A 1SQQE 2YFLA 1EZVE 1BCCE 1P84E 2XSHA 2HMOA 3GCEA 1UUWA 4H44D 1SQBE 3L70E 1O7MA 2NVGA 2NUKA 5AEUA 4QDDA 2QJYC 3CX5E 4NBDD 4HM3A 3GL0A 3D89A 4NBFD 4P1BH 3H1JE 2Q3WA 1G8KB 1Q90C 2HMJA 1EG9A 2E74D 4HM6A 5KLIC 2DE5D 1KB9E 2BMQA 2FYNC 2YFIA 2DE6D 2GBWA 3AZCA 2QJKC 1VF5D 3VMID 3L72E 1O7WA 1ULJA 4P1CH 2XR8A 4QURA 4HM4A 1RFSA 4NBHD 4U3FE 2B1XA 2ZT9D 4HKVA 4AAYB 5HL4A 5KLVE 2I7FA 2YIUC 3VCPA 2BMOA 2GBXA 2QPZA 4H13D 5BOKA 4QUQA 4H0LD 1NTKE 2BMRA 1RIEA 4HM5A 4QDFA 4NBED 1SQVE 4HM7A 3VCAA 3FOUA 1L0LE 1O7NA 2IBZE 2NVEA 2XSOA 1ULIA 4NB8D 4NBCD 1KYOE 2CKFA 3EQQA 5CXMA 1O7PA 4QDCA 2YFJA 2YVJB 4HJLA 3H1LE 1SQXE 3H1KE 3GKEA 1O7GA 3C0DA 5AEWA 3GZYA 2E4QA 3VMGD 3GB4A 2HMLA 2FYUE 3GTEA 2HMKA 3N0QA 4NBBD 4OGQD 3CXHE 4AIVA 3H1IE 2JO6A 2DE7D 3DQYA 3GZXA 2E75D 4HM1A 4PV1D 4NBAD 3L74E 2JZAA 4PD4E 1VM9A 3VMHD 1SJGA 2HMNA 2XRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H A;  3CWB E;  2B24 A;  3L71 E;  3H1H E;  3L73 E;  1NTZ E;  1ZRT E;  1NYK A;  2HMM A;  2BCC E;  2E4P A;  5KKZ C;  2A06 E;  2E76 D;  4HM0 A;  3GOB A;  4EMJ B;  2ZYL A;  1BE3 E;  1G8J B;  2NVF A;  1FQT A;  1L0N E;  3L75 E;  4QDF B;  2D2C D;  4QUP A;  4D6T E;  4QCK A;  1PP9 E;  1BGY E;  1SQP E;  3GTS A;  3BCC E;  1NTM E;  1PPJ E;  4NBG D;  3EN1 A;  1NU1 E;  1VCK A;  1WQL A;  4NB9 D;  3TGU E;  4HM2 A;  1JM1 A;  3GL2 A;  2QJP C;  2NWF A;  1UUV A;  1NDO A;  2NUM A;  4HM8 A;  1SQQ E;  2YFL A;  1EZV E;  1BCC E;  1P84 E;  2XSH A;  2HMO A;  3GCE A;  1UUW A;  4H44 D;  1SQB E;  3L70 E;  1O7M A;  2NVG A;  2NUK A;  5AEU A;  4QDD A;  2QJY C;  3CX5 E;  4NBD D;  4HM3 A;  3GL0 A;  3D89 A;  4NBF D;  4P1B H;  3H1J E;  2Q3W A;  1G8K B;  1Q90 C;  2HMJ A;  1EG9 A;  2E74 D;  4HM6 A;  5KLI C;  2DE5 D;  1KB9 E;  2BMQ A;  2FYN C;  2YFI A;  2DE6 D;  2GBW A;  3AZC A;  2QJK C;  1VF5 D;  3VMI D;  3L72 E;  1O7W A;  1ULJ A;  4P1C H;  2XR8 A;  4QUR A;  4HM4 A;  1RFS A;  4NBH D;  4U3F E;  2B1X A;  2ZT9 D;  4HKV A;  4AAY B;  5HL4 A;  5KLV E;  2I7F A;  2YIU C;  3VCP A;  2BMO A;  2GBX A;  2QPZ A;  4H13 D;  5BOK A;  4QUQ A;  4H0L D;  1NTK E;  2BMR A;  1RIE A;  4HM5 A;  4QDF A;  4NBE D;  1SQV E;  4HM7 A;  3VCA A;  3FOU A;  1L0L E;  1O7N A;  2IBZ E;  2NVE A;  2XSO A;  1ULI A;  4NB8 D;  4NBC D;  1KYO E;  2CKF A;  3EQQ A;  5CXM A;  1O7P A;  4QDC A;  2YFJ A;  2YVJ B;  4HJL A;  3H1L E;  1SQX E;  3H1K E;  3GKE A;  1O7G A;  3C0D A;  5AEW A;  3GZY A;  2E4Q A;  3VMG D;  3GB4 A;  2HML A;  2FYU E;  3GTE A;  2HMK A;  3N0Q A;  4NBB D;  4OGQ D;  3CXH E;  4AIV A;  3H1I E;  2JO6 A;  2DE7 D;  3DQY A;  3GZX A;  2E75 D;  4HM1 A;  4PV1 D;  4NBA D;  3L74 E;  2JZA A;  4PD4 E;  1VM9 A;  3VMH D;  1SJG A;  2HMN A;  2XRX A; 
#chains in the Genus database with same CATH topology
 3B5N B;  3L73 E;  1NTZ E;  3CPW O;  2FKW B;  4H0L C;  2R5D A;  3A0H H;  1FZC A;  1BSN A;  4KJM A;  1GD2 E;  2XDJ A;  4JYB A;  1GU4 A;  3H1I D;  1L0N J;  3L75 J;  5APU A;  1S9K E;  3V4Q A;  1JY3 O;  3T97 A;  1GL2 D;  1RY3 A;  3QWO C;  1N7S A;  1ZRT D;  4H44 D;  4IOI H;  1S3J A;  5AEU A;  5B5E H;  3CX5 E;  1ZR4 A;  1H88 A;  2ZXX A;  3M06 A;  1LP1 A;  3V2N A;  1U7J A;  5KJ7 C;  1ZN5 A;  5CJ0 A;  2BMQ A;  1LWU B;  5AW7 B;  1YJW P;  3B4S A;  1YBK A;  3B5N A;  1SQQ G;  2ZT9 D;  3P8M C;  4I1L A;  1N73 B;  4HM5 A;  5EFW B;  2KP8 A;  1HBW A;  2QG4 A;  1JY3 P;  1GL2 C;  3A5T A;  1A02 J;  4DCK A;  1ULI A;  3U1A A;  5KAF E;  2CKF A;  4H44 C;  2P10 A;  1J1E C;  1ZV8 A;  2KOG A;  2N1T B;  4GOD A;  5KLV G;  2ZJS E;  1R5S A;  3GHG A;  3SWY A;  3PRJ A;  4DZO A;  3HD7 B;  2ZT9 C;  3O6Q B;  3IAO A;  1R5L A;  3CWB E;  1MKM A;  3H1L G;  5AW1 B;  2CPS A;  2L5G B;  1N73 A;  2P2U A;  5CCG A;  1N86 A;  1X9V A;  1JY2 O;  3I5C A;  3H32 B;  3S9O A;  1RQV A;  1BE3 J;  1BGY E;  5KAI H;  4UB8 H;  2M3B A;  4LLH A;  1KTM A;  1PP9 J;  1NU1 E;  1WQL A;  2P67 A;  4RES B;  3WUV A;  1SVF A;  2MJZ A;  3CC4 P;  2Y0C A;  2YFL A;  3A0B E;  1L0N K;  5AVW B;  1HGZ A;  3D6Y A;  3L73 G;  1NTZ G;  4NBD D;  2Z5H A;  1L0N D;  3L75 D;  1PZQ A;  1NAF A;  1LTB C;  5M1B A;  3PP5 A;  1NVO A;  2Y9Y A;  3D71 A;  1EZV D;  3O6Q A;  3OJA B;  1D7M A;  5AW8 B;  3USS A;  2XR8 A;  4NBH D;  1NKN A;  2K3R A;  2GM4 A;  1JY2 P;  3D6Z A;  2J58 A;  3RL0 D;  2WPV B;  1LTT C;  1ZOY C;  1RH5 B;  2FXP A;  1PPJ G;  1FAV A;  4I7Z C;  1KB9 I;  3WU2 H;  4YXD C;  1VQ4 P;  2Z4E A;  4QMA A;  1YIJ P;  2KUB A;  2K88 A;  3KZI E;  2IYP A;  1VQ7 P;  4I2L C;  2XV5 A;  1Y9B A;  4PD4 H;  2I8D A;  2B87 B;  3L71 E;  2ZYG A;  1LTI C;  3CLQ A;  2BEQ D;  1GDT A;  5AVV B;  3RL0 C;  2XKM A;  1LTJ B;  3AE6 C;  2WPS A;  1J2J B;  3BCC E;  2IBZ G;  3TGU E;  1JM1 A;  1M57 D;  3GL2 A;  3EFF K;  1M1J C;  4RJT A;  3V2Q A;  4ASV A;  3N4X A;  1LT9 B;  3GLM A;  1RQU A;  1RF1 C;  2PRR A;  3CWB G;  2NPS B;  4BRY B;  3SWF A;  1BE3 D;  1N2D C;  1PP9 D;  4HH2 A;  1PIX A;  1BGY G;  1KC8 Q;  1GK6 A;  1FOS E;  1NU1 G;  1VL2 A;  3Q5S A;  4U3F D;  1YYC A;  1URQ A;  1FS0 E;  4C7N A;  2B1X A;  4AAY B;  5CCH C;  3TF5 A;  2RMZ A;  1NTK D;  1LTJ A;  3PTZ A;  2HR3 A;  1L0L E;  4PJ0 H;  2QJP B;  1K73 Q;  4DJG A;  4LGD E;  2FBW C;  3H1K J;  4R4M A;  2M5A B;  4BRY A;  5KKZ B;  4Y28 J;  3MD0 A;  1S5L X;  2O3J A;  3SSU A;  4HM1 A;  4PV1 D;  1Q7Y Q;  1AQ5 A;  3RK2 B;  3KQG A;  3CC7 P;  2QVA A;  4WBA A;  1FOS F;  2P7J A;  2E75 B;  2QIW A;  1GW3 A;  3Q2Y A;  1LTS C;  3FWN A;  2NWF A;  2IX7 C;  4AYC A;  2M3E A;  2OGU A;  3CCM P;  4PD4 I;  1GK4 A;  1KFN A;  2FY8 A;  1NHL A;  2V4H A;  2ZVO B;  3L71 G;  1SFC A;  4HM3 A;  2AEF A;  5B5E E;  2Q3W A;  2OTL P;  1ZME C;  1KB9 E;  2W8Z A;  3BCC G;  4WB4 A;  3MIW A;  1IK7 A;  4W7Y A;  2GBW A;  2ZFC A;  3TGU G;  5KTB A;  1E5W A;  2C0X A;  2A45 H;  3L72 J;  1RE4 C;  3LIE A;  3FWL A;  2KS1 B;  3WMM 0;  2E42 A;  1CSB A;  2WZ7 A;  1EDI A;  3CXH H;  1NKZ B;  2HPC B;  2Q3E A;  2JO1 A;  4IL6 H;  2QM7 A;  1JTH A;  2UWJ E;  4NB8 D;  4XE5 B;  3EQQ A;  5B66 E;  1W2E A;  3BVH A;  1S72 P;  2YNY A;  1NTZ J;  3GZY A;  2HML A;  3L36 A;  3CX5 I;  3P7K A;  1L0L G;  4N3Y B;  5APS A;  4I6M C;  1J1D C;  4HKZ H;  1K9M Q;  1PL5 A;  3AEF C;  3D70 A;  3H1K D;  4WVZ A;  1KQG B;  1LTG C;  5CBO A;  2KS1 A;  2O01 H;  2MKV A;  4KHX A;  1JMB A;  5AVS B;  4B86 A;  4EMJ B;  2B88 A;  1OMI A;  1WMK A;  1SQP E;  1Y47 A;  3E1I A;  1KIL D;  3KPE A;  1L4A A;  4NBG D;  1GL2 B;  3V4W A;  1IFN A;  1OW8 A;  1NTM J;  1VDF A;  3AEC C;  1OIP A;  1JCD A;  1BCC E;  5AW3 B;  1J1E B;  2KLV A;  4JPZ B;  2A06 D;  2FFD B;  5APT A;  3CCR P;  3D89 A;  3ABV C;  2OYI C;  1NYH A;  2HLO A;  2OTJ P;  3CMA P;  3HUS B;  2C9L Y;  1OW6 A;  3AEG C;  1O7W A;  1HTL C;  3KDP B;  3P32 A;  3FXD A;  1NOH A;  1KIL C;  3U1C A;  4L75 A;  1MFZ A;  1SQV J;  1YQ3 C;  2IZ0 A;  1VQM P;  3L72 D;  4GOF A;  4HJL A;  3VMX A;  1TU3 F;  2WT7 B;  3CC2 P;  1XTG B;  2FFD A;  3VOP A;  3RK3 D;  2A45 I;  2FYU E;  3NMD A;  4WY4 A;  5AVU B;  4N6J A;  1JM0 A;  2R5B A;  2AXT H;  3HUS A;  1H0T B;  2WPQ A;  4LC1 A;  1QVF O;  4M3L A;  3VMA A;  2JZA A;  1T3U A;  4PD4 E;  3GF3 A;  2KNC A;  1NTZ D;  5BVZ A;  3WUT A;  3KHU A;  1PFI A;  2YXQ B;  2M0B A;  2HMM A;  2BCC E;  2GUS A;  3AE4 C;  3SWK A;  3AEB C;  3CCL P;  4D6T J;  5E79 E;  1VQ8 P;  2WTY A;  2ZVN B;  4I7Z B;  1EDJ A;  3M91 A;  3H25 A;  1OX3 A;  2P1J A;  3AEA C;  1VQ6 P;  1X22 A;  2WT7 A;  1ZR2 A;  3B71 A;  1PGP A;  1NTM K;  2IPP A;  3HE4 B;  3GL0 A;  1M7L A;  4C46 A;  5AVY B;  2O01 J;  1RE3 A;  1OWA A;  3H1J E;  5AVQ B;  1HJB A;  1NTM D;  1PPJ D;  1H0T A;  2Q3I A;  1SP4 A;  2YFI A;  2QJK C;  1P84 D;  3ZDM A;  3AE7 C;  1RFS A;  3M9H A;  2YIU C;  1R8E A;  1HWT C;  2JEE A;  2DW3 A;  1YTZ T;  3GG2 A;  3VTP C;  5C39 A;  3VCA A;  4JYC A;  3GF7 A;  4PJ0 E;  3F89 A;  1T2K D;  3PH0 A;  2YFJ A;  1SQX E;  1SQV K;  1MV8 A;  1UII A;  1RF1 B;  2KLU A;  2E4Q A;  3GB4 A;  5TIS H;  1SQV D;  3G71 P;  2HMK A;  1OZH A;  2GA1 A;  2IBZ D;  1AVO A;  4EDF A;  4EOT A;  5APY A;  5GTI H;  1SS1 A;  3H1I E;  3CCQ P;  1BDC A;  3OAK A;  3L74 J;  1BDD A;  1N7L A;  3E7K A;  1M8O B;  5CMZ A;  1S5L E;  2B24 A;  1ZRT E;  3H1H J;  1LGH B;  4HM0 A;  3S4R A;  1AFO A;  1IC2 A;  1G8J B;  2FYU G;  3CXH D;  1DEE G;  3EN1 A;  1T2K C;  1LWU A;  1UUV A;  3H6P A;  5AVR B;  3IFM A;  5GTH H;  2H43 A;  3L70 E;  2E76 B;  2PGD A;  1EDK A;  3R2P A;  2BCC G;  1W5C E;  4NBF D;  3FGA D;  2D2C B;  3AE5 C;  4D6T D;  1X79 B;  2HMJ A;  4HM6 A;  1EC5 A;  4YPC A;  1VF5 D;  1FBM A;  1ZW0 A;  4P1C H;  5CCH A;  1N7S D;  4U3F J;  2N1T A;  1YHQ P;  4H13 D;  2QPZ A;  1U57 A;  1X8Y A;  1IZN B;  3H1J G;  1NTK J;  1HVV A;  2PP6 A;  1OVR A;  2O01 N;  2LKM A;  3CCE P;  2YMK A;  3HD7 A;  2IFM A;  2YVJ B;  1YIT P;  1EXI A;  2O1K A;  3B5N D;  3TK1 A;  1FZC C;  2I1J A;  3H32 A;  1KZU B;  1QX8 A;  1VF5 C;  5AW2 B;  4N78 D;  4NPF X;  1IFI A;  3JCU E;  1K8A Q;  3K5B A;  1N7S C;  2L91 A;  3M0D A;  4H13 C;  1SQX G;  1FDM A;  1NYK A;  2K1A A;  1NO4 A;  1NH4 A;  3G6E P;  4OGQ B;  3CME P;  3I55 P;  1L0N E;  3L75 E;  5CBN A;  1IFM A;  1ZXG A;  3L74 D;  1RF0 A;  3H1I G;  2KZJ A;  4A7P A;  2NUM A;  1EZV E;  3IR9 A;  3B5N C;  2XSH A;  3H1H D;  3MUD A;  3GCE A;  4ZNC A;  1PGQ A;  2B89 A;  5K5G B;  1SQB J;  3PLN A;  3L37 A;  2RN0 A;  5CCG D;  5BU8 B;  1H8A A;  1MZ9 A;  2E74 D;  1QVG O;  2IDB A;  4TLF A;  1KYO H;  1J1D B;  3Q5R A;  4GDO A;  2W6A A;  1DX7 A;  1GW4 A;  3VCP A;  3L70 G;  2N1T D;  5BOK A;  3GHG C;  1RIE A;  1FJK A;  3VP8 A;  1E79 H;  4GOE A;  2NZ2 A;  2XSO A;  1YI2 P;  4Z1M H;  1Q86 Q;  2B87 A;  1RHZ B;  4QDC A;  1NTK K;  2A45 G;  2YKO A;  3GKE A;  2LXC B;  2WQY C;  4JQ0 D;  3EFG A;  2WSF H;  3HRN A;  3GTE A;  2P58 A;  4TT3 H;  2E74 C;  2OYI B;  3O8Z A;  5DJU B;  1LT1 A;  2AXT E;  3DQY A;  4ZKP A;  1PV3 A;  2HMN A;  1LT9 A;  3GW6 A;  3CCV P;  2NPS A;  4CPG A;  1KQS O;  3P8C D;  1BE3 E;  2WSS H;  1KIL B;  2NVF A;  1FQT A;  2W83 C;  4QCK A;  1PP9 E;  1Z56 A;  4JF7 A;  1VQN P;  1P84 H;  3CI9 A;  2R44 A;  1SQQ J;  3AE1 C;  2NUK A;  2OYI A;  1A02 F;  2H8P D;  2Q7C A;  4IFF A;  3A0H E;  1L0N G;  3L75 G;  5KLI C;  1CW5 A;  1Y8A A;  3V2R A;  1SQB K;  2YXR B;  2KK7 A;  1SQB D;  2KSJ A;  1VQL P;  2M5A A;  2OYH C;  2GBX A;  5KLV J;  1VQK P;  4IFM A;  3A3Y B;  2QEX P;  4PV1 C;  2K37 A;  2KIK A;  2M8R A;  5AW9 B;  1URQ D;  1KQF B;  3H1L J;  1JB0 J;  4IL6 X;  2WSE J;  4H0L B;  2E5Y A;  4K3A A;  3N0Q A;  5TIS E;  3TYY A;  5AVX B;  2JO6 A;  2XNX A;  3MHV A;  4KT0 J;  2JWA A;  1OXZ A;  2QJK B;  3II6 A;  3A0B H;  3V5B A;  1XTC C;  1LNQ A;  5L8R J;  3L73 J;  2E4P A;  2NPS D;  2AEM A;  1L2P A;  2ZYL A;  1CI6 B;  2WSF J;  3JC2 2;  1S4X A;  2H88 C;  2XU6 A;  2NRG A;  1URQ C;  4HM8 A;  5GTH E;  4L74 A;  3Q5P A;  2HMO A;  3U59 A;  3NTN A;  1O7M A;  1MFT A;  2NVG A;  3AED C;  4QDD A;  2QJY C;  1LTJ C;  3AE8 C;  4OVN F;  1G1I A;  2HPC A;  1SQQ K;  1PP9 G;  5KAI E;  4UB8 E;  3W68 A;  1SQQ D;  3LID A;  1KQL A;  4H44 B;  1IFP A;  4BWN A;  1P84 I;  1WRG A;  3TNU B;  1KD1 Q;  4QUQ A;  1KFM A;  1SFC D;  5KJ7 A;  4NBE D;  1CI6 A;  4OWF A;  2WPR A;  2NVE A;  3C1L A;  1Q81 Q;  1U7M A;  4ASW A;  4K35 A;  4AQR D;  5KLV K;  1H89 A;  3IN6 A;  2ZT9 B;  5APV A;  1S2E A;  3VMY A;  1G2C B;  5KLV D;  3H1K E;  2XND H;  3RK2 D;  1NAY A;  4GIF A;  1GL2 A;  1KIL E;  2E75 D;  1KYO D;  1DD4 A;  3H1L D;  3WU2 E;  2H89 C;  1O7H A;  3CWB J;  3HE5 B;  1SFC C;  5KKZ C;  2A06 E;  3AE2 C;  3G3Z A;  1PGJ A;  1KOR A;  4ZKU A;  1FE6 A;  1BGY J;  3CXH I;  1Q2N A;  4HM2 A;  1NTZ K;  1NU1 J;  1NDO A;  2BEZ F;  2QA4 P;  3L73 D;  4HB1 A;  1X0T A;  1LTA C;  1FZC B;  3Q3D A;  5AW5 B;  1S9K D;  2N9B A;  2FYN C;  1VF5 B;  3KXD A;  1L4A D;  3VMI D;  3L72 E;  1N7S B;  2ZYD A;  3M9B A;  3HTK B;  5AVZ B;  3RK3 C;  4HKV A;  4H13 B;  3HE5 A;  2C0W A;  3CX5 D;  3RK3 E;  1VQ9 P;  1LP1 B;  3G4S P;  3M0A A;  3BRT B;  1UIX A;  2K9J B;  1SQP G;  2WSC J;  1AVY A;  1K05 A;  3A7O A;  1O7P A;  1LJ2 A;  3RBZ A;  5APX A;  1BCC G;  3AE3 C;  1EZV I;  3GMA A;  2WMM A;  1HJ0 A;  3RL0 B;  2QE7 H;  4DT0 A;  1JEK A;  1L4A C;  2R32 A;  2JJL A;  1M1J B;  5AW4 B;  1K04 A;  3HTK A;  2YKP A;  3H1K G;  3LW5 H;  3L71 J;  3HE4 A;  4RO0 A;  3GHG B;  1AV1 A;  1KB9 H;  4WY4 D;  3S1K A;  3NXS A;  1NTM E;  1PPJ E;  1HF9 A;  2K9J A;  3BCC J;  1FJP A;  2ZYA A;  5H2F H;  1OVV A;  3TGU J;  2HOD B;  2JKV A;  3CWB D;  1FDI A;  1P84 E;  3L70 D;  3OA7 A;  1FU1 A;  1VQ5 P;  3E1R A;  2YKQ A;  1NU1 K;  2E74 B;  2A06 G;  4Y99 C;  2R3C A;  1BGY D;  1G8K B;  1NU1 D;  5B66 H;  3MZW B;  1YJ9 P;  1YJN P;  1M1J A;  2W27 A;  1T3J A;  2RH0 A;  3EQ2 A;  1DD3 A;  2Y9Z A;  1RF1 A;  1FZG A;  2FFD C;  2BMO A;  3VP9 A;  4WY4 C;  1S1C X;  1SQV E;  3FOU A;  2YO2 A;  2QM8 A;  2IBZ E;  3HUS C;  3N7N A;  1L0L J;  3SFD C;  2HOD A;  4ZMD A;  1GZL A;  1YTZ I;  3L72 G;  4EYY Q;  3C0D A;  4BXL A;  2ITA A;  3VMG D;  5AEW A;  2G8Y A;  3CXH E;  5KLI B;  1USD A;  1BSH A;  4OH8 B;  3AEE C;  4IL6 E;  3QH9 A;  2V7Q J;  2JDI H;  1NGM B;  1HUC A;  2OYH B;  4W80 A;  3GOB A;  4XA4 A;  1AQT A;  1RE3 C;  4L76 A;  4D6T E;  2AEJ A;  2HFE D;  4GT1 A;  3GTS A;  4PV1 B;  2VRS A;  4RKU J;  4NB9 D;  1QL2 A;  4GKG A;  3L71 D;  1UUW A;  2IZ1 A;  4HYT B;  1JO5 A;  2WWW A;  3V6I A;  3LW5 J;  1VPC A;  3BCC D;  1DIP A;  2Q6Q A;  2DE5 D;  4IFD K;  1IFD A;  3TGU D;  1NTM G;  3AZC A;  3I56 P;  1ULJ A;  2YMY A;  4HM4 A;  4XFJ A;  2PAJ A;  5HL4 A;  4MN4 C;  2OYH A;  3MGN A;  2W6J H;  4HM7 A;  2Q1K A;  2IFN A;  2RKL A;  4N78 E;  1M90 Q;  3CD6 P;  1URQ B;  4C7N B;  4UB6 H;  1RE4 A;  2WSE H;  2J5U A;  1L0L K;  4YTP C;  2QJY B;  5CCH D;  5AVT B;  1QLE D;  2YO3 A;  1L0L D;  2R3S A;  5E79 H;  1SQV G;  3TSI A;  1PGO A;  3GZX A;  1LWU C;  3VYI A;  4NBA D;  3L74 E;  3VMH D;  1SJG A;  2Q9I A;  3HD7 D;  3BAS A;  3WUU A;  2JR8 A;  2CPB A;  3H1H E;  3CCJ P;  1Q82 Q;  3A2A A;  1N73 C;  2E76 D;  5CCG C;  1FC2 C;  2D2C D;  2KXP B;  4WWI A;  1SQP J;  2B9B A;  4AUW A;  2C9N Y;  1KMI Z;  4NPE A;  2XZR A;  5AW0 B;  1JMM A;  4EI2 A;  1T6A A;  2N9Y B;  1BCC J;  2LR2 A;  1FZF A;  2N1T C;  3CX5 H;  1ZP0 C;  4JBZ A;  3RBX A;  1ZLL A;  1HGV A;  1EQ7 A;  2E5T A;  1DH3 A;  2K9Y A;  4D6T G;  2JWD A;  3CCU P;  2QRX A;  3PJS K;  3G9R A;  3HD7 C;  3RGU A;  3F5H A;  1AJY A;  3C8V A;  4QUR A;  4U3F E;  3KYQ A;  2E76 C;  1SFC B;  2W90 A;  2D2C C;  1NTK E;  1KB9 D;  1JY3 N;  3EWK A;  5KAF H;  2HYN A;  1QL1 A;  3FXE A;  1S5L H;  5CXM A;  1NJI Q;  1FZE A;  3M0D C;  1EZV G;  1O7G A;  1GMJ A;  1KIL A;  2FYU J;  4NBB D;  4OGQ D;  3P8C E;  3FX0 A;  1KV4 A;  2FYN B;  1N8R Q;  1JTH B;  1RF0 C;  1FDO A;  5AW6 B;  1WT6 A;  1VM9 A;  1KYO I;  4C7R A;  3MUD C;  3RK3 B;  2ZXE B;  3TDK A;  1OW7 A;  4O9B A;  3UIA A;  2BCC J;  1YQ4 C;  4DOJ A;  2KI7 B;  2Q5U A;  3RL0 g;  2OAR A;  5GTI E;  1EXJ A;  1EDL A;  3L74 G;  5H2F E;  1VQO P;  5APQ A;  2FXO A;  1VQP P;  1SQB E;  1SQP K;  3H1H G;  2YIU B;  4OGQ C;  4P1B H;  5BU5 A;  2KYV A;  1SQP D;  2HG5 D;  3H1J J;  1EG9 A;  3OW2 O;  1L4A B;  1OVU A;  2OYO A;  1AA0 A;  1FZA A;  1DEB A;  1BCC D;  2J59 M;  1KN7 A;  1JOC A;  2BAS A;  2SPZ A;  3CCS P;  4NPD A;  2JP3 A;  2KZI A;  1GU5 A;  2FYZ A;  2KSE A;  1JY2 N;  3IF4 A;  3VMZ A;  5CJ4 A;  3AE9 C;  1QGK B;  2BMR A;  4EIJ A;  1BE3 G;  2WSC H;  1OFC X;  2OQQ A;  3JCU H;  2W6B A;  4NBC D;  4W7Z A;  5CHX A;  1LT9 C;  2OTK E;  2AXC A;  4R4L A;  1SQX J;  2NPS C;  4U3F G;  1CZQ A;  3KZI H;  2WVR A;  4Y99 B;  2GUV A;  1GTW A;  1NTK G;  1QEX A;  3C9I A;  1Q90 D;  3H1I J;  2CK3 H;  2FYU K;  3NFQ A;  1IJD B;  2FYU D;  2WIT A;  3BRV B;  4WY4 B;  4QDF B;  4QUP A;  4PD4 D;  1VCK A;  2QJP C;  2IBZ I;  2KNC B;  2KB7 P;  1SQQ E;  2FXM A;  3MP7 B;  2G3A A;  2BCC D;  3L4F A;  1USE A;  3BAT A;  3Q1M A;  3L70 J;  3TNU A;  2POH A;  3PHL A;  2LXB A;  3MTU E;  4U7J A;  1Q90 C;  1JUN A;  3R4Y A;  1T8Z A;  5DJT B;  1JCC A;  2DE6 D;  1SLQ A;  3CL3 D;  4YXW H;  3ITK A;  3RK2 C;  2IYO A;  1G2C A;  3L35 A;  5KLV E;  2I7F A;  2QSI A;  1SQB G;  2I1K A;  2E43 A;  1M56 D;  3H1J D;  3JSV C;  4H0L D;  5TJH A;  4QDF A;  2PFX A;  1O7N A;  1NWQ A;  2E75 C;  1M1K Q;  1G1J A;  2Y0D A;  2ZAE B;  3T97 B;  1KYO E;  2Y0E A;  4L73 A;  1IFJ A;  3H1L E;  5APW A;  4UB6 E;  3V2P A;  1W2B O;  2H7H A;  1HH0 A;  1MUU A;  1JNM A;  2Z5I A;  3VN0 A;  1IO4 A;  1IK9 A;  4AIV A;  5KJ7 D;  2V7Q H;  3B8E B;  2DE7 D;  1SQX K;  2O1J A;  3SFE C;  4HJG H;  3W67 A;  3M9Q A;  1SQX D;  1FZB A;  2XRX A; 
#chains in the Genus database with same CATH homology
 1O7H A;  3CWB E;  2B24 A;  3L71 E;  3H1H E;  3L73 E;  1NTZ E;  1ZRT E;  1NYK A;  2HMM A;  2BCC E;  2E4P A;  5KKZ C;  2A06 E;  2E76 D;  4HM0 A;  3GOB A;  4EMJ B;  2ZYL A;  1BE3 E;  1G8J B;  2NVF A;  1FQT A;  1L0N E;  3L75 E;  4QDF B;  2D2C D;  4QUP A;  4D6T E;  4QCK A;  1PP9 E;  1BGY E;  1SQP E;  3GTS A;  3BCC E;  1NTM E;  1PPJ E;  4NBG D;  3EN1 A;  1NU1 E;  1VCK A;  1WQL A;  4NB9 D;  3TGU E;  4HM2 A;  1JM1 A;  3GL2 A;  2QJP C;  2NWF A;  1UUV A;  1NDO A;  2NUM A;  4HM8 A;  1SQQ E;  2YFL A;  1EZV E;  1BCC E;  1P84 E;  2XSH A;  2HMO A;  3GCE A;  1UUW A;  4H44 D;  1SQB E;  3L70 E;  1O7M A;  2NVG A;  2NUK A;  5AEU A;  4QDD A;  2QJY C;  3CX5 E;  4NBD D;  4HM3 A;  3GL0 A;  3D89 A;  4NBF D;  4P1B H;  3H1J E;  2Q3W A;  1G8K B;  1Q90 C;  2HMJ A;  1EG9 A;  2E74 D;  4HM6 A;  5KLI C;  2DE5 D;  1KB9 E;  2BMQ A;  2FYN C;  2YFI A;  2DE6 D;  2GBW A;  3AZC A;  2QJK C;  1VF5 D;  3VMI D;  3L72 E;  1O7W A;  1ULJ A;  4P1C H;  2XR8 A;  4QUR A;  4HM4 A;  1RFS A;  4NBH D;  4U3F E;  2B1X A;  2ZT9 D;  4HKV A;  4AAY B;  5HL4 A;  5KLV E;  2I7F A;  2YIU C;  3VCP A;  2BMO A;  2GBX A;  2QPZ A;  4H13 D;  5BOK A;  4QUQ A;  4H0L D;  1NTK E;  2BMR A;  1RIE A;  4HM5 A;  4QDF A;  4NBE D;  1SQV E;  4HM7 A;  3VCA A;  3FOU A;  1L0L E;  1O7N A;  2IBZ E;  2NVE A;  2XSO A;  1ULI A;  4NB8 D;  4NBC D;  1KYO E;  2CKF A;  3EQQ A;  5CXM A;  1O7P A;  4QDC A;  2YFJ A;  2YVJ B;  4HJL A;  3H1L E;  1SQX E;  3H1K E;  3GKE A;  1O7G A;  3C0D A;  5AEW A;  3GZY A;  2E4Q A;  3VMG D;  3GB4 A;  2HML A;  2FYU E;  3GTE A;  2HMK A;  3N0Q A;  4NBB D;  4OGQ D;  3CXH E;  4AIV A;  3H1I E;  2JO6 A;  2DE7 D;  3DQY A;  3GZX A;  2E75 D;  4HM1 A;  4PV1 D;  4NBA D;  3L74 E;  2JZA A;  4PD4 E;  1VM9 A;  3VMH D;  1SJG A;  2HMN A;  2XRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...