3L75E

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l75E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l75E02
3GL2A 2E4QA 2JZAA 3GZXA 3GKEA 4NBAD 2BMRA 4NBDD 2QPZA 1NU1E 2E76D 3GOBA 4QDFA 3CX5E 4H44D 4AIVA 3AZCA 1FQTA 3VMGD 3VMID 1SQVE 3D89A 1VCKA 4P1BH 3DQYA 2B1XA 1L0LE 4HM6A 2B24A 1BCCE 4NB9D 1Q90C 3GTEA 4HM2A 4NBED 3H1JE 5BOKA 1JM1A 3L73E 2HMOA 3L72E 3VCPA 2NVGA 3EN1A 4D6TE 2BCCE 1O7MA 2E74D 2BMQA 1SQQE 3GB4A 4HM0A 1RFSA 2HMNA 1L0NE 2E4PA 1ULJA 1VM9A 1NTKE 1WQLA 4NBBD 1O7PA 4AAYB 1O7HA 5AEWA 1PPJE 1NTME 3L71E 2FYNC 2NVEA 2XSOA 2GBXA 2E75D 2HMJA 2XSHA 4NBHD 3TGUE 2JO6A 5HL4A 4QUQA 4NB8D 4NBFD 1UUVA 4HM4A 5CXMA 4HJLA 5KKZC 3H1IE 1O7WA 1KB9E 2D2CD 3VMHD 3L70E 1BE3E 4QURA 1ULIA 3GZYA 2YFLA 4QDFB 2YVJB 1SQBE 2BMOA 1G8JB 2YFJA 2NUMA 2CKFA 4HM8A 4PD4E 2HMMA 3EQQA 3L75E 1EG9A 3C0DA 4EMJB 1P84E 3CWBE 1PP9E 3L74E 4HM7A 1SJGA 3GL0A 2A06E 4NBCD 3CXHE 2XR8A 1BGYE 3GCEA 2XRXA 4QCKA 2QJKC 4QUPA 3N0QA 4P1CH 5KLVE 2DE5D 2YIUC 2HMKA 1VF5D 1EZVE 4H0LD 2IBZE 2GBWA 2QJPC 4QDCA 2FYUE 4HKVA 2I7FA 2NWFA 1ZRTE 1RIEA 5AEUA 3GTSA 3H1KE 1O7NA 1G8KB 1UUWA 1NYKA 4HM5A 2ZYLA 2ZT9D 1NDOA 4U3FE 4QDDA 2YFIA 3FOUA 1O7GA 3BCCE 4PV1D 1SQXE 1KYOE 2DE7D 5KLIC 2HMLA 2NVFA 4H13D 4OGQD 2NUKA 2QJYC 4HM3A 4HM1A 2DE6D 3VCAA 2Q3WA 3H1HE 4NBGD 1SQPE 3H1LE 1NTZE
chains in the Genus database with same CATH superfamily
3L75G 1KORA 1M1JB 1ZR4A 3H1HD 2NPSB 1JY3P 4ASWA 1J2JB 1HGVA 1QL1A 1KQGB 2XZRA 2OYIA 2ZYDA 3H6PA 1JY2N 4WY4C 4D6TE 4RO0A 1KILD 1Z56A 3KQGA 1YQ3C 2XDJA 1RFSA 1WQLA 4H0LB 4NBBD 1O7PA 2K37A 2IBZD 3OJAB 2DW3A 4HJLA 1MZ9A 2J59M 1VQ6P 1SQBG 3WU2H 4C46A 2W90A 3H1JJ 1OVVA 1ULIA 1BCCJ 3GZYA 1GL2D 5KJ7A 2M3BA 5E79E 1Q82Q 1FZBA 1S5LH 3VP8A 4TLFA 2A06E 1M90Q 3AE9C 1AVYA 1KQLA 3IN6A 3LIEA 4H44B 1N7SC 1HGZA 1KYOD 5AVQB 2DE5D 2PAJA 2A45G 2QJPC 4QDCA 3G71P 1ZRTE 1X9VA 2AEMA 1FZCB 4OWFA 4K35A 1S5LX 3BCCJ 2MJZA 2P2UA 5K5GB 2WSCJ 4U3FJ 2XKMA 2Q3IA 2KP8A 3U1AA 1LT9A 3F89A 3FXDA 2WSCH 4PV1D 2YKPA 4KJMA 2NUKA 2DE6D 1SQPE 2E76C 1HJ0A 2OYIC 4WB4A 3GZXA 1FE6A 2Z5HA 2PGDA 1GU5A 2Q7CA 2JEEA 3U59A 3L73G 1RHZB 2R32A 2FBWC 1OIPA 1UIIA 1BE3D 1KFNA 2V7QJ 3D71A 1FS0E 2R5BA 4L74A 2BCCE 3CX5H 1PGJA 2UWJE 1IK7A 4HJGH 2V7QH 4WY4B 3GHGC 5AEWA 1EZVI 1NTME 3L4FA 3HUSA 1JUNA 5KLVD 3RL0D 1LWUA 1NGMB 3HTKA 1KILB 1SQXG 3H1IE 1NAYA 1O7WA 2ZXEB 1NWQA 1MV8A 4GDOA 1WMKA 2QJKB 2WPRA 2P67A 5AVRB 1GL2C 3EQQA 3E1IA 4HM7A 1NJIQ 2O01H 3CCSP 3CXHE 4KHXA 1BGYE 3GCEA 2QJKC 4DJGA 1GL2B 1FZCA 1RF1A 2I7FA 3MHVA 5KLIB 4W7YA 4I6MC 1H89A 4L73A 1S4XA 1PFIA 2W6JH 1DD3A 4IFMA 5CHXA 4NBGD 1Q81Q 1H0TB 2AXTE 3FX0A 2JJLA 2J5UA 3RK3D 4B86A 5CCHC 1NTZG 2KOGA 3L70D 1FQTA 1VQOP 1PL5A 3UIAA 1NU1G 2B24A 1ZMEC 1BE3J 4EYYQ 3H1KG 3M9HA 4EOTA 2NVGA 1O7MA 3L36A 1UIXA 4IL6X 3L37A 2IBZI 2GBXA 4L75A 4Y99C 1FC2C 4NBFD 2A06D 3KZIE 4YXDC 1OVRA 1SQXK 1X8YA 1VQMP 1JMMA 3TF5A 5APYA 4PD4E 2K3RA 3L75E 2WSSH 2R3CA 3FGAD 3L74E 4YPCA 3Q1MA 1SJGA 1T3UA 1VQNP 5L8RJ 2XR8A 2XRXA 4QCKA 5APSA 3F5HA 2A45H 3CPWO 4H13B 4OGQB 2FXOA 4OVNF 4H0LD 2AEFA 1SQPD 1AFOA 5B5EE 3ZDMA 1VQ9P 1Q86Q 3FOUA 3S1KA 1LTJA 4BRYB 1QL2A 2XNXA 5APXA 2YMKA 1ZP0C 4H13D 4OGQD 3JCUE 5APVA 3S4RA 3H1HE 1N86A 2JZAA 2BCCD 1LTGC 3OW2O 2BMRA 4NPEA 2QPZA 2IZ0A 4AIVA 1NTMD 3MZWB 2BCCG 2ITAA 1N73A 1FDIA 1LGHB 1SQQE 2BMQA 3CXHD 1VQPP 2E4PA 1RE3C 2HODB 5DJTB 1PP9D 3BRVB 3MP7B 3L71J 4GOEA 3LW5H 2IDBA 4NBHD 3LIDA 3AEDC 1HTLC 1SQQJ 2B87A 1SFCD 3SWYA 1KN7A 2FXMA 2W27A 2M3EA 2JKVA 4GT1A 4WY4A 3KZIH 1JTHB 1RE4C 1EDLA 1R5LA 2C0XA 2E74C 2KIKA 3BVHA 4ZKPA 3RK3E 2H88C 1HF9A 2WPVB 1G2CB 3H1HJ 3D70A 5CBOA 2NWFA 1NTZK 3TSIA 3AE6C 2KS1A 2OYHC 2YFIA 2PRRA 3CLQA 2YXQB 3HE4A 3L71G 1YJWP 2FFDC 2G3AA 1SQPG 2YKQA 2HMLA 4HM3A 3H32A 1RF1B 3CC2P 1ZV8A 2YNYA 2KI7B 2N1TC 3L75J 5BVZA 1DD4A 3B5NB 3HUSB 3DQYA 1N73B 2KZIA 3A0HH 4NBED 4HM2A 3AE8C 2B88A 3E7KA 3M0DA 3WUVA 3B4SA 1SQBD 5KLVG 4HM0A 1VQ5P 3TGUJ 5KKZB 3HD7B 4AAYB 2Z5IA 1LTJC 1R8EA 4LLHA 2NVEA 1VQ8P 2XSOA 1LTAC 4RJTA 1EDKA 4UB6E 3WMM0 1LTJB 4BRYA 2Z4EA 3V2NA 5GTHH 1BE3E 1VF5C 2YFJA 4JQ0D 1KC8Q 3VP9A 3A7OA 2ZVOB 3MUDA 3CXHI 2YO2A 1GU4A 2OARA 2H7HA 4HH2A 5AVYB 1K05A 5KLVE 1Q7YQ 1FBMA 2WTYA 2RKLA 5KAFE 2IBZE 2GBWA 2FYUE 1LTIC 3A0BE 2YIUB 2D2CC 1LP1A 2XU6A 4QMAA 3N7NA 5AVUB 3T97A 1IFJA 2OYIB 3C1LA 1GK6A 1N2DC 2XNDH 4L76A 3BATA 2J58A 2KXPB 2Y9YA 3V2QA 3IFMA 3NXSA 1P84I 1NTZE 1K04A 1OWAA 3CCRP 2OTJP 3CWBG 1OW8A 1Q90D 3RGUA 3GOBA 3BASA 4P1BH 1H88A 3SFDC 1M8OB 3VMXA 3GTEA 5TISE 2IYOA 2N1TA 3M06A 3VCPA 1PGPA 2Q6QA 1MFTA 3AE2C 1NVOA 5AW4B 2M5AB 4Y99B 1FZFA 2LXBA 4PV1C 2HMJA 5HL4A 4QUQA 1T6AA 4JBZA 3L72J 4PD4D 3HD7D 1MKMA 5AVZB 2C9LY 1SQVJ 2HODA 3L74G 3RK2C 3OAKA 2ZVNB 1L0LG 2P10A 3WUTA 3GW6A 1U7MA 3A2AA 2QIWA 2SPZA 4AYCA 2HYNA 5KAIH 2H8PD 3P7KA 3FWNA 1IC2A 1FAVA 2BEQD 3L75D 2CPSA 1M7LA 2GUSA 1OFCX 2N9YB 3I56P 3AEEC 1O7NA 3C8VA 4LGDE 2KS1B 4ZMDA 1L4AD 1JB0J 1OMIA 4QDDA 1SFCB 1USEA 1FJKA 1SQXE 2PP6A 2P58A 1X22A 2I1JA 2JP3A 2OTLP 1IFNA 1U7JA 4GODA 4U3FD 2K1AA 3M9QA 4LC1A 4N78E 2KSEA 1NHLA 2WZ7A 2FXPA 3O6QA 2H89C 1YTZT 2C0WA 5B66H 2JWAA 4NB9D 2IZ1A 3H1JE 1VDFA 1LT1A 2HMOA 1OW6A 2WITA 1LTBC 3GHGA 2A45I 1KB9H 1L0NE 2AEJA 1NTKE 1VL2A 4UB6H 2O01J 2KNCB 3CX5I 2OGUA 1YYCA 3H1HG 4D6TJ 1NH4A 3BCCG 5AW8B 3CI9A 1OW7A 4PJ0H 3L73J 1GDTA 3MTUE 3L70E 4QURA 2W6BA 3Q5RA 2ZFCA 3OA7A 1SQVG 3Q5SA 1FOSF 1PP9E 2MKVA 1GK4A 3CCMP 2AXCA 1DX7A 2O3JA 4GOFA 1KILA 4QUPA 3A3YB 1GMJA 1YJNP 2Y0CA 3I5CA 4TT3H 1LWUB 1NKZB 3PJSK 1S5LE 1J1DB 2K9JB 4M3LA 5AW2B 3VMZA 1LP1B 3M0AA 5BU8B 1J1EC 2DE7D 1AQ5A 5GTIH 3VCAA 1J1DC 4JPZB 3RL0g 2P7JA 3B8EB 1IFPA 1N73C 2LR2A 2ZYGA 5AVVB 4H44D 1AA0A 2WSEJ 1FZAA 2NPSA 1W2BO 3P8CD 2O1KA 2HPCA 1DEEG 2VRSA 2A06G 3HTKB 3PTZA 1JM1A 3A0HE 4DT0A 2QA4P 3HE5B 1M1KQ 3AE1C 3AE7C 1D7MA 2GA1A 2Q3EA 2IBZG 3R4YA 2FY8A 1SQVD 1NTKG 1SFCA 1T2KD 1FDMA 2WVRA 2IPPA 3P8MC 1URQA 1ZN5A 5CBNA 1ZR2A 4R4MA 4RKUJ 3CMEP 1SQBE 4XA4A 1EG9A 4CPGA 3KHUA 1N7SB 3CCEP 1QLED 3W68A 1IJDB 2RN0A 1DEBA 3CCLP 1LTTC 2D2CB 1BSNA 2HMKA 1URQC 3AE5C 3TYYA 2KNCA 3PHLA 2ZYAA 2FYUD 1Q2NA 1NTMG 1RH5B 1JOCA 1CI6A 1W5CE 3H1LE 2OYHB 1OVUA 3V5BA 1PP9J 4NBDD 1NU1E 1OZHA 4H0LC 2B1XA 2YO3A 2M0BA 3L70J 5BOKA 3L73E 1LNQA 3PP5A 1CI6B 2KYVA 1VM9A 3B71A 1PPJE 3GG2A 2OYHA 4HB1A 4DZOA 1NTKJ 1L0NJ 5AW9B 2YMYA 4NB8D 2GUVA 5CCGC 3RBXA 1IZNB 1P84D 1SQPK 2KB7P 2QRXA 3CCVP 1N7SD 3CCQP 1KFMA 2QJPB 2IFNA 4PD4I 2QM7A 4JF7A 4NBCD 5KJ7C 5H2FH 4N6JA 2B89A 3H25A 4XFJA 2PFXA 1WT6A 1VF5D 2POHA 3GLMA 1SQXJ 1SQXD 1S9KE 3V2PA 1VQ7P 1QX8A 4HM5A 1JY3N 5TJHA 2E76B 1YQ4C 2KUBA 4Z1MH 3TDKA 5AVTB 1KYOE 4U3FG 1Y9BA 2K9JA 5CJ0A 3AEFC 2IFMA 4U7JA 2E4QA 3TNUB 3BRTB 3VMGD 1SQVE 1KD1Q 2N1TB 4I1LA 1IFDA 5M1BA 5DJUB 1Y8AA 5AVSB 3L72E 1A02J 1YHQP 3EWKA 1KQFB 3H1JD 1S2EA 1T3JA 1SP4A 1DIPA 1RF0C 1FZEA 1L0LD 3HD7C 4N78D 2HG5D 2WSFJ 3E1RA 2JO6A 2JO1A 1CZQA 2YKOA 2ZT9B 2ZJSE 2P1JA 2YFLA 1K9MQ 2BMOA 5TISH 1GTWA 4NPDA 3C0DA 3GL0A 1SVFA 2KLUA 3KDPB 1NTZJ 3AEGC 1VQKP 2W6AA 1L0NG 1BGYG 2OQQA 2YXRB 4EDFA 1UUWA 1LT9C 2QM8A 1KYOH 1JNMA 4C7NB 1BGYD 1O7GA 4ZKUA 5KLVK 1L0LK 1JCCA 2FYUJ 2I1KA 1YITP 1EXJA 2B9BA 1M57D 5KLVJ 3HE5A 5KAFH 4RESB 1ZRTD 1Y47A 5AW6B 3CX5E 1BDCA 1PPJD 3VMID 1LJ2A 4HM6A 1Q90C 1VQ4P 1M1JA 4GIFA 5AW7B 2FYUK 2RH0A 2Y0DA 1RQUA 3GB4A 3WU2E 1EZVG 3SSUA 1ULJA 3P32A 2LXCB 1O7HA 4XE5B 2FYNC 1KQSO 3TGUE 2R3SA 1EZVD 2WT7A 1A02F 3VMAA 3NFQA 1YJ9P 3VTPC 2B87B 2HMMA 3BCCD 1BSHA 1OX3A 5CCGA 1EC5A 3LW5J 4EI2A 2O01N 3Q5PA 1HWTC 1SQVK 3V2RA 1KTMA 3H1ID 4JYCA 1RIEA 5AEUA 3SWFA 4IOIH 3G4SP 4N3YB 1NDOA 4R4LA 3IF4A 1LWUC 3H1KJ 1RY3A 4HM1A 2Q3WA 4JYBA 2E75B 4AQRD 3JSVC 3GF3A 2CPBA 1P84H 2QJYB 3G6EP 1SQQD 1J1EB 1R5SA 3CWBJ 4IL6H 3L73D 1L4AB 2C9NY 4QDFA 1HBWA 1VCKA 3ITKA 4YXWH 1L0LE 2Q1KA 2WSEH 2O1JA 2NPSD 3QWOC 5C39A 3IR9A 1BCCD 1PGQA 3TNUA 3RK2D 1IK9A 4D6TG 2R5DA 2OYOA 3L71E 4OH8B 5KTBA 2JWDA 2ZXXA 4EIJA 2QSIA 2FYNB 5CJ4A 1FJPA 4IFDK 3Q3DA 1IO4A 2E74B 1YIJP 2D2CD 1EXIA 3M0DC 1L0LJ 1ZOYC 1PP9G 2LKMA 1AQTA 3PLNA 4EMJB 1P84E 2L91A 3CWBE 3RK3B 1E79H 3QH9A 3O8ZA 4IL6E 1SS1A 2ZAEB 1NTKK 2YIUC 3B5NA 2I8DA 3CX5D 2K9YA 3H32B 1MFZA 2GM4A 3H1KE 2WPSA 5CMZA 1SQQG 3U1CA 5B66E 1EQ7A 2JDIH 3A5TA 1QGKB 4C7NA 1M1JC 3EFGA 3H1IG 1DH3A 3R2PA 1X79B 2CK3H 4W80A 3NTNA 3B5NC 1EDJA 4BWNA 2E5TA 4W7ZA 1G1JA 3L74J 3L72D 3D6ZA 2QEXP 3AZCA 5CCHA 4HYTB 1URQD 5EFWB 1JM0A 4WWIA 4PD4H 1BDDA 1QVFO 3TK1A 3RBZA 3KYQA 3GHGB 4I2LC 3V6IA 1H8AA 2WQYC 4MN4C 1KB9I 3HUSC 1QVGO 3JC22 2HPCB 2Y0EA 2ZT9C 3T97B 5GTIE 1BE3G 5AVWB 4ZNCA 5KKZC 5KJ7D 4I7ZC 1KB9E 2N9BA 1NU1D 3RK2B 1SLQA 2HFED 2QE7H 2KK7A 3USSA 1GL2A 3H1JG 3PH0A 1HVVA 1T8ZA 4KT0J 1USDA 2W83C 3WUUA 3N0QA 2E43A 2QG4A 1MUUA 1NYHA 2AXTH 1GW3A 5APWA 3SFEC 3SWKA 1SFCC 1L0NK 2ZT9D 3CL3D 2RMZA 1FZGA 1NOHA 3CC7P 3L71D 1EDIA 1KILE 3MUDC 3EFFK 1N7LA 3C9IA 1BGYJ 3GL2A 1KMIZ 3L70G 4NBAD 2QVAA 3CXHH 1YI2P 1T2KC 3D89A 2K88A 3CC4P 3HRNA 3Q2YA 1L2PA 3H1IJ 1VPCA 3VYIA 1FOSE 2E5YA 1NTMJ 4D6TD 1N7SA 4UB8H 4HM4A 2BCCJ 4ASVA 2WSFH 1AVOA 3L35A 3G9RA 4PV1B 2YVJB 2M5AA 3M91A 1G8JB 3H1LG 2HR3A 1QEXA 1NU1K 1YBKA 3MD0A 4HM8A 3MIWA 1VF5B 1KILC 2NZ2A 3V4QA 1RE4A 1E5WA 4GKGA 1KZUB 1PIXA 4P1CH 3TGUD 1SQPJ 1EZVE 5KAIE 1HH0A 5AW3B 4H44C 1L4AA 2WWWA 1JTHA 1CW5A 5CCGD 1G8KB 4O9BA 2W8ZA 1RF0A 1FZCC 2ZYLA 3A0BH 1KV4A 3CCJP 4U3FE 4NPFX 3CD6P 3CCUP 3BCCE 5KLIC 3I55P 2QJYC 4UB8E 5H2FE 2OTKE 2Q9IA 1LT9B 5APTA 3KPEA 5CXMA 1L4AC 2N1TD 3VN0A 1HJBA 3GKEA 2XV5A 1AJYA 1PGOA 3FWLA 2M8RA 1N8RQ 2E76D 2FYZA 5GTHE 3HE4B 3L72G 3AE4C 4WVZA 1BCCE 3VMYA 2IYPA 4IFFA 3L74D 1JO5A 1JCDA 3EN1A 3IAOA 2E74D 3AE3C 3W67A 1PPJG 2H43A 1NTZD 3PRJA 3D6YA 3HD7A 3GMAA 2E75D 2JR8A 4K3AA 1NKNA 4Y28J 3ABVC 5APQA 1XTCC 3MGNA 1L0ND 3KXDA 1S3JA 4QDFB 1M56D 4BXLA 2V4HA 1LTSC 4H13C 1WRGA 3AECC 1ZW0A 4OGQC 2NUMA 1YTZI 4YTPC 1NU1J 1JY3O 1AV1A 1BCCG 1PZQA 1TU3F 4C7RA 2KSJA 3H1LJ 3H1LD 3RL0B 1GZLA 3CWBD 5BU5A 3G3ZA 5AVXB 1ZXGA 2R44A 3GTSA 5E79H 2FYUG 1NYKA 2HLOA 3TGUG 2FFDB 3II6A 3RL0C 4WY4D 1JMBA 1W2EA 3B5ND 5APUA 3VOPA 3H1KD 2WMMA 1KYOI 3P8CE 1NTMK 1NAFA 2NVFA 3K5BA 2BASA 4DOJA 1SQQK 2NPSC 3JCUH 1SQBK 1GD2E 1X0TA 1S72P 2FKWB 1VQLP 1IFIA 1FU1A 2E75C 1SQBJ 3M9BA 1CSBA 2FFDA 2KZJA 5AW5B 1NO4A 1JY2O 5AW0B 3V4WA 1HUCA 2G8YA 2IX7C 1PV3A 4HKZH 2BEZF 2HMNA 1U57A 3AEAC 3CMAP 3AEBC 2XSHA 1RE3A 3S9OA 4I7ZB 2Q5UA 1UUVA 4WBAA 1FDOA 1S1CX 1XTGB 1JEKA 3RK3C 5CCHD 1GW4A 3VMHD 1OXZA 1S9KD 1JY2P 3NMDA 4PJ0E 4DCKA 2CKFA 1K73Q 1KB9D 3FXEA 1NTKD 2KLVA 1ZLLA 4AUWA 4A7PA 1G2CA 1K8AQ 3GF7A 5AW1B 2WT7B 1G1IA 2L5GB 3O6QB 4HKVA 1RF1C 2NRGA 2WPQA 3N4XA 1H0TA 2E42A 1URQB 5B5EH 3EQ2A 1RQVA 2Y9ZA 1IFMA
chains in the Genus database with same CATH topology
3GL2A 2E4QA 2JZAA 3GZXA 3GKEA 4NBAD 2BMRA 4NBDD 2QPZA 1NU1E 2E76D 3GOBA 4QDFA 3CX5E 4H44D 4AIVA 3AZCA 1FQTA 3VMGD 3VMID 1SQVE 3D89A 1VCKA 4P1BH 3DQYA 2B1XA 1L0LE 4HM6A 2B24A 1BCCE 4NB9D 1Q90C 3GTEA 4HM2A 4NBED 3H1JE 5BOKA 1JM1A 3L73E 2HMOA 3L72E 3VCPA 2NVGA 3EN1A 4D6TE 2BCCE 1O7MA 2E74D 2BMQA 1SQQE 3GB4A 4HM0A 1RFSA 2HMNA 1L0NE 2E4PA 1ULJA 1VM9A 1NTKE 1WQLA 4NBBD 1O7PA 4AAYB 1O7HA 5AEWA 1PPJE 1NTME 3L71E 2FYNC 2NVEA 2XSOA 2GBXA 2E75D 2HMJA 2XSHA 4NBHD 3TGUE 2JO6A 5HL4A 4QUQA 4NB8D 4NBFD 1UUVA 4HM4A 5CXMA 4HJLA 5KKZC 3H1IE 1O7WA 1KB9E 2D2CD 3VMHD 3L70E 1BE3E 4QURA 1ULIA 3GZYA 2YFLA 4QDFB 2YVJB 1SQBE 2BMOA 1G8JB 2YFJA 2NUMA 2CKFA 4HM8A 4PD4E 2HMMA 3EQQA 3L75E 1EG9A 3C0DA 4EMJB 1P84E 3CWBE 1PP9E 3L74E 4HM7A 1SJGA 3GL0A 2A06E 4NBCD 3CXHE 2XR8A 1BGYE 3GCEA 2XRXA 4QCKA 2QJKC 4QUPA 3N0QA 4P1CH 5KLVE 2DE5D 2YIUC 2HMKA 1VF5D 1EZVE 4H0LD 2IBZE 2GBWA 2QJPC 4QDCA 2FYUE 4HKVA 2I7FA 2NWFA 1ZRTE 1RIEA 5AEUA 3GTSA 3H1KE 1O7NA 1G8KB 1UUWA 1NYKA 4HM5A 2ZYLA 2ZT9D 1NDOA 4U3FE 4QDDA 2YFIA 3FOUA 1O7GA 3BCCE 4PV1D 1SQXE 1KYOE 2DE7D 5KLIC 2HMLA 2NVFA 4H13D 4OGQD 2NUKA 2QJYC 4HM3A 4HM1A 2DE6D 3VCAA 2Q3WA 3H1HE 4NBGD 1SQPE 3H1LE 1NTZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL2 A;  2E4Q A;  2JZA A;  3GZX A;  3GKE A;  4NBA D;  2BMR A;  4NBD D;  2QPZ A;  1NU1 E;  2E76 D;  3GOB A;  4QDF A;  3CX5 E;  4H44 D;  4AIV A;  3AZC A;  1FQT A;  3VMG D;  3VMI D;  1SQV E;  3D89 A;  1VCK A;  4P1B H;  3DQY A;  2B1X A;  1L0L E;  4HM6 A;  2B24 A;  1BCC E;  4NB9 D;  1Q90 C;  3GTE A;  4HM2 A;  4NBE D;  3H1J E;  5BOK A;  1JM1 A;  3L73 E;  2HMO A;  3L72 E;  3VCP A;  2NVG A;  3EN1 A;  4D6T E;  2BCC E;  1O7M A;  2E74 D;  2BMQ A;  1SQQ E;  3GB4 A;  4HM0 A;  1RFS A;  2HMN A;  1L0N E;  2E4P A;  1ULJ A;  1VM9 A;  1NTK E;  1WQL A;  4NBB D;  1O7P A;  4AAY B;  1O7H A;  5AEW A;  1PPJ E;  1NTM E;  3L71 E;  2FYN C;  2NVE A;  2XSO A;  2GBX A;  2E75 D;  2HMJ A;  2XSH A;  4NBH D;  3TGU E;  2JO6 A;  5HL4 A;  4QUQ A;  4NB8 D;  4NBF D;  1UUV A;  4HM4 A;  5CXM A;  4HJL A;  5KKZ C;  3H1I E;  1O7W A;  1KB9 E;  2D2C D;  3VMH D;  3L70 E;  1BE3 E;  4QUR A;  1ULI A;  3GZY A;  2YFL A;  4QDF B;  2YVJ B;  1SQB E;  2BMO A;  1G8J B;  2YFJ A;  2NUM A;  2CKF A;  4HM8 A;  4PD4 E;  2HMM A;  3EQQ A;  3L75 E;  1EG9 A;  3C0D A;  4EMJ B;  1P84 E;  3CWB E;  1PP9 E;  3L74 E;  4HM7 A;  1SJG A;  3GL0 A;  2A06 E;  4NBC D;  3CXH E;  2XR8 A;  1BGY E;  3GCE A;  2XRX A;  4QCK A;  2QJK C;  4QUP A;  3N0Q A;  4P1C H;  5KLV E;  2DE5 D;  2YIU C;  2HMK A;  1VF5 D;  1EZV E;  4H0L D;  2IBZ E;  2GBW A;  2QJP C;  4QDC A;  2FYU E;  4HKV A;  2I7F A;  2NWF A;  1ZRT E;  1RIE A;  5AEU A;  3GTS A;  3H1K E;  1O7N A;  1G8K B;  1UUW A;  1NYK A;  4HM5 A;  2ZYL A;  2ZT9 D;  1NDO A;  4U3F E;  4QDD A;  2YFI A;  3FOU A;  1O7G A;  3BCC E;  4PV1 D;  1SQX E;  1KYO E;  2DE7 D;  5KLI C;  2HML A;  2NVF A;  4H13 D;  4OGQ D;  2NUK A;  2QJY C;  4HM3 A;  4HM1 A;  2DE6 D;  3VCA A;  2Q3W A;  3H1H E;  4NBG D;  1SQP E;  3H1L E;  1NTZ E; 
#chains in the Genus database with same CATH topology
 3L75 G;  1KOR A;  1M1J B;  1ZR4 A;  3H1H D;  2NPS B;  1JY3 P;  4ASW A;  1J2J B;  1HGV A;  1QL1 A;  1KQG B;  2XZR A;  2OYI A;  2ZYD A;  3H6P A;  1JY2 N;  4WY4 C;  4D6T E;  4RO0 A;  1KIL D;  1Z56 A;  3KQG A;  1YQ3 C;  2XDJ A;  1RFS A;  1WQL A;  4H0L B;  4NBB D;  1O7P A;  2K37 A;  2IBZ D;  3OJA B;  2DW3 A;  4HJL A;  1MZ9 A;  2J59 M;  1VQ6 P;  1SQB G;  3WU2 H;  4C46 A;  2W90 A;  3H1J J;  1OVV A;  1ULI A;  1BCC J;  3GZY A;  1GL2 D;  5KJ7 A;  2M3B A;  5E79 E;  1Q82 Q;  1FZB A;  1S5L H;  3VP8 A;  4TLF A;  2A06 E;  1M90 Q;  3AE9 C;  1AVY A;  1KQL A;  3IN6 A;  3LIE A;  4H44 B;  1N7S C;  1HGZ A;  1KYO D;  5AVQ B;  2DE5 D;  2PAJ A;  2A45 G;  2QJP C;  4QDC A;  3G71 P;  1ZRT E;  1X9V A;  2AEM A;  1FZC B;  4OWF A;  4K35 A;  1S5L X;  3BCC J;  2MJZ A;  2P2U A;  5K5G B;  2WSC J;  4U3F J;  2XKM A;  2Q3I A;  2KP8 A;  3U1A A;  1LT9 A;  3F89 A;  3FXD A;  2WSC H;  4PV1 D;  2YKP A;  4KJM A;  2NUK A;  2DE6 D;  1SQP E;  2E76 C;  1HJ0 A;  2OYI C;  4WB4 A;  3GZX A;  1FE6 A;  2Z5H A;  2PGD A;  1GU5 A;  2Q7C A;  2JEE A;  3U59 A;  3L73 G;  1RHZ B;  2R32 A;  2FBW C;  1OIP A;  1UII A;  1BE3 D;  1KFN A;  2V7Q J;  3D71 A;  1FS0 E;  2R5B A;  4L74 A;  2BCC E;  3CX5 H;  1PGJ A;  2UWJ E;  1IK7 A;  4HJG H;  2V7Q H;  4WY4 B;  3GHG C;  5AEW A;  1EZV I;  1NTM E;  3L4F A;  3HUS A;  1JUN A;  5KLV D;  3RL0 D;  1LWU A;  1NGM B;  3HTK A;  1KIL B;  1SQX G;  3H1I E;  1NAY A;  1O7W A;  2ZXE B;  1NWQ A;  1MV8 A;  4GDO A;  1WMK A;  2QJK B;  2WPR A;  2P67 A;  5AVR B;  1GL2 C;  3EQQ A;  3E1I A;  4HM7 A;  1NJI Q;  2O01 H;  3CCS P;  3CXH E;  4KHX A;  1BGY E;  3GCE A;  2QJK C;  4DJG A;  1GL2 B;  1FZC A;  1RF1 A;  2I7F A;  3MHV A;  5KLI B;  4W7Y A;  4I6M C;  1H89 A;  4L73 A;  1S4X A;  1PFI A;  2W6J H;  1DD3 A;  4IFM A;  5CHX A;  4NBG D;  1Q81 Q;  1H0T B;  2AXT E;  3FX0 A;  2JJL A;  2J5U A;  3RK3 D;  4B86 A;  5CCH C;  1NTZ G;  2KOG A;  3L70 D;  1FQT A;  1VQO P;  1PL5 A;  3UIA A;  1NU1 G;  2B24 A;  1ZME C;  1BE3 J;  4EYY Q;  3H1K G;  3M9H A;  4EOT A;  2NVG A;  1O7M A;  3L36 A;  1UIX A;  4IL6 X;  3L37 A;  2IBZ I;  2GBX A;  4L75 A;  4Y99 C;  1FC2 C;  4NBF D;  2A06 D;  3KZI E;  4YXD C;  1OVR A;  1SQX K;  1X8Y A;  1VQM P;  1JMM A;  3TF5 A;  5APY A;  4PD4 E;  2K3R A;  3L75 E;  2WSS H;  2R3C A;  3FGA D;  3L74 E;  4YPC A;  3Q1M A;  1SJG A;  1T3U A;  1VQN P;  5L8R J;  2XR8 A;  2XRX A;  4QCK A;  5APS A;  3F5H A;  2A45 H;  3CPW O;  4H13 B;  4OGQ B;  2FXO A;  4OVN F;  4H0L D;  2AEF A;  1SQP D;  1AFO A;  5B5E E;  3ZDM A;  1VQ9 P;  1Q86 Q;  3FOU A;  3S1K A;  1LTJ A;  4BRY B;  1QL2 A;  2XNX A;  5APX A;  2YMK A;  1ZP0 C;  4H13 D;  4OGQ D;  3JCU E;  5APV A;  3S4R A;  3H1H E;  1N86 A;  2JZA A;  2BCC D;  1LTG C;  3OW2 O;  2BMR A;  4NPE A;  2QPZ A;  2IZ0 A;  4AIV A;  1NTM D;  3MZW B;  2BCC G;  2ITA A;  1N73 A;  1FDI A;  1LGH B;  1SQQ E;  2BMQ A;  3CXH D;  1VQP P;  2E4P A;  1RE3 C;  2HOD B;  5DJT B;  1PP9 D;  3BRV B;  3MP7 B;  3L71 J;  4GOE A;  3LW5 H;  2IDB A;  4NBH D;  3LID A;  3AED C;  1HTL C;  1SQQ J;  2B87 A;  1SFC D;  3SWY A;  1KN7 A;  2FXM A;  2W27 A;  2M3E A;  2JKV A;  4GT1 A;  4WY4 A;  3KZI H;  1JTH B;  1RE4 C;  1EDL A;  1R5L A;  2C0X A;  2E74 C;  2KIK A;  3BVH A;  4ZKP A;  3RK3 E;  2H88 C;  1HF9 A;  2WPV B;  1G2C B;  3H1H J;  3D70 A;  5CBO A;  2NWF A;  1NTZ K;  3TSI A;  3AE6 C;  2KS1 A;  2OYH C;  2YFI A;  2PRR A;  3CLQ A;  2YXQ B;  3HE4 A;  3L71 G;  1YJW P;  2FFD C;  2G3A A;  1SQP G;  2YKQ A;  2HML A;  4HM3 A;  3H32 A;  1RF1 B;  3CC2 P;  1ZV8 A;  2YNY A;  2KI7 B;  2N1T C;  3L75 J;  5BVZ A;  1DD4 A;  3B5N B;  3HUS B;  3DQY A;  1N73 B;  2KZI A;  3A0H H;  4NBE D;  4HM2 A;  3AE8 C;  2B88 A;  3E7K A;  3M0D A;  3WUV A;  3B4S A;  1SQB D;  5KLV G;  4HM0 A;  1VQ5 P;  3TGU J;  5KKZ B;  3HD7 B;  4AAY B;  2Z5I A;  1LTJ C;  1R8E A;  4LLH A;  2NVE A;  1VQ8 P;  2XSO A;  1LTA C;  4RJT A;  1EDK A;  4UB6 E;  3WMM 0;  1LTJ B;  4BRY A;  2Z4E A;  3V2N A;  5GTH H;  1BE3 E;  1VF5 C;  2YFJ A;  4JQ0 D;  1KC8 Q;  3VP9 A;  3A7O A;  2ZVO B;  3MUD A;  3CXH I;  2YO2 A;  1GU4 A;  2OAR A;  2H7H A;  4HH2 A;  5AVY B;  1K05 A;  5KLV E;  1Q7Y Q;  1FBM A;  2WTY A;  2RKL A;  5KAF E;  2IBZ E;  2GBW A;  2FYU E;  1LTI C;  3A0B E;  2YIU B;  2D2C C;  1LP1 A;  2XU6 A;  4QMA A;  3N7N A;  5AVU B;  3T97 A;  1IFJ A;  2OYI B;  3C1L A;  1GK6 A;  1N2D C;  2XND H;  4L76 A;  3BAT A;  2J58 A;  2KXP B;  2Y9Y A;  3V2Q A;  3IFM A;  3NXS A;  1P84 I;  1NTZ E;  1K04 A;  1OWA A;  3CCR P;  2OTJ P;  3CWB G;  1OW8 A;  1Q90 D;  3RGU A;  3GOB A;  3BAS A;  4P1B H;  1H88 A;  3SFD C;  1M8O B;  3VMX A;  3GTE A;  5TIS E;  2IYO A;  2N1T A;  3M06 A;  3VCP A;  1PGP A;  2Q6Q A;  1MFT A;  3AE2 C;  1NVO A;  5AW4 B;  2M5A B;  4Y99 B;  1FZF A;  2LXB A;  4PV1 C;  2HMJ A;  5HL4 A;  4QUQ A;  1T6A A;  4JBZ A;  3L72 J;  4PD4 D;  3HD7 D;  1MKM A;  5AVZ B;  2C9L Y;  1SQV J;  2HOD A;  3L74 G;  3RK2 C;  3OAK A;  2ZVN B;  1L0L G;  2P10 A;  3WUT A;  3GW6 A;  1U7M A;  3A2A A;  2QIW A;  2SPZ A;  4AYC A;  2HYN A;  5KAI H;  2H8P D;  3P7K A;  3FWN A;  1IC2 A;  1FAV A;  2BEQ D;  3L75 D;  2CPS A;  1M7L A;  2GUS A;  1OFC X;  2N9Y B;  3I56 P;  3AEE C;  1O7N A;  3C8V A;  4LGD E;  2KS1 B;  4ZMD A;  1L4A D;  1JB0 J;  1OMI A;  4QDD A;  1SFC B;  1USE A;  1FJK A;  1SQX E;  2PP6 A;  2P58 A;  1X22 A;  2I1J A;  2JP3 A;  2OTL P;  1IFN A;  1U7J A;  4GOD A;  4U3F D;  2K1A A;  3M9Q A;  4LC1 A;  4N78 E;  2KSE A;  1NHL A;  2WZ7 A;  2FXP A;  3O6Q A;  2H89 C;  1YTZ T;  2C0W A;  5B66 H;  2JWA A;  4NB9 D;  2IZ1 A;  3H1J E;  1VDF A;  1LT1 A;  2HMO A;  1OW6 A;  2WIT A;  1LTB C;  3GHG A;  2A45 I;  1KB9 H;  1L0N E;  2AEJ A;  1NTK E;  1VL2 A;  4UB6 H;  2O01 J;  2KNC B;  3CX5 I;  2OGU A;  1YYC A;  3H1H G;  4D6T J;  1NH4 A;  3BCC G;  5AW8 B;  3CI9 A;  1OW7 A;  4PJ0 H;  3L73 J;  1GDT A;  3MTU E;  3L70 E;  4QUR A;  2W6B A;  3Q5R A;  2ZFC A;  3OA7 A;  1SQV G;  3Q5S A;  1FOS F;  1PP9 E;  2MKV A;  1GK4 A;  3CCM P;  2AXC A;  1DX7 A;  2O3J A;  4GOF A;  1KIL A;  4QUP A;  3A3Y B;  1GMJ A;  1YJN P;  2Y0C A;  3I5C A;  4TT3 H;  1LWU B;  1NKZ B;  3PJS K;  1S5L E;  1J1D B;  2K9J B;  4M3L A;  5AW2 B;  3VMZ A;  1LP1 B;  3M0A A;  5BU8 B;  1J1E C;  2DE7 D;  1AQ5 A;  5GTI H;  3VCA A;  1J1D C;  4JPZ B;  3RL0 g;  2P7J A;  3B8E B;  1IFP A;  1N73 C;  2LR2 A;  2ZYG A;  5AVV B;  4H44 D;  1AA0 A;  2WSE J;  1FZA A;  2NPS A;  1W2B O;  3P8C D;  2O1K A;  2HPC A;  1DEE G;  2VRS A;  2A06 G;  3HTK B;  3PTZ A;  1JM1 A;  3A0H E;  4DT0 A;  2QA4 P;  3HE5 B;  1M1K Q;  3AE1 C;  3AE7 C;  1D7M A;  2GA1 A;  2Q3E A;  2IBZ G;  3R4Y A;  2FY8 A;  1SQV D;  1NTK G;  1SFC A;  1T2K D;  1FDM A;  2WVR A;  2IPP A;  3P8M C;  1URQ A;  1ZN5 A;  5CBN A;  1ZR2 A;  4R4M A;  4RKU J;  3CME P;  1SQB E;  4XA4 A;  1EG9 A;  4CPG A;  3KHU A;  1N7S B;  3CCE P;  1QLE D;  3W68 A;  1IJD B;  2RN0 A;  1DEB A;  3CCL P;  1LTT C;  2D2C B;  1BSN A;  2HMK A;  1URQ C;  3AE5 C;  3TYY A;  2KNC A;  3PHL A;  2ZYA A;  2FYU D;  1Q2N A;  1NTM G;  1RH5 B;  1JOC A;  1CI6 A;  1W5C E;  3H1L E;  2OYH B;  1OVU A;  3V5B A;  1PP9 J;  4NBD D;  1NU1 E;  1OZH A;  4H0L C;  2B1X A;  2YO3 A;  2M0B A;  3L70 J;  5BOK A;  3L73 E;  1LNQ A;  3PP5 A;  1CI6 B;  2KYV A;  1VM9 A;  3B71 A;  1PPJ E;  3GG2 A;  2OYH A;  4HB1 A;  4DZO A;  1NTK J;  1L0N J;  5AW9 B;  2YMY A;  4NB8 D;  2GUV A;  5CCG C;  3RBX A;  1IZN B;  1P84 D;  1SQP K;  2KB7 P;  2QRX A;  3CCV P;  1N7S D;  3CCQ P;  1KFM A;  2QJP B;  2IFN A;  4PD4 I;  2QM7 A;  4JF7 A;  4NBC D;  5KJ7 C;  5H2F H;  4N6J A;  2B89 A;  3H25 A;  4XFJ A;  2PFX A;  1WT6 A;  1VF5 D;  2POH A;  3GLM A;  1SQX J;  1SQX D;  1S9K E;  3V2P A;  1VQ7 P;  1QX8 A;  4HM5 A;  1JY3 N;  5TJH A;  2E76 B;  1YQ4 C;  2KUB A;  4Z1M H;  3TDK A;  5AVT B;  1KYO E;  4U3F G;  1Y9B A;  2K9J A;  5CJ0 A;  3AEF C;  2IFM A;  4U7J A;  2E4Q A;  3TNU B;  3BRT B;  3VMG D;  1SQV E;  1KD1 Q;  2N1T B;  4I1L A;  1IFD A;  5M1B A;  5DJU B;  1Y8A A;  5AVS B;  3L72 E;  1A02 J;  1YHQ P;  3EWK A;  1KQF B;  3H1J D;  1S2E A;  1T3J A;  1SP4 A;  1DIP A;  1RF0 C;  1FZE A;  1L0L D;  3HD7 C;  4N78 D;  2HG5 D;  2WSF J;  3E1R A;  2JO6 A;  2JO1 A;  1CZQ A;  2YKO A;  2ZT9 B;  2ZJS E;  2P1J A;  2YFL A;  1K9M Q;  2BMO A;  5TIS H;  1GTW A;  4NPD A;  3C0D A;  3GL0 A;  1SVF A;  2KLU A;  3KDP B;  1NTZ J;  3AEG C;  1VQK P;  2W6A A;  1L0N G;  1BGY G;  2OQQ A;  2YXR B;  4EDF A;  1UUW A;  1LT9 C;  2QM8 A;  1KYO H;  1JNM A;  4C7N B;  1BGY D;  1O7G A;  4ZKU A;  5KLV K;  1L0L K;  1JCC A;  2FYU J;  2I1K A;  1YIT P;  1EXJ A;  2B9B A;  1M57 D;  5KLV J;  3HE5 A;  5KAF H;  4RES B;  1ZRT D;  1Y47 A;  5AW6 B;  3CX5 E;  1BDC A;  1PPJ D;  3VMI D;  1LJ2 A;  4HM6 A;  1Q90 C;  1VQ4 P;  1M1J A;  4GIF A;  5AW7 B;  2FYU K;  2RH0 A;  2Y0D A;  1RQU A;  3GB4 A;  3WU2 E;  1EZV G;  3SSU A;  1ULJ A;  3P32 A;  2LXC B;  1O7H A;  4XE5 B;  2FYN C;  1KQS O;  3TGU E;  2R3S A;  1EZV D;  2WT7 A;  1A02 F;  3VMA A;  3NFQ A;  1YJ9 P;  3VTP C;  2B87 B;  2HMM A;  3BCC D;  1BSH A;  1OX3 A;  5CCG A;  1EC5 A;  3LW5 J;  4EI2 A;  2O01 N;  3Q5P A;  1HWT C;  1SQV K;  3V2R A;  1KTM A;  3H1I D;  4JYC A;  1RIE A;  5AEU A;  3SWF A;  4IOI H;  3G4S P;  4N3Y B;  1NDO A;  4R4L A;  3IF4 A;  1LWU C;  3H1K J;  1RY3 A;  4HM1 A;  2Q3W A;  4JYB A;  2E75 B;  4AQR D;  3JSV C;  3GF3 A;  2CPB A;  1P84 H;  2QJY B;  3G6E P;  1SQQ D;  1J1E B;  1R5S A;  3CWB J;  4IL6 H;  3L73 D;  1L4A B;  2C9N Y;  4QDF A;  1HBW A;  1VCK A;  3ITK A;  4YXW H;  1L0L E;  2Q1K A;  2WSE H;  2O1J A;  2NPS D;  3QWO C;  5C39 A;  3IR9 A;  1BCC D;  1PGQ A;  3TNU A;  3RK2 D;  1IK9 A;  4D6T G;  2R5D A;  2OYO A;  3L71 E;  4OH8 B;  5KTB A;  2JWD A;  2ZXX A;  4EIJ A;  2QSI A;  2FYN B;  5CJ4 A;  1FJP A;  4IFD K;  3Q3D A;  1IO4 A;  2E74 B;  1YIJ P;  2D2C D;  1EXI A;  3M0D C;  1L0L J;  1ZOY C;  1PP9 G;  2LKM A;  1AQT A;  3PLN A;  4EMJ B;  1P84 E;  2L91 A;  3CWB E;  3RK3 B;  1E79 H;  3QH9 A;  3O8Z A;  4IL6 E;  1SS1 A;  2ZAE B;  1NTK K;  2YIU C;  3B5N A;  2I8D A;  3CX5 D;  2K9Y A;  3H32 B;  1MFZ A;  2GM4 A;  3H1K E;  2WPS A;  5CMZ A;  1SQQ G;  3U1C A;  5B66 E;  1EQ7 A;  2JDI H;  3A5T A;  1QGK B;  4C7N A;  1M1J C;  3EFG A;  3H1I G;  1DH3 A;  3R2P A;  1X79 B;  2CK3 H;  4W80 A;  3NTN A;  3B5N C;  1EDJ A;  4BWN A;  2E5T A;  4W7Z A;  1G1J A;  3L74 J;  3L72 D;  3D6Z A;  2QEX P;  3AZC A;  5CCH A;  4HYT B;  1URQ D;  5EFW B;  1JM0 A;  4WWI A;  4PD4 H;  1BDD A;  1QVF O;  3TK1 A;  3RBZ A;  3KYQ A;  3GHG B;  4I2L C;  3V6I A;  1H8A A;  2WQY C;  4MN4 C;  1KB9 I;  3HUS C;  1QVG O;  3JC2 2;  2HPC B;  2Y0E A;  2ZT9 C;  3T97 B;  5GTI E;  1BE3 G;  5AVW B;  4ZNC A;  5KKZ C;  5KJ7 D;  4I7Z C;  1KB9 E;  2N9B A;  1NU1 D;  3RK2 B;  1SLQ A;  2HFE D;  2QE7 H;  2KK7 A;  3USS A;  1GL2 A;  3H1J G;  3PH0 A;  1HVV A;  1T8Z A;  4KT0 J;  1USD A;  2W83 C;  3WUU A;  3N0Q A;  2E43 A;  2QG4 A;  1MUU A;  1NYH A;  2AXT H;  1GW3 A;  5APW A;  3SFE C;  3SWK A;  1SFC C;  1L0N K;  2ZT9 D;  3CL3 D;  2RMZ A;  1FZG A;  1NOH A;  3CC7 P;  3L71 D;  1EDI A;  1KIL E;  3MUD C;  3EFF K;  1N7L A;  3C9I A;  1BGY J;  3GL2 A;  1KMI Z;  3L70 G;  4NBA D;  2QVA A;  3CXH H;  1YI2 P;  1T2K C;  3D89 A;  2K88 A;  3CC4 P;  3HRN A;  3Q2Y A;  1L2P A;  3H1I J;  1VPC A;  3VYI A;  1FOS E;  2E5Y A;  1NTM J;  4D6T D;  1N7S A;  4UB8 H;  4HM4 A;  2BCC J;  4ASV A;  2WSF H;  1AVO A;  3L35 A;  3G9R A;  4PV1 B;  2YVJ B;  2M5A A;  3M91 A;  1G8J B;  3H1L G;  2HR3 A;  1QEX A;  1NU1 K;  1YBK A;  3MD0 A;  4HM8 A;  3MIW A;  1VF5 B;  1KIL C;  2NZ2 A;  3V4Q A;  1RE4 A;  1E5W A;  4GKG A;  1KZU B;  1PIX A;  4P1C H;  3TGU D;  1SQP J;  1EZV E;  5KAI E;  1HH0 A;  5AW3 B;  4H44 C;  1L4A A;  2WWW A;  1JTH A;  1CW5 A;  5CCG D;  1G8K B;  4O9B A;  2W8Z A;  1RF0 A;  1FZC C;  2ZYL A;  3A0B H;  1KV4 A;  3CCJ P;  4U3F E;  4NPF X;  3CD6 P;  3CCU P;  3BCC E;  5KLI C;  3I55 P;  2QJY C;  4UB8 E;  5H2F E;  2OTK E;  2Q9I A;  1LT9 B;  5APT A;  3KPE A;  5CXM A;  1L4A C;  2N1T D;  3VN0 A;  1HJB A;  3GKE A;  2XV5 A;  1AJY A;  1PGO A;  3FWL A;  2M8R A;  1N8R Q;  2E76 D;  2FYZ A;  5GTH E;  3HE4 B;  3L72 G;  3AE4 C;  4WVZ A;  1BCC E;  3VMY A;  2IYP A;  4IFF A;  3L74 D;  1JO5 A;  1JCD A;  3EN1 A;  3IAO A;  2E74 D;  3AE3 C;  3W67 A;  1PPJ G;  2H43 A;  1NTZ D;  3PRJ A;  3D6Y A;  3HD7 A;  3GMA A;  2E75 D;  2JR8 A;  4K3A A;  1NKN A;  4Y28 J;  3ABV C;  5APQ A;  1XTC C;  3MGN A;  1L0N D;  3KXD A;  1S3J A;  4QDF B;  1M56 D;  4BXL A;  2V4H A;  1LTS C;  4H13 C;  1WRG A;  3AEC C;  1ZW0 A;  4OGQ C;  2NUM A;  1YTZ I;  4YTP C;  1NU1 J;  1JY3 O;  1AV1 A;  1BCC G;  1PZQ A;  1TU3 F;  4C7R A;  2KSJ A;  3H1L J;  3H1L D;  3RL0 B;  1GZL A;  3CWB D;  5BU5 A;  3G3Z A;  5AVX B;  1ZXG A;  2R44 A;  3GTS A;  5E79 H;  2FYU G;  1NYK A;  2HLO A;  3TGU G;  2FFD B;  3II6 A;  3RL0 C;  4WY4 D;  1JMB A;  1W2E A;  3B5N D;  5APU A;  3VOP A;  3H1K D;  2WMM A;  1KYO I;  3P8C E;  1NTM K;  1NAF A;  2NVF A;  3K5B A;  2BAS A;  4DOJ A;  1SQQ K;  2NPS C;  3JCU H;  1SQB K;  1GD2 E;  1X0T A;  1S72 P;  2FKW B;  1VQL P;  1IFI A;  1FU1 A;  2E75 C;  1SQB J;  3M9B A;  1CSB A;  2FFD A;  2KZJ A;  5AW5 B;  1NO4 A;  1JY2 O;  5AW0 B;  3V4W A;  1HUC A;  2G8Y A;  2IX7 C;  1PV3 A;  4HKZ H;  2BEZ F;  2HMN A;  1U57 A;  3AEA C;  3CMA P;  3AEB C;  2XSH A;  1RE3 A;  3S9O A;  4I7Z B;  2Q5U A;  1UUV A;  4WBA A;  1FDO A;  1S1C X;  1XTG B;  1JEK A;  3RK3 C;  5CCH D;  1GW4 A;  3VMH D;  1OXZ A;  1S9K D;  1JY2 P;  3NMD A;  4PJ0 E;  4DCK A;  2CKF A;  1K73 Q;  1KB9 D;  3FXE A;  1NTK D;  2KLV A;  1ZLL A;  4AUW A;  4A7P A;  1G2C A;  1K8A Q;  3GF7 A;  5AW1 B;  2WT7 B;  1G1I A;  2L5G B;  3O6Q B;  4HKV A;  1RF1 C;  2NRG A;  2WPQ A;  3N4X A;  1H0T A;  2E42 A;  1URQ B;  5B5E H;  3EQ2 A;  1RQV A;  2Y9Z A;  1IFM A; 
#chains in the Genus database with same CATH homology
 3GL2 A;  2E4Q A;  2JZA A;  3GZX A;  3GKE A;  4NBA D;  2BMR A;  4NBD D;  2QPZ A;  1NU1 E;  2E76 D;  3GOB A;  4QDF A;  3CX5 E;  4H44 D;  4AIV A;  3AZC A;  1FQT A;  3VMG D;  3VMI D;  1SQV E;  3D89 A;  1VCK A;  4P1B H;  3DQY A;  2B1X A;  1L0L E;  4HM6 A;  2B24 A;  1BCC E;  4NB9 D;  1Q90 C;  3GTE A;  4HM2 A;  4NBE D;  3H1J E;  5BOK A;  1JM1 A;  3L73 E;  2HMO A;  3L72 E;  3VCP A;  2NVG A;  3EN1 A;  4D6T E;  2BCC E;  1O7M A;  2E74 D;  2BMQ A;  1SQQ E;  3GB4 A;  4HM0 A;  1RFS A;  2HMN A;  1L0N E;  2E4P A;  1ULJ A;  1VM9 A;  1NTK E;  1WQL A;  4NBB D;  1O7P A;  4AAY B;  1O7H A;  5AEW A;  1PPJ E;  1NTM E;  3L71 E;  2FYN C;  2NVE A;  2XSO A;  2GBX A;  2E75 D;  2HMJ A;  2XSH A;  4NBH D;  3TGU E;  2JO6 A;  5HL4 A;  4QUQ A;  4NB8 D;  4NBF D;  1UUV A;  4HM4 A;  5CXM A;  4HJL A;  5KKZ C;  3H1I E;  1O7W A;  1KB9 E;  2D2C D;  3VMH D;  3L70 E;  1BE3 E;  4QUR A;  1ULI A;  3GZY A;  2YFL A;  4QDF B;  2YVJ B;  1SQB E;  2BMO A;  1G8J B;  2YFJ A;  2NUM A;  2CKF A;  4HM8 A;  4PD4 E;  2HMM A;  3EQQ A;  3L75 E;  1EG9 A;  3C0D A;  4EMJ B;  1P84 E;  3CWB E;  1PP9 E;  3L74 E;  4HM7 A;  1SJG A;  3GL0 A;  2A06 E;  4NBC D;  3CXH E;  2XR8 A;  1BGY E;  3GCE A;  2XRX A;  4QCK A;  2QJK C;  4QUP A;  3N0Q A;  4P1C H;  5KLV E;  2DE5 D;  2YIU C;  2HMK A;  1VF5 D;  1EZV E;  4H0L D;  2IBZ E;  2GBW A;  2QJP C;  4QDC A;  2FYU E;  4HKV A;  2I7F A;  2NWF A;  1ZRT E;  1RIE A;  5AEU A;  3GTS A;  3H1K E;  1O7N A;  1G8K B;  1UUW A;  1NYK A;  4HM5 A;  2ZYL A;  2ZT9 D;  1NDO A;  4U3F E;  4QDD A;  2YFI A;  3FOU A;  1O7G A;  3BCC E;  4PV1 D;  1SQX E;  1KYO E;  2DE7 D;  5KLI C;  2HML A;  2NVF A;  4H13 D;  4OGQ D;  2NUK A;  2QJY C;  4HM3 A;  4HM1 A;  2DE6 D;  3VCA A;  2Q3W A;  3H1H E;  4NBG D;  1SQP E;  3H1L E;  1NTZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...