3L75E

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
molecule tags Oxidoreductase
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l75E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l75E02
1PP9E 4HM8A 3GL0A 4QURA 2BMOA 1NTZE 4NBDD 2HMNA 4PV1D 3C0DA 2DE5D 2NUMA 1EZVE 5KLVE 2JO6A 4QDDA 5AEUA 2NWFA 1VM9A 4HM2A 3L71E 1SQPE 4D6TE 4U3FE 4NB9D 1L0LE 1UUWA 2QJPC 1KB9E 1EG9A 3GZXA 4HM4A 1SQQE 4HKVA 5BOKA 2IBZE 2ZT9D 2E75D 2YFIA 3CXHE 2QPZA 3GOBA 2NVFA 5CXMA 3CX5E 2NVGA 2GBXA 4NBBD 1SQVE 1O7NA 2DE7D 1BE3E 2FYNC 1FQTA 2BMRA 2XSHA 4QDFA 2HMLA 2B24A 2HMMA 3BCCE 3H1JE 3L75E 2E4QA 2XR8A 4OGQD 1O7GA 1G8KB 2E4PA 2E74D 4AAYB 3H1LE 4NBAD 4QCKA 3VMHD 4P1CH 2HMJA 2FYUE 3TGUE 3GCEA 3VMID 5AEWA 1Q90C 4HM0A 5KLIC 2E76D 2NVEA 1L0NE 2BMQA 1ULJA 4HM1A 1ULIA 3AZCA 2GBWA 4P1BH 3L74E 1VCKA 3GZYA 2NUKA 1O7PA 3H1HE 4HM7A 3VCPA 3H1KE 1SQBE 3DQYA 1BCCE 2JZAA 3GB4A 4QUPA 2XRXA 2A06E 2BCCE 1VF5D 2HMKA 2YIUC 3CWBE 3GL2A 4HM3A 2I7FA 2Q3WA 1NDOA 1G8JB 2B1XA 3D89A 4NBED 2YVJB 1KYOE 1PPJE 4H13D 4NBFD 3H1IE 4HM5A 2D2CD 3EN1A 3L70E 1P84E 2QJYC 1RIEA 4H44D 3L72E 4NBHD 1O7WA 4QUQA 1SQXE 3GKEA 4HJLA 4QDFB 2YFJA 4HM6A 3VMGD 1O7MA 5HL4A 1JM1A 4PD4E 2YFLA 4QDCA 1NYKA 4NB8D 1O7HA 4NBCD 2XSOA 3L73E 1SJGA 1NTKE 1UUVA 2ZYLA 2QJKC 4NBGD 1BGYE 2CKFA 3GTSA 1ZRTE 2DE6D 1WQLA 3N0QA 3EQQA 4AIVA 5KKZC 3VCAA 4H0LD 1NU1E 1NTME 1RFSA 2HMOA 4EMJB 3GTEA 3FOUA
chains in the Genus database with same CATH superfamily
1SFCC 3A2AA 3AE6C 1Q82Q 2ZJSE 2FXPA 3H1JG 3PRJA 2YMKA 2WPSA 3A5TA 4C7NA 5AVRB 2OYHC 1LTTC 4H13B 2CPSA 2KYVA 4IFFA 2WZ7A 5AW7B 1AFOA 1FZGA 3ITKA 1P84H 3B5NB 2FYNC 1BE3E 2E74C 2E4QA 3USSA 2W6BA 3L37A 5APXA 4M3LA 3A0BE 2ZYAA 3V2QA 5KTBA 3CMEP 1YBKA 2JJLA 3QWOC 4W80A 1NJIQ 2OTLP 1UIIA 4TT3H 2V7QH 2P1JA 2Q3EA 1SQBE 4WY4A 1J2JB 1JY3P 2Y9ZA 4B86A 2XKMA 2BASA 1U7MA 2QVAA 3CL3D 1KILD 4H13C 4YPCA 3I56P 4JYBA 1IFJA 5GTHE 1PP9G 1E79H 5CCHC 3L70J 1NYKA 1M90Q 3KZIH 4NBGD 1IO4A 1FBMA 1ZRTD 2NPSB 2BCCD 3L75J 2IPPA 1GTWA 1YJWP 1BCCJ 3E7KA 1PP9E 4HM8A 3G9RA 1RQVA 1BSNA 1VQ6P 4PV1D 5GTIE 2BEQD 2DE5D 2NUMA 3GHGA 2OYOA 3M0DA 4HJGH 4YXDC 3RK3E 3H1KG 3RK3D 4ASVA 4JPZB 4HM4A 3RBXA 1SQQE 4HKVA 2KI7B 2YXQB 1Y47A 3CXHE 3TDKA 2FYUK 1JB0J 3C9IA 4R4MA 1EDLA 4PD4I 3RK3C 1IJDB 3GMAA 1YJNP 2FYNB 5APTA 1NTMJ 4AAYB 5APYA 3L74G 1EDJA 1KORA 1M56D 1DEBA 2B88A 1EZVD 2BEZF 2O01J 1ULJA 2WVRA 2WTYA 1Y9BA 1Y8AA 1JNMA 3GZYA 5AVWB 2NZ2A 1NTZG 3MGNA 3LIDA 5E79H 1PL5A 2E5YA 1FDIA 2H88C 3S1KA 2KK7A 1N7SC 4AUWA 1FS0E 1N86A 4NBHD 4UB8H 1RF0A 4WBAA 4HJLA 2N1TD 1EXIA 3VMXA 2KIKA 1IFPA 1MKMA 3WUVA 3L70D 1LNQA 3IR9A 5B5EH 1AVYA 1ZRTE 3H1JD 3TGUD 2WITA 1L0NJ 1BGYG 2JWDA 1HGZA 1FU1A 2PFXA 4NBDD 1IK9A 4N6JA 2N1TA 4HB1A 4OH8B 1RF0C 1NU1D 2OYHA 2Q9IA 2W83C 2P58A 2QM7A 1AQTA 2NWFA 4I7ZB 2DW3A 3L71E 4RJTA 3GW6A 5K5GB 4NB9D 3C1LA 3G3ZA 2AEMA 1PFIA 5KAFE 3CCRP 2O01H 2Z5IA 3AEAC 3CI9A 2IBZE 1ZR4A 3CX5D 1EQ7A 3CX5E 2HYNA 4I1LA 2G8YA 3RK2C 2E42A 2E43A 2LXBA 5KLIC 1PGJA 4JF7A 2GBWA 4P1BH 3MIWA 4BRYB 1VCKA 2Q6QA 1G1IA 4W7ZA 5AVYB 1SQBK 1L4AC 3TYYA 3GL2A 1HGVA 4U3FJ 3D89A 4Y99B 1NVOA 1NTMK 1IFIA 3HUSC 1GL2B 3OW2O 3M06A 4IOIH 4D6TD 4QDFB 5AVZB 5AVVB 1R8EA 5AVUB 1M1JB 2OARA 3CCLP 3M0AA 4H0LD 5KAIH 2HMOA 4EMJB 3GTEA 1L0ND 3CWBD 3GL0A 2KUBA 1KMIZ 1N2DC 3T97B 4QDDA 5AEUA 2H8PD 5APUA 1RHZB 3CCMP 1SVFA 3OAKA 3AEDC 1BDCA 3U1AA 2NPSD 4WY4C 1ZP0C 2ZVNB 2DE7D 2FFDA 1HVVA 5CCHA 2A06G 1OIPA 2Q7CA 1H89A 1BGYJ 5EFWB 4A7PA 4P1CH 3EQ2A 3TGUE 3V6IA 1NTKJ 4H44B 1JMBA 1SQPD 4DZOA 1KYOH 1VDFA 4ZMDA 2KZIA 4MN4C 3VCPA 1S5LX 1VQLP 1VF5D 1GL2D 4DT0A 2HMKA 1HH0A 1G8JB 3KYQA 3GF3A 2W27A 1S9KD 2LXCB 3L70G 3HD7B 2B9BA 4HM6A 3F5HA 1WRGA 3LIEA 1LTBC 5APSA 2Y0CA 4QDCA 1H0TA 1O7HA 3KPEA 2ZXXA 4WWIA 1USEA 3AE1C 3EFFK 3M9QA 1YQ3C 3TSIA 3NTNA 1VQ9P 5KJ7D 2W8ZA 1NU1G 2OYIA 1NTME 1RFSA 1AA0A 3SFDC 3H1LG 3L74J 3O6QB 1OW8A 5E79E 1LT9B 1KILB 1SQQJ 2YO2A 3WU2E 2KZJA 4D6TJ 1LT9A 3K5BA 4IFDK 2FYUG 4JBZA 3L72J 1SQBD 2OGUA 2PP6A 3PTZA 5DJUB 3CXHH 3W67A 1FOSF 2QPZA 1XTCC 1K05A 2NVGA 4NPEA 3CC4P 1Q2NA 5GTHH 1SQVK 3SWYA 4QCKA 1H0TB 2JKVA 2M0BA 5KLIB 1N7SD 5CCGA 1ZXGA 2QEXP 3CCEP 1Q86Q 1SQPJ 1W2BO 2NUKA 5BU5A 3BRVB 4HYTB 2JDIH 5KLVG 3L71D 2A06E 2BCCE 1N7SB 2IX7C 1LWUC 3Q5RA 1NKNA 3L71J 1A02F 2B87B 3A3YB 1FJKA 3KXDA 2GUVA 1YITP 3AEFC 1HBWA 1NTKE 2GA1A 3M9BA 1NTKD 3U59A 3CWBG 4IFMA 2FFDB 1FDMA 2B89A 1K8AQ 1E5WA 4QURA 2ZAEB 1Q7YQ 5KJ7C 3N4XA 5AW5B 2JO6A 3BRTB 1OW7A 4IL6H 4HM2A 2UWJE 1WMKA 1JTHA 1PPJG 1W2EA 1KB9E 4LC1A 2XNDH 5GTIH 3T97A 2QA4P 2YKOA 1LT1A 1X8YA 2ZT9D 4U3FG 3AE5C 2JO1A 5CXMA 5AW0B 1UIXA 1O7NA 1K73Q 2WSEJ 3V2NA 1IK7A 2FBWC 4UB8E 5APVA 4OGQD 1J1DC 1SQPG 2FYUE 1GW3A 1M1JA 1M7LA 3VMID 2MJZA 1L0NE 1OVUA 3L35A 1QL1A 4KHXA 1FJPA 4DJGA 3A7OA 2WSEH 2O1KA 5L8RJ 4GODA 3RL0C 1YYCA 3MUDC 1M57D 3CCJP 2XRXA 1ZR2A 1LP1B 1G2CA 4NBED 2WT7B 1O7WA 5TISE 3NXSA 2OYIB 5KAFH 1DD3A 2J5UA 2IYPA 2OYHB 3GHGB 3H1LD 3IFMA 4N78E 3H32A 2QE7H 2WSSH 5CHXA 2IFNA 1IC2A 3FWLA 3H1KJ 1X0TA 1T2KC 1DEEG 1FZBA 4Y28J 1NGMB 2P2UA 1HUCA 3MP7B 1EZVE 2RKLA 3PHLA 3H1KD 1SQBG 2OTKE 1L4AD 2AEJA 1S9KE 2Q3IA 3RBZA 2N1TB 4WB4A 3E1IA 3P8MC 2YFIA 2WWWA 1PZQA 1RQUA 3JCUH 4NBBD 1FQTA 2A45H 2B24A 3GF7A 1S72P 5CCGC 1KQSO 4XFJA 3CWBJ 2V7QJ 1YIJP 1HWTC 3A0HH 1GU5A 2JZAA 4L74A 4HH2A 1KB9D 3RK2D 1FZAA 1MFZA 4QUQA 4AQRD 3GKEA 5AW4B 1O7MA 1CW5A 4PD4D 1BGYD 1UUVA 2QJKC 1BGYE 1GU4A 1IFDA 1LTJB 4OGQC 1DH3A 2C0XA 5C39A 2OTJP 1PPJD 2R3CA 1URQB 3P32A 1YQ4C 3M9HA 3A0HE 1ZOYC 1RF1C 1SQPE 3Q3DA 2B87A 1KZUB 1R5LA 1HJ0A 3AECC 3NFQA 3F89A 2JEEA 2N1TC 3GOBA 4U7JA 2R44A 3KHUA 5AW9B 2BMRA 3D6ZA 3P7KA 1G8KB 3H1LE 2HMJA 3AE2C 4GIFA 3H6PA 3MZWB 1GMJA 4RESB 5KKZB 2M5AA 3CCVP 1X22A 1OVVA 1VQMP 2NPSA 1KV4A 1VF5C 1M1JC 3CWBE 4D6TG 3PLNA 5CJ4A 1RE4A 1KYOE 2D2CD 4PV1C 3EN1A 1KN7A 4YTPC 1AV1A 2E75C 4ZKUA 3ZDMA 1KILA 2HFED 1M8OB 2R5BA 3VMGD 3CC7P 4PD4E 3VMAA 1VQKP 5KLVK 1NTZK 5AVXB 3VYIA 1LJ2A 1Z56A 2QSIA 3GG2A 2WSCH 5B66E 1AQ5A 5AVQB 1U57A 4Y99C 2FYUJ 3A0BH 2R3SA 2BMOA 1N7LA 3MD0A 1L0LJ 2WQYC 1Q90D 1R5SA 4R4LA 3FX0A 1JO5A 1JY2P 5DJTB 1NO4A 3VN0A 4H0LC 1JTHB 2A06D 3AEBC 1NOHA 3BASA 1SQPK 3II6A 1QGKB 1BE3G 1OXZA 2K88A 2MKVA 4N78D 3B71A 1IFMA 3AE4C 3CLQA 4GOFA 3D70A 3H1LJ 2R5DA 2YXRB 5CMZA 3H1KE 5CBOA 1WT6A 4EIJA 1SFCD 3MTUE 2I7FA 1KYOD 1S4XA 2D2CC 4XE5B 3D71A 2HPCA 3B4SA 1S3JA 1BSHA 4GOEA 1LP1A 3CX5I 1L0LG 1N7SA 1LTGC 5CCGD 1KB9H 1JM1A 1BE3J 4H44C 4NBCD 4QMAA 1CI6B 5KJ7A 1OW6A 3CX5H 2ZVOB 2DE6D 1FOSE 4AIVA 5TJHA 2RH0A 5AW2B 4PD4H 1OVRA 1RY3A 1NYHA 2O1JA 1FC2C 4I6MC 3FOUA 1KQLA 1JOCA 1VQ7P 2OQQA 3VMZA 2FYUD 1YTZI 2K9JB 3IAOA 4UB6H 1KD1Q 3G71P 2NPSC 2RN0A 3IN6A 1L0LE 1OWAA 4WY4B 1SQXG 3LW5H 1VQPP 3L72D 1K04A 4PJ0E 2HPCB 2WPRA 1JY3N 2XV5A 3BCCE 1O7GA 2G3AA 1RE3A 3GHGC 2M3BA 4JYCA 3B5NA 3TGUJ 5BVZA 1TU3F 2AXTE 5KLVD 3L71G 1H8AA 1BCCD 2AXTH 1Q81Q 4WY4D 2ZYGA 1RH5B 1VQNP 3L73G 2WSFJ 1PV3A 3RL0D 1BDDA 1PIXA 1FZCA 2OYIC 2K3RA 3KDPB 3H1IE 4C7RA 4DCKA 3HD7C 4H44D 2KS1B 2CK3H 1M1KQ 3TNUA 1NAFA 3E1RA 2KB7P 4XA4A 1ZMEC 3PJSK 3P8CE 3L73E 3VMYA 1ZN5A 1EC5A 2CKFA 2Y0DA 1VQ5P 1EDIA 1ZW0A 2PAJA 3N0QA 3H1IG 3FXEA 2QJYB 2QM8A 2AEFA 2ITAA 2SPZA 2C9LY 1VQOP 1SFCB 1KFNA 3Q5SA 3AE3C 4AYCA 1JCDA 2AXCA 2L5GB 2RMZA 4U3FD 3Q1MA 4U3FE 2FXMA 1EG9A 1YI2P 3R2PA 1BE3D 2QIWA 4UB6E 2IBZG 2IBZI 3VTPC 5B5EE 4BWNA 1LTSC 4QDFA 1U7JA 4GKGA 3B5NC 1T2KD 3L4FA 2E4PA 1LWUB 3EFGA 1HTLC 3TK1A 5CCHD 1QX8A 2VRSA 1L4AA 3FWNA 3BCCJ 1FE6A 1FZCC 3L36A 1CI6A 3CD6P 1KTMA 5CJ0A 1X9VA 3H1HE 3DQYA 4BRYA 1URQC 1NWQA 2E5TA 1NTZJ 1H88A 1J1EC 1L0LD 1SQVD 1RIEA 4GDOA 3D6YA 1L0LK 3H1IJ 2L91A 1SQVJ 2YFLA 1YHQP 2XSOA 1SJGA 3I5CA 2ZYLA 2I1JA 2IZ0A 3MHVA 2WMMA 1ZV8A 3L73J 5CBNA 1FAVA 2LR2A 5AVTB 2HR3A 1A02J 2C9NY 1SQXD 3CPWO 2M8RA 2ZT9C 3TNUB 2KS1A 3L72G 4BXLA 2P10A 3G6EP 2HODB 1T6AA 3R4YA 2KXPB 5AW1B 5BU8B 1NHLA 3WUUA 1RE3C 3RGUA 1OFCX 3SFEC 1LTIC 2YIUB 1LT9C 2HG5D 3AE7C 4TLFA 2Y0EA 2Y9YA 3WMM0 1LTJC 1N73B 4W7YA 1W5CE 5AEWA 1VF5B 3HE5A 1IZNB 1JY2N 4KJMA 3I55P 1RE4C 4C7NB 2M3EA 1ULIA 3H1HD 1EXJA 1DX7A 1PGQA 3VP9A 1RF1B 3CCSP 3GB4A 1KFMA 1T8ZA 1EZVI 1AVOA 2Q3WA 1NDOA 2J58A 3AEEC 2KNCA 4NBFD 1PPJE 4H13D 1J1DB 1P84E 2E76C 3NMDA 3L72E 3IF4A 3WU2H 3CXHI 2CPBA 1S5LH 4KT0J 1EDKA 2YMYA 3H1ID 2K1AA 3OJAB 1YJ9P 4RKUJ 4Z1MH 1KILC 5KKZC 2FKWB 1URQD 3CCQP 3Q2YA 1NU1E 3AE9C 2GUSA 3CCUP 4LLHA 1NTZE 2Z4EA 1IFNA 3C0DA 3BCCG 1T3JA 1XTGB 2BCCG 1T3UA 5KLVJ 4EDFA 4H0LB 3H32B 3KZIE 1KILE 2ZFCA 1SQXJ 2IBZD 1QLED 1JEKA 3CMAP 1VPCA 4O9BA 1JUNA 4L76A 1FZEA 3S9OA 1URQA 5M1BA 2I1KA 1JCCA 2XDJA 1SS1A 1QVGO 4NPFX 2HMLA 3RK2B 3KQGA 4HKZH 2E74D 3C8VA 1VL2A 2IZ1A 3VMHD 5AW3B 3O6QA 1S2EA 3L75G 2FYZA 3AZCA 3HE5B 2POHA 3L74E 1JY2O 3L74D 2O01N 1SQVG 2NRGA 3AE8C 3H1HJ 4NPDA 2ZYDA 2FXOA 1LWUA 1VQ8P 1EZVG 2A45I 2YO3A 2KNCB 1GZLA 2R32A 3RL0g 1JY3O 1SQQD 1J1EB 1D7MA 1LGHB 3VP8A 2H43A 2YVJB 2H7HA 4HM5A 1RF1A 1SQXK 1L0NK 1DIPA 2FFDC 4K35A 3FGAD 2HODA 2YFJA 3HUSA 5HL4A 4K3AA 1N73C 4ZNCA 3JCUE 3G4SP 2YKPA 1SFCA 3EQQA 3HUSB 4L73A 2HLOA 3HE4A 2JR8A 5APWA 2KLVA 3TGUG 2E74B 1NTKK 2BCCJ 1VM9A 3TF5A 5H2FE 3JSVC 1PGOA 1KB9I 2QJKB 2K9YA 1AJYA 3BVHA 1CSBA 5BOKA 2E75D 3WUTA 2GBXA 1OX3A 1S1CX 1NKZB 3EWKA 1GK6A 1KC8Q 4OGQB 4I2LC 4N3YB 2WPQA 1OMIA 2M5AB 3H1JE 2XNXA 3S4RA 2IFMA 3AEGC 4NBAD 3H1HG 2N9YB 4ZKPA 3GCEA 1KQGB 1MUUA 1NH4A 1GDTA 3JC22 2WSCJ 1NAYA 3W68A 1FZFA 4QUPA 2Z5HA 1PGPA 3CXHD 2KOGA 5H2FH 3Q5PA 1LTAC 2QJPB 1GK4A 2W6JH 2A45G 1L4AB 1QVFO 1G1JA 4IL6E 1LTJA 2WPVB 1NTMD 2K37A 1S5LE 3SWKA 1HF9A 3H25A 3BCCD 3VCAA 1KQFB 4PV1B 3M0DC 1CZQA 1N73A 2J59M 2KSJA 5KLVE 3FXDA 1GD2E 1L0NG 1JM0A 5TISH 4D6TE 1KYOI 3V4WA 3N7NA 4GT1A 1P84D 2P7JA 4L75A 4WVZA 1UUWA 1SLQA 2QJPC 5APQA 2JWAA 2WSFH 2PGDA 4EI2A 1SQVE 4RO0A 2XSHA 2C0WA 3L75E 2XR8A 3B5ND 1BCCG 3L75D 4LGDE 3LW5J 3L73D 1Q90C 3H1JJ 3PP5A 1ZLLA 4HM0A 2E76D 2NVEA 2XU6A 2BMQA 1USDA 2KLUA 3MUDA 1QEXA 1SQQG 1O7PA 1N8RQ 3V5BA 3CC2P 2YIUC 3HE4B 2E76B 3ABVC 2O3JA 3HTKA 3SSUA 2V4HA 1DD4A 4DOJA 4EOTA 1SQXE 2IYOA 3VOPA 1FDOA 2W6AA 2I8DA 2LKMA 1PP9D 3GTSA 2K9JA 4OWFA 3O8ZA 2KP8A 4YXWH 2D2CB 3M91A 1VQ4P 1QL2A 2YKQA 2HMNA 2KSEA 2QG4A 2JP3A 3SWFA 2WT7A 3UIAA 1SQBJ 1NU1K 4I7ZC 1GL2C 1YTZT 3GZXA 1G2CB 3OA7A 2NVFA 1GL2A 3B8EB 1HJBA 5AVSB 3HD7D 4OVNF 1L2PA 2ZXEB 2HMMA 2FY8A 3RK3B 3V4QA 2YNYA 1SP4A 2H89C 2XZRA 3GLMA 4C46A 2P67A 4JQ0D 1NU1J 4HM1A 2QRXA 4HM7A 2ZT9B 1BCCE 4EYYQ 4HM3A 3HD7A 4ASWA 1JMMA 1MZ9A 2B1XA 5AW6B 1P84I 1NTZD 3L70E 2QJYC 3HTKB 5B66H 2IDBA 3BATA 1NTMG 2Q1KA 2W90A 1X79B 3U1CA 1FZCB 4NB8D 3RL0B 3QH9A 2N9BA 3PH0A 4PJ0H 3HRNA 4IL6X 1PP9J 3V2PA 1WQLA 3V2RA 4CPGA 1SQQK 2E75B 3P8CD 2GM4A 1K9MQ 1OZHA 2Q5UA 1GW4A 5AW8B 5KAIE 1MFTA 1NTKG 2PRRA 1MV8A
chains in the Genus database with same CATH topology
1PP9E 4HM8A 3GL0A 4QURA 2BMOA 1NTZE 4NBDD 2HMNA 4PV1D 3C0DA 2DE5D 2NUMA 1EZVE 5KLVE 2JO6A 4QDDA 5AEUA 2NWFA 1VM9A 4HM2A 3L71E 1SQPE 4D6TE 4U3FE 4NB9D 1L0LE 1UUWA 2QJPC 1KB9E 1EG9A 3GZXA 4HM4A 1SQQE 4HKVA 5BOKA 2IBZE 2ZT9D 2E75D 2YFIA 3CXHE 2QPZA 3GOBA 2NVFA 5CXMA 3CX5E 2NVGA 2GBXA 4NBBD 1SQVE 1O7NA 2DE7D 1BE3E 2FYNC 1FQTA 2BMRA 2XSHA 4QDFA 2HMLA 2B24A 2HMMA 3BCCE 3H1JE 3L75E 2E4QA 2XR8A 4OGQD 1O7GA 1G8KB 2E4PA 2E74D 4AAYB 3H1LE 4NBAD 4QCKA 3VMHD 4P1CH 2HMJA 2FYUE 3TGUE 3GCEA 3VMID 5AEWA 1Q90C 4HM0A 5KLIC 2E76D 2NVEA 1L0NE 2BMQA 1ULJA 4HM1A 1ULIA 3AZCA 2GBWA 4P1BH 3L74E 1VCKA 3GZYA 2NUKA 1O7PA 3H1HE 4HM7A 3VCPA 3H1KE 1SQBE 3DQYA 1BCCE 2JZAA 3GB4A 4QUPA 2XRXA 2A06E 2BCCE 1VF5D 2HMKA 2YIUC 3CWBE 3GL2A 4HM3A 2I7FA 2Q3WA 1NDOA 1G8JB 2B1XA 3D89A 4NBED 2YVJB 1KYOE 1PPJE 4H13D 4NBFD 3H1IE 4HM5A 2D2CD 3EN1A 3L70E 1P84E 2QJYC 1RIEA 4H44D 3L72E 4NBHD 1O7WA 4QUQA 1SQXE 3GKEA 4HJLA 4QDFB 2YFJA 4HM6A 3VMGD 1O7MA 5HL4A 1JM1A 4PD4E 2YFLA 4QDCA 1NYKA 4NB8D 1O7HA 4NBCD 2XSOA 3L73E 1SJGA 1NTKE 1UUVA 2ZYLA 2QJKC 4NBGD 1BGYE 2CKFA 3GTSA 1ZRTE 2DE6D 1WQLA 3N0QA 3EQQA 4AIVA 5KKZC 3VCAA 4H0LD 1NU1E 1NTME 1RFSA 2HMOA 4EMJB 3GTEA 3FOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 E;  4HM8 A;  3GL0 A;  4QUR A;  2BMO A;  1NTZ E;  4NBD D;  2HMN A;  4PV1 D;  3C0D A;  2DE5 D;  2NUM A;  1EZV E;  5KLV E;  2JO6 A;  4QDD A;  5AEU A;  2NWF A;  1VM9 A;  4HM2 A;  3L71 E;  1SQP E;  4D6T E;  4U3F E;  4NB9 D;  1L0L E;  1UUW A;  2QJP C;  1KB9 E;  1EG9 A;  3GZX A;  4HM4 A;  1SQQ E;  4HKV A;  5BOK A;  2IBZ E;  2ZT9 D;  2E75 D;  2YFI A;  3CXH E;  2QPZ A;  3GOB A;  2NVF A;  5CXM A;  3CX5 E;  2NVG A;  2GBX A;  4NBB D;  1SQV E;  1O7N A;  2DE7 D;  1BE3 E;  2FYN C;  1FQT A;  2BMR A;  2XSH A;  4QDF A;  2HML A;  2B24 A;  2HMM A;  3BCC E;  3H1J E;  3L75 E;  2E4Q A;  2XR8 A;  4OGQ D;  1O7G A;  1G8K B;  2E4P A;  2E74 D;  4AAY B;  3H1L E;  4NBA D;  4QCK A;  3VMH D;  4P1C H;  2HMJ A;  2FYU E;  3TGU E;  3GCE A;  3VMI D;  5AEW A;  1Q90 C;  4HM0 A;  5KLI C;  2E76 D;  2NVE A;  1L0N E;  2BMQ A;  1ULJ A;  4HM1 A;  1ULI A;  3AZC A;  2GBW A;  4P1B H;  3L74 E;  1VCK A;  3GZY A;  2NUK A;  1O7P A;  3H1H E;  4HM7 A;  3VCP A;  3H1K E;  1SQB E;  3DQY A;  1BCC E;  2JZA A;  3GB4 A;  4QUP A;  2XRX A;  2A06 E;  2BCC E;  1VF5 D;  2HMK A;  2YIU C;  3CWB E;  3GL2 A;  4HM3 A;  2I7F A;  2Q3W A;  1NDO A;  1G8J B;  2B1X A;  3D89 A;  4NBE D;  2YVJ B;  1KYO E;  1PPJ E;  4H13 D;  4NBF D;  3H1I E;  4HM5 A;  2D2C D;  3EN1 A;  3L70 E;  1P84 E;  2QJY C;  1RIE A;  4H44 D;  3L72 E;  4NBH D;  1O7W A;  4QUQ A;  1SQX E;  3GKE A;  4HJL A;  4QDF B;  2YFJ A;  4HM6 A;  3VMG D;  1O7M A;  5HL4 A;  1JM1 A;  4PD4 E;  2YFL A;  4QDC A;  1NYK A;  4NB8 D;  1O7H A;  4NBC D;  2XSO A;  3L73 E;  1SJG A;  1NTK E;  1UUV A;  2ZYL A;  2QJK C;  4NBG D;  1BGY E;  2CKF A;  3GTS A;  1ZRT E;  2DE6 D;  1WQL A;  3N0Q A;  3EQQ A;  4AIV A;  5KKZ C;  3VCA A;  4H0L D;  1NU1 E;  1NTM E;  1RFS A;  2HMO A;  4EMJ B;  3GTE A;  3FOU A; 
#chains in the Genus database with same CATH topology
 1SFC C;  3A2A A;  3AE6 C;  1Q82 Q;  2ZJS E;  2FXP A;  3H1J G;  3PRJ A;  2YMK A;  2WPS A;  3A5T A;  4C7N A;  5AVR B;  2OYH C;  1LTT C;  4H13 B;  2CPS A;  2KYV A;  4IFF A;  2WZ7 A;  5AW7 B;  1AFO A;  1FZG A;  3ITK A;  1P84 H;  3B5N B;  2FYN C;  1BE3 E;  2E74 C;  2E4Q A;  3USS A;  2W6B A;  3L37 A;  5APX A;  4M3L A;  3A0B E;  2ZYA A;  3V2Q A;  5KTB A;  3CME P;  1YBK A;  2JJL A;  3QWO C;  4W80 A;  1NJI Q;  2OTL P;  1UII A;  4TT3 H;  2V7Q H;  2P1J A;  2Q3E A;  1SQB E;  4WY4 A;  1J2J B;  1JY3 P;  2Y9Z A;  4B86 A;  2XKM A;  2BAS A;  1U7M A;  2QVA A;  3CL3 D;  1KIL D;  4H13 C;  4YPC A;  3I56 P;  4JYB A;  1IFJ A;  5GTH E;  1PP9 G;  1E79 H;  5CCH C;  3L70 J;  1NYK A;  1M90 Q;  3KZI H;  4NBG D;  1IO4 A;  1FBM A;  1ZRT D;  2NPS B;  2BCC D;  3L75 J;  2IPP A;  1GTW A;  1YJW P;  1BCC J;  3E7K A;  1PP9 E;  4HM8 A;  3G9R A;  1RQV A;  1BSN A;  1VQ6 P;  4PV1 D;  5GTI E;  2BEQ D;  2DE5 D;  2NUM A;  3GHG A;  2OYO A;  3M0D A;  4HJG H;  4YXD C;  3RK3 E;  3H1K G;  3RK3 D;  4ASV A;  4JPZ B;  4HM4 A;  3RBX A;  1SQQ E;  4HKV A;  2KI7 B;  2YXQ B;  1Y47 A;  3CXH E;  3TDK A;  2FYU K;  1JB0 J;  3C9I A;  4R4M A;  1EDL A;  4PD4 I;  3RK3 C;  1IJD B;  3GMA A;  1YJN P;  2FYN B;  5APT A;  1NTM J;  4AAY B;  5APY A;  3L74 G;  1EDJ A;  1KOR A;  1M56 D;  1DEB A;  2B88 A;  1EZV D;  2BEZ F;  2O01 J;  1ULJ A;  2WVR A;  2WTY A;  1Y9B A;  1Y8A A;  1JNM A;  3GZY A;  5AVW B;  2NZ2 A;  1NTZ G;  3MGN A;  3LID A;  5E79 H;  1PL5 A;  2E5Y A;  1FDI A;  2H88 C;  3S1K A;  2KK7 A;  1N7S C;  4AUW A;  1FS0 E;  1N86 A;  4NBH D;  4UB8 H;  1RF0 A;  4WBA A;  4HJL A;  2N1T D;  1EXI A;  3VMX A;  2KIK A;  1IFP A;  1MKM A;  3WUV A;  3L70 D;  1LNQ A;  3IR9 A;  5B5E H;  1AVY A;  1ZRT E;  3H1J D;  3TGU D;  2WIT A;  1L0N J;  1BGY G;  2JWD A;  1HGZ A;  1FU1 A;  2PFX A;  4NBD D;  1IK9 A;  4N6J A;  2N1T A;  4HB1 A;  4OH8 B;  1RF0 C;  1NU1 D;  2OYH A;  2Q9I A;  2W83 C;  2P58 A;  2QM7 A;  1AQT A;  2NWF A;  4I7Z B;  2DW3 A;  3L71 E;  4RJT A;  3GW6 A;  5K5G B;  4NB9 D;  3C1L A;  3G3Z A;  2AEM A;  1PFI A;  5KAF E;  3CCR P;  2O01 H;  2Z5I A;  3AEA C;  3CI9 A;  2IBZ E;  1ZR4 A;  3CX5 D;  1EQ7 A;  3CX5 E;  2HYN A;  4I1L A;  2G8Y A;  3RK2 C;  2E42 A;  2E43 A;  2LXB A;  5KLI C;  1PGJ A;  4JF7 A;  2GBW A;  4P1B H;  3MIW A;  4BRY B;  1VCK A;  2Q6Q A;  1G1I A;  4W7Z A;  5AVY B;  1SQB K;  1L4A C;  3TYY A;  3GL2 A;  1HGV A;  4U3F J;  3D89 A;  4Y99 B;  1NVO A;  1NTM K;  1IFI A;  3HUS C;  1GL2 B;  3OW2 O;  3M06 A;  4IOI H;  4D6T D;  4QDF B;  5AVZ B;  5AVV B;  1R8E A;  5AVU B;  1M1J B;  2OAR A;  3CCL P;  3M0A A;  4H0L D;  5KAI H;  2HMO A;  4EMJ B;  3GTE A;  1L0N D;  3CWB D;  3GL0 A;  2KUB A;  1KMI Z;  1N2D C;  3T97 B;  4QDD A;  5AEU A;  2H8P D;  5APU A;  1RHZ B;  3CCM P;  1SVF A;  3OAK A;  3AED C;  1BDC A;  3U1A A;  2NPS D;  4WY4 C;  1ZP0 C;  2ZVN B;  2DE7 D;  2FFD A;  1HVV A;  5CCH A;  2A06 G;  1OIP A;  2Q7C A;  1H89 A;  1BGY J;  5EFW B;  4A7P A;  4P1C H;  3EQ2 A;  3TGU E;  3V6I A;  1NTK J;  4H44 B;  1JMB A;  1SQP D;  4DZO A;  1KYO H;  1VDF A;  4ZMD A;  2KZI A;  4MN4 C;  3VCP A;  1S5L X;  1VQL P;  1VF5 D;  1GL2 D;  4DT0 A;  2HMK A;  1HH0 A;  1G8J B;  3KYQ A;  3GF3 A;  2W27 A;  1S9K D;  2LXC B;  3L70 G;  3HD7 B;  2B9B A;  4HM6 A;  3F5H A;  1WRG A;  3LIE A;  1LTB C;  5APS A;  2Y0C A;  4QDC A;  1H0T A;  1O7H A;  3KPE A;  2ZXX A;  4WWI A;  1USE A;  3AE1 C;  3EFF K;  3M9Q A;  1YQ3 C;  3TSI A;  3NTN A;  1VQ9 P;  5KJ7 D;  2W8Z A;  1NU1 G;  2OYI A;  1NTM E;  1RFS A;  1AA0 A;  3SFD C;  3H1L G;  3L74 J;  3O6Q B;  1OW8 A;  5E79 E;  1LT9 B;  1KIL B;  1SQQ J;  2YO2 A;  3WU2 E;  2KZJ A;  4D6T J;  1LT9 A;  3K5B A;  4IFD K;  2FYU G;  4JBZ A;  3L72 J;  1SQB D;  2OGU A;  2PP6 A;  3PTZ A;  5DJU B;  3CXH H;  3W67 A;  1FOS F;  2QPZ A;  1XTC C;  1K05 A;  2NVG A;  4NPE A;  3CC4 P;  1Q2N A;  5GTH H;  1SQV K;  3SWY A;  4QCK A;  1H0T B;  2JKV A;  2M0B A;  5KLI B;  1N7S D;  5CCG A;  1ZXG A;  2QEX P;  3CCE P;  1Q86 Q;  1SQP J;  1W2B O;  2NUK A;  5BU5 A;  3BRV B;  4HYT B;  2JDI H;  5KLV G;  3L71 D;  2A06 E;  2BCC E;  1N7S B;  2IX7 C;  1LWU C;  3Q5R A;  1NKN A;  3L71 J;  1A02 F;  2B87 B;  3A3Y B;  1FJK A;  3KXD A;  2GUV A;  1YIT P;  3AEF C;  1HBW A;  1NTK E;  2GA1 A;  3M9B A;  1NTK D;  3U59 A;  3CWB G;  4IFM A;  2FFD B;  1FDM A;  2B89 A;  1K8A Q;  1E5W A;  4QUR A;  2ZAE B;  1Q7Y Q;  5KJ7 C;  3N4X A;  5AW5 B;  2JO6 A;  3BRT B;  1OW7 A;  4IL6 H;  4HM2 A;  2UWJ E;  1WMK A;  1JTH A;  1PPJ G;  1W2E A;  1KB9 E;  4LC1 A;  2XND H;  5GTI H;  3T97 A;  2QA4 P;  2YKO A;  1LT1 A;  1X8Y A;  2ZT9 D;  4U3F G;  3AE5 C;  2JO1 A;  5CXM A;  5AW0 B;  1UIX A;  1O7N A;  1K73 Q;  2WSE J;  3V2N A;  1IK7 A;  2FBW C;  4UB8 E;  5APV A;  4OGQ D;  1J1D C;  1SQP G;  2FYU E;  1GW3 A;  1M1J A;  1M7L A;  3VMI D;  2MJZ A;  1L0N E;  1OVU A;  3L35 A;  1QL1 A;  4KHX A;  1FJP A;  4DJG A;  3A7O A;  2WSE H;  2O1K A;  5L8R J;  4GOD A;  3RL0 C;  1YYC A;  3MUD C;  1M57 D;  3CCJ P;  2XRX A;  1ZR2 A;  1LP1 B;  1G2C A;  4NBE D;  2WT7 B;  1O7W A;  5TIS E;  3NXS A;  2OYI B;  5KAF H;  1DD3 A;  2J5U A;  2IYP A;  2OYH B;  3GHG B;  3H1L D;  3IFM A;  4N78 E;  3H32 A;  2QE7 H;  2WSS H;  5CHX A;  2IFN A;  1IC2 A;  3FWL A;  3H1K J;  1X0T A;  1T2K C;  1DEE G;  1FZB A;  4Y28 J;  1NGM B;  2P2U A;  1HUC A;  3MP7 B;  1EZV E;  2RKL A;  3PHL A;  3H1K D;  1SQB G;  2OTK E;  1L4A D;  2AEJ A;  1S9K E;  2Q3I A;  3RBZ A;  2N1T B;  4WB4 A;  3E1I A;  3P8M C;  2YFI A;  2WWW A;  1PZQ A;  1RQU A;  3JCU H;  4NBB D;  1FQT A;  2A45 H;  2B24 A;  3GF7 A;  1S72 P;  5CCG C;  1KQS O;  4XFJ A;  3CWB J;  2V7Q J;  1YIJ P;  1HWT C;  3A0H H;  1GU5 A;  2JZA A;  4L74 A;  4HH2 A;  1KB9 D;  3RK2 D;  1FZA A;  1MFZ A;  4QUQ A;  4AQR D;  3GKE A;  5AW4 B;  1O7M A;  1CW5 A;  4PD4 D;  1BGY D;  1UUV A;  2QJK C;  1BGY E;  1GU4 A;  1IFD A;  1LTJ B;  4OGQ C;  1DH3 A;  2C0X A;  5C39 A;  2OTJ P;  1PPJ D;  2R3C A;  1URQ B;  3P32 A;  1YQ4 C;  3M9H A;  3A0H E;  1ZOY C;  1RF1 C;  1SQP E;  3Q3D A;  2B87 A;  1KZU B;  1R5L A;  1HJ0 A;  3AEC C;  3NFQ A;  3F89 A;  2JEE A;  2N1T C;  3GOB A;  4U7J A;  2R44 A;  3KHU A;  5AW9 B;  2BMR A;  3D6Z A;  3P7K A;  1G8K B;  3H1L E;  2HMJ A;  3AE2 C;  4GIF A;  3H6P A;  3MZW B;  1GMJ A;  4RES B;  5KKZ B;  2M5A A;  3CCV P;  1X22 A;  1OVV A;  1VQM P;  2NPS A;  1KV4 A;  1VF5 C;  1M1J C;  3CWB E;  4D6T G;  3PLN A;  5CJ4 A;  1RE4 A;  1KYO E;  2D2C D;  4PV1 C;  3EN1 A;  1KN7 A;  4YTP C;  1AV1 A;  2E75 C;  4ZKU A;  3ZDM A;  1KIL A;  2HFE D;  1M8O B;  2R5B A;  3VMG D;  3CC7 P;  4PD4 E;  3VMA A;  1VQK P;  5KLV K;  1NTZ K;  5AVX B;  3VYI A;  1LJ2 A;  1Z56 A;  2QSI A;  3GG2 A;  2WSC H;  5B66 E;  1AQ5 A;  5AVQ B;  1U57 A;  4Y99 C;  2FYU J;  3A0B H;  2R3S A;  2BMO A;  1N7L A;  3MD0 A;  1L0L J;  2WQY C;  1Q90 D;  1R5S A;  4R4L A;  3FX0 A;  1JO5 A;  1JY2 P;  5DJT B;  1NO4 A;  3VN0 A;  4H0L C;  1JTH B;  2A06 D;  3AEB C;  1NOH A;  3BAS A;  1SQP K;  3II6 A;  1QGK B;  1BE3 G;  1OXZ A;  2K88 A;  2MKV A;  4N78 D;  3B71 A;  1IFM A;  3AE4 C;  3CLQ A;  4GOF A;  3D70 A;  3H1L J;  2R5D A;  2YXR B;  5CMZ A;  3H1K E;  5CBO A;  1WT6 A;  4EIJ A;  1SFC D;  3MTU E;  2I7F A;  1KYO D;  1S4X A;  2D2C C;  4XE5 B;  3D71 A;  2HPC A;  3B4S A;  1S3J A;  1BSH A;  4GOE A;  1LP1 A;  3CX5 I;  1L0L G;  1N7S A;  1LTG C;  5CCG D;  1KB9 H;  1JM1 A;  1BE3 J;  4H44 C;  4NBC D;  4QMA A;  1CI6 B;  5KJ7 A;  1OW6 A;  3CX5 H;  2ZVO B;  2DE6 D;  1FOS E;  4AIV A;  5TJH A;  2RH0 A;  5AW2 B;  4PD4 H;  1OVR A;  1RY3 A;  1NYH A;  2O1J A;  1FC2 C;  4I6M C;  3FOU A;  1KQL A;  1JOC A;  1VQ7 P;  2OQQ A;  3VMZ A;  2FYU D;  1YTZ I;  2K9J B;  3IAO A;  4UB6 H;  1KD1 Q;  3G71 P;  2NPS C;  2RN0 A;  3IN6 A;  1L0L E;  1OWA A;  4WY4 B;  1SQX G;  3LW5 H;  1VQP P;  3L72 D;  1K04 A;  4PJ0 E;  2HPC B;  2WPR A;  1JY3 N;  2XV5 A;  3BCC E;  1O7G A;  2G3A A;  1RE3 A;  3GHG C;  2M3B A;  4JYC A;  3B5N A;  3TGU J;  5BVZ A;  1TU3 F;  2AXT E;  5KLV D;  3L71 G;  1H8A A;  1BCC D;  2AXT H;  1Q81 Q;  4WY4 D;  2ZYG A;  1RH5 B;  1VQN P;  3L73 G;  2WSF J;  1PV3 A;  3RL0 D;  1BDD A;  1PIX A;  1FZC A;  2OYI C;  2K3R A;  3KDP B;  3H1I E;  4C7R A;  4DCK A;  3HD7 C;  4H44 D;  2KS1 B;  2CK3 H;  1M1K Q;  3TNU A;  1NAF A;  3E1R A;  2KB7 P;  4XA4 A;  1ZME C;  3PJS K;  3P8C E;  3L73 E;  3VMY A;  1ZN5 A;  1EC5 A;  2CKF A;  2Y0D A;  1VQ5 P;  1EDI A;  1ZW0 A;  2PAJ A;  3N0Q A;  3H1I G;  3FXE A;  2QJY B;  2QM8 A;  2AEF A;  2ITA A;  2SPZ A;  2C9L Y;  1VQO P;  1SFC B;  1KFN A;  3Q5S A;  3AE3 C;  4AYC A;  1JCD A;  2AXC A;  2L5G B;  2RMZ A;  4U3F D;  3Q1M A;  4U3F E;  2FXM A;  1EG9 A;  1YI2 P;  3R2P A;  1BE3 D;  2QIW A;  4UB6 E;  2IBZ G;  2IBZ I;  3VTP C;  5B5E E;  4BWN A;  1LTS C;  4QDF A;  1U7J A;  4GKG A;  3B5N C;  1T2K D;  3L4F A;  2E4P A;  1LWU B;  3EFG A;  1HTL C;  3TK1 A;  5CCH D;  1QX8 A;  2VRS A;  1L4A A;  3FWN A;  3BCC J;  1FE6 A;  1FZC C;  3L36 A;  1CI6 A;  3CD6 P;  1KTM A;  5CJ0 A;  1X9V A;  3H1H E;  3DQY A;  4BRY A;  1URQ C;  1NWQ A;  2E5T A;  1NTZ J;  1H88 A;  1J1E C;  1L0L D;  1SQV D;  1RIE A;  4GDO A;  3D6Y A;  1L0L K;  3H1I J;  2L91 A;  1SQV J;  2YFL A;  1YHQ P;  2XSO A;  1SJG A;  3I5C A;  2ZYL A;  2I1J A;  2IZ0 A;  3MHV A;  2WMM A;  1ZV8 A;  3L73 J;  5CBN A;  1FAV A;  2LR2 A;  5AVT B;  2HR3 A;  1A02 J;  2C9N Y;  1SQX D;  3CPW O;  2M8R A;  2ZT9 C;  3TNU B;  2KS1 A;  3L72 G;  4BXL A;  2P10 A;  3G6E P;  2HOD B;  1T6A A;  3R4Y A;  2KXP B;  5AW1 B;  5BU8 B;  1NHL A;  3WUU A;  1RE3 C;  3RGU A;  1OFC X;  3SFE C;  1LTI C;  2YIU B;  1LT9 C;  2HG5 D;  3AE7 C;  4TLF A;  2Y0E A;  2Y9Y A;  3WMM 0;  1LTJ C;  1N73 B;  4W7Y A;  1W5C E;  5AEW A;  1VF5 B;  3HE5 A;  1IZN B;  1JY2 N;  4KJM A;  3I55 P;  1RE4 C;  4C7N B;  2M3E A;  1ULI A;  3H1H D;  1EXJ A;  1DX7 A;  1PGQ A;  3VP9 A;  1RF1 B;  3CCS P;  3GB4 A;  1KFM A;  1T8Z A;  1EZV I;  1AVO A;  2Q3W A;  1NDO A;  2J58 A;  3AEE C;  2KNC A;  4NBF D;  1PPJ E;  4H13 D;  1J1D B;  1P84 E;  2E76 C;  3NMD A;  3L72 E;  3IF4 A;  3WU2 H;  3CXH I;  2CPB A;  1S5L H;  4KT0 J;  1EDK A;  2YMY A;  3H1I D;  2K1A A;  3OJA B;  1YJ9 P;  4RKU J;  4Z1M H;  1KIL C;  5KKZ C;  2FKW B;  1URQ D;  3CCQ P;  3Q2Y A;  1NU1 E;  3AE9 C;  2GUS A;  3CCU P;  4LLH A;  1NTZ E;  2Z4E A;  1IFN A;  3C0D A;  3BCC G;  1T3J A;  1XTG B;  2BCC G;  1T3U A;  5KLV J;  4EDF A;  4H0L B;  3H32 B;  3KZI E;  1KIL E;  2ZFC A;  1SQX J;  2IBZ D;  1QLE D;  1JEK A;  3CMA P;  1VPC A;  4O9B A;  1JUN A;  4L76 A;  1FZE A;  3S9O A;  1URQ A;  5M1B A;  2I1K A;  1JCC A;  2XDJ A;  1SS1 A;  1QVG O;  4NPF X;  2HML A;  3RK2 B;  3KQG A;  4HKZ H;  2E74 D;  3C8V A;  1VL2 A;  2IZ1 A;  3VMH D;  5AW3 B;  3O6Q A;  1S2E A;  3L75 G;  2FYZ A;  3AZC A;  3HE5 B;  2POH A;  3L74 E;  1JY2 O;  3L74 D;  2O01 N;  1SQV G;  2NRG A;  3AE8 C;  3H1H J;  4NPD A;  2ZYD A;  2FXO A;  1LWU A;  1VQ8 P;  1EZV G;  2A45 I;  2YO3 A;  2KNC B;  1GZL A;  2R32 A;  3RL0 g;  1JY3 O;  1SQQ D;  1J1E B;  1D7M A;  1LGH B;  3VP8 A;  2H43 A;  2YVJ B;  2H7H A;  4HM5 A;  1RF1 A;  1SQX K;  1L0N K;  1DIP A;  2FFD C;  4K35 A;  3FGA D;  2HOD A;  2YFJ A;  3HUS A;  5HL4 A;  4K3A A;  1N73 C;  4ZNC A;  3JCU E;  3G4S P;  2YKP A;  1SFC A;  3EQQ A;  3HUS B;  4L73 A;  2HLO A;  3HE4 A;  2JR8 A;  5APW A;  2KLV A;  3TGU G;  2E74 B;  1NTK K;  2BCC J;  1VM9 A;  3TF5 A;  5H2F E;  3JSV C;  1PGO A;  1KB9 I;  2QJK B;  2K9Y A;  1AJY A;  3BVH A;  1CSB A;  5BOK A;  2E75 D;  3WUT A;  2GBX A;  1OX3 A;  1S1C X;  1NKZ B;  3EWK A;  1GK6 A;  1KC8 Q;  4OGQ B;  4I2L C;  4N3Y B;  2WPQ A;  1OMI A;  2M5A B;  3H1J E;  2XNX A;  3S4R A;  2IFM A;  3AEG C;  4NBA D;  3H1H G;  2N9Y B;  4ZKP A;  3GCE A;  1KQG B;  1MUU A;  1NH4 A;  1GDT A;  3JC2 2;  2WSC J;  1NAY A;  3W68 A;  1FZF A;  4QUP A;  2Z5H A;  1PGP A;  3CXH D;  2KOG A;  5H2F H;  3Q5P A;  1LTA C;  2QJP B;  1GK4 A;  2W6J H;  2A45 G;  1L4A B;  1QVF O;  1G1J A;  4IL6 E;  1LTJ A;  2WPV B;  1NTM D;  2K37 A;  1S5L E;  3SWK A;  1HF9 A;  3H25 A;  3BCC D;  3VCA A;  1KQF B;  4PV1 B;  3M0D C;  1CZQ A;  1N73 A;  2J59 M;  2KSJ A;  5KLV E;  3FXD A;  1GD2 E;  1L0N G;  1JM0 A;  5TIS H;  4D6T E;  1KYO I;  3V4W A;  3N7N A;  4GT1 A;  1P84 D;  2P7J A;  4L75 A;  4WVZ A;  1UUW A;  1SLQ A;  2QJP C;  5APQ A;  2JWA A;  2WSF H;  2PGD A;  4EI2 A;  1SQV E;  4RO0 A;  2XSH A;  2C0W A;  3L75 E;  2XR8 A;  3B5N D;  1BCC G;  3L75 D;  4LGD E;  3LW5 J;  3L73 D;  1Q90 C;  3H1J J;  3PP5 A;  1ZLL A;  4HM0 A;  2E76 D;  2NVE A;  2XU6 A;  2BMQ A;  1USD A;  2KLU A;  3MUD A;  1QEX A;  1SQQ G;  1O7P A;  1N8R Q;  3V5B A;  3CC2 P;  2YIU C;  3HE4 B;  2E76 B;  3ABV C;  2O3J A;  3HTK A;  3SSU A;  2V4H A;  1DD4 A;  4DOJ A;  4EOT A;  1SQX E;  2IYO A;  3VOP A;  1FDO A;  2W6A A;  2I8D A;  2LKM A;  1PP9 D;  3GTS A;  2K9J A;  4OWF A;  3O8Z A;  2KP8 A;  4YXW H;  2D2C B;  3M91 A;  1VQ4 P;  1QL2 A;  2YKQ A;  2HMN A;  2KSE A;  2QG4 A;  2JP3 A;  3SWF A;  2WT7 A;  3UIA A;  1SQB J;  1NU1 K;  4I7Z C;  1GL2 C;  1YTZ T;  3GZX A;  1G2C B;  3OA7 A;  2NVF A;  1GL2 A;  3B8E B;  1HJB A;  5AVS B;  3HD7 D;  4OVN F;  1L2P A;  2ZXE B;  2HMM A;  2FY8 A;  3RK3 B;  3V4Q A;  2YNY A;  1SP4 A;  2H89 C;  2XZR A;  3GLM A;  4C46 A;  2P67 A;  4JQ0 D;  1NU1 J;  4HM1 A;  2QRX A;  4HM7 A;  2ZT9 B;  1BCC E;  4EYY Q;  4HM3 A;  3HD7 A;  4ASW A;  1JMM A;  1MZ9 A;  2B1X A;  5AW6 B;  1P84 I;  1NTZ D;  3L70 E;  2QJY C;  3HTK B;  5B66 H;  2IDB A;  3BAT A;  1NTM G;  2Q1K A;  2W90 A;  1X79 B;  3U1C A;  1FZC B;  4NB8 D;  3RL0 B;  3QH9 A;  2N9B A;  3PH0 A;  4PJ0 H;  3HRN A;  4IL6 X;  1PP9 J;  3V2P A;  1WQL A;  3V2R A;  4CPG A;  1SQQ K;  2E75 B;  3P8C D;  2GM4 A;  1K9M Q;  1OZH A;  2Q5U A;  1GW4 A;  5AW8 B;  5KAI E;  1MFT A;  1NTK G;  2PRR A;  1MV8 A; 
#chains in the Genus database with same CATH homology
 1PP9 E;  4HM8 A;  3GL0 A;  4QUR A;  2BMO A;  1NTZ E;  4NBD D;  2HMN A;  4PV1 D;  3C0D A;  2DE5 D;  2NUM A;  1EZV E;  5KLV E;  2JO6 A;  4QDD A;  5AEU A;  2NWF A;  1VM9 A;  4HM2 A;  3L71 E;  1SQP E;  4D6T E;  4U3F E;  4NB9 D;  1L0L E;  1UUW A;  2QJP C;  1KB9 E;  1EG9 A;  3GZX A;  4HM4 A;  1SQQ E;  4HKV A;  5BOK A;  2IBZ E;  2ZT9 D;  2E75 D;  2YFI A;  3CXH E;  2QPZ A;  3GOB A;  2NVF A;  5CXM A;  3CX5 E;  2NVG A;  2GBX A;  4NBB D;  1SQV E;  1O7N A;  2DE7 D;  1BE3 E;  2FYN C;  1FQT A;  2BMR A;  2XSH A;  4QDF A;  2HML A;  2B24 A;  2HMM A;  3BCC E;  3H1J E;  3L75 E;  2E4Q A;  2XR8 A;  4OGQ D;  1O7G A;  1G8K B;  2E4P A;  2E74 D;  4AAY B;  3H1L E;  4NBA D;  4QCK A;  3VMH D;  4P1C H;  2HMJ A;  2FYU E;  3TGU E;  3GCE A;  3VMI D;  5AEW A;  1Q90 C;  4HM0 A;  5KLI C;  2E76 D;  2NVE A;  1L0N E;  2BMQ A;  1ULJ A;  4HM1 A;  1ULI A;  3AZC A;  2GBW A;  4P1B H;  3L74 E;  1VCK A;  3GZY A;  2NUK A;  1O7P A;  3H1H E;  4HM7 A;  3VCP A;  3H1K E;  1SQB E;  3DQY A;  1BCC E;  2JZA A;  3GB4 A;  4QUP A;  2XRX A;  2A06 E;  2BCC E;  1VF5 D;  2HMK A;  2YIU C;  3CWB E;  3GL2 A;  4HM3 A;  2I7F A;  2Q3W A;  1NDO A;  1G8J B;  2B1X A;  3D89 A;  4NBE D;  2YVJ B;  1KYO E;  1PPJ E;  4H13 D;  4NBF D;  3H1I E;  4HM5 A;  2D2C D;  3EN1 A;  3L70 E;  1P84 E;  2QJY C;  1RIE A;  4H44 D;  3L72 E;  4NBH D;  1O7W A;  4QUQ A;  1SQX E;  3GKE A;  4HJL A;  4QDF B;  2YFJ A;  4HM6 A;  3VMG D;  1O7M A;  5HL4 A;  1JM1 A;  4PD4 E;  2YFL A;  4QDC A;  1NYK A;  4NB8 D;  1O7H A;  4NBC D;  2XSO A;  3L73 E;  1SJG A;  1NTK E;  1UUV A;  2ZYL A;  2QJK C;  4NBG D;  1BGY E;  2CKF A;  3GTS A;  1ZRT E;  2DE6 D;  1WQL A;  3N0Q A;  3EQQ A;  4AIV A;  5KKZ C;  3VCA A;  4H0L D;  1NU1 E;  1NTM E;  1RFS A;  2HMO A;  4EMJ B;  3GTE A;  3FOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...