3L75E

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l75E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l75E02
2QJPC 4HM2A 4HM0A 1ZRTE 1PPJE 4AAYB 4H0LD 4HM4A 2NVEA 2JO6A 4P1CH 3FOUA 3BCCE 3H1HE 2E76D 1SQBE 4QDFB 1VCKA 3VMHD 4QDFA 1L0NE 2FYUE 1O7MA 2E4PA 2YFLA 2XSHA 4EMJB 4NB8D 4HM1A 3EN1A 4P1BH 5BOKA 2B1XA 2BMRA 3H1LE 2BCCE 1NDOA 3GOBA 3L72E 2XRXA 2YIUC 4NBGD 1WQLA 4QCKA 2I7FA 2NWFA 4H13D 1O7WA 4D6TE 1O7NA 4QDCA 2DE6D 4NBDD 1NTME 1SQPE 3L73E 4HM8A 1SQXE 1BGYE 4U3FE 3GZYA 3GB4A 4NBCD 4HJLA 2JZAA 2NUKA 4NBFD 2FYNC 3GCEA 2XR8A 5HL4A 2ZT9D 1Q90C 5AEWA 2GBWA 1O7GA 1NTKE 2D2CD 2NUMA 2YFIA 1BE3E 1ULIA 3L71E 1EG9A 5AEUA 2E4QA 3GKEA 4HKVA 1ULJA 2Q3WA 4NBBD 2HMMA 1UUVA 3GL0A 4NBHD 4NBAD 2CKFA 3GL2A 1P84E 3TGUE 4QURA 2BMOA 3GTEA 1SJGA 3CX5E 3L74E 2DE7D 2NVGA 4NBED 1BCCE 3D89A 2YVJB 1G8JB 3H1KE 1NTZE 4QUQA 2QJKC 3C0DA 3VMID 2E75D 3VMGD 3GTSA 2DE5D 2HMLA 3EQQA 4H44D 2B24A 4PV1D 1O7PA 2HMOA 1UUWA 1SQVE 2XSOA 3AZCA 3CWBE 1RFSA 2ZYLA 2A06E 3L75E 2HMNA 1PP9E 3L70E 2YFJA 2IBZE 3N0QA 1NYKA 3VCAA 5CXMA 1SQQE 1EZVE 2E74D 3H1IE 3GZXA 4NB9D 3VCPA 4AIVA 3CXHE 4HM5A 2GBXA 4QDDA 5KKZC 4HM3A 1G8KB 2NVFA 4OGQD 4HM7A 3H1JE 4HM6A 2BMQA 4QUPA 1KB9E 3DQYA 2HMJA 1VM9A 1FQTA 5KLVE 1KYOE 1VF5D 2HMKA 1O7HA 1JM1A 1NU1E 2QJYC 2QPZA 4PD4E 1L0LE 1RIEA 5KLIC
chains in the Genus database with same CATH superfamily
4JYCA 3A5TA 2BEQD 1ZRTE 1JTHA 3TF5A 1IFDA 1X8YA 1PPJE 4AAYB 3CX5I 1URQC 2K88A 3N7NA 5CCGA 1R5LA 1M56D 2FYUE 2YFLA 3RK2B 1KTMA 1N86A 3CX5H 3LIEA 1O7NA 1L4AC 3PJSK 3C8VA 1Y9BA 1DX7A 1Y8AA 2FKWB 1LT1A 3N4XA 1KV4A 3SFDC 2CPBA 1HGZA 1L4AB 1AJYA 1VDFA 1NTZK 1GL2A 3WUUA 2M0BA 4IL6H 2SPZA 1YJ9P 3IN6A 1FZEA 3WMM0 1SJGA 4NBED 2NRGA 1G8JB 2MJZA 1MFZA 2HG5D 3VP8A 4Z1MH 1LTAC 4UB6H 2IFMA 3CWBE 3R2PA 1GK4A 1IK7A 5APWA 3H32A 1SQQE 1LT9B 1T6AA 3FXEA 1CSBA 3BASA 4YPCA 2AXTE 3H1JE 1IFMA 1S4XA 2HMKA 2J5UA 3L75G 3L75J 3VOPA 3CCLP 1FZCC 2P2UA 2FFDC 4HM4A 1MUUA 1LTTC 1IZNB 1IFPA 1NU1D 1PIXA 2M5AA 3CCSP 2KB7P 2P7JA 4ASWA 3EN1A 2FFDB 4UB8E 1L2PA 4QDCA 1URQA 3CCJP 3KQGA 5AW8B 1S3JA 4YXWH 2E42A 3RL0C 2ZYDA 2WWWA 1BDCA 1HWTC 1NTMD 1S5LE 3L71E 1MZ9A 4W7ZA 1L4AA 1U7MA 1Q81Q 3RL0B 1BE3D 1IFNA 2YMKA 2XNXA 3FX0A 2LKMA 3H1KE 2MKVA 1DIPA 1GZLA 5AVQB 4PV1B 3V4QA 4GOFA 3I56P 2A06E 2Z4EA 1U57A 2IBZE 3WU2H 5AW4B 1NKNA 1RE4C 1KORA 2ITAA 2ZXEB 1YBKA 2QJYB 2GUVA 4HM6A 1VQ9P 1VF5B 2KP8A 5AVSB 2KLUA 1CW5A 3VYIA 2H88C 2QJPC 2J59M 5BU5A 4AQRD 3A3YB 2WT7A 2OTKE 3V6IA 2GM4A 3P8MC 1UIXA 1PGPA 4PJ0H 5KLVG 5KLVJ 3TSIA 2XRXA 1FZCA 1YTZT 2FFDA 4D6TE 1RF0C 3VMAA 1X9VA 1L0ND 1SQXE 2W6AA 1ZMEC 5APTA 2QG4A 1AA0A 4EI2A 4GDOA 3RBZA 3OJAB 2HYNA 5AW1B 2KS1B 3L35A 3HE4A 3M9BA 2Q3WA 1JY3P 2IFNA 3GHGB 5GTIH 1K05A 3TGUE 3I5CA 3CX5E 2AXCA 1BCCE 5DJTB 3PH0A 1OMIA 5CJ0A 1AV1A 3GW6A 1GU5A 3EQQA 1X79B 2XSOA 4I1LA 5AVZB 2ZFCA 1PFIA 2JO1A 1ZN5A 1SFCB 2YNYA 1EZVG 5KLVK 1NWQA 1KILE 3GF3A 1GTWA 2N1TB 3A0HE 3VCPA 1VQ5P 4WBAA 3L74G 1FOSF 3L74J 2ZJSE 4DT0A 5KKZC 5APQA 4HM3A 2B87A 2M3BA 5AW7B 4HM7A 4IL6E 1M8OB 3L70D 1OIPA 5KLIB 4EOTA 4OH8B 3MHVA 3CXHD 5C39A 2QPZA 1RE4A 2LR2A 1QL2A 1L0LE 4HYTB 3U1CA 4H0LB 4UB6E 2CPSA 3GLMA 2JO6A 2HODA 3D6YA 1HH0A 2BEZF 3BCCE 5AW0B 1SQPD 2FXOA 5BOKA 2V7QH 2ZT9C 4RESB 4QCKA 5CCHD 5KAFH 1Z56A 2QVAA 3L73E 2P1JA 1YQ3C 2BCCD 3VP9A 2ZT9B 3H1HG 5CCHC 3H1HJ 3V5BA 3CCUP 4JF7A 3M9HA 1G2CB 4I7ZB 2Q3EA 1RF0A 3L72G 3L72J 1QLED 2KS1A 1H88A 3V4WA 5KJ7C 1KD1Q 3NFQA 1OX3A 4L74A 3B8EB 4EIJA 4GKGA 2Q1KA 1QL1A 3CMEP 2XKMA 1G1IA 2KYVA 1OZHA 4H44D 1QGKB 3CWBG 1K04A 3CWBJ 1KZUB 3AEEC 1ZR2A 1NTZD 2YKOA 3H1IE 3RK3D 4GODA 3DQYA 2HMJA 2H8PD 3RK3C 2PAJA 1VL2A 2KXPB 2K9JB 4HM0A 3IFMA 1VQNP 3L36A 1J2JB 2KI7B 2NVEA 5CCGD 1JY2O 2JJLA 2YIUB 1FE6A 4PD4D 1M1KQ 2XSHA 3M9QA 1R8EA 5CCGC 3FWNA 2ZXXA 3A0BH 2QA4P 1WQLA 4A7PA 2YKQA 2YO3A 3CXHI 1IFJA 3GB4A 2NUKA 2K9YA 2JDIH 5TJHA 4XA4A 1KC8Q 1N7SC 2E75B 3V2QA 1ULIA 3JCUE 1EG9A 1G2CA 2E4QA 3MUDC 3CCRP 3CXHH 1OXZA 3CMAP 1GL2D 1JY3N 3E1IA 3JC22 1J1DC 3UIAA 1VQ4P 2NPSB 3GL0A 4NBHD 2FY8A 1M1JB 2L91A 5CCHA 1W2EA 3LW5H 2XZRA 1N7SB 1BGYJ 2K37A 1T2KC 1M90Q 1Q82Q 2WITA 2QJKC 1J1DB 5KJ7A 4EDFA 2QEXP 3E7KA 4EYYQ 3AE5C 2WVRA 1RFSA 4Y99C 3GF7A 2E74D 2IYOA 1ZP0C 3D6ZA 2QJKB 5DJUB 3IR9A 3CLQA 2P67A 1EC5A 1OVRA 3A7OA 5CBOA 3L75D 5GTIE 2E74C 1GW4A 2FBWC 2M3EA 3CC7P 3CPWO 2E76C 3CCEP 1ZXGA 1FZBA 1NU1E 3AE6C 2W27A 4C7NB 3AE2C 3FGAD 2K9JA 2O01J 2E76B 3HD7B 1EDIA 1VCKA 1AFOA 3RK2D 3PTZA 1RE3C 2O01H 1USEA 2WTYA 1NTME 1SVFA 2L5GB 2QIWA 4L76A 2WSSH 4HJLA 1VPCA 4RO0A 4JBZA 2XR8A 1BE3E 2PFXA 1N2DC 1L4AD 1Y47A 4PD4I 2ZYGA 1UUVA 4NBAD 1KQGB 1M1JA 3B5NB 4YTPC 2B88A 5H2FH 1N7SA 1BCCG 1BCCJ 2IX7C 1NTKG 4PD4H 1NTKJ 3CL3D 3MUDA 3HTKB 3VMID 2IPPA 1VQMP 3KHUA 1J1EB 3ITKA 5GTHH 3PHLA 1IFIA 5E79H 2IDBA 5APUA 2KK7A 2Q3IA 1NYHA 2AEJA 2IZ1A 2N9BA 1LT9C 2WSEJ 1FZGA 3VMYA 3CCQP 5AVTB 2P10A 1RHZB 2R3CA 1CI6B 2WSEH 3I55P 1GD2E 5KLVD 3BCCG 3BCCJ 3TNUB 3S1KA 2QM7A 3Q5PA 1L0NE 4AUWA 4P1BH 3H1LE 1ZW0A 2KSJA 3HE5A 1NTKK 2D2CC 2Q9IA 4LLHA 1HJBA 1VQ8P 2OARA 3BRVB 2UWJE 3P7KA 1CZQA 5HL4A 1SQBG 1SQBJ 1S9KE 2D2CB 1RE3A 2OYHC 1M57D 1FOSE 1NAYA 1GW3A 4DCKA 1A02J 2C9NY 1PGOA 4GT1A 3RL0D 1YYCA 4U3FG 4U3FJ 2OYHB 1R5SA 3B5NA 1EXJA 3GTEA 1VQOP 5AVXB 3QWOC 4DOJA 1EZVD 3GTSA 5B5EH 4PV1D 4M3LA 3O6QB 3S4RA 4NPDA 1M7LA 3L74D 3EFGA 3L70E 1X0TA 3QH9A 2KNCB 1H89A 5CXMA 4PV1C 3MTUE 4L73A 3CXHE 2K3RA 4W80A 3VMXA 1LP1B 1ZRTD 3AE7C 2H89C 5CMZA 4KHXA 1VF5D 5AVRB 1SQBK 1JM1A 1GU4A 2QJYC 1KN7A 3W67A 1VF5C 1LT9A 3NXSA 1LWUC 2I1JA 2QRXA 4EMJB 1NHLA 2BCCE 1NDOA 1U7JA 2O1JA 2NWFA 3H1HD 5CBNA 1LWUB 1LTGC 1IO4A 3HUSB 2A45G 3L72D 1PV3A 2Z5IA 2GBWA 1WT6A 4Y28J 4LC1A 1W5CE 1NAFA 2HMMA 2I1KA 1H8AA 1ZR4A 3P8CD 2CKFA 2OYHA 3OAKA 4QURA 3CWBD 3GHGC 3MZWB 2KSEA 2Y9YA 1NTZE 1JMBA 2WQYC 3ABVC 3O6QA 3RK3E 2ZYLA 3C9IA 1RQVA 2HMNA 2Y0DA 3PLNA 2WSFJ 3KYQA 3H6PA 2FXPA 1SFCC 2NVFA 4BWNA 2WSFH 2BMQA 2N1TC 1FZFA 1QVFO 1OW8A 1SQVG 1KQSO 1SQVJ 1O7HA 4KJMA 2RKLA 1LTIC 1PP9G 4PD4E 4RKUJ 1PP9J 1EZVI 4YXDC 3F5HA 5KLIC 1PL5A 5GTHE 4H0LD 3CI9A 5KAIH 4H13C 1FU1A 3T97B 4QDFB 4N78E 4H0LC 4IFDK 1JOCA 2XNDH 1NVOA 4H13B 2FYNB 3BATA 2DE6D 5AVYB 1PPJG 1LWUA 1BDDA 4WY4B 2ZT9D 1Q90C 1MFTA 2FYUG 2HPCB 2W6BA 2FYUJ 1DD3A 1EDLA 1BGYD 1QEXA 1NKZB 1PGQA 4HKVA 3OA7A 1W2BO 2V4HA 1BSNA 4I7ZC 1SQVK 1VQ7P 1JEKA 1EDJA 3V2NA 2BMOA 1N8RQ 2AEFA 5KJ7D 3RGUA 3CC2P 4OVNF 3AE4C 1LJ2A 3L75E 1S5LX 1N73B 1NYKA 3GHGA 1S1CX 4AIVA 5AW3B 2PGDA 3MIWA 2GBXA 5KTBA 2B9BA 3AEBC 1LTJB 3CC4P 3Q5SA 3V2RA 2FYUK 1SQQG 3AEAC 1SQQJ 1SFCA 2R5BA 5B5EE 3SWYA 3GMAA 2N1TA 4HB1A 2C9LY 3H1JG 2PRRA 3H1JJ 4QDFA 1LTSC 3H1LG 3H1LJ 2B1XA 2Y0CA 2YIUC 3WUTA 3F89A 2AXTH 4IFMA 4HKZH 2JZAA 2KIKA 1JY3O 2HR3A 5AEWA 4XE5B 3WU2E 2OYIC 1RF1B 4W7YA 1ULJA 1BCCD 1LTBC 2O1KA 2E75C 4U7JA 1NTKD 2NPSD 1N7SD 2OYIB 3VTPC 5K5GB 2DE7D 1FZAA 2NPSC 1SQQK 1M1JC 2W83C 1EDKA 4CPGA 3L71G 3L71J 3O8ZA 2Q6QA 4C46A 1T2KD 2CK3H 3CCVP 2C0XA 1JTHB 1KILC 4PJ0E 1QX8A 1N73A 5AVVB 5M1BA 1KQLA 2ZVNB 4OGQB 3H1KG 3H1KJ 1Q86Q 3M0AA 1VQKP 1KILB 5KLVE 1JCCA 2A06G 3BCCD 3E1RA 1JY2N 2IBZG 2HFED 4GOEA 3B71A 1DEBA 5BU8B 1RY3A 1IJDB 1SP4A 1JCDA 1SLQA 3L4FA 2E76D 3HD7D 2FYZA 1VQPP 1O7MA 5TISH 4HM1A 2H7HA 4IL6X 3HD7C 1QVGO 2B89A 3II6A 2E5TA 1YTZI 2I7FA 1SQBD 3FXDA 2K1AA 4NBDD 4LGDE 4HM8A 2KZIA 4ASVA 3D71A 4NPEA 5B66H 3GCEA 1DH3A 3SWKA 1IK9A 1NH4A 1RQUA 3OW2O 2YXRB 5KAIE 4U3FD 3M06A 3C1LA 1OWAA 1BSHA 1YHQP 4D6TG 3H32B 1HUCA 4D6TJ 1OW6A 1SQXG 1SQXJ 1VQ6P 3L37A 3B5ND 3GL2A 2OYIA 3L74E 2NVGA 4NPFX 1A02F 2GUSA 3B5NC 1OW7A 1YJNP 2JP3A 3NTNA 1HBWA 4C7RA 1P84D 3AZCA 1HVVA 4HJGH 1J1EC 2NPSA 1ZV8A 2IZ0A 3TGUG 3TGUJ 2M5AB 4HM5A 3KPEA 1DD4A 1JNMA 4L75A 2QM8A 5KAFE 2JWDA 2RMZA 4R4LA 1S2EA 4GIFA 1KILA 2WZ7A 3AEDC 1URQB 4IOIH 1AQTA 2JEEA 2RH0A 1ZOYC 1KYOD 3FOUA 3H1HE 3VMHD 1SQXK 2WPQA 2ZVOB 3A0HH 2R32A 3CCMP 3L72E 1GK6A 1IC2A 1L0LG 1L0LJ 1HJ0A 1VQLP 3BVHA 4C7NA 3KZIH 2O3JA 3AE3C 1FDOA 3VN0A 2D2CD 2OGUA 3HD7A 3P8CE 1Q2NA 3EWKA 4KT0J 3KXDA 3M0DC 3L73G 3L73J 2Z5HA 3G71P 2QE7H 5AW2B 4QUQA 2IYPA 1WMKA 4IFFA 1LGHB 2YFJA 2H43A 3N0QA 2I8DA 2WT7B 2OTJP 1Q7YQ 4N6JA 3A0BE 1L0LK 3U59A 1SQVD 2C0WA 1JMMA 1PP9D 2R5DA 1VM9A 3HTKA 1FZCB 4OWFA 2YKPA 1ZLLA 1WRGA 1G1JA 1P84I 1KB9D 3H1IG 3H1IJ 1DEEG 2PP6A 3HE4B 3USSA 1PPJD 3G9RA 2RN0A 2BASA 1P84H 4ZNCA 3S9OA 1O7WA 1SQPE 2FYUD 1BGYE 1CI6A 4NBCD 4TLFA 4TT3H 3ZDMA 2VRSA 3TNUA 1FS0E 2NUMA 2WPSA 3Q5RA 2YFIA 1KYOI 1UIIA 1T3JA 5AEUA 3AE8C 3HUSC 4JPZB 3NMDA 3GKEA 4BRYB 3BRTB 5TISE 1XTCC 5AVUB 2OTLP 2B87B 2A45I 1PZQA 1KYOH 5AW5B 3M91A 1GDTA 1OVVA 4I6MC 2YXQB 1FDMA 1FDIA 4JQ0D 3M0DA 2B24A 5B66E 2HMOA 2A45H 2GA1A 1FJKA 3IF4A 3MP7B 3JCUH 2HODB 4RJTA 3AECC 2XDJA 3TK1A 4R4MA 1KMIZ 4QUPA 2QJPB 3EFFK 1SQQD 1NO4A 3CD6P 2E5YA 1SFCD 3H1JD 1MKMA 4AYCA 2KNCA 3H1LD 2N1TD 2XV5A 4HH2A 2AEMA 4P1CH 2DW3A 1AVYA 1KFNA 1OVUA 3FWLA 1JUNA 5H2FE 1LP1A 4QMAA 2W6JH 3GOBA 1NU1G 4DJGA 1NOHA 1NU1J 1HF9A 1JY2P 2R44A 4H13D 1S9KD 1E79H 4BXLA 2JR8A 3G4SP 3D70A 3SFEC 4WB4A 4WY4D 2FYNC 4NBFD 1FBMA 5E79E 1O7GA 3HRNA 1KB9I 1NTKE 1USDA 2G8YA 5APYA 5AVWB 4ZMDA 4WY4C 4XFJA 2KUBA 3PP5A 1S72P 4MN4C 4BRYA 2Y0EA 2Q7CA 1NTMG 1NTMJ 1Q90D 1KB9H 2O01N 3L71D 1EXIA 3HUSA 3G3ZA 1BE3G 1BE3J 3VMGD 3KZIE 2DE5D 2KOGA 1UUWA 3W68A 3P32A 5KKZB 3H1KD 4ZKUA 2V7QJ 5CHXA 1JO5A 3AEGC 1NU1K 3RBXA 2W8ZA 2A06D 1N73C 2IBZD 1FQTA 3MD0A 3VMZA 2FXMA 5AW9B 1GMJA 1LTJC 4HM2A 1XTGB 1T8ZA 1D7MA 2M8RA 5AW6B 1NTMK 1H0TB 1SQBE 1N7LA 4NB8D 3JSVC 1NJIQ 3H25A 3MGNA 1HGVA 1KFMA 2KLVA 1FAVA 4U3FE 3GZYA 2G3AA 2KZJA 1YQ4C 4WVZA 2W90A 1L0NG 4D6TD 1L0NJ 3T97A 4WWIA 1SQXD 4N3YB 2WPVB 1NGMB 4H44C 1RF1C 3Q3DA 4I2LC 1P84E 1FJPA 4WY4A 3A2AA 3WUVA 2WSCJ 1FC2C 2E75D 4K3AA 4H44B 2HPCA 2HMLA 3SSUA 1JM0A 2ZYAA 1O7PA 3TGUD 1HTLC 3CX5D 1MV8A 2WPRA 2WSCH 3TYYA 3LIDA 3AE1C 4NB9D 1PGJA 1KQFB 4QDDA 3RK3B 1SS1A 3IAOA 4OGQD 2ZAEB 4UB8H 4O9BA 1KILD 1KYOE 2OYOA 3B4SA 4JYBA 4OGQC 3K5BA 3L70G 1L0NK 3L70J 1RIEA 2XU6A 4N78D 1AVOA 3PRJA 1K73Q 1S5LH 2Y9ZA 1T3UA 5APSA 2YO2A 3RL0g 3Q2YA 1L0LD 2JKVA 1TU3F 5APVA 1H0TA 3LW5J 2E4PA 2QSIA 3U1AA 1LTJA 2BMRA 4K35A 4NBGD 2WMMA 3GG2A 3G6EP 2IBZI 2J58A 1SQPG 1SQPJ 2Q5UA 1BGYG 5EFWB 2P58A 1GL2C 5BVZA 3Q1MA 1LNQA 1OFCX 2HLOA 4DZOA 2LXBA 3EQ2A 2POHA 3L73D 2BCCG 2BCCJ 4B86A 1YITP 2E43A 4NBBD 1GL2B 5APXA 3SWFA 3AE9C 2YMYA 2LXCB 3D89A 2YVJB 4Y99B 1X22A 1E5WA 3C0DA 1JB0J 4ZKPA 1RF1A 1SQVE 1YJWP 1PP9E 5L8RJ 3AEFC 1RH5B 3TDKA 3VCAA 2E74B 1EZVE 3GZXA 1K8AQ 5CJ4A 1SQPK 3KDPB 1G8KB 2N9YB 1NTZG 2R3SA 1EQ7A 1NTZJ 1YIJP 2OQQA 1YI2P 1KB9E 3HE5B 3R4YA 3H1ID 2NZ2A 3V2PA 2JWAA 1URQD 1AQ5A 1K9MQ 3RK2C
chains in the Genus database with same CATH topology
2QJPC 4HM2A 4HM0A 1ZRTE 1PPJE 4AAYB 4H0LD 4HM4A 2NVEA 2JO6A 4P1CH 3FOUA 3BCCE 3H1HE 2E76D 1SQBE 4QDFB 1VCKA 3VMHD 4QDFA 1L0NE 2FYUE 1O7MA 2E4PA 2YFLA 2XSHA 4EMJB 4NB8D 4HM1A 3EN1A 4P1BH 5BOKA 2B1XA 2BMRA 3H1LE 2BCCE 1NDOA 3GOBA 3L72E 2XRXA 2YIUC 4NBGD 1WQLA 4QCKA 2I7FA 2NWFA 4H13D 1O7WA 4D6TE 1O7NA 4QDCA 2DE6D 4NBDD 1NTME 1SQPE 3L73E 4HM8A 1SQXE 1BGYE 4U3FE 3GZYA 3GB4A 4NBCD 4HJLA 2JZAA 2NUKA 4NBFD 2FYNC 3GCEA 2XR8A 5HL4A 2ZT9D 1Q90C 5AEWA 2GBWA 1O7GA 1NTKE 2D2CD 2NUMA 2YFIA 1BE3E 1ULIA 3L71E 1EG9A 5AEUA 2E4QA 3GKEA 4HKVA 1ULJA 2Q3WA 4NBBD 2HMMA 1UUVA 3GL0A 4NBHD 4NBAD 2CKFA 3GL2A 1P84E 3TGUE 4QURA 2BMOA 3GTEA 1SJGA 3CX5E 3L74E 2DE7D 2NVGA 4NBED 1BCCE 3D89A 2YVJB 1G8JB 3H1KE 1NTZE 4QUQA 2QJKC 3C0DA 3VMID 2E75D 3VMGD 3GTSA 2DE5D 2HMLA 3EQQA 4H44D 2B24A 4PV1D 1O7PA 2HMOA 1UUWA 1SQVE 2XSOA 3AZCA 3CWBE 1RFSA 2ZYLA 2A06E 3L75E 2HMNA 1PP9E 3L70E 2YFJA 2IBZE 3N0QA 1NYKA 3VCAA 5CXMA 1SQQE 1EZVE 2E74D 3H1IE 3GZXA 4NB9D 3VCPA 4AIVA 3CXHE 4HM5A 2GBXA 4QDDA 5KKZC 4HM3A 1G8KB 2NVFA 4OGQD 4HM7A 3H1JE 4HM6A 2BMQA 4QUPA 1KB9E 3DQYA 2HMJA 1VM9A 1FQTA 5KLVE 1KYOE 1VF5D 2HMKA 1O7HA 1JM1A 1NU1E 2QJYC 2QPZA 4PD4E 1L0LE 1RIEA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJP C;  4HM2 A;  4HM0 A;  1ZRT E;  1PPJ E;  4AAY B;  4H0L D;  4HM4 A;  2NVE A;  2JO6 A;  4P1C H;  3FOU A;  3BCC E;  3H1H E;  2E76 D;  1SQB E;  4QDF B;  1VCK A;  3VMH D;  4QDF A;  1L0N E;  2FYU E;  1O7M A;  2E4P A;  2YFL A;  2XSH A;  4EMJ B;  4NB8 D;  4HM1 A;  3EN1 A;  4P1B H;  5BOK A;  2B1X A;  2BMR A;  3H1L E;  2BCC E;  1NDO A;  3GOB A;  3L72 E;  2XRX A;  2YIU C;  4NBG D;  1WQL A;  4QCK A;  2I7F A;  2NWF A;  4H13 D;  1O7W A;  4D6T E;  1O7N A;  4QDC A;  2DE6 D;  4NBD D;  1NTM E;  1SQP E;  3L73 E;  4HM8 A;  1SQX E;  1BGY E;  4U3F E;  3GZY A;  3GB4 A;  4NBC D;  4HJL A;  2JZA A;  2NUK A;  4NBF D;  2FYN C;  3GCE A;  2XR8 A;  5HL4 A;  2ZT9 D;  1Q90 C;  5AEW A;  2GBW A;  1O7G A;  1NTK E;  2D2C D;  2NUM A;  2YFI A;  1BE3 E;  1ULI A;  3L71 E;  1EG9 A;  5AEU A;  2E4Q A;  3GKE A;  4HKV A;  1ULJ A;  2Q3W A;  4NBB D;  2HMM A;  1UUV A;  3GL0 A;  4NBH D;  4NBA D;  2CKF A;  3GL2 A;  1P84 E;  3TGU E;  4QUR A;  2BMO A;  3GTE A;  1SJG A;  3CX5 E;  3L74 E;  2DE7 D;  2NVG A;  4NBE D;  1BCC E;  3D89 A;  2YVJ B;  1G8J B;  3H1K E;  1NTZ E;  4QUQ A;  2QJK C;  3C0D A;  3VMI D;  2E75 D;  3VMG D;  3GTS A;  2DE5 D;  2HML A;  3EQQ A;  4H44 D;  2B24 A;  4PV1 D;  1O7P A;  2HMO A;  1UUW A;  1SQV E;  2XSO A;  3AZC A;  3CWB E;  1RFS A;  2ZYL A;  2A06 E;  3L75 E;  2HMN A;  1PP9 E;  3L70 E;  2YFJ A;  2IBZ E;  3N0Q A;  1NYK A;  3VCA A;  5CXM A;  1SQQ E;  1EZV E;  2E74 D;  3H1I E;  3GZX A;  4NB9 D;  3VCP A;  4AIV A;  3CXH E;  4HM5 A;  2GBX A;  4QDD A;  5KKZ C;  4HM3 A;  1G8K B;  2NVF A;  4OGQ D;  4HM7 A;  3H1J E;  4HM6 A;  2BMQ A;  4QUP A;  1KB9 E;  3DQY A;  2HMJ A;  1VM9 A;  1FQT A;  5KLV E;  1KYO E;  1VF5 D;  2HMK A;  1O7H A;  1JM1 A;  1NU1 E;  2QJY C;  2QPZ A;  4PD4 E;  1L0L E;  1RIE A;  5KLI C; 
#chains in the Genus database with same CATH topology
 4JYC A;  3A5T A;  2BEQ D;  1ZRT E;  1JTH A;  3TF5 A;  1IFD A;  1X8Y A;  1PPJ E;  4AAY B;  3CX5 I;  1URQ C;  2K88 A;  3N7N A;  5CCG A;  1R5L A;  1M56 D;  2FYU E;  2YFL A;  3RK2 B;  1KTM A;  1N86 A;  3CX5 H;  3LIE A;  1O7N A;  1L4A C;  3PJS K;  3C8V A;  1Y9B A;  1DX7 A;  1Y8A A;  2FKW B;  1LT1 A;  3N4X A;  1KV4 A;  3SFD C;  2CPB A;  1HGZ A;  1L4A B;  1AJY A;  1VDF A;  1NTZ K;  1GL2 A;  3WUU A;  2M0B A;  4IL6 H;  2SPZ A;  1YJ9 P;  3IN6 A;  1FZE A;  3WMM 0;  1SJG A;  4NBE D;  2NRG A;  1G8J B;  2MJZ A;  1MFZ A;  2HG5 D;  3VP8 A;  4Z1M H;  1LTA C;  4UB6 H;  2IFM A;  3CWB E;  3R2P A;  1GK4 A;  1IK7 A;  5APW A;  3H32 A;  1SQQ E;  1LT9 B;  1T6A A;  3FXE A;  1CSB A;  3BAS A;  4YPC A;  2AXT E;  3H1J E;  1IFM A;  1S4X A;  2HMK A;  2J5U A;  3L75 G;  3L75 J;  3VOP A;  3CCL P;  1FZC C;  2P2U A;  2FFD C;  4HM4 A;  1MUU A;  1LTT C;  1IZN B;  1IFP A;  1NU1 D;  1PIX A;  2M5A A;  3CCS P;  2KB7 P;  2P7J A;  4ASW A;  3EN1 A;  2FFD B;  4UB8 E;  1L2P A;  4QDC A;  1URQ A;  3CCJ P;  3KQG A;  5AW8 B;  1S3J A;  4YXW H;  2E42 A;  3RL0 C;  2ZYD A;  2WWW A;  1BDC A;  1HWT C;  1NTM D;  1S5L E;  3L71 E;  1MZ9 A;  4W7Z A;  1L4A A;  1U7M A;  1Q81 Q;  3RL0 B;  1BE3 D;  1IFN A;  2YMK A;  2XNX A;  3FX0 A;  2LKM A;  3H1K E;  2MKV A;  1DIP A;  1GZL A;  5AVQ B;  4PV1 B;  3V4Q A;  4GOF A;  3I56 P;  2A06 E;  2Z4E A;  1U57 A;  2IBZ E;  3WU2 H;  5AW4 B;  1NKN A;  1RE4 C;  1KOR A;  2ITA A;  2ZXE B;  1YBK A;  2QJY B;  2GUV A;  4HM6 A;  1VQ9 P;  1VF5 B;  2KP8 A;  5AVS B;  2KLU A;  1CW5 A;  3VYI A;  2H88 C;  2QJP C;  2J59 M;  5BU5 A;  4AQR D;  3A3Y B;  2WT7 A;  2OTK E;  3V6I A;  2GM4 A;  3P8M C;  1UIX A;  1PGP A;  4PJ0 H;  5KLV G;  5KLV J;  3TSI A;  2XRX A;  1FZC A;  1YTZ T;  2FFD A;  4D6T E;  1RF0 C;  3VMA A;  1X9V A;  1L0N D;  1SQX E;  2W6A A;  1ZME C;  5APT A;  2QG4 A;  1AA0 A;  4EI2 A;  4GDO A;  3RBZ A;  3OJA B;  2HYN A;  5AW1 B;  2KS1 B;  3L35 A;  3HE4 A;  3M9B A;  2Q3W A;  1JY3 P;  2IFN A;  3GHG B;  5GTI H;  1K05 A;  3TGU E;  3I5C A;  3CX5 E;  2AXC A;  1BCC E;  5DJT B;  3PH0 A;  1OMI A;  5CJ0 A;  1AV1 A;  3GW6 A;  1GU5 A;  3EQQ A;  1X79 B;  2XSO A;  4I1L A;  5AVZ B;  2ZFC A;  1PFI A;  2JO1 A;  1ZN5 A;  1SFC B;  2YNY A;  1EZV G;  5KLV K;  1NWQ A;  1KIL E;  3GF3 A;  1GTW A;  2N1T B;  3A0H E;  3VCP A;  1VQ5 P;  4WBA A;  3L74 G;  1FOS F;  3L74 J;  2ZJS E;  4DT0 A;  5KKZ C;  5APQ A;  4HM3 A;  2B87 A;  2M3B A;  5AW7 B;  4HM7 A;  4IL6 E;  1M8O B;  3L70 D;  1OIP A;  5KLI B;  4EOT A;  4OH8 B;  3MHV A;  3CXH D;  5C39 A;  2QPZ A;  1RE4 A;  2LR2 A;  1QL2 A;  1L0L E;  4HYT B;  3U1C A;  4H0L B;  4UB6 E;  2CPS A;  3GLM A;  2JO6 A;  2HOD A;  3D6Y A;  1HH0 A;  2BEZ F;  3BCC E;  5AW0 B;  1SQP D;  2FXO A;  5BOK A;  2V7Q H;  2ZT9 C;  4RES B;  4QCK A;  5CCH D;  5KAF H;  1Z56 A;  2QVA A;  3L73 E;  2P1J A;  1YQ3 C;  2BCC D;  3VP9 A;  2ZT9 B;  3H1H G;  5CCH C;  3H1H J;  3V5B A;  3CCU P;  4JF7 A;  3M9H A;  1G2C B;  4I7Z B;  2Q3E A;  1RF0 A;  3L72 G;  3L72 J;  1QLE D;  2KS1 A;  1H88 A;  3V4W A;  5KJ7 C;  1KD1 Q;  3NFQ A;  1OX3 A;  4L74 A;  3B8E B;  4EIJ A;  4GKG A;  2Q1K A;  1QL1 A;  3CME P;  2XKM A;  1G1I A;  2KYV A;  1OZH A;  4H44 D;  1QGK B;  3CWB G;  1K04 A;  3CWB J;  1KZU B;  3AEE C;  1ZR2 A;  1NTZ D;  2YKO A;  3H1I E;  3RK3 D;  4GOD A;  3DQY A;  2HMJ A;  2H8P D;  3RK3 C;  2PAJ A;  1VL2 A;  2KXP B;  2K9J B;  4HM0 A;  3IFM A;  1VQN P;  3L36 A;  1J2J B;  2KI7 B;  2NVE A;  5CCG D;  1JY2 O;  2JJL A;  2YIU B;  1FE6 A;  4PD4 D;  1M1K Q;  2XSH A;  3M9Q A;  1R8E A;  5CCG C;  3FWN A;  2ZXX A;  3A0B H;  2QA4 P;  1WQL A;  4A7P A;  2YKQ A;  2YO3 A;  3CXH I;  1IFJ A;  3GB4 A;  2NUK A;  2K9Y A;  2JDI H;  5TJH A;  4XA4 A;  1KC8 Q;  1N7S C;  2E75 B;  3V2Q A;  1ULI A;  3JCU E;  1EG9 A;  1G2C A;  2E4Q A;  3MUD C;  3CCR P;  3CXH H;  1OXZ A;  3CMA P;  1GL2 D;  1JY3 N;  3E1I A;  3JC2 2;  1J1D C;  3UIA A;  1VQ4 P;  2NPS B;  3GL0 A;  4NBH D;  2FY8 A;  1M1J B;  2L91 A;  5CCH A;  1W2E A;  3LW5 H;  2XZR A;  1N7S B;  1BGY J;  2K37 A;  1T2K C;  1M90 Q;  1Q82 Q;  2WIT A;  2QJK C;  1J1D B;  5KJ7 A;  4EDF A;  2QEX P;  3E7K A;  4EYY Q;  3AE5 C;  2WVR A;  1RFS A;  4Y99 C;  3GF7 A;  2E74 D;  2IYO A;  1ZP0 C;  3D6Z A;  2QJK B;  5DJU B;  3IR9 A;  3CLQ A;  2P67 A;  1EC5 A;  1OVR A;  3A7O A;  5CBO A;  3L75 D;  5GTI E;  2E74 C;  1GW4 A;  2FBW C;  2M3E A;  3CC7 P;  3CPW O;  2E76 C;  3CCE P;  1ZXG A;  1FZB A;  1NU1 E;  3AE6 C;  2W27 A;  4C7N B;  3AE2 C;  3FGA D;  2K9J A;  2O01 J;  2E76 B;  3HD7 B;  1EDI A;  1VCK A;  1AFO A;  3RK2 D;  3PTZ A;  1RE3 C;  2O01 H;  1USE A;  2WTY A;  1NTM E;  1SVF A;  2L5G B;  2QIW A;  4L76 A;  2WSS H;  4HJL A;  1VPC A;  4RO0 A;  4JBZ A;  2XR8 A;  1BE3 E;  2PFX A;  1N2D C;  1L4A D;  1Y47 A;  4PD4 I;  2ZYG A;  1UUV A;  4NBA D;  1KQG B;  1M1J A;  3B5N B;  4YTP C;  2B88 A;  5H2F H;  1N7S A;  1BCC G;  1BCC J;  2IX7 C;  1NTK G;  4PD4 H;  1NTK J;  3CL3 D;  3MUD A;  3HTK B;  3VMI D;  2IPP A;  1VQM P;  3KHU A;  1J1E B;  3ITK A;  5GTH H;  3PHL A;  1IFI A;  5E79 H;  2IDB A;  5APU A;  2KK7 A;  2Q3I A;  1NYH A;  2AEJ A;  2IZ1 A;  2N9B A;  1LT9 C;  2WSE J;  1FZG A;  3VMY A;  3CCQ P;  5AVT B;  2P10 A;  1RHZ B;  2R3C A;  1CI6 B;  2WSE H;  3I55 P;  1GD2 E;  5KLV D;  3BCC G;  3BCC J;  3TNU B;  3S1K A;  2QM7 A;  3Q5P A;  1L0N E;  4AUW A;  4P1B H;  3H1L E;  1ZW0 A;  2KSJ A;  3HE5 A;  1NTK K;  2D2C C;  2Q9I A;  4LLH A;  1HJB A;  1VQ8 P;  2OAR A;  3BRV B;  2UWJ E;  3P7K A;  1CZQ A;  5HL4 A;  1SQB G;  1SQB J;  1S9K E;  2D2C B;  1RE3 A;  2OYH C;  1M57 D;  1FOS E;  1NAY A;  1GW3 A;  4DCK A;  1A02 J;  2C9N Y;  1PGO A;  4GT1 A;  3RL0 D;  1YYC A;  4U3F G;  4U3F J;  2OYH B;  1R5S A;  3B5N A;  1EXJ A;  3GTE A;  1VQO P;  5AVX B;  3QWO C;  4DOJ A;  1EZV D;  3GTS A;  5B5E H;  4PV1 D;  4M3L A;  3O6Q B;  3S4R A;  4NPD A;  1M7L A;  3L74 D;  3EFG A;  3L70 E;  1X0T A;  3QH9 A;  2KNC B;  1H89 A;  5CXM A;  4PV1 C;  3MTU E;  4L73 A;  3CXH E;  2K3R A;  4W80 A;  3VMX A;  1LP1 B;  1ZRT D;  3AE7 C;  2H89 C;  5CMZ A;  4KHX A;  1VF5 D;  5AVR B;  1SQB K;  1JM1 A;  1GU4 A;  2QJY C;  1KN7 A;  3W67 A;  1VF5 C;  1LT9 A;  3NXS A;  1LWU C;  2I1J A;  2QRX A;  4EMJ B;  1NHL A;  2BCC E;  1NDO A;  1U7J A;  2O1J A;  2NWF A;  3H1H D;  5CBN A;  1LWU B;  1LTG C;  1IO4 A;  3HUS B;  2A45 G;  3L72 D;  1PV3 A;  2Z5I A;  2GBW A;  1WT6 A;  4Y28 J;  4LC1 A;  1W5C E;  1NAF A;  2HMM A;  2I1K A;  1H8A A;  1ZR4 A;  3P8C D;  2CKF A;  2OYH A;  3OAK A;  4QUR A;  3CWB D;  3GHG C;  3MZW B;  2KSE A;  2Y9Y A;  1NTZ E;  1JMB A;  2WQY C;  3ABV C;  3O6Q A;  3RK3 E;  2ZYL A;  3C9I A;  1RQV A;  2HMN A;  2Y0D A;  3PLN A;  2WSF J;  3KYQ A;  3H6P A;  2FXP A;  1SFC C;  2NVF A;  4BWN A;  2WSF H;  2BMQ A;  2N1T C;  1FZF A;  1QVF O;  1OW8 A;  1SQV G;  1KQS O;  1SQV J;  1O7H A;  4KJM A;  2RKL A;  1LTI C;  1PP9 G;  4PD4 E;  4RKU J;  1PP9 J;  1EZV I;  4YXD C;  3F5H A;  5KLI C;  1PL5 A;  5GTH E;  4H0L D;  3CI9 A;  5KAI H;  4H13 C;  1FU1 A;  3T97 B;  4QDF B;  4N78 E;  4H0L C;  4IFD K;  1JOC A;  2XND H;  1NVO A;  4H13 B;  2FYN B;  3BAT A;  2DE6 D;  5AVY B;  1PPJ G;  1LWU A;  1BDD A;  4WY4 B;  2ZT9 D;  1Q90 C;  1MFT A;  2FYU G;  2HPC B;  2W6B A;  2FYU J;  1DD3 A;  1EDL A;  1BGY D;  1QEX A;  1NKZ B;  1PGQ A;  4HKV A;  3OA7 A;  1W2B O;  2V4H A;  1BSN A;  4I7Z C;  1SQV K;  1VQ7 P;  1JEK A;  1EDJ A;  3V2N A;  2BMO A;  1N8R Q;  2AEF A;  5KJ7 D;  3RGU A;  3CC2 P;  4OVN F;  3AE4 C;  1LJ2 A;  3L75 E;  1S5L X;  1N73 B;  1NYK A;  3GHG A;  1S1C X;  4AIV A;  5AW3 B;  2PGD A;  3MIW A;  2GBX A;  5KTB A;  2B9B A;  3AEB C;  1LTJ B;  3CC4 P;  3Q5S A;  3V2R A;  2FYU K;  1SQQ G;  3AEA C;  1SQQ J;  1SFC A;  2R5B A;  5B5E E;  3SWY A;  3GMA A;  2N1T A;  4HB1 A;  2C9L Y;  3H1J G;  2PRR A;  3H1J J;  4QDF A;  1LTS C;  3H1L G;  3H1L J;  2B1X A;  2Y0C A;  2YIU C;  3WUT A;  3F89 A;  2AXT H;  4IFM A;  4HKZ H;  2JZA A;  2KIK A;  1JY3 O;  2HR3 A;  5AEW A;  4XE5 B;  3WU2 E;  2OYI C;  1RF1 B;  4W7Y A;  1ULJ A;  1BCC D;  1LTB C;  2O1K A;  2E75 C;  4U7J A;  1NTK D;  2NPS D;  1N7S D;  2OYI B;  3VTP C;  5K5G B;  2DE7 D;  1FZA A;  2NPS C;  1SQQ K;  1M1J C;  2W83 C;  1EDK A;  4CPG A;  3L71 G;  3L71 J;  3O8Z A;  2Q6Q A;  4C46 A;  1T2K D;  2CK3 H;  3CCV P;  2C0X A;  1JTH B;  1KIL C;  4PJ0 E;  1QX8 A;  1N73 A;  5AVV B;  5M1B A;  1KQL A;  2ZVN B;  4OGQ B;  3H1K G;  3H1K J;  1Q86 Q;  3M0A A;  1VQK P;  1KIL B;  5KLV E;  1JCC A;  2A06 G;  3BCC D;  3E1R A;  1JY2 N;  2IBZ G;  2HFE D;  4GOE A;  3B71 A;  1DEB A;  5BU8 B;  1RY3 A;  1IJD B;  1SP4 A;  1JCD A;  1SLQ A;  3L4F A;  2E76 D;  3HD7 D;  2FYZ A;  1VQP P;  1O7M A;  5TIS H;  4HM1 A;  2H7H A;  4IL6 X;  3HD7 C;  1QVG O;  2B89 A;  3II6 A;  2E5T A;  1YTZ I;  2I7F A;  1SQB D;  3FXD A;  2K1A A;  4NBD D;  4LGD E;  4HM8 A;  2KZI A;  4ASV A;  3D71 A;  4NPE A;  5B66 H;  3GCE A;  1DH3 A;  3SWK A;  1IK9 A;  1NH4 A;  1RQU A;  3OW2 O;  2YXR B;  5KAI E;  4U3F D;  3M06 A;  3C1L A;  1OWA A;  1BSH A;  1YHQ P;  4D6T G;  3H32 B;  1HUC A;  4D6T J;  1OW6 A;  1SQX G;  1SQX J;  1VQ6 P;  3L37 A;  3B5N D;  3GL2 A;  2OYI A;  3L74 E;  2NVG A;  4NPF X;  1A02 F;  2GUS A;  3B5N C;  1OW7 A;  1YJN P;  2JP3 A;  3NTN A;  1HBW A;  4C7R A;  1P84 D;  3AZC A;  1HVV A;  4HJG H;  1J1E C;  2NPS A;  1ZV8 A;  2IZ0 A;  3TGU G;  3TGU J;  2M5A B;  4HM5 A;  3KPE A;  1DD4 A;  1JNM A;  4L75 A;  2QM8 A;  5KAF E;  2JWD A;  2RMZ A;  4R4L A;  1S2E A;  4GIF A;  1KIL A;  2WZ7 A;  3AED C;  1URQ B;  4IOI H;  1AQT A;  2JEE A;  2RH0 A;  1ZOY C;  1KYO D;  3FOU A;  3H1H E;  3VMH D;  1SQX K;  2WPQ A;  2ZVO B;  3A0H H;  2R32 A;  3CCM P;  3L72 E;  1GK6 A;  1IC2 A;  1L0L G;  1L0L J;  1HJ0 A;  1VQL P;  3BVH A;  4C7N A;  3KZI H;  2O3J A;  3AE3 C;  1FDO A;  3VN0 A;  2D2C D;  2OGU A;  3HD7 A;  3P8C E;  1Q2N A;  3EWK A;  4KT0 J;  3KXD A;  3M0D C;  3L73 G;  3L73 J;  2Z5H A;  3G71 P;  2QE7 H;  5AW2 B;  4QUQ A;  2IYP A;  1WMK A;  4IFF A;  1LGH B;  2YFJ A;  2H43 A;  3N0Q A;  2I8D A;  2WT7 B;  2OTJ P;  1Q7Y Q;  4N6J A;  3A0B E;  1L0L K;  3U59 A;  1SQV D;  2C0W A;  1JMM A;  1PP9 D;  2R5D A;  1VM9 A;  3HTK A;  1FZC B;  4OWF A;  2YKP A;  1ZLL A;  1WRG A;  1G1J A;  1P84 I;  1KB9 D;  3H1I G;  3H1I J;  1DEE G;  2PP6 A;  3HE4 B;  3USS A;  1PPJ D;  3G9R A;  2RN0 A;  2BAS A;  1P84 H;  4ZNC A;  3S9O A;  1O7W A;  1SQP E;  2FYU D;  1BGY E;  1CI6 A;  4NBC D;  4TLF A;  4TT3 H;  3ZDM A;  2VRS A;  3TNU A;  1FS0 E;  2NUM A;  2WPS A;  3Q5R A;  2YFI A;  1KYO I;  1UII A;  1T3J A;  5AEU A;  3AE8 C;  3HUS C;  4JPZ B;  3NMD A;  3GKE A;  4BRY B;  3BRT B;  5TIS E;  1XTC C;  5AVU B;  2OTL P;  2B87 B;  2A45 I;  1PZQ A;  1KYO H;  5AW5 B;  3M91 A;  1GDT A;  1OVV A;  4I6M C;  2YXQ B;  1FDM A;  1FDI A;  4JQ0 D;  3M0D A;  2B24 A;  5B66 E;  2HMO A;  2A45 H;  2GA1 A;  1FJK A;  3IF4 A;  3MP7 B;  3JCU H;  2HOD B;  4RJT A;  3AEC C;  2XDJ A;  3TK1 A;  4R4M A;  1KMI Z;  4QUP A;  2QJP B;  3EFF K;  1SQQ D;  1NO4 A;  3CD6 P;  2E5Y A;  1SFC D;  3H1J D;  1MKM A;  4AYC A;  2KNC A;  3H1L D;  2N1T D;  2XV5 A;  4HH2 A;  2AEM A;  4P1C H;  2DW3 A;  1AVY A;  1KFN A;  1OVU A;  3FWL A;  1JUN A;  5H2F E;  1LP1 A;  4QMA A;  2W6J H;  3GOB A;  1NU1 G;  4DJG A;  1NOH A;  1NU1 J;  1HF9 A;  1JY2 P;  2R44 A;  4H13 D;  1S9K D;  1E79 H;  4BXL A;  2JR8 A;  3G4S P;  3D70 A;  3SFE C;  4WB4 A;  4WY4 D;  2FYN C;  4NBF D;  1FBM A;  5E79 E;  1O7G A;  3HRN A;  1KB9 I;  1NTK E;  1USD A;  2G8Y A;  5APY A;  5AVW B;  4ZMD A;  4WY4 C;  4XFJ A;  2KUB A;  3PP5 A;  1S72 P;  4MN4 C;  4BRY A;  2Y0E A;  2Q7C A;  1NTM G;  1NTM J;  1Q90 D;  1KB9 H;  2O01 N;  3L71 D;  1EXI A;  3HUS A;  3G3Z A;  1BE3 G;  1BE3 J;  3VMG D;  3KZI E;  2DE5 D;  2KOG A;  1UUW A;  3W68 A;  3P32 A;  5KKZ B;  3H1K D;  4ZKU A;  2V7Q J;  5CHX A;  1JO5 A;  3AEG C;  1NU1 K;  3RBX A;  2W8Z A;  2A06 D;  1N73 C;  2IBZ D;  1FQT A;  3MD0 A;  3VMZ A;  2FXM A;  5AW9 B;  1GMJ A;  1LTJ C;  4HM2 A;  1XTG B;  1T8Z A;  1D7M A;  2M8R A;  5AW6 B;  1NTM K;  1H0T B;  1SQB E;  1N7L A;  4NB8 D;  3JSV C;  1NJI Q;  3H25 A;  3MGN A;  1HGV A;  1KFM A;  2KLV A;  1FAV A;  4U3F E;  3GZY A;  2G3A A;  2KZJ A;  1YQ4 C;  4WVZ A;  2W90 A;  1L0N G;  4D6T D;  1L0N J;  3T97 A;  4WWI A;  1SQX D;  4N3Y B;  2WPV B;  1NGM B;  4H44 C;  1RF1 C;  3Q3D A;  4I2L C;  1P84 E;  1FJP A;  4WY4 A;  3A2A A;  3WUV A;  2WSC J;  1FC2 C;  2E75 D;  4K3A A;  4H44 B;  2HPC A;  2HML A;  3SSU A;  1JM0 A;  2ZYA A;  1O7P A;  3TGU D;  1HTL C;  3CX5 D;  1MV8 A;  2WPR A;  2WSC H;  3TYY A;  3LID A;  3AE1 C;  4NB9 D;  1PGJ A;  1KQF B;  4QDD A;  3RK3 B;  1SS1 A;  3IAO A;  4OGQ D;  2ZAE B;  4UB8 H;  4O9B A;  1KIL D;  1KYO E;  2OYO A;  3B4S A;  4JYB A;  4OGQ C;  3K5B A;  3L70 G;  1L0N K;  3L70 J;  1RIE A;  2XU6 A;  4N78 D;  1AVO A;  3PRJ A;  1K73 Q;  1S5L H;  2Y9Z A;  1T3U A;  5APS A;  2YO2 A;  3RL0 g;  3Q2Y A;  1L0L D;  2JKV A;  1TU3 F;  5APV A;  1H0T A;  3LW5 J;  2E4P A;  2QSI A;  3U1A A;  1LTJ A;  2BMR A;  4K35 A;  4NBG D;  2WMM A;  3GG2 A;  3G6E P;  2IBZ I;  2J58 A;  1SQP G;  1SQP J;  2Q5U A;  1BGY G;  5EFW B;  2P58 A;  1GL2 C;  5BVZ A;  3Q1M A;  1LNQ A;  1OFC X;  2HLO A;  4DZO A;  2LXB A;  3EQ2 A;  2POH A;  3L73 D;  2BCC G;  2BCC J;  4B86 A;  1YIT P;  2E43 A;  4NBB D;  1GL2 B;  5APX A;  3SWF A;  3AE9 C;  2YMY A;  2LXC B;  3D89 A;  2YVJ B;  4Y99 B;  1X22 A;  1E5W A;  3C0D A;  1JB0 J;  4ZKP A;  1RF1 A;  1SQV E;  1YJW P;  1PP9 E;  5L8R J;  3AEF C;  1RH5 B;  3TDK A;  3VCA A;  2E74 B;  1EZV E;  3GZX A;  1K8A Q;  5CJ4 A;  1SQP K;  3KDP B;  1G8K B;  2N9Y B;  1NTZ G;  2R3S A;  1EQ7 A;  1NTZ J;  1YIJ P;  2OQQ A;  1YI2 P;  1KB9 E;  3HE5 B;  3R4Y A;  3H1I D;  2NZ2 A;  3V2P A;  2JWA A;  1URQ D;  1AQ5 A;  1K9M Q;  3RK2 C; 
#chains in the Genus database with same CATH homology
 2QJP C;  4HM2 A;  4HM0 A;  1ZRT E;  1PPJ E;  4AAY B;  4H0L D;  4HM4 A;  2NVE A;  2JO6 A;  4P1C H;  3FOU A;  3BCC E;  3H1H E;  2E76 D;  1SQB E;  4QDF B;  1VCK A;  3VMH D;  4QDF A;  1L0N E;  2FYU E;  1O7M A;  2E4P A;  2YFL A;  2XSH A;  4EMJ B;  4NB8 D;  4HM1 A;  3EN1 A;  4P1B H;  5BOK A;  2B1X A;  2BMR A;  3H1L E;  2BCC E;  1NDO A;  3GOB A;  3L72 E;  2XRX A;  2YIU C;  4NBG D;  1WQL A;  4QCK A;  2I7F A;  2NWF A;  4H13 D;  1O7W A;  4D6T E;  1O7N A;  4QDC A;  2DE6 D;  4NBD D;  1NTM E;  1SQP E;  3L73 E;  4HM8 A;  1SQX E;  1BGY E;  4U3F E;  3GZY A;  3GB4 A;  4NBC D;  4HJL A;  2JZA A;  2NUK A;  4NBF D;  2FYN C;  3GCE A;  2XR8 A;  5HL4 A;  2ZT9 D;  1Q90 C;  5AEW A;  2GBW A;  1O7G A;  1NTK E;  2D2C D;  2NUM A;  2YFI A;  1BE3 E;  1ULI A;  3L71 E;  1EG9 A;  5AEU A;  2E4Q A;  3GKE A;  4HKV A;  1ULJ A;  2Q3W A;  4NBB D;  2HMM A;  1UUV A;  3GL0 A;  4NBH D;  4NBA D;  2CKF A;  3GL2 A;  1P84 E;  3TGU E;  4QUR A;  2BMO A;  3GTE A;  1SJG A;  3CX5 E;  3L74 E;  2DE7 D;  2NVG A;  4NBE D;  1BCC E;  3D89 A;  2YVJ B;  1G8J B;  3H1K E;  1NTZ E;  4QUQ A;  2QJK C;  3C0D A;  3VMI D;  2E75 D;  3VMG D;  3GTS A;  2DE5 D;  2HML A;  3EQQ A;  4H44 D;  2B24 A;  4PV1 D;  1O7P A;  2HMO A;  1UUW A;  1SQV E;  2XSO A;  3AZC A;  3CWB E;  1RFS A;  2ZYL A;  2A06 E;  3L75 E;  2HMN A;  1PP9 E;  3L70 E;  2YFJ A;  2IBZ E;  3N0Q A;  1NYK A;  3VCA A;  5CXM A;  1SQQ E;  1EZV E;  2E74 D;  3H1I E;  3GZX A;  4NB9 D;  3VCP A;  4AIV A;  3CXH E;  4HM5 A;  2GBX A;  4QDD A;  5KKZ C;  4HM3 A;  1G8K B;  2NVF A;  4OGQ D;  4HM7 A;  3H1J E;  4HM6 A;  2BMQ A;  4QUP A;  1KB9 E;  3DQY A;  2HMJ A;  1VM9 A;  1FQT A;  5KLV E;  1KYO E;  1VF5 D;  2HMK A;  1O7H A;  1JM1 A;  1NU1 E;  2QJY C;  2QPZ A;  4PD4 E;  1L0L E;  1RIE A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...