3L75E

Cytochrome bc1 complex from chicken with fenamidone bound
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY ACRYLATE INHIBITORS IN THE Qo SITE OF THE BC1 COMPL AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO CLOSE TO BUT DISTINCT FROM THAT SEEN WITH STIGMATELLIN AND OTHER "DISTAL" Qo INHIBITORS.
rcsb
total genus 48
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3l75E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3l75E02
4AIVA 3H1IE 1EZVE 3BCCE 4NBBD 2HMKA 5BOKA 2HMOA 2NVEA 2YFLA 1O7MA 2BCCE 3GTSA 4QDDA 1SQBE 2E4QA 4QUQA 4HM8A 5AEUA 5KKZC 3GCEA 4P1BH 1KYOE 3H1KE 4HJLA 5KLIC 2YIUC 4QCKA 1ULJA 3L73E 3AZCA 4P1CH 1WQLA 1SQXE 1JM1A 4NB9D 4QDCA 1SJGA 1ULIA 2DE6D 2I7FA 3TGUE 1EG9A 1PP9E 1FQTA 1KB9E 2GBWA 2YVJB 2GBXA 1NU1E 2B1XA 4HKVA 1SQVE 4HM5A 2HMNA 4HM4A 3L75E 4QURA 2HMMA 3DQYA 5AEWA 3H1JE 1ZRTE 4NBED 3GTEA 2YFJA 3C0DA 2XR8A 2NWFA 4H13D 2XRXA 1O7WA 2B24A 2NVFA 1P84E 2BMOA 3H1LE 2DE7D 1UUWA 2XSOA 2BMRA 1BGYE 2Q3WA 2XSHA 2E4PA 1NTZE 4HM3A 1NTKE 1NDOA 2NVGA 3D89A 3GB4A 1G8KB 2NUKA 1O7PA 3VMHD 1L0NE 2E75D 2HMLA 2FYUE 1SQPE 4U3FE 3L71E 3L72E 4PD4E 2DE5D 2ZYLA 4QDFA 4NBAD 1RFSA 4HM0A 4EMJB 3L70E 2D2CD 2QJPC 4NBDD 3GL0A 2NUMA 3CWBE 1RIEA 5HL4A 1NTME 4H44D 2QJYC 1O7GA 4AAYB 2JZAA 1SQQE 3GZXA 3CXHE 1VCKA 4NBGD 4OGQD 5CXMA 3VCPA 1UUVA 4H0LD 3EQQA 4HM1A 2BMQA 2ZT9D 3VMGD 2A06E 3VMID 1BE3E 3GZYA 3GOBA 4NBHD 4NBFD 2CKFA 2FYNC 3EN1A 4NBCD 1L0LE 3GL2A 2E76D 3L74E 1G8JB 3FOUA 2HMJA 3VCAA 3N0QA 4QUPA 4NB8D 1BCCE 4QDFB 3GKEA 1Q90C 5KLVE 1VM9A 4HM6A 4HM7A 1PPJE 3H1HE 4PV1D 1O7HA 2QJKC 2IBZE 2E74D 3CX5E 1VF5D 2JO6A 2QPZA 2YFIA 4D6TE 1O7NA 4HM2A 1NYKA
chains in the Genus database with same CATH superfamily
1EZVE 1USDA 2G8YA 2NPSD 2OYIB 5B5EE 5KAFE 2V7QH 1BGYD 2B87A 3VMAA 1JM1A 4U3FG 1FZCA 1HVVA 3SWFA 1HJBA 1NTMG 2IX7C 2HMMA 1HBWA 2NPSC 3V4WA 1BE3G 3O6QB 1KFMA 3WU2H 4EIJA 1VQMP 4HM3A 3AEFC 1IO4A 2QE7H 2OTKE 4EDFA 5KLVG 1IFIA 1SQVK 3H1HG 1RFSA 2IZ1A 1KZUB 3TNUA 2ZJSE 1QL2A 1IFMA 2VRSA 1RIEA 5HL4A 2W83C 1VQ4P 2KS1B 1VL2A 1OX3A 3GZXA 4DZOA 3AE1C 1GD2E 1MZ9A 4GODA 1EDLA 4TT3H 2YKQA 2W8ZA 2E5YA 5AVVB 1YJ9P 3FOUA 1VQPP 1M56D 1GL2D 4IFFA 3L72G 1JO5A 5AVXB 3CCQP 5AVSB 4PD4H 2QG4A 3H1IE 2HMKA 2YFLA 2FXOA 4IOIH 2WTYA 4CPGA 5AW1B 3CXHI 4HM8A 1PGQA 1Q81Q 2YO2A 5AW2B 2A45H 3L73E 5AVQB 4Y99B 2RKLA 3E1RA 4OVNF 1ULIA 1GL2C 1GDTA 1PP9E 1QGKB 5H2FE 2YMYA 2FBWC 2KZIA 2WQYC 1QX8A 1AQ5A 2GUVA 2WPRA 4AYCA 4H13D 2P1JA 2XV5A 3CX5H 2Y9YA 3A0BH 1JY2O 2XSHA 1U7MA 2Y9ZA 4R4MA 1RH5B 2NUKA 3CC7P 4W7YA 1BCCD 2OYHC 5TISH 3L36A 4OH8B 1ZR4A 3VP8A 2PAJA 1BSHA 2QJYC 1UIIA 3L73J 1GL2B 1KILC 1YQ3C 1PP9J 4UB8H 4NBFD 1M7LA 2I1JA 3U1AA 1NU1K 1LTJC 2E76C 1SQVG 1Q90D 1LP1B 1N7LA 1NU1D 2JJLA 3P8CE 1M8OB 1VF5D 1IFJA 2ITAA 2FXMA 2HMOA 1MFTA 1AA0A 1H8AA 2NRGA 3H1KE 1GW3A 2JO1A 2H7HA 2OYHB 1KQGB 3AE7C 5BU8B 4QDCA 3SWYA 1DX7A 1YYCA 1L0ND 1T8ZA 1WRGA 3TGUE 3CCLP 2HG5D 1OXZA 1JMMA 3NXSA 4K3AA 2QJYB 1EQ7A 3TYYA 4HKVA 3DQYA 2E42A 2KK7A 2GA1A 5L8RJ 1KILB 2AXTH 2KXPB 1LTJB 2E76B 2ZVOB 3A2AA 2N1TA 2J58A 3V2NA 3NMDA 1J1DC 3VMHD 2HMLA 1SQPE 4L73A 1FZGA 3EFFK 1PPJD 4NBDD 1H0TA 3CWBE 1EZVG 1SQBK 2JR8A 2QSIA 4BRYA 2RMZA 3PHLA 2R5BA 2QEXP 3W67A 3M91A 1HUCA 5TJHA 1SQBD 4H0LD 3EQQA 3Q5RA 3HD7B 4GOEA 3VTPC 3GOBA 4NBHD 1L0LE 2PFXA 1CZQA 3JCUE 1VQOP 3RK3D 2IBZE 1S2EA 2WSEJ 1L4AA 2W6AA 2M5AA 1O7MA 4KT0J 4HH2A 3H1LD 1NTKK 1J1DB 2N9BA 2YO3A 4RO0A 2FYUK 2HLOA 1NTZD 3TK1A 1CI6A 1NTKD 2B87B 2K88A 4KJMA 2XZRA 2FYUD 1KB9E 2QRXA 1FZCB 1OMIA 1N7SD 2HMNA 4BXLA 4D6TJ 4KHXA 3WUTA 3GTEA 1PFIA 3B5ND 2FFDA 1NHLA 3HTKA 2FYZA 2P58A 2NZ2A 2R3CA 3H32B 4IL6X 2QA4P 3G4SP 5KAIH 3HUSA 1N7SC 3GG2A 1DEBA 2I8DA 3L72E 5GTHE 1ZN5A 1OFCX 2YNYA 2I1KA 3B5NC 2ZAEB 2DW3A 1R8EA 3TNUB 1VQNP 5CCGA 1SQQE 4U7JA 2FXPA 4GOFA 1E79H 4HM1A 1MV8A 1EXIA 3TSIA 3L73G 1Y8AA 1OWAA 5CMZA 2WWWA 5M1BA 1PP9G 4JF7A 5CCHD 4QDFB 4HM6A 3O8ZA 4GKGA 3RL0B 3L75D 3II6A 2E43A 2H88C 4WBAA 3BCCE 1YI2P 3AE3C 1WT6A 3WU2E 2IBZI 4QDDA 1OVVA 2WSEH 1VQ6P 1N7SB 1HGVA 2BASA 2M8RA 4QCKA 4IFDK 3AZCA 4QMAA 2YKPA 1ZV8A 2IZ0A 3VMZA 4U3FD 4IL6H 4DT0A 3CCSP 2ZVNB 3VP9A 2Z4EA 4QURA 3C9IA 2JP3A 3H1JE 1NTMD 1ZRTE 2KLVA 4NBED 3BRTB 1KQLA 2BCCJ 3MIWA 1UUWA 5E79H 2BMRA 3I55P 1BE3D 3UIAA 1AFOA 1KYOH 3L70D 1K73Q 3L71E 1SLQA 4PD4E 5KLVD 3Q3DA 1M57D 1CSBA 1EDKA 2KNCA 1URQD 2W90A 4N78E 2NUMA 1N73C 1RF0A 1KORA 3H1KG 1BGYJ 1LTAC 2A06E 2CPBA 3AEDC 1VQ9P 2WSSH 3TGUG 1FZBA 1URQC 1JY3P 2CK3H 2JO6A 4WY4A 3CX5E 1JY3O 3SWKA 3A0BE 1HF9A 1LT9A 3SFEC 1NAYA 3G6EP 1FU1A 3M0DC 3L71J 2LKMA 5TISE 3HE4B 1SQPG 2I7FA 3QWOC 1GK4A 1N73B 1Q82Q 5APVA 3CWBG 1FBMA 3A3YB 2QIWA 3CCEP 1SFCD 1K8AQ 4YXDC 1WMKA 3GHGA 3AEAC 2WVRA 4LLHA 1M1JC 1LWUA 3T97A 2FKWB 1G2CB 4UB8E 2HODA 2WT7A 1L0LG 1URQB 2JEEA 3HE5B 3NTNA 2XDJA 4ASWA 1O7PA 1S9KD 2R32A 3PTZA 5AW5B 1SFCC 1RE3A 4NBAD 2IBZG 3N7NA 3C8VA 4R4LA 2JKVA 4H44D 1N86A 5KJ7A 1PIXA 2C0WA 3BVHA 4JYBA 1VCKA 4OGQD 1P84I 2OQQA 2P10A 2BMQA 2KI7B 3VMGD 5AVTB 5EFWB 2CKFA 1RF1C 2A45I 3EN1A 4NBCD 3G9RA 3R4YA 4Y99C 1IK7A 2HFED 1DD4A 4H44C 1SQVD 5AW8B 1M1JB 2XU6A 2E74C 1BSNA 2AXTE 2K9JA 4OGQC 3CCMP 1NYKA 3U59A 3ITKA 1P84D 3CX5I 2M5AB 1LTSC 1ULJA 3RK2D 1SFCB 2J5UA 2D2CB 2DE6D 1JCDA 3QH9A 1BCCJ 1EG9A 3P32A 1FQTA 2M3BA 3OAKA 1H89A 3V2QA 3F89A 1M1KQ 1SQQG 1VQ7P 2IDBA 1EZVI 1RF1B 3RK2C 5KKZB 2W6JH 3HTKB 2E4PA 3VMXA 3D6ZA 3AE6C 4H44B 5APWA 3AEBC 4HKZH 2E74B 1IFDA 2QVAA 4OGQB 1NU1J 4GIFA 1YIJP 1LTIC 1JY2P 3P8MC 3BCCG 5CBOA 4RKUJ 3CXHD 1EZVD 4L75A 4AAYB 1X9VA 2POHA 2YKOA 2XKMA 2H43A 1KILD 2V4HA 2ZXEB 1KD1Q 1PV3A 1L0NJ 2E76D 4N6JA 2JWAA 4QUPA 2QM7A 1JM0A 3GF3A 3FWNA 3H1JG 3D71A 3S4RA 3RK2B 2Y0DA 2K1AA 5APTA 1DEEG 3GTSA 1FDMA 2OTJP 1DIPA 1ZW0A 1OVUA 2P67A 5AW4B 5KAIE 1YHQP 5CCHA 3RBZA 1FZAA 1OZHA 3L71G 1OIPA 3HD7D 3CPWO 2KSEA 1KV4A 1YBKA 1NH4A 3LW5J 2K37A 2WPVB 2AEJA 1DH3A 1VDFA 3BRVB 5BU5A 2A45G 3VOPA 1U7JA 2BMOA 1EDIA 2A06G 1RE4A 3I56P 2C0XA 1ZR2A 1MFZA 3HD7C 4JQ0D 3EFGA 3Q5PA 3MUDA 1ZXGA 2R3SA 4LC1A 2M3EA 2ZYLA 3B4SA 2KZJA 2Q3EA 4HM0A 4PJ0H 2L5GB 1NKZB 1X8YA 3CC4P 3H1ID 2C9LY 2O1KA 3H1LJ 4I1LA 2Q9IA 2OYIA 2KIKA 1FOSF 1UUVA 1NTZJ 3H6PA 3GZYA 1NTKJ 3L73D 2FYNC 4ZKUA 4IL6E 1RY3A 2ZYDA 1RQVA 1X22A 2FYUJ 1EDJA 4DOJA 1PP9D 1YTZT 3F5HA 5CHXA 1FZCC 5AW6B 2QJKC 2YMKA 4YXWH 4D6TE 2W6BA 1FJKA 4AUWA 5E79E 4Z1MH 1A02F 3O6QA 1KYOE 2H8PD 5AW0B 3P7KA 4P1CH 1SQXE 1KN7A 4TLFA 3JSVC 3D70A 3AE9C 3CCUP 1VQ8P 2LXBA 4NPEA 2B1XA 4ZMDA 1ZP0C 2W27A 5APSA 1IK9A 1FOSE 1FDOA 2OARA 1MUUA 4N3YB 2YFJA 3RL0D 2FYNB 3LW5H 1X79B 3T97B 1LWUB 1NVOA 4YTPC 2HODB 4EOTA 3E7KA 1G8KB 1FDIA 2QJKB 5AW3B 2NPSA 3M06A 1Q86Q 1N2DC 5KTBA 3L70E 2QJPC 3P8CD 3KZIH 3RL0C 4YPCA 3CCJP 1NYHA 5B66H 1SQXJ 1YQ4C 3H1KD 1DD3A 3SSUA 3GL2A 4RJTA 3L74E 4HJGH 3TGUD 5DJUB 3GKEA 1Z56A 1W5CE 2HPCA 1NTMJ 2Q7CA 4W80A 5AVYB 4HM2A 4AIVA 3A5TA 1AV1A 2BCCE 2K9JB 2AXCA 3E1IA 3GCEA 1IFNA 1QVFO 3I5CA 1SQPK 1TU3F 5CJ4A 1K04A 3U1CA 1FZEA 3R2PA 1WQLA 4NB9D 1NWQA 3L70J 2QJPB 1KYOI 1SQPD 5KLVJ 5AVRB 2GUSA 2B9BA 1A02J 2YVJB 4UB6H 1XTCC 4HM5A 3CWBD 2Q3IA 1VQ5P 3CC2P 5AW9B 5APQA 3C1LA 1L0LK 1NJIQ 2KLUA 3L74J 1GL2A 1BGYE 2KUBA 2H89C 1L0LD 2O01N 3AE5C 3D89A 4NPFX 3B71A 1Y47A 1S1CX 1KB9I 2IBZD 2WSFJ 2M0BA 2E5TA 2YXQB 3PJSK 3KQGA 3AEEC 2JZAA 1LTTC 3CD6P 2ZT9D 1FAVA 3VYIA 4GT1A 3AEGC 2K3RA 2ZXXA 3ABVC 2OYHA 1G8JB 4IFMA 3H1HD 1ZLLA 1KB9D 2OTLP 4L76A 2B88A 3OA7A 5CBNA 4JYCA 1Q2NA 3MTUE 1NO4A 2BEQD 2ZT9C 1KFNA 1KILA 3WUVA 1T3UA 2KYVA 2E4QA 2Q5UA 1LTJA 4JPZB 4HJLA 2YIUC 1YTZI 2Q6QA 1GZLA 1HH0A 1KC8Q 2N1TC 1SVFA 3L72D 1SQQK 5AEWA 4ZKPA 3S1KA 3NFQA 1G1JA 1SQQD 3TDKA 2JDIH 2Z5IA 2Q1KA 2O01J 1FZFA 2Q3WA 1VQLP 1JTHA 1NDOA 1L4AD 3GB4A 3Q2YA 1YJNP 1QEXA 4BWNA 1SQVJ 5APXA 1GU4A 2ZT9B 3V4QA 2D2CD 3RGUA 4D6TG 3BCCD 1O7GA 2YIUB 1KQSO 4EYYQ 3CXHE 2WSFH 1L4AC 3JC22 2N1TB 1SQXG 3IF4A 1JY3N 3IR9A 3L37A 2OGUA 1GW4A 1KILE 4O9BA 3RL0g 3GMAA 3CMEP 2D2CC 2YXRB 1BCCE 3BATA 3HRNA 4PD4I 1H0TB 1D7MA 1Q7YQ 2E74D 4BRYB 3H1JD 1ZRTD 3MGNA 5BOKA 4XE5B 2NVEA 2IYPA 4QUQA 4XA4A 2PRRA 5KKZC 4P1BH 2FFDC 1T3JA 1W2BO 1HGZA 3H32A 5CCGD 2WITA 3L4FA 1GU5A 4PJ0E 3L71D 3L70G 4PD4D 1S5LH 2R5DA 1NU1E 3HUSC 4C7NA 2N9YB 4N78D 3M9HA 1L4AB 2IFMA 2XRXA 2B24A 1JOCA 2XSOA 2Y0EA 5CCGC 2A06D 2PGDA 1CI6B 3L74G 3KPEA 2O01H 1BDCA 1L0NE 2FY8A 2RH0A 4QDFA 2NPSB 1FS0E 3CX5D 1USEA 2BCCG 2FFDB 3PLNA 4A7PA 1GTWA 4NBGD 5CXMA 3WUUA 1P84H 5AW7B 4HYTB 1N7SA 1J1EC 3S9OA 3HUSB 2PP6A 4JBZA 5GTIH 3B5NA 3N0QA 2IPPA 3VMYA 1PGOA 5K5GB 1PPJE 1O7HA 2ZYAA 2B89A 2P2UA 2HPCB 3FWLA 4NBBD 4K35A 4B86A 1LTGC 1SQBE 1BGYG 5APYA 1LJ2A 5AEUA 1XTGB 5KLIC 3A0HH 2QM8A 5C39A 1SJGA 1AVOA 1VQKP 3KZIE 1EXJA 3AECC 1PZQA 3RK3E 5B66E 3H1IJ 1ZOYC 3GF7A 4H13C 2NWFA 4NPDA 1OW7A 1J1EB 1FE6A 3A7OA 3USSA 3H1LE 3CXHH 3L35A 3KYQA 1RF0C 3AE4C 1J2JB 4WY4D 1NTZE 5B5EH 5KAFH 1NTKE 1E5WA 3GLMA 1NKNA 2G3AA 2HYNA 1JY2N 3IFMA 2FYUE 5CJ0A 4I2LC 3GW6A 4RESB 2DE5D 1N8RQ 1M90Q 3GL0A 1ZMEC 1SQBJ 3LIDA 3MD0A 5KLIB 3EQ2A 4WY4C 1OVRA 2IYOA 1LT9C 1H88A 2RN0A 3FGAD 3FX0A 1L0NK 4UB6E 3HE4A 5BVZA 2HMJA 3TF5A 1R5SA 1Q90C 1N73A 1R5LA 4H13B 1VM9A 3MHVA 4W7ZA 2KNCB 1LGHB 3V6IA 4PV1D 1VF5C 2WMMA 1Y9BA 1FJPA 1QVGO 1AQTA 3B8EB 4L74A 1PL5A 1G2CA 3GHGC 2HR3A 2XNDH 3K5BA 4LGDE 1IFPA 3V5BA 1HWTC 4Y28J 1LWUC 1FC2C 1URQA 3HE5A 5KJ7D 1T2KD 4C7RA 3PRJA 1T6AA 4WVZA 1LT1A 4PV1C 4HB1A 3KXDA 4GDOA 1VPCA 4WY4B 4HM4A 3L75E 1AJYA 2JWDA 1RE3C 3G3ZA 1IZNB 1LT9B 3M0DA 4C46A 1LTBC 5KJ7C 3H1KJ 2Z5HA 1T2KC 2BEZF 1IC2A 3TGUJ 2LR2A 1BCCG 3IAOA 1JB0J 1VF5B 1JTHB 2E75D 3G71P 3Q5SA 4U3FE 1MKMA 3EWKA 2GM4A 5AVWB 3VN0A 1M1JA 2AEFA 5H2FH 2KS1A 1NTME 3GHGB 2WZ7A 3LIEA 1KQFB 1OW6A 4DCKA 3PH0A 2O1JA 1SP4A 4H0LC 2XNXA 2WT7B 1JNMA 3VMID 1BE3E 1NTZK 4PV1B 1RHZB 2E75C 2P7JA 1SFCA 1W2EA 1SQPJ 3L75J 1NU1G 5KLVE 3WMM0 3RK3C 3CWBJ 3H1HE 1NAFA 2ZFCA 1RQUA 2IFNA 1HTLC 1RF1A 1LNQA 1L2PA 1CW5A 5APUA 1NOHA 1L0LJ 4U3FJ 4MN4C 1L0NG 5AVUB 1SS1A 1KMIZ 1S4XA 4WB4A 1X0TA 3ZDMA 4OWFA 2GBWA 2GBXA 4EI2A 1K05A 4H0LB 5AVZB 4C7NB 3C0DA 2XR8A 1BE3J 3H1IG 2NVFA 2E75B 3D6YA 2Y0CA 4M3LA 2OYOA 2LXCB 2DE7D 3CL3D 1HJ0A 3OW2O 1EC5A 2NVGA 1NGMB 3RK3B 4AQRD 3H1HJ 1PPJG 1PGJA 1K9MQ 2C9NY 3KDPB 3Q1MA 1JMBA 2MJZA 3W68A 4D6TD 3CMAP 1SQBG 3PP5A 2WSCJ 1SQXK 1GK6A 1KYOD 1SQXD 1S5LE 2CPSA 1LP1A 1S9KE 3VCAA 3L72J 5CCHC 1QL1A 3B5NB 1NTMK 2AEMA 4WWIA 2QPZA 3M0AA 4ASVA 1JCCA 2V7QJ 3BASA 3H1LG 1SQQJ 2K9YA 1OW8A 1PGPA 3CI9A 3SFDC 1AVYA 1NTZG 2SPZA 4XFJA 1NTKG 3MP7B 3H25A 4DJGA 1RE4C 2KP8A 3AE8C 2FYUG 1BDDA 2N1TD 5KLVK 3OJAB 1SQVE 3RBXA 3MUDC 3MZWB 1UIXA 3BCCJ 1YITP 3CCVP 3JCUH 4I7ZC 5DJTB 1O7WA 1P84E 1GMJA 2UWJE 5GTIE 2O3JA 1JUNA 2OYIC 2L91A 3L74D 3FXEA 2KOGA 4EMJB 3H1JJ 1U57A 4ZNCA 1KB9H 1QLED 3KHUA 3M9QA 2WPQA 2BCCD 2MKVA 3HD7A 1G1IA 3VCPA 3A0HE 1S72P 1S5LX 3CLQA 2WPSA 1KTMA 3N4XA 3V2PA 2R44A 2WSCH 2ZYGA 2J59M 3M9BA 3CCRP 3FXDA 4NB8D 2KSJA 4I6MC 4I7ZB 1S3JA 3V2RA 3L75G 4HM7A 1JEKA 1YJWP 3IN6A 1IJDB 3AE2C 5GTHH 2YFIA 2KB7P 1O7NA
chains in the Genus database with same CATH topology
4AIVA 3H1IE 1EZVE 3BCCE 4NBBD 2HMKA 5BOKA 2HMOA 2NVEA 2YFLA 1O7MA 2BCCE 3GTSA 4QDDA 1SQBE 2E4QA 4QUQA 4HM8A 5AEUA 5KKZC 3GCEA 4P1BH 1KYOE 3H1KE 4HJLA 5KLIC 2YIUC 4QCKA 1ULJA 3L73E 3AZCA 4P1CH 1WQLA 1SQXE 1JM1A 4NB9D 4QDCA 1SJGA 1ULIA 2DE6D 2I7FA 3TGUE 1EG9A 1PP9E 1FQTA 1KB9E 2GBWA 2YVJB 2GBXA 1NU1E 2B1XA 4HKVA 1SQVE 4HM5A 2HMNA 4HM4A 3L75E 4QURA 2HMMA 3DQYA 5AEWA 3H1JE 1ZRTE 4NBED 3GTEA 2YFJA 3C0DA 2XR8A 2NWFA 4H13D 2XRXA 1O7WA 2B24A 2NVFA 1P84E 2BMOA 3H1LE 2DE7D 1UUWA 2XSOA 2BMRA 1BGYE 2Q3WA 2XSHA 2E4PA 1NTZE 4HM3A 1NTKE 1NDOA 2NVGA 3D89A 3GB4A 1G8KB 2NUKA 1O7PA 3VMHD 1L0NE 2E75D 2HMLA 2FYUE 1SQPE 4U3FE 3L71E 3L72E 4PD4E 2DE5D 2ZYLA 4QDFA 4NBAD 1RFSA 4HM0A 4EMJB 3L70E 2D2CD 2QJPC 4NBDD 3GL0A 2NUMA 3CWBE 1RIEA 5HL4A 1NTME 4H44D 2QJYC 1O7GA 4AAYB 2JZAA 1SQQE 3GZXA 3CXHE 1VCKA 4NBGD 4OGQD 5CXMA 3VCPA 1UUVA 4H0LD 3EQQA 4HM1A 2BMQA 2ZT9D 3VMGD 2A06E 3VMID 1BE3E 3GZYA 3GOBA 4NBHD 4NBFD 2CKFA 2FYNC 3EN1A 4NBCD 1L0LE 3GL2A 2E76D 3L74E 1G8JB 3FOUA 2HMJA 3VCAA 3N0QA 4QUPA 4NB8D 1BCCE 4QDFB 3GKEA 1Q90C 5KLVE 1VM9A 4HM6A 4HM7A 1PPJE 3H1HE 4PV1D 1O7HA 2QJKC 2IBZE 2E74D 3CX5E 1VF5D 2JO6A 2QPZA 2YFIA 4D6TE 1O7NA 4HM2A 1NYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIV A;  3H1I E;  1EZV E;  3BCC E;  4NBB D;  2HMK A;  5BOK A;  2HMO A;  2NVE A;  2YFL A;  1O7M A;  2BCC E;  3GTS A;  4QDD A;  1SQB E;  2E4Q A;  4QUQ A;  4HM8 A;  5AEU A;  5KKZ C;  3GCE A;  4P1B H;  1KYO E;  3H1K E;  4HJL A;  5KLI C;  2YIU C;  4QCK A;  1ULJ A;  3L73 E;  3AZC A;  4P1C H;  1WQL A;  1SQX E;  1JM1 A;  4NB9 D;  4QDC A;  1SJG A;  1ULI A;  2DE6 D;  2I7F A;  3TGU E;  1EG9 A;  1PP9 E;  1FQT A;  1KB9 E;  2GBW A;  2YVJ B;  2GBX A;  1NU1 E;  2B1X A;  4HKV A;  1SQV E;  4HM5 A;  2HMN A;  4HM4 A;  3L75 E;  4QUR A;  2HMM A;  3DQY A;  5AEW A;  3H1J E;  1ZRT E;  4NBE D;  3GTE A;  2YFJ A;  3C0D A;  2XR8 A;  2NWF A;  4H13 D;  2XRX A;  1O7W A;  2B24 A;  2NVF A;  1P84 E;  2BMO A;  3H1L E;  2DE7 D;  1UUW A;  2XSO A;  2BMR A;  1BGY E;  2Q3W A;  2XSH A;  2E4P A;  1NTZ E;  4HM3 A;  1NTK E;  1NDO A;  2NVG A;  3D89 A;  3GB4 A;  1G8K B;  2NUK A;  1O7P A;  3VMH D;  1L0N E;  2E75 D;  2HML A;  2FYU E;  1SQP E;  4U3F E;  3L71 E;  3L72 E;  4PD4 E;  2DE5 D;  2ZYL A;  4QDF A;  4NBA D;  1RFS A;  4HM0 A;  4EMJ B;  3L70 E;  2D2C D;  2QJP C;  4NBD D;  3GL0 A;  2NUM A;  3CWB E;  1RIE A;  5HL4 A;  1NTM E;  4H44 D;  2QJY C;  1O7G A;  4AAY B;  2JZA A;  1SQQ E;  3GZX A;  3CXH E;  1VCK A;  4NBG D;  4OGQ D;  5CXM A;  3VCP A;  1UUV A;  4H0L D;  3EQQ A;  4HM1 A;  2BMQ A;  2ZT9 D;  3VMG D;  2A06 E;  3VMI D;  1BE3 E;  3GZY A;  3GOB A;  4NBH D;  4NBF D;  2CKF A;  2FYN C;  3EN1 A;  4NBC D;  1L0L E;  3GL2 A;  2E76 D;  3L74 E;  1G8J B;  3FOU A;  2HMJ A;  3VCA A;  3N0Q A;  4QUP A;  4NB8 D;  1BCC E;  4QDF B;  3GKE A;  1Q90 C;  5KLV E;  1VM9 A;  4HM6 A;  4HM7 A;  1PPJ E;  3H1H E;  4PV1 D;  1O7H A;  2QJK C;  2IBZ E;  2E74 D;  3CX5 E;  1VF5 D;  2JO6 A;  2QPZ A;  2YFI A;  4D6T E;  1O7N A;  4HM2 A;  1NYK A; 
#chains in the Genus database with same CATH topology
 1EZV E;  1USD A;  2G8Y A;  2NPS D;  2OYI B;  5B5E E;  5KAF E;  2V7Q H;  1BGY D;  2B87 A;  3VMA A;  1JM1 A;  4U3F G;  1FZC A;  1HVV A;  3SWF A;  1HJB A;  1NTM G;  2IX7 C;  2HMM A;  1HBW A;  2NPS C;  3V4W A;  1BE3 G;  3O6Q B;  1KFM A;  3WU2 H;  4EIJ A;  1VQM P;  4HM3 A;  3AEF C;  1IO4 A;  2QE7 H;  2OTK E;  4EDF A;  5KLV G;  1IFI A;  1SQV K;  3H1H G;  1RFS A;  2IZ1 A;  1KZU B;  3TNU A;  2ZJS E;  1QL2 A;  1IFM A;  2VRS A;  1RIE A;  5HL4 A;  2W83 C;  1VQ4 P;  2KS1 B;  1VL2 A;  1OX3 A;  3GZX A;  4DZO A;  3AE1 C;  1GD2 E;  1MZ9 A;  4GOD A;  1EDL A;  4TT3 H;  2YKQ A;  2W8Z A;  2E5Y A;  5AVV B;  1YJ9 P;  3FOU A;  1VQP P;  1M56 D;  1GL2 D;  4IFF A;  3L72 G;  1JO5 A;  5AVX B;  3CCQ P;  5AVS B;  4PD4 H;  2QG4 A;  3H1I E;  2HMK A;  2YFL A;  2FXO A;  4IOI H;  2WTY A;  4CPG A;  5AW1 B;  3CXH I;  4HM8 A;  1PGQ A;  1Q81 Q;  2YO2 A;  5AW2 B;  2A45 H;  3L73 E;  5AVQ B;  4Y99 B;  2RKL A;  3E1R A;  4OVN F;  1ULI A;  1GL2 C;  1GDT A;  1PP9 E;  1QGK B;  5H2F E;  2YMY A;  2FBW C;  2KZI A;  2WQY C;  1QX8 A;  1AQ5 A;  2GUV A;  2WPR A;  4AYC A;  4H13 D;  2P1J A;  2XV5 A;  3CX5 H;  2Y9Y A;  3A0B H;  1JY2 O;  2XSH A;  1U7M A;  2Y9Z A;  4R4M A;  1RH5 B;  2NUK A;  3CC7 P;  4W7Y A;  1BCC D;  2OYH C;  5TIS H;  3L36 A;  4OH8 B;  1ZR4 A;  3VP8 A;  2PAJ A;  1BSH A;  2QJY C;  1UII A;  3L73 J;  1GL2 B;  1KIL C;  1YQ3 C;  1PP9 J;  4UB8 H;  4NBF D;  1M7L A;  2I1J A;  3U1A A;  1NU1 K;  1LTJ C;  2E76 C;  1SQV G;  1Q90 D;  1LP1 B;  1N7L A;  1NU1 D;  2JJL A;  3P8C E;  1M8O B;  1VF5 D;  1IFJ A;  2ITA A;  2FXM A;  2HMO A;  1MFT A;  1AA0 A;  1H8A A;  2NRG A;  3H1K E;  1GW3 A;  2JO1 A;  2H7H A;  2OYH B;  1KQG B;  3AE7 C;  5BU8 B;  4QDC A;  3SWY A;  1DX7 A;  1YYC A;  1L0N D;  1T8Z A;  1WRG A;  3TGU E;  3CCL P;  2HG5 D;  1OXZ A;  1JMM A;  3NXS A;  4K3A A;  2QJY B;  1EQ7 A;  3TYY A;  4HKV A;  3DQY A;  2E42 A;  2KK7 A;  2GA1 A;  5L8R J;  1KIL B;  2AXT H;  2KXP B;  1LTJ B;  2E76 B;  2ZVO B;  3A2A A;  2N1T A;  2J58 A;  3V2N A;  3NMD A;  1J1D C;  3VMH D;  2HML A;  1SQP E;  4L73 A;  1FZG A;  3EFF K;  1PPJ D;  4NBD D;  1H0T A;  3CWB E;  1EZV G;  1SQB K;  2JR8 A;  2QSI A;  4BRY A;  2RMZ A;  3PHL A;  2R5B A;  2QEX P;  3W67 A;  3M91 A;  1HUC A;  5TJH A;  1SQB D;  4H0L D;  3EQQ A;  3Q5R A;  3HD7 B;  4GOE A;  3VTP C;  3GOB A;  4NBH D;  1L0L E;  2PFX A;  1CZQ A;  3JCU E;  1VQO P;  3RK3 D;  2IBZ E;  1S2E A;  2WSE J;  1L4A A;  2W6A A;  2M5A A;  1O7M A;  4KT0 J;  4HH2 A;  3H1L D;  1NTK K;  1J1D B;  2N9B A;  2YO3 A;  4RO0 A;  2FYU K;  2HLO A;  1NTZ D;  3TK1 A;  1CI6 A;  1NTK D;  2B87 B;  2K88 A;  4KJM A;  2XZR A;  2FYU D;  1KB9 E;  2QRX A;  1FZC B;  1OMI A;  1N7S D;  2HMN A;  4BXL A;  4D6T J;  4KHX A;  3WUT A;  3GTE A;  1PFI A;  3B5N D;  2FFD A;  1NHL A;  3HTK A;  2FYZ A;  2P58 A;  2NZ2 A;  2R3C A;  3H32 B;  4IL6 X;  2QA4 P;  3G4S P;  5KAI H;  3HUS A;  1N7S C;  3GG2 A;  1DEB A;  2I8D A;  3L72 E;  5GTH E;  1ZN5 A;  1OFC X;  2YNY A;  2I1K A;  3B5N C;  2ZAE B;  2DW3 A;  1R8E A;  3TNU B;  1VQN P;  5CCG A;  1SQQ E;  4U7J A;  2FXP A;  4GOF A;  1E79 H;  4HM1 A;  1MV8 A;  1EXI A;  3TSI A;  3L73 G;  1Y8A A;  1OWA A;  5CMZ A;  2WWW A;  5M1B A;  1PP9 G;  4JF7 A;  5CCH D;  4QDF B;  4HM6 A;  3O8Z A;  4GKG A;  3RL0 B;  3L75 D;  3II6 A;  2E43 A;  2H88 C;  4WBA A;  3BCC E;  1YI2 P;  3AE3 C;  1WT6 A;  3WU2 E;  2IBZ I;  4QDD A;  1OVV A;  2WSE H;  1VQ6 P;  1N7S B;  1HGV A;  2BAS A;  2M8R A;  4QCK A;  4IFD K;  3AZC A;  4QMA A;  2YKP A;  1ZV8 A;  2IZ0 A;  3VMZ A;  4U3F D;  4IL6 H;  4DT0 A;  3CCS P;  2ZVN B;  3VP9 A;  2Z4E A;  4QUR A;  3C9I A;  2JP3 A;  3H1J E;  1NTM D;  1ZRT E;  2KLV A;  4NBE D;  3BRT B;  1KQL A;  2BCC J;  3MIW A;  1UUW A;  5E79 H;  2BMR A;  3I55 P;  1BE3 D;  3UIA A;  1AFO A;  1KYO H;  3L70 D;  1K73 Q;  3L71 E;  1SLQ A;  4PD4 E;  5KLV D;  3Q3D A;  1M57 D;  1CSB A;  1EDK A;  2KNC A;  1URQ D;  2W90 A;  4N78 E;  2NUM A;  1N73 C;  1RF0 A;  1KOR A;  3H1K G;  1BGY J;  1LTA C;  2A06 E;  2CPB A;  3AED C;  1VQ9 P;  2WSS H;  3TGU G;  1FZB A;  1URQ C;  1JY3 P;  2CK3 H;  2JO6 A;  4WY4 A;  3CX5 E;  1JY3 O;  3SWK A;  3A0B E;  1HF9 A;  1LT9 A;  3SFE C;  1NAY A;  3G6E P;  1FU1 A;  3M0D C;  3L71 J;  2LKM A;  5TIS E;  3HE4 B;  1SQP G;  2I7F A;  3QWO C;  1GK4 A;  1N73 B;  1Q82 Q;  5APV A;  3CWB G;  1FBM A;  3A3Y B;  2QIW A;  3CCE P;  1SFC D;  1K8A Q;  4YXD C;  1WMK A;  3GHG A;  3AEA C;  2WVR A;  4LLH A;  1M1J C;  1LWU A;  3T97 A;  2FKW B;  1G2C B;  4UB8 E;  2HOD A;  2WT7 A;  1L0L G;  1URQ B;  2JEE A;  3HE5 B;  3NTN A;  2XDJ A;  4ASW A;  1O7P A;  1S9K D;  2R32 A;  3PTZ A;  5AW5 B;  1SFC C;  1RE3 A;  4NBA D;  2IBZ G;  3N7N A;  3C8V A;  4R4L A;  2JKV A;  4H44 D;  1N86 A;  5KJ7 A;  1PIX A;  2C0W A;  3BVH A;  4JYB A;  1VCK A;  4OGQ D;  1P84 I;  2OQQ A;  2P10 A;  2BMQ A;  2KI7 B;  3VMG D;  5AVT B;  5EFW B;  2CKF A;  1RF1 C;  2A45 I;  3EN1 A;  4NBC D;  3G9R A;  3R4Y A;  4Y99 C;  1IK7 A;  2HFE D;  1DD4 A;  4H44 C;  1SQV D;  5AW8 B;  1M1J B;  2XU6 A;  2E74 C;  1BSN A;  2AXT E;  2K9J A;  4OGQ C;  3CCM P;  1NYK A;  3U59 A;  3ITK A;  1P84 D;  3CX5 I;  2M5A B;  1LTS C;  1ULJ A;  3RK2 D;  1SFC B;  2J5U A;  2D2C B;  2DE6 D;  1JCD A;  3QH9 A;  1BCC J;  1EG9 A;  3P32 A;  1FQT A;  2M3B A;  3OAK A;  1H89 A;  3V2Q A;  3F89 A;  1M1K Q;  1SQQ G;  1VQ7 P;  2IDB A;  1EZV I;  1RF1 B;  3RK2 C;  5KKZ B;  2W6J H;  3HTK B;  2E4P A;  3VMX A;  3D6Z A;  3AE6 C;  4H44 B;  5APW A;  3AEB C;  4HKZ H;  2E74 B;  1IFD A;  2QVA A;  4OGQ B;  1NU1 J;  4GIF A;  1YIJ P;  1LTI C;  1JY2 P;  3P8M C;  3BCC G;  5CBO A;  4RKU J;  3CXH D;  1EZV D;  4L75 A;  4AAY B;  1X9V A;  2POH A;  2YKO A;  2XKM A;  2H43 A;  1KIL D;  2V4H A;  2ZXE B;  1KD1 Q;  1PV3 A;  1L0N J;  2E76 D;  4N6J A;  2JWA A;  4QUP A;  2QM7 A;  1JM0 A;  3GF3 A;  3FWN A;  3H1J G;  3D71 A;  3S4R A;  3RK2 B;  2Y0D A;  2K1A A;  5APT A;  1DEE G;  3GTS A;  1FDM A;  2OTJ P;  1DIP A;  1ZW0 A;  1OVU A;  2P67 A;  5AW4 B;  5KAI E;  1YHQ P;  5CCH A;  3RBZ A;  1FZA A;  1OZH A;  3L71 G;  1OIP A;  3HD7 D;  3CPW O;  2KSE A;  1KV4 A;  1YBK A;  1NH4 A;  3LW5 J;  2K37 A;  2WPV B;  2AEJ A;  1DH3 A;  1VDF A;  3BRV B;  5BU5 A;  2A45 G;  3VOP A;  1U7J A;  2BMO A;  1EDI A;  2A06 G;  1RE4 A;  3I56 P;  2C0X A;  1ZR2 A;  1MFZ A;  3HD7 C;  4JQ0 D;  3EFG A;  3Q5P A;  3MUD A;  1ZXG A;  2R3S A;  4LC1 A;  2M3E A;  2ZYL A;  3B4S A;  2KZJ A;  2Q3E A;  4HM0 A;  4PJ0 H;  2L5G B;  1NKZ B;  1X8Y A;  3CC4 P;  3H1I D;  2C9L Y;  2O1K A;  3H1L J;  4I1L A;  2Q9I A;  2OYI A;  2KIK A;  1FOS F;  1UUV A;  1NTZ J;  3H6P A;  3GZY A;  1NTK J;  3L73 D;  2FYN C;  4ZKU A;  4IL6 E;  1RY3 A;  2ZYD A;  1RQV A;  1X22 A;  2FYU J;  1EDJ A;  4DOJ A;  1PP9 D;  1YTZ T;  3F5H A;  5CHX A;  1FZC C;  5AW6 B;  2QJK C;  2YMK A;  4YXW H;  4D6T E;  2W6B A;  1FJK A;  4AUW A;  5E79 E;  4Z1M H;  1A02 F;  3O6Q A;  1KYO E;  2H8P D;  5AW0 B;  3P7K A;  4P1C H;  1SQX E;  1KN7 A;  4TLF A;  3JSV C;  3D70 A;  3AE9 C;  3CCU P;  1VQ8 P;  2LXB A;  4NPE A;  2B1X A;  4ZMD A;  1ZP0 C;  2W27 A;  5APS A;  1IK9 A;  1FOS E;  1FDO A;  2OAR A;  1MUU A;  4N3Y B;  2YFJ A;  3RL0 D;  2FYN B;  3LW5 H;  1X79 B;  3T97 B;  1LWU B;  1NVO A;  4YTP C;  2HOD B;  4EOT A;  3E7K A;  1G8K B;  1FDI A;  2QJK B;  5AW3 B;  2NPS A;  3M06 A;  1Q86 Q;  1N2D C;  5KTB A;  3L70 E;  2QJP C;  3P8C D;  3KZI H;  3RL0 C;  4YPC A;  3CCJ P;  1NYH A;  5B66 H;  1SQX J;  1YQ4 C;  3H1K D;  1DD3 A;  3SSU A;  3GL2 A;  4RJT A;  3L74 E;  4HJG H;  3TGU D;  5DJU B;  3GKE A;  1Z56 A;  1W5C E;  2HPC A;  1NTM J;  2Q7C A;  4W80 A;  5AVY B;  4HM2 A;  4AIV A;  3A5T A;  1AV1 A;  2BCC E;  2K9J B;  2AXC A;  3E1I A;  3GCE A;  1IFN A;  1QVF O;  3I5C A;  1SQP K;  1TU3 F;  5CJ4 A;  1K04 A;  3U1C A;  1FZE A;  3R2P A;  1WQL A;  4NB9 D;  1NWQ A;  3L70 J;  2QJP B;  1KYO I;  1SQP D;  5KLV J;  5AVR B;  2GUS A;  2B9B A;  1A02 J;  2YVJ B;  4UB6 H;  1XTC C;  4HM5 A;  3CWB D;  2Q3I A;  1VQ5 P;  3CC2 P;  5AW9 B;  5APQ A;  3C1L A;  1L0L K;  1NJI Q;  2KLU A;  3L74 J;  1GL2 A;  1BGY E;  2KUB A;  2H89 C;  1L0L D;  2O01 N;  3AE5 C;  3D89 A;  4NPF X;  3B71 A;  1Y47 A;  1S1C X;  1KB9 I;  2IBZ D;  2WSF J;  2M0B A;  2E5T A;  2YXQ B;  3PJS K;  3KQG A;  3AEE C;  2JZA A;  1LTT C;  3CD6 P;  2ZT9 D;  1FAV A;  3VYI A;  4GT1 A;  3AEG C;  2K3R A;  2ZXX A;  3ABV C;  2OYH A;  1G8J B;  4IFM A;  3H1H D;  1ZLL A;  1KB9 D;  2OTL P;  4L76 A;  2B88 A;  3OA7 A;  5CBN A;  4JYC A;  1Q2N A;  3MTU E;  1NO4 A;  2BEQ D;  2ZT9 C;  1KFN A;  1KIL A;  3WUV A;  1T3U A;  2KYV A;  2E4Q A;  2Q5U A;  1LTJ A;  4JPZ B;  4HJL A;  2YIU C;  1YTZ I;  2Q6Q A;  1GZL A;  1HH0 A;  1KC8 Q;  2N1T C;  1SVF A;  3L72 D;  1SQQ K;  5AEW A;  4ZKP A;  3S1K A;  3NFQ A;  1G1J A;  1SQQ D;  3TDK A;  2JDI H;  2Z5I A;  2Q1K A;  2O01 J;  1FZF A;  2Q3W A;  1VQL P;  1JTH A;  1NDO A;  1L4A D;  3GB4 A;  3Q2Y A;  1YJN P;  1QEX A;  4BWN A;  1SQV J;  5APX A;  1GU4 A;  2ZT9 B;  3V4Q A;  2D2C D;  3RGU A;  4D6T G;  3BCC D;  1O7G A;  2YIU B;  1KQS O;  4EYY Q;  3CXH E;  2WSF H;  1L4A C;  3JC2 2;  2N1T B;  1SQX G;  3IF4 A;  1JY3 N;  3IR9 A;  3L37 A;  2OGU A;  1GW4 A;  1KIL E;  4O9B A;  3RL0 g;  3GMA A;  3CME P;  2D2C C;  2YXR B;  1BCC E;  3BAT A;  3HRN A;  4PD4 I;  1H0T B;  1D7M A;  1Q7Y Q;  2E74 D;  4BRY B;  3H1J D;  1ZRT D;  3MGN A;  5BOK A;  4XE5 B;  2NVE A;  2IYP A;  4QUQ A;  4XA4 A;  2PRR A;  5KKZ C;  4P1B H;  2FFD C;  1T3J A;  1W2B O;  1HGZ A;  3H32 A;  5CCG D;  2WIT A;  3L4F A;  1GU5 A;  4PJ0 E;  3L71 D;  3L70 G;  4PD4 D;  1S5L H;  2R5D A;  1NU1 E;  3HUS C;  4C7N A;  2N9Y B;  4N78 D;  3M9H A;  1L4A B;  2IFM A;  2XRX A;  2B24 A;  1JOC A;  2XSO A;  2Y0E A;  5CCG C;  2A06 D;  2PGD A;  1CI6 B;  3L74 G;  3KPE A;  2O01 H;  1BDC A;  1L0N E;  2FY8 A;  2RH0 A;  4QDF A;  2NPS B;  1FS0 E;  3CX5 D;  1USE A;  2BCC G;  2FFD B;  3PLN A;  4A7P A;  1GTW A;  4NBG D;  5CXM A;  3WUU A;  1P84 H;  5AW7 B;  4HYT B;  1N7S A;  1J1E C;  3S9O A;  3HUS B;  2PP6 A;  4JBZ A;  5GTI H;  3B5N A;  3N0Q A;  2IPP A;  3VMY A;  1PGO A;  5K5G B;  1PPJ E;  1O7H A;  2ZYA A;  2B89 A;  2P2U A;  2HPC B;  3FWL A;  4NBB D;  4K35 A;  4B86 A;  1LTG C;  1SQB E;  1BGY G;  5APY A;  1LJ2 A;  5AEU A;  1XTG B;  5KLI C;  3A0H H;  2QM8 A;  5C39 A;  1SJG A;  1AVO A;  1VQK P;  3KZI E;  1EXJ A;  3AEC C;  1PZQ A;  3RK3 E;  5B66 E;  3H1I J;  1ZOY C;  3GF7 A;  4H13 C;  2NWF A;  4NPD A;  1OW7 A;  1J1E B;  1FE6 A;  3A7O A;  3USS A;  3H1L E;  3CXH H;  3L35 A;  3KYQ A;  1RF0 C;  3AE4 C;  1J2J B;  4WY4 D;  1NTZ E;  5B5E H;  5KAF H;  1NTK E;  1E5W A;  3GLM A;  1NKN A;  2G3A A;  2HYN A;  1JY2 N;  3IFM A;  2FYU E;  5CJ0 A;  4I2L C;  3GW6 A;  4RES B;  2DE5 D;  1N8R Q;  1M90 Q;  3GL0 A;  1ZME C;  1SQB J;  3LID A;  3MD0 A;  5KLI B;  3EQ2 A;  4WY4 C;  1OVR A;  2IYO A;  1LT9 C;  1H88 A;  2RN0 A;  3FGA D;  3FX0 A;  1L0N K;  4UB6 E;  3HE4 A;  5BVZ A;  2HMJ A;  3TF5 A;  1R5S A;  1Q90 C;  1N73 A;  1R5L A;  4H13 B;  1VM9 A;  3MHV A;  4W7Z A;  2KNC B;  1LGH B;  3V6I A;  4PV1 D;  1VF5 C;  2WMM A;  1Y9B A;  1FJP A;  1QVG O;  1AQT A;  3B8E B;  4L74 A;  1PL5 A;  1G2C A;  3GHG C;  2HR3 A;  2XND H;  3K5B A;  4LGD E;  1IFP A;  3V5B A;  1HWT C;  4Y28 J;  1LWU C;  1FC2 C;  1URQ A;  3HE5 A;  5KJ7 D;  1T2K D;  4C7R A;  3PRJ A;  1T6A A;  4WVZ A;  1LT1 A;  4PV1 C;  4HB1 A;  3KXD A;  4GDO A;  1VPC A;  4WY4 B;  4HM4 A;  3L75 E;  1AJY A;  2JWD A;  1RE3 C;  3G3Z A;  1IZN B;  1LT9 B;  3M0D A;  4C46 A;  1LTB C;  5KJ7 C;  3H1K J;  2Z5H A;  1T2K C;  2BEZ F;  1IC2 A;  3TGU J;  2LR2 A;  1BCC G;  3IAO A;  1JB0 J;  1VF5 B;  1JTH B;  2E75 D;  3G71 P;  3Q5S A;  4U3F E;  1MKM A;  3EWK A;  2GM4 A;  5AVW B;  3VN0 A;  1M1J A;  2AEF A;  5H2F H;  2KS1 A;  1NTM E;  3GHG B;  2WZ7 A;  3LIE A;  1KQF B;  1OW6 A;  4DCK A;  3PH0 A;  2O1J A;  1SP4 A;  4H0L C;  2XNX A;  2WT7 B;  1JNM A;  3VMI D;  1BE3 E;  1NTZ K;  4PV1 B;  1RHZ B;  2E75 C;  2P7J A;  1SFC A;  1W2E A;  1SQP J;  3L75 J;  1NU1 G;  5KLV E;  3WMM 0;  3RK3 C;  3CWB J;  3H1H E;  1NAF A;  2ZFC A;  1RQU A;  2IFN A;  1HTL C;  1RF1 A;  1LNQ A;  1L2P A;  1CW5 A;  5APU A;  1NOH A;  1L0L J;  4U3F J;  4MN4 C;  1L0N G;  5AVU B;  1SS1 A;  1KMI Z;  1S4X A;  4WB4 A;  1X0T A;  3ZDM A;  4OWF A;  2GBW A;  2GBX A;  4EI2 A;  1K05 A;  4H0L B;  5AVZ B;  4C7N B;  3C0D A;  2XR8 A;  1BE3 J;  3H1I G;  2NVF A;  2E75 B;  3D6Y A;  2Y0C A;  4M3L A;  2OYO A;  2LXC B;  2DE7 D;  3CL3 D;  1HJ0 A;  3OW2 O;  1EC5 A;  2NVG A;  1NGM B;  3RK3 B;  4AQR D;  3H1H J;  1PPJ G;  1PGJ A;  1K9M Q;  2C9N Y;  3KDP B;  3Q1M A;  1JMB A;  2MJZ A;  3W68 A;  4D6T D;  3CMA P;  1SQB G;  3PP5 A;  2WSC J;  1SQX K;  1GK6 A;  1KYO D;  1SQX D;  1S5L E;  2CPS A;  1LP1 A;  1S9K E;  3VCA A;  3L72 J;  5CCH C;  1QL1 A;  3B5N B;  1NTM K;  2AEM A;  4WWI A;  2QPZ A;  3M0A A;  4ASV A;  1JCC A;  2V7Q J;  3BAS A;  3H1L G;  1SQQ J;  2K9Y A;  1OW8 A;  1PGP A;  3CI9 A;  3SFD C;  1AVY A;  1NTZ G;  2SPZ A;  4XFJ A;  1NTK G;  3MP7 B;  3H25 A;  4DJG A;  1RE4 C;  2KP8 A;  3AE8 C;  2FYU G;  1BDD A;  2N1T D;  5KLV K;  3OJA B;  1SQV E;  3RBX A;  3MUD C;  3MZW B;  1UIX A;  3BCC J;  1YIT P;  3CCV P;  3JCU H;  4I7Z C;  5DJT B;  1O7W A;  1P84 E;  1GMJ A;  2UWJ E;  5GTI E;  2O3J A;  1JUN A;  2OYI C;  2L91 A;  3L74 D;  3FXE A;  2KOG A;  4EMJ B;  3H1J J;  1U57 A;  4ZNC A;  1KB9 H;  1QLE D;  3KHU A;  3M9Q A;  2WPQ A;  2BCC D;  2MKV A;  3HD7 A;  1G1I A;  3VCP A;  3A0H E;  1S72 P;  1S5L X;  3CLQ A;  2WPS A;  1KTM A;  3N4X A;  3V2P A;  2R44 A;  2WSC H;  2ZYG A;  2J59 M;  3M9B A;  3CCR P;  3FXD A;  4NB8 D;  2KSJ A;  4I6M C;  4I7Z B;  1S3J A;  3V2R A;  3L75 G;  4HM7 A;  1JEK A;  1YJW P;  3IN6 A;  1IJD B;  3AE2 C;  5GTH H;  2YFI A;  2KB7 P;  1O7N A; 
#chains in the Genus database with same CATH homology
 4AIV A;  3H1I E;  1EZV E;  3BCC E;  4NBB D;  2HMK A;  5BOK A;  2HMO A;  2NVE A;  2YFL A;  1O7M A;  2BCC E;  3GTS A;  4QDD A;  1SQB E;  2E4Q A;  4QUQ A;  4HM8 A;  5AEU A;  5KKZ C;  3GCE A;  4P1B H;  1KYO E;  3H1K E;  4HJL A;  5KLI C;  2YIU C;  4QCK A;  1ULJ A;  3L73 E;  3AZC A;  4P1C H;  1WQL A;  1SQX E;  1JM1 A;  4NB9 D;  4QDC A;  1SJG A;  1ULI A;  2DE6 D;  2I7F A;  3TGU E;  1EG9 A;  1PP9 E;  1FQT A;  1KB9 E;  2GBW A;  2YVJ B;  2GBX A;  1NU1 E;  2B1X A;  4HKV A;  1SQV E;  4HM5 A;  2HMN A;  4HM4 A;  3L75 E;  4QUR A;  2HMM A;  3DQY A;  5AEW A;  3H1J E;  1ZRT E;  4NBE D;  3GTE A;  2YFJ A;  3C0D A;  2XR8 A;  2NWF A;  4H13 D;  2XRX A;  1O7W A;  2B24 A;  2NVF A;  1P84 E;  2BMO A;  3H1L E;  2DE7 D;  1UUW A;  2XSO A;  2BMR A;  1BGY E;  2Q3W A;  2XSH A;  2E4P A;  1NTZ E;  4HM3 A;  1NTK E;  1NDO A;  2NVG A;  3D89 A;  3GB4 A;  1G8K B;  2NUK A;  1O7P A;  3VMH D;  1L0N E;  2E75 D;  2HML A;  2FYU E;  1SQP E;  4U3F E;  3L71 E;  3L72 E;  4PD4 E;  2DE5 D;  2ZYL A;  4QDF A;  4NBA D;  1RFS A;  4HM0 A;  4EMJ B;  3L70 E;  2D2C D;  2QJP C;  4NBD D;  3GL0 A;  2NUM A;  3CWB E;  1RIE A;  5HL4 A;  1NTM E;  4H44 D;  2QJY C;  1O7G A;  4AAY B;  2JZA A;  1SQQ E;  3GZX A;  3CXH E;  1VCK A;  4NBG D;  4OGQ D;  5CXM A;  3VCP A;  1UUV A;  4H0L D;  3EQQ A;  4HM1 A;  2BMQ A;  2ZT9 D;  3VMG D;  2A06 E;  3VMI D;  1BE3 E;  3GZY A;  3GOB A;  4NBH D;  4NBF D;  2CKF A;  2FYN C;  3EN1 A;  4NBC D;  1L0L E;  3GL2 A;  2E76 D;  3L74 E;  1G8J B;  3FOU A;  2HMJ A;  3VCA A;  3N0Q A;  4QUP A;  4NB8 D;  1BCC E;  4QDF B;  3GKE A;  1Q90 C;  5KLV E;  1VM9 A;  4HM6 A;  4HM7 A;  1PPJ E;  3H1H E;  4PV1 D;  1O7H A;  2QJK C;  2IBZ E;  2E74 D;  3CX5 E;  1VF5 D;  2JO6 A;  2QPZ A;  2YFI A;  4D6T E;  1O7N A;  4HM2 A;  1NYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...