2D2CD

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2d2cD02
4H44C 4HM3A 5KLIC 2GBWA 1EG9A 1L0LE 1UUVA 3D89A 3L71E 1VF5C 4P1CH 2YMKA 1ZRTE 2BMQA 2XR8A 3H1IE 4OGQC 2NVFA 4HM5A 2Q3WA 4AIVA 2E4PA 2A06E 2DE6D 1NTZE 4NBGD 1RIEA 1PP9E 2HMOA 4AAYB 2DE5D 3CXHE 4NBED 2ZT9D 2NUMA 2NWFA 3AZCA 1VF5D 3H1LE 1VCKA 2YFJA 3GCEA 4PV1D 4HJLA 3CX5E 2B1XA 4H44D 2XSOA 3DQYA 3GOBA 3VCAA 1NYKA 3EQQA 1O7WA 2I7FA 3N0QA 2E76D 1G8KB 1L0NE 2JZAA 4H0LD 2JO6A 2E74C 4H13C 4NBFD 3EN1A 4U3FE 3GTEA 1FQTA 4QDFB 5KKZC 2YIUC 4QDCA 4QUPA 2CKFA 4HKVA 1SQBE 1NTME 4I7ZC 1JM1A 1WQLA 2HMKA 4HM6A 4HM8A 4NBHD 3VMID 1PPJE 1SQPE 1NU1E 3VMGD 4NBAD 4QUQA 2YFIA 1SQXE 5AEUA 2BMRA 2E75C 1O7GA 5HL4A 3CWBE 5BOKA 2DE7D 3H1HE 2GBXA 1UUWA 2HMNA 2D2CC 1ULJA 2E4QA 3VCPA 4HM0A 1NDOA 4HM2A 2NVEA 2QJKC 2QJPC 1RFSA 4QCKA 4QURA 1SQQE 3GTSA 2HMJA 3GL2A 3GKEA 2QJYC 2BCCE 3FOUA 4NBCD 2E75D 1P84E 2BMOA 1VM9A 2B24A 3TGUE 1O7MA 4QDDA 1O7PA 1EZVE 2ZYLA 1Q90C 3BCCE 3GL0A 1NTKE 2XSHA 3C0DA 5KLVE 5AEWA 1SQVE 3L75E 4HM1A 4HM7A 1O7NA 1BCCE 2NUKA 2D2CD 2FYNC 1BE3E 2YVJB 4H0LC 4PD4E 4P1BH 4NBBD 3L74E 4PV1C 1KYOE 2QPZA 1ULIA 3GZXA 1SJGA 3H1KE 1G8JB 2IBZE 3L72E 4HM4A 1O7HA 2ZT9C 1KB9E 4NBDD 4NB9D 3H1JE 3GZYA 4EMJB 2FYUE 2HMLA 5CXMA 3GB4A 2XRXA 4NB8D 3L73E 4QDFA 2E74D 4H13D 3VMHD 2E76C 3L70E 2NVGA 2HMMA 2YFLA 4OGQD
chains in the Genus database with same CATH superfamily
1M7LA 2IBZI 1L0LE 3HD7C 2OYOA 1S5LE 2JEEA 5CJ0A 1YTZI 3B8EB 2ZXXA 3OW2O 3V4WA 4GOFA 5E79E 5DJUB 2WZ7A 1RF0C 3L70J 4PD4D 3CCLP 4OVNF 1FZCB 3EN1A 2ZXEB 2YIUC 1LTTC 3PLNA 1SQBE 1JM1A 2ZVOB 3H1LJ 4GT1A 2W6AA 2IZ1A 3G71P 3H32B 2WPVB 1ZMEC 2AEMA 3L71D 2FFDA 1EZVD 5CCHD 2QA4P 4D6TE 1NGMB 2IFMA 5AW1B 2KS1B 1BGYE 2BMOA 3M0DC 1CZQA 2Z5IA 3V2QA 1JNMA 2OYHA 5APYA 3HTKA 1O7NA 2H8PD 2W83C 2KZIA 4LC1A 5BVZA 2QJYB 4IOIH 2QM7A 4PJ0H 1D7MA 3U1CA 1LT9C 3QWOC 1FDMA 1KN7A 2OQQA 1O7HA 3BATA 2E76B 1QVFO 2KUBA 2KZJA 4EOTA 2N1TC 2SPZA 2J5UA 1JY2P 1KQSO 1HJ0A 4HM3A 2LXBA 1JEKA 1JCCA 5AVSB 1PL5A 5CJ4A 3EFFK 4N78D 1YQ3C 2M8RA 3AEGC 2R44A 3RK2B 1NAYA 1S5LH 3L35A 4AYCA 3CX5E 3E1RA 3CD6P 2KIKA 5KJ7A 1IK7A 3CI9A 4BXLA 4HM6A 1L0LG 2C9LY 1Q81Q 2E75C 3L74G 1RF1A 1KYOH 3AE9C 3CCQP 2HMNA 3TGUG 1J1DB 1W2BO 1AQTA 4GODA 4OWFA 1J2JB 2WMMA 1QEXA 1WMKA 2B24A 3RBZA 1K9MQ 1G1JA 3GL0A 1R8EA 2IFNA 3C0DA 1KQLA 1JY2O 1PGJA 3CXHD 2WSEH 1PFIA 3M06A 1BCCE 4R4MA 2GUVA 2A45H 3V2PA 1IO4A 3PH0A 4HM4A 1J1EB 2B87B 2ZT9C 2WSCH 3L4FA 4NB8D 2HR3A 3E7KA 4H13D 1GL2B 3CMAP 1NTMJ 1PP9G 3D89A 1SQQJ 1SQXG 2CPBA 3PJSK 3RK2D 1LTIC 4HM5A 2KB7P 4WVZA 2E4PA 1RHZB 3WU2E 1VQ8P 1OVUA 5KLVJ 1PP9E 3QH9A 3L75J 2Y9YA 2W90A 1BSHA 3OJAB 2XV5A 4NBED 3H1ID 3H1LE 1FOSE 1VQ9P 2M3EA 1RF0A 3IFMA 3EQQA 3CX5D 1KFNA 1M56D 1H8AA 3H1LG 1NVOA 2MJZA 2FKWB 1LTSC 2YKOA 2IYOA 3H1JD 4O9BA 1IFNA 1ULJA 1GZLA 3A3YB 1UIIA 1DEEG 3A0BH 1YJ9P 3CWBG 4QURA 1MKMA 1SQQE 3GTSA 3HD7B 4NBCD 1O7MA 2YNYA 1LWUA 2QSIA 3CCJP 2C0XA 2WVRA 1BDCA 3H1JJ 1VDFA 5GTHH 1JY3P 1Q86Q 4R4LA 1DX7A 1NWQA 3L74E 3L73G 3GHGC 5KLVG 2QPZA 1NTZJ 1NU1J 2KK7A 5AW7B 4Z1MH 3NMDA 1FZBA 2NVGA 1PGOA 1NKZB 3M9BA 3D6ZA 3RK3B 1LTGC 1PIXA 1JO5A 4WY4A 2E75B 3AE6C 1EXIA 1USEA 1ZRTE 1EDKA 1JMBA 1X22A 4W7YA 1ZLLA 3CXHH 5GTIE 1NTZE 3MIWA 1GTWA 2ZYDA 1LGHB 1CW5A 1E79H 1RIEA 3LIDA 3H1LD 2QG4A 1OVVA 1K05A 1KQGB 1SQBG 1SQBK 1KFMA 1N7LA 2YFJA 3GCEA 1EZVI 4IFFA 1N8RQ 1W2EA 2XSOA 1O7WA 2YXRB 3P7KA 2JZAA 5APQA 1URQB 4U3FE 3GTEA 1LJ2A 2BEQD 2WITA 3U59A 1BCCG 2XU6A 1OWAA 4XFJA 3CMEP 1PZQA 1SQXE 2IYPA 2OYHB 2XNDH 2DE7D 1U7MA 4EI2A 2HPCB 1JY3O 2N1TB 1NDOA 1L0LK 1AVOA 1OIPA 2QJPC 4AQRD 2K9YA 3H1KJ 1T6AA 1RQVA 1YIJP 2E43A 3MTUE 1SS1A 4L75A 2G8YA 5CCHC 3WUUA 1FZEA 1S3JA 2NUKA 1ZV8A 4JF7A 1JTHA 1SQVK 3M9QA 1KYOD 1S2EA 1LWUC 4NPFX 4PV1C 4WY4C 2RN0A 5CCGC 1ULIA 3H25A 2K88A 5AVWB 4ASWA 1G8JB 1IFPA 1SQBJ 5GTIH 1GMJA 1ZW0A 3MD0A 3VMHD 2C0WA 2KXPB 2JDIH 5AW5B 3LW5H 4C46A 1NU1D 3AEEC 1Q7YQ 2BCCJ 2ZYGA 1JUNA 3O6QA 3GW6A 4JQ0D 4K35A 3HD7D 1EDJA 3DQYA 4N3YB 1SQVD 3VMID 4I2LC 2OTKE 4OGQB 2LXCB 1P84I 2K3RA 2XNXA 2JWDA 1HGZA 5EFWB 2PAJA 1T2KC 1Y9BA 2NPSB 3W67A 4RJTA 1KQFB 3RL0D 3CLQA 3Q5PA 1SQVG 1RFSA 3I55P 2KNCA 1JM0A 5APWA 1FDOA 2BCCE 2YMYA 1VM9A 3FWLA 3G9RA 4HJGH 1FBMA 2Z4EA 1NTMG 1NTZG 2BCCG 2H43A 3L73J 1L4AA 1W5CE 5H2FH 1VPCA 1HJBA 3GHGB 1J1DC 2KI7B 3E1IA 1URQC 1OVRA 3GB4A 1R5SA 3JCUH 1FJKA 2I1JA 1NO4A 4PD4H 1YBKA 3L71E 4P1CH 1L0NJ 4AUWA 2NRGA 4LLHA 4IL6E 1S9KD 1NTMK 1VQ7P 1ZP0C 3RK2C 1FJPA 3VTPC 3CCSP 1OXZA 3TDKA 2QJPB 2I7FA 3S1KA 1L0NE 3TSIA 4H13C 3CCRP 2GM4A 2HLOA 1WQLA 4HH2A 1GW4A 2CK3H 3HRNA 3BRTB 2KSJA 3VMYA 3Q5SA 5K5GB 2R3CA 2QE7H 5CMZA 1VQNP 3VMAA 1RE3C 2N1TA 1VQOP 1USDA 1FU1A 2WWWA 2VRSA 1MFZA 2QJYC 4DOJA 3LIEA 2QIWA 4IFDK 2ZVNB 1EDIA 3Q2YA 4TT3H 2B89A 5KLVE 1NTMD 1KILE 1BE3D 4YXDC 1BE3E 3CX5H 2OYIB 2AXTE 3AE2C 1EXJA 2QEXP 1SJGA 1WT6A 4NB9D 2ITAA 4GKGA 1GK4A 2Y0DA 2Q5UA 3L73D 5DJTB 1NHLA 2L5GB 4OGQD 2YFLA 1YQ4C 1VQ4P 1VF5C 4EIJA 1KYOI 5M1BA 3AEDC 1L4AC 2NVFA 4IL6X 1ZRTD 2JKVA 2A06E 2DE6D 4W7ZA 1LTJB 2NWFA 1RY3A 3HUSA 4NBFD 2FFDC 4UB8E 2HMKA 4HM8A 2XZRA 5CBNA 3OAKA 3VMGD 4NBAD 1MUUA 4D6TG 5BOKA 5B5EH 5AVUB 2FYZA 1SQPG 3AE7C 3H1IJ 1FZFA 2WPRA 1N2DC 3T97B 2O1JA 2FYUK 1H0TA 3JSVC 2HFED 5AW2B 3RL0g 1EZVE 3VN0A 4KHXA 1M1JC 3A5TA 1CI6B 2R5BA 1VQMP 4N6JA 3NTNA 1G1IA 1JTHB 4EYYQ 2WSFJ 4NBBD 3CWBD 3S4RA 3KYQA 3HE5B 3JC22 1YJWP 1M90Q 4TLFA 5BU8B 2FFDB 4UB6H 2WPSA 1SQXD 1L0NG 5APSA 2WSFH 3L70E 2K9JB 3WMM0 1PP9D 3L36A 1LTJC 5APUA 2YMKA 1H0TB 2J59M 4ASVA 5APTA 3A0HH 2Q3IA 1NU1K 3H1HG 1DEBA 3MZWB 2YO2A 2BASA 1HWTC 1A02J 1NTKK 4AAYB 5B66E 3L72D 3AZCA 1FC2C 3H32A 1SQQD 3Q1MA 2E76D 1PV3A 1PPJD 3EFGA 4HKVA 3L75D 1GK6A 4KT0J 4UB6E 4HB1A 2OGUA 3VP8A 1MV8A 1T3UA 3H6PA 3L72J 2E4QA 1X0TA 1ZR4A 1N7SC 3VMXA 1JY2N 2QJKC 1VQ6P 2IDBA 3RK3E 4BWNA 1P84E 2JO1A 3PHLA 4U3FJ 2P10A 3BRVB 4PJ0E 1G2CB 1KORA 1T3JA 2FXOA 1EC5A 1KILD 1FE6A 1L4AB 1QGKB 3MHVA 1IFDA 2WT7B 1FDIA 5AVYB 1SFCC 1FAVA 2XKMA 1KZUB 2JR8A 2WT7A 3GF7A 3H1JE 3H1HD 4UB8H 4N78E 4QDFA 2E74D 2BEZF 1IZNB 1XTCC 3C8VA 3H1JG 3CX5I 4HYTB 3TF5A 2AEJA 1KB9I 2RMZA 1JCDA 2OTJP 1K8AQ 1R5LA 2CPSA 3N4XA 2FYNB 2HMOA 1P84D 3RBXA 3HE4A 3AECC 1L0LJ 2ZFCA 1SQBD 5AVVB 3CXHI 3IAOA 3HUSC 3W68A 4C7NB 1AJYA 2B1XA 1Z56A 1EZVG 1NH4A 3CC4P 1VQKP 2O01N 4QUPA 3B5ND 1GL2D 1SQPK 1SFCB 2PRRA 4H44B 5AEUA 2BMRA 1BGYJ 2R5DA 1NJIQ 5HL4A 2LKMA 3H1HE 1YITP 1K04A 1S4XA 1RE4A 4I1LA 1K73Q 2RH0A 4JYCA 1VL2A 4QCKA 3L70G 3T97A 2NPSC 5B66H 1KILB 1AVYA 3PTZA 1O7PA 2Q7CA 2H89C 3SWFA 5TISE 3B5NC 3II6A 2D2CD 5AW4B 3V5BA 3NXSA 2KNCB 2V7QH 2AEFA 1TU3F 2WQYC 3FGAD 1KB9E 3AEFC 3M9HA 1VQ5P 1M1KQ 1RE3A 1AA0A 4ZMDA 3VOPA 4XA4A 3OA7A 1EDLA 1GW3A 3L74J 2P2UA 4AIVA 4H13B 1KV4A 1N73C 1QL1A 2PFXA 1NOHA 1JB0J 3WUTA 3NFQA 1SFCD 1FZCA 4H44D 2M0BA 1DIPA 1YTZT 2XDJA 4JBZA 3TGUD 3SFDC 4JYBA 5KKZC 3U1AA 1L0ND 3WUVA 1AQ5A 2HYNA 1N73A 1SQPE 1H88A 3D71A 1NU1E 3MP7B 2OTLP 3L70D 5AVXB 2WSSH 3R2PA 5KJ7C 1N7SD 3V2NA 1BDDA 1FZCC 1LT9A 4YPCA 1LT1A 2XSHA 4ZKUA 1SQXJ 3K5BA 1NTZK 1NYHA 2FYNC 2OYHC 5APXA 2FY8A 4EDFA 3Q3DA 4DCKA 2KLUA 3P8CE 3H1KE 1SLQA 4A7PA 2QM8A 2HPCA 2OYIC 1RH5B 3BVHA 2FYUE 4QMAA 3ITKA 1RE4C 1H89A 4GDOA 3L73E 4JPZB 1KD1Q 2KLVA 3G3ZA 3LW5J 1AV1A 2IBZD 2HODB 5GTHE 1IJDB 3H1IE 3MGNA 1HTLC 1S5LX 3B5NA 3RK3D 2MKVA 2Z5HA 2DE5D 3C9IA 1OW8A 3L72G 4PV1D 4WY4D 2ZYAA 1EQ7A 4QDFB 4I7ZC 3KQGA 3H1KD 1DD4A 2O01J 2FXPA 3Q5RA 1NKNA 1FZGA 1PPJG 2FXMA 1OMIA 1YHQP 2ZAEB 1IK9A 3BCCE 2N9YB 3WU2H 2K1AA 4U3FG 2KSEA 4DJGA 1RF1B 2W6BA 4ZNCA 1S1CX 2M3BA 5KJ7D 5CCHA 2YO3A 4PD4E 3USSA 1NTKG 1JOCA 2Y0EA 2KP8A 5AVRB 2QVAA 2B9BA 1IFIA 4ZKPA 1GD2E 2HMLA 3L71G 4LGDE 3ZDMA 1BE3J 2IBZG 5H2FE 1L0LD 4H44C 1BCCJ 2OARA 3B71A 1SP4A 3VYIA 1LP1B 4MN4C 1QLED 3FXDA 3PP5A 4OGQC 2V4HA 3VP9A 1SQVJ 3UIAA 1GDTA 2C9NY 1Y8AA 5KLIB 3H1KG 5AW0B 2H7HA 3L71J 4I7ZB 1FQTA 1SQPD 2G3AA 2ZT9B 3GMAA 3B4SA 3SFEC 4QUQA 3AEBC 3CPWO 3CWBE 1SQQG 1UUWA 2D2CC 2K37A 4HM2A 3I5CA 2Y9ZA 3L75G 2K9JA 5KAFE 2POHA 3GKEA 2M5AA 2IX7C 3D6YA 2YKQA 3TGUE 1KMIZ 2LR2A 2NPSD 1NAFA 3L75E 1PGQA 3M0AA 3TNUB 5CBOA 2BCCD 1OW7A 3N7NA 2P1JA 5BU5A 2WPQA 2I1KA 1KB9D 4K3AA 5AVTB 2P67A 4PV1B 4WY4B 5KTBA 3L72E 2W8ZA 4NBDD 3GZYA 2PGDA 2A45I 2XRXA 3CCVP 4RKUJ 1N73B 3CWBJ 4RO0A 1EG9A 3GHGA 5KLVK 2M5AB 4WB4A 5KAIH 3A7OA 2YIUB 1BGYD 1M1JA 1URQD 3S9OA 1JY3N 4WBAA 2ZT9D 4I6MC 1BCCD 1KC8Q 1QVGO 2JWAA 1YJNP 1GU4A 1NU1G 3BCCG 4NPDA 1G8KB 2KYVA 4BRYA 4QDCA 3JCUE 5AVZB 3GG2A 2HODA 1M8OB 5KAIE 3VMZA 4L73A 3GLMA 3BCCD 4IFMA 1LNQA 2P7JA 4U7JA 1T2KD 3RGUA 4GOEA 5AW3B 3IR9A 1JMMA 1AFOA 3GL2A 1OW6A 2E75D 1WRGA 2HG5D 3HTKB 1KB9H 3CL3D 1Q2NA 4H0LB 1XTGB 1M1JB 4WWIA 2E5TA 2FYUG 2O3JA 3SWYA 1KYOE 1A02F 3SWKA 1Y47A 1QX8A 5C39A 1BE3G 3F89A 2FBWC 3O6QB 3L37A 5KAFH 2UWJE 2OYIA 1VQPP 3A2AA 3TGUJ 5AW8B 5KLIC 2GBWA 1ZOYC 3GF3A 1UUVA 1J1EC 2KOGA 1IFMA 2KS1A 1Q82Q 1RQUA 3RK3C 2N1TD 2YKPA 1BSNA 3FXEA 4DZOA 3ABVC 3AE3C 2NUMA 2A06G 4PD4I 3A0BE 3MUDA 5CCGD 2ZJSE 2WSEJ 2V7QJ 3EQ2A 3GOBA 2R32A 3VCAA 1L2PA 2W6JH 4D6TJ 3KDPB 1GU5A 2NZ2A 2E42A 1YYCA 1NTME 3CC7P 4NBHD 1PPJE 3RL0B 1RF1C 4OH8B 2YFIA 1YI2P 4C7NA 4GIFA 2QRXA 2A06D 2JP3A 1KTMA 5AW6B 1IC2A 3V4QA 1CI6A 1LTBC 1URQA 5B5EE 1DH3A 2O1KA 4D6TD 2HMJA 3V2RA 3MUDC 3HE5A 2L91A 4QDDA 2ZYLA 1NTKE 2GA1A 3I56P 4HM7A 1FOSF 1BGYG 3CCMP 3P8MC 1PP9J 2B87A 1MZ9A 2B88A 1NTKD 1HUCA 4NPEA 5KLVD 2IBZE 1HBWA 2A45G 4EMJB 1P84H 1T8ZA 3KHUA 4XE5B 1G2CA 1S9KE 2O01H 2RKLA 4M3LA 1LP1A 1HVVA 2XR8A 1E5WA 4DT0A 1ZN5A 2QJKB 3AEAC 4HKZH 2YXQB 1X79B 4NBGD 5E79H 3TK1A 1U57A 1L4AD 3CXHE 1HH0A 3M0DA 3C1LA 1VF5D 1VCKA 2AXTH 2JJLA 4HJLA 2NPSA 3L74D 3N0QA 2JO6A 1M57D 2Y0CA 1OZHA 4H0LD 1SQXK 5TISH 2CKFA 4YXWH 4RESB 1Q90D 5L8RJ 3G4SP 3HD7A 3H1IG 3IN6A 2AXCA 4U3FD 1X9VA 3VCPA 3AE8C 2P58A 1LTAC 1IFJA 5APVA 2NVEA 4YTPC 5CCGA 3M91A 1SVFA 5AEWA 1SQVE 3FWNA 4BRYB 2WTYA 3H1HJ 2FYUJ 1S72P 3B5NB 5CHXA 2YVJB 1U7JA 5KKZB 2Q1KA 4L74A 2PP6A 3GZXA 3KZIH 2I8DA 4CPGA 1HF9A 1GL2C 1UIXA 1N7SA 4IL6H 1PGPA 1CSBA 2HMMA 3O8ZA 3HE4B 4Y28J 1SFCA 4Y99B 1NTKJ 4B86A 2BMQA 1DD3A 2Q3WA 3TYYA 2E74B 3AE4C 1N86A 1QL2A 1OX3A 1NTZD 3P32A 5AW9B 3R4YA 3P8CD 1MFTA 2Q9IA 4C7RA 1OFCX 2E5YA 2IZ0A 2W27A 1LT9B 2IPPA 1X8YA 1NYKA 3TNUA 3BCCJ 2E74C 3F5HA 5TJHA 1KILA 2GUSA 4L76A 3CC2P 3KZIE 3HUSB 1O7GA 1HGVA 1LTJA 2GBXA 3D70A 4W80A 3BASA 5AVQB 1KILC 2Q3EA 2Q6QA 1L0NK 2H88C 3FX0A 4HM0A 3V6IA 3G6EP 1GL2A 3SSUA 1ZR2A 1LWUB 3CCEP 3FOUA 1SQPJ 1Q90C 2N9BA 1FZAA 3PRJA 1ZXGA 4HM1A 3IF4A 3RL0C 3KXDA 4H0LC 4P1BH 2R3SA 1VQLP 1VF5B 1FS0E 3AE5C 2J58A 1SQQK 2D2CB 3CCUP 3AE1C 4KJMA 4Y99C 5CXMA 1N7SB 2FYUD 3EWKA 2WSCJ 2E76C 3A0HE 2DW3A 3KPEA
chains in the Genus database with same CATH topology
3C8VA 1EG9A 1L0LE 3AEEC 3O6QA 2HMOA 3S9OA 3AECC 2ZT9D 3IAOA 1AJYA 2B1XA 3DQYA 1G8KB 3EN1A 2YIUC 4QDCA 4QUPA 1SQBE 1JM1A 3VMID 4OGQB 4H44B 5AEUA 2BMRA 5HL4A 2WPVB 3H1HE 1ZMEC 3GLMA 1Y9BA 1K04A 1KQFB 3Q5PA 4U7JA 1NGMB 1VL2A 1RFSA 4QCKA 3GL2A 1FDOA 1OW6A 2BCCE 2E75D 2BMOA 1VM9A 1O7PA 2H89C 4H0LB 3G9RA 1O7NA 2D2CD 1KYOE 1TU3F 2WQYC 3FGAD 2OQQA 1O7HA 1KB9E 2E76B 3AEFC 2FBWC 3GB4A 2J5UA 4HM3A 1HJ0A 5KLIC 2GBWA 1ZOYC 3GF3A 1UUVA 3L71E 4P1CH 1PL5A 1RQUA 4AIVA 4H13B 1YQ3C 3AEGC 1JB0J 1ZP0C 3ABVC 3AE3C 2NUMA 3CX5E 2WSEJ 2V7QJ 4H44D 1DIPA 3GOBA 3VCAA 2I7FA 1L0NE 3SFDC 4H13C 5KKZC 2NZ2A 1IK7A 1NTME 1WQLA 4HM6A 4NBHD 1PPJE 1SQPE 3D71A 1NU1E 2YFIA 3Q5SA 2E75C 2JP3A 1KTMA 3AE9C 2HMNA 2HMJA 2QJYC 2QIWA 1WMKA 2B24A 4QDDA 2ZYLA 3GL0A 1NTKE 3Q2YA 4TT3H 1R8EA 2XSHA 3C0DA 5KLVE 1KILE 4HM7A 1BCCE 1NYHA 4YXDC 2FYNC 4R4MA 1BE3E 3Q3DA 3AE2C 1EXJA 1SJGA 3H1KE 2IBZE 4HM4A 2ZT9C 4NB9D 4EMJB 2FYUE 4GDOA 4NB8D 3L73E 4H13D 3LW5J 2YFLA 4OGQD 1YQ4C 3D89A 1VF5C 5M1BA 3AEDC 2XR8A 3H1IE 2NVFA 4IL6X 4HM5A 2A06E 2E4PA 1S5LX 2DE6D 3AEAC 4NBGD 1PP9E 2MKVA 1U57A 2DE5D 3CXHE 4NBED 1OW8A 2NWFA 1VF5D 3H1LE 1VCKA 4PV1D 4HJLA 3EQQA 3N0QA 2JO6A 4H0LD 4NBFD 4QDFB 2CKFA 2HMKA 4I7ZC 4HM8A 1Q90D 3VMGD 1DD4A 4NBAD 5L8RJ 2O01J 3IN6A 5BOKA 2FXPA 3Q5RA 1ULJA 3VCPA 3AE7C 3AE8C 1OMIA 2NVEA 4YTPC 3T97B 4QURA 1MKMA 1SQQE 3GTSA 4NBCD 1O7MA 3RL0g 1EZVE 3BCCE 2QSIA 5AEWA 1SQVE 1S1CX 2YVJB 4PD4E 4R4LA 2WSFJ 4NBBD 3L74E 2QPZA 3GZXA 1HF9A 2HMLA 4Z1MH 1UIXA 3L70E 2NVGA 2HMMA 3D6ZA 4Y28J 4H44C 3B71A 1PIXA 2E75B 3AE6C 2YMKA 1EXIA 1ZRTE 2BMQA 1DD3A 4OGQC 2Q3WA 2E74B 3AE4C 1NTZE 1RIEA 3R4YA 4AAYB 1K05A 3AZCA 1KQGB 2YFJA 3GCEA 3Q1MA 2XSOA 1NYKA 1O7WA 2E76D 4I7ZB 2JZAA 1PV3A 2E74C 4U3FE 3GTEA 1FQTA 2BEQD 2G3AA 2ZT9B 4HKVA 3GMAA 4XFJA 4KT0J 3SFEC 4QUQA 1SQXE 1O7GA 3AEBC 3CWBE 2DE7D 2GBXA 3D70A 1UUWA 2D2CC 2E4QA 2H88C 4HM0A 1NDOA 4HM2A 2QJKC 2QJPC 2K9YA 1RQVA 2IDBA 3GKEA 3RK3E 3FOUA 3D6YA 2JO1A 1P84E 3TGUE 1KMIZ 1Q90C 2P10A 2G8YA 1KORA 3L75E 4HM1A 2NUKA 4H0LC 4P1BH 1OW7A 1FDIA 4PV1C 1VF5B 1ULIA 3H25A 3AE5C 4PV1B 1G8JB 3L72E 4NBDD 3GF7A 3H1JE 3GZYA 2D2CB 3AE1C 5CXMA 2XRXA 1GMJA 4QDFA 3EWKA 2E74D 3VMHD 2WSCJ 2BEZF 2E76C 4RKUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H44 C;  4HM3 A;  5KLI C;  2GBW A;  1EG9 A;  1L0L E;  1UUV A;  3D89 A;  3L71 E;  1VF5 C;  4P1C H;  2YMK A;  1ZRT E;  2BMQ A;  2XR8 A;  3H1I E;  4OGQ C;  2NVF A;  4HM5 A;  2Q3W A;  4AIV A;  2E4P A;  2A06 E;  2DE6 D;  1NTZ E;  4NBG D;  1RIE A;  1PP9 E;  2HMO A;  4AAY B;  2DE5 D;  3CXH E;  4NBE D;  2ZT9 D;  2NUM A;  2NWF A;  3AZC A;  1VF5 D;  3H1L E;  1VCK A;  2YFJ A;  3GCE A;  4PV1 D;  4HJL A;  3CX5 E;  2B1X A;  4H44 D;  2XSO A;  3DQY A;  3GOB A;  3VCA A;  1NYK A;  3EQQ A;  1O7W A;  2I7F A;  3N0Q A;  2E76 D;  1G8K B;  1L0N E;  2JZA A;  4H0L D;  2JO6 A;  2E74 C;  4H13 C;  4NBF D;  3EN1 A;  4U3F E;  3GTE A;  1FQT A;  4QDF B;  5KKZ C;  2YIU C;  4QDC A;  4QUP A;  2CKF A;  4HKV A;  1SQB E;  1NTM E;  4I7Z C;  1JM1 A;  1WQL A;  2HMK A;  4HM6 A;  4HM8 A;  4NBH D;  3VMI D;  1PPJ E;  1SQP E;  1NU1 E;  3VMG D;  4NBA D;  4QUQ A;  2YFI A;  1SQX E;  5AEU A;  2BMR A;  2E75 C;  1O7G A;  5HL4 A;  3CWB E;  5BOK A;  2DE7 D;  3H1H E;  2GBX A;  1UUW A;  2HMN A;  2D2C C;  1ULJ A;  2E4Q A;  3VCP A;  4HM0 A;  1NDO A;  4HM2 A;  2NVE A;  2QJK C;  2QJP C;  1RFS A;  4QCK A;  4QUR A;  1SQQ E;  3GTS A;  2HMJ A;  3GL2 A;  3GKE A;  2QJY C;  2BCC E;  3FOU A;  4NBC D;  2E75 D;  1P84 E;  2BMO A;  1VM9 A;  2B24 A;  3TGU E;  1O7M A;  4QDD A;  1O7P A;  1EZV E;  2ZYL A;  1Q90 C;  3BCC E;  3GL0 A;  1NTK E;  2XSH A;  3C0D A;  5KLV E;  5AEW A;  1SQV E;  3L75 E;  4HM1 A;  4HM7 A;  1O7N A;  1BCC E;  2NUK A;  2D2C D;  2FYN C;  1BE3 E;  2YVJ B;  4H0L C;  4PD4 E;  4P1B H;  4NBB D;  3L74 E;  4PV1 C;  1KYO E;  2QPZ A;  1ULI A;  3GZX A;  1SJG A;  3H1K E;  1G8J B;  2IBZ E;  3L72 E;  4HM4 A;  1O7H A;  2ZT9 C;  1KB9 E;  4NBD D;  4NB9 D;  3H1J E;  3GZY A;  4EMJ B;  2FYU E;  2HML A;  5CXM A;  3GB4 A;  2XRX A;  4NB8 D;  3L73 E;  4QDF A;  2E74 D;  4H13 D;  3VMH D;  2E76 C;  3L70 E;  2NVG A;  2HMM A;  2YFL A;  4OGQ D; 
#chains in the Genus database with same CATH topology
 1M7L A;  2IBZ I;  1L0L E;  3HD7 C;  2OYO A;  1S5L E;  2JEE A;  5CJ0 A;  1YTZ I;  3B8E B;  2ZXX A;  3OW2 O;  3V4W A;  4GOF A;  5E79 E;  5DJU B;  2WZ7 A;  1RF0 C;  3L70 J;  4PD4 D;  3CCL P;  4OVN F;  1FZC B;  3EN1 A;  2ZXE B;  2YIU C;  1LTT C;  3PLN A;  1SQB E;  1JM1 A;  2ZVO B;  3H1L J;  4GT1 A;  2W6A A;  2IZ1 A;  3G71 P;  3H32 B;  2WPV B;  1ZME C;  2AEM A;  3L71 D;  2FFD A;  1EZV D;  5CCH D;  2QA4 P;  4D6T E;  1NGM B;  2IFM A;  5AW1 B;  2KS1 B;  1BGY E;  2BMO A;  3M0D C;  1CZQ A;  2Z5I A;  3V2Q A;  1JNM A;  2OYH A;  5APY A;  3HTK A;  1O7N A;  2H8P D;  2W83 C;  2KZI A;  4LC1 A;  5BVZ A;  2QJY B;  4IOI H;  2QM7 A;  4PJ0 H;  1D7M A;  3U1C A;  1LT9 C;  3QWO C;  1FDM A;  1KN7 A;  2OQQ A;  1O7H A;  3BAT A;  2E76 B;  1QVF O;  2KUB A;  2KZJ A;  4EOT A;  2N1T C;  2SPZ A;  2J5U A;  1JY2 P;  1KQS O;  1HJ0 A;  4HM3 A;  2LXB A;  1JEK A;  1JCC A;  5AVS B;  1PL5 A;  5CJ4 A;  3EFF K;  4N78 D;  1YQ3 C;  2M8R A;  3AEG C;  2R44 A;  3RK2 B;  1NAY A;  1S5L H;  3L35 A;  4AYC A;  3CX5 E;  3E1R A;  3CD6 P;  2KIK A;  5KJ7 A;  1IK7 A;  3CI9 A;  4BXL A;  4HM6 A;  1L0L G;  2C9L Y;  1Q81 Q;  2E75 C;  3L74 G;  1RF1 A;  1KYO H;  3AE9 C;  3CCQ P;  2HMN A;  3TGU G;  1J1D B;  1W2B O;  1AQT A;  4GOD A;  4OWF A;  1J2J B;  2WMM A;  1QEX A;  1WMK A;  2B24 A;  3RBZ A;  1K9M Q;  1G1J A;  3GL0 A;  1R8E A;  2IFN A;  3C0D A;  1KQL A;  1JY2 O;  1PGJ A;  3CXH D;  2WSE H;  1PFI A;  3M06 A;  1BCC E;  4R4M A;  2GUV A;  2A45 H;  3V2P A;  1IO4 A;  3PH0 A;  4HM4 A;  1J1E B;  2B87 B;  2ZT9 C;  2WSC H;  3L4F A;  4NB8 D;  2HR3 A;  3E7K A;  4H13 D;  1GL2 B;  3CMA P;  1NTM J;  1PP9 G;  3D89 A;  1SQQ J;  1SQX G;  2CPB A;  3PJS K;  3RK2 D;  1LTI C;  4HM5 A;  2KB7 P;  4WVZ A;  2E4P A;  1RHZ B;  3WU2 E;  1VQ8 P;  1OVU A;  5KLV J;  1PP9 E;  3QH9 A;  3L75 J;  2Y9Y A;  2W90 A;  1BSH A;  3OJA B;  2XV5 A;  4NBE D;  3H1I D;  3H1L E;  1FOS E;  1VQ9 P;  2M3E A;  1RF0 A;  3IFM A;  3EQQ A;  3CX5 D;  1KFN A;  1M56 D;  1H8A A;  3H1L G;  1NVO A;  2MJZ A;  2FKW B;  1LTS C;  2YKO A;  2IYO A;  3H1J D;  4O9B A;  1IFN A;  1ULJ A;  1GZL A;  3A3Y B;  1UII A;  1DEE G;  3A0B H;  1YJ9 P;  3CWB G;  4QUR A;  1MKM A;  1SQQ E;  3GTS A;  3HD7 B;  4NBC D;  1O7M A;  2YNY A;  1LWU A;  2QSI A;  3CCJ P;  2C0X A;  2WVR A;  1BDC A;  3H1J J;  1VDF A;  5GTH H;  1JY3 P;  1Q86 Q;  4R4L A;  1DX7 A;  1NWQ A;  3L74 E;  3L73 G;  3GHG C;  5KLV G;  2QPZ A;  1NTZ J;  1NU1 J;  2KK7 A;  5AW7 B;  4Z1M H;  3NMD A;  1FZB A;  2NVG A;  1PGO A;  1NKZ B;  3M9B A;  3D6Z A;  3RK3 B;  1LTG C;  1PIX A;  1JO5 A;  4WY4 A;  2E75 B;  3AE6 C;  1EXI A;  1USE A;  1ZRT E;  1EDK A;  1JMB A;  1X22 A;  4W7Y A;  1ZLL A;  3CXH H;  5GTI E;  1NTZ E;  3MIW A;  1GTW A;  2ZYD A;  1LGH B;  1CW5 A;  1E79 H;  1RIE A;  3LID A;  3H1L D;  2QG4 A;  1OVV A;  1K05 A;  1KQG B;  1SQB G;  1SQB K;  1KFM A;  1N7L A;  2YFJ A;  3GCE A;  1EZV I;  4IFF A;  1N8R Q;  1W2E A;  2XSO A;  1O7W A;  2YXR B;  3P7K A;  2JZA A;  5APQ A;  1URQ B;  4U3F E;  3GTE A;  1LJ2 A;  2BEQ D;  2WIT A;  3U59 A;  1BCC G;  2XU6 A;  1OWA A;  4XFJ A;  3CME P;  1PZQ A;  1SQX E;  2IYP A;  2OYH B;  2XND H;  2DE7 D;  1U7M A;  4EI2 A;  2HPC B;  1JY3 O;  2N1T B;  1NDO A;  1L0L K;  1AVO A;  1OIP A;  2QJP C;  4AQR D;  2K9Y A;  3H1K J;  1T6A A;  1RQV A;  1YIJ P;  2E43 A;  3MTU E;  1SS1 A;  4L75 A;  2G8Y A;  5CCH C;  3WUU A;  1FZE A;  1S3J A;  2NUK A;  1ZV8 A;  4JF7 A;  1JTH A;  1SQV K;  3M9Q A;  1KYO D;  1S2E A;  1LWU C;  4NPF X;  4PV1 C;  4WY4 C;  2RN0 A;  5CCG C;  1ULI A;  3H25 A;  2K88 A;  5AVW B;  4ASW A;  1G8J B;  1IFP A;  1SQB J;  5GTI H;  1GMJ A;  1ZW0 A;  3MD0 A;  3VMH D;  2C0W A;  2KXP B;  2JDI H;  5AW5 B;  3LW5 H;  4C46 A;  1NU1 D;  3AEE C;  1Q7Y Q;  2BCC J;  2ZYG A;  1JUN A;  3O6Q A;  3GW6 A;  4JQ0 D;  4K35 A;  3HD7 D;  1EDJ A;  3DQY A;  4N3Y B;  1SQV D;  3VMI D;  4I2L C;  2OTK E;  4OGQ B;  2LXC B;  1P84 I;  2K3R A;  2XNX A;  2JWD A;  1HGZ A;  5EFW B;  2PAJ A;  1T2K C;  1Y9B A;  2NPS B;  3W67 A;  4RJT A;  1KQF B;  3RL0 D;  3CLQ A;  3Q5P A;  1SQV G;  1RFS A;  3I55 P;  2KNC A;  1JM0 A;  5APW A;  1FDO A;  2BCC E;  2YMY A;  1VM9 A;  3FWL A;  3G9R A;  4HJG H;  1FBM A;  2Z4E A;  1NTM G;  1NTZ G;  2BCC G;  2H43 A;  3L73 J;  1L4A A;  1W5C E;  5H2F H;  1VPC A;  1HJB A;  3GHG B;  1J1D C;  2KI7 B;  3E1I A;  1URQ C;  1OVR A;  3GB4 A;  1R5S A;  3JCU H;  1FJK A;  2I1J A;  1NO4 A;  4PD4 H;  1YBK A;  3L71 E;  4P1C H;  1L0N J;  4AUW A;  2NRG A;  4LLH A;  4IL6 E;  1S9K D;  1NTM K;  1VQ7 P;  1ZP0 C;  3RK2 C;  1FJP A;  3VTP C;  3CCS P;  1OXZ A;  3TDK A;  2QJP B;  2I7F A;  3S1K A;  1L0N E;  3TSI A;  4H13 C;  3CCR P;  2GM4 A;  2HLO A;  1WQL A;  4HH2 A;  1GW4 A;  2CK3 H;  3HRN A;  3BRT B;  2KSJ A;  3VMY A;  3Q5S A;  5K5G B;  2R3C A;  2QE7 H;  5CMZ A;  1VQN P;  3VMA A;  1RE3 C;  2N1T A;  1VQO P;  1USD A;  1FU1 A;  2WWW A;  2VRS A;  1MFZ A;  2QJY C;  4DOJ A;  3LIE A;  2QIW A;  4IFD K;  2ZVN B;  1EDI A;  3Q2Y A;  4TT3 H;  2B89 A;  5KLV E;  1NTM D;  1KIL E;  1BE3 D;  4YXD C;  1BE3 E;  3CX5 H;  2OYI B;  2AXT E;  3AE2 C;  1EXJ A;  2QEX P;  1SJG A;  1WT6 A;  4NB9 D;  2ITA A;  4GKG A;  1GK4 A;  2Y0D A;  2Q5U A;  3L73 D;  5DJT B;  1NHL A;  2L5G B;  4OGQ D;  2YFL A;  1YQ4 C;  1VQ4 P;  1VF5 C;  4EIJ A;  1KYO I;  5M1B A;  3AED C;  1L4A C;  2NVF A;  4IL6 X;  1ZRT D;  2JKV A;  2A06 E;  2DE6 D;  4W7Z A;  1LTJ B;  2NWF A;  1RY3 A;  3HUS A;  4NBF D;  2FFD C;  4UB8 E;  2HMK A;  4HM8 A;  2XZR A;  5CBN A;  3OAK A;  3VMG D;  4NBA D;  1MUU A;  4D6T G;  5BOK A;  5B5E H;  5AVU B;  2FYZ A;  1SQP G;  3AE7 C;  3H1I J;  1FZF A;  2WPR A;  1N2D C;  3T97 B;  2O1J A;  2FYU K;  1H0T A;  3JSV C;  2HFE D;  5AW2 B;  3RL0 g;  1EZV E;  3VN0 A;  4KHX A;  1M1J C;  3A5T A;  1CI6 B;  2R5B A;  1VQM P;  4N6J A;  3NTN A;  1G1I A;  1JTH B;  4EYY Q;  2WSF J;  4NBB D;  3CWB D;  3S4R A;  3KYQ A;  3HE5 B;  3JC2 2;  1YJW P;  1M90 Q;  4TLF A;  5BU8 B;  2FFD B;  4UB6 H;  2WPS A;  1SQX D;  1L0N G;  5APS A;  2WSF H;  3L70 E;  2K9J B;  3WMM 0;  1PP9 D;  3L36 A;  1LTJ C;  5APU A;  2YMK A;  1H0T B;  2J59 M;  4ASV A;  5APT A;  3A0H H;  2Q3I A;  1NU1 K;  3H1H G;  1DEB A;  3MZW B;  2YO2 A;  2BAS A;  1HWT C;  1A02 J;  1NTK K;  4AAY B;  5B66 E;  3L72 D;  3AZC A;  1FC2 C;  3H32 A;  1SQQ D;  3Q1M A;  2E76 D;  1PV3 A;  1PPJ D;  3EFG A;  4HKV A;  3L75 D;  1GK6 A;  4KT0 J;  4UB6 E;  4HB1 A;  2OGU A;  3VP8 A;  1MV8 A;  1T3U A;  3H6P A;  3L72 J;  2E4Q A;  1X0T A;  1ZR4 A;  1N7S C;  3VMX A;  1JY2 N;  2QJK C;  1VQ6 P;  2IDB A;  3RK3 E;  4BWN A;  1P84 E;  2JO1 A;  3PHL A;  4U3F J;  2P10 A;  3BRV B;  4PJ0 E;  1G2C B;  1KOR A;  1T3J A;  2FXO A;  1EC5 A;  1KIL D;  1FE6 A;  1L4A B;  1QGK B;  3MHV A;  1IFD A;  2WT7 B;  1FDI A;  5AVY B;  1SFC C;  1FAV A;  2XKM A;  1KZU B;  2JR8 A;  2WT7 A;  3GF7 A;  3H1J E;  3H1H D;  4UB8 H;  4N78 E;  4QDF A;  2E74 D;  2BEZ F;  1IZN B;  1XTC C;  3C8V A;  3H1J G;  3CX5 I;  4HYT B;  3TF5 A;  2AEJ A;  1KB9 I;  2RMZ A;  1JCD A;  2OTJ P;  1K8A Q;  1R5L A;  2CPS A;  3N4X A;  2FYN B;  2HMO A;  1P84 D;  3RBX A;  3HE4 A;  3AEC C;  1L0L J;  2ZFC A;  1SQB D;  5AVV B;  3CXH I;  3IAO A;  3HUS C;  3W68 A;  4C7N B;  1AJY A;  2B1X A;  1Z56 A;  1EZV G;  1NH4 A;  3CC4 P;  1VQK P;  2O01 N;  4QUP A;  3B5N D;  1GL2 D;  1SQP K;  1SFC B;  2PRR A;  4H44 B;  5AEU A;  2BMR A;  1BGY J;  2R5D A;  1NJI Q;  5HL4 A;  2LKM A;  3H1H E;  1YIT P;  1K04 A;  1S4X A;  1RE4 A;  4I1L A;  1K73 Q;  2RH0 A;  4JYC A;  1VL2 A;  4QCK A;  3L70 G;  3T97 A;  2NPS C;  5B66 H;  1KIL B;  1AVY A;  3PTZ A;  1O7P A;  2Q7C A;  2H89 C;  3SWF A;  5TIS E;  3B5N C;  3II6 A;  2D2C D;  5AW4 B;  3V5B A;  3NXS A;  2KNC B;  2V7Q H;  2AEF A;  1TU3 F;  2WQY C;  3FGA D;  1KB9 E;  3AEF C;  3M9H A;  1VQ5 P;  1M1K Q;  1RE3 A;  1AA0 A;  4ZMD A;  3VOP A;  4XA4 A;  3OA7 A;  1EDL A;  1GW3 A;  3L74 J;  2P2U A;  4AIV A;  4H13 B;  1KV4 A;  1N73 C;  1QL1 A;  2PFX A;  1NOH A;  1JB0 J;  3WUT A;  3NFQ A;  1SFC D;  1FZC A;  4H44 D;  2M0B A;  1DIP A;  1YTZ T;  2XDJ A;  4JBZ A;  3TGU D;  3SFD C;  4JYB A;  5KKZ C;  3U1A A;  1L0N D;  3WUV A;  1AQ5 A;  2HYN A;  1N73 A;  1SQP E;  1H88 A;  3D71 A;  1NU1 E;  3MP7 B;  2OTL P;  3L70 D;  5AVX B;  2WSS H;  3R2P A;  5KJ7 C;  1N7S D;  3V2N A;  1BDD A;  1FZC C;  1LT9 A;  4YPC A;  1LT1 A;  2XSH A;  4ZKU A;  1SQX J;  3K5B A;  1NTZ K;  1NYH A;  2FYN C;  2OYH C;  5APX A;  2FY8 A;  4EDF A;  3Q3D A;  4DCK A;  2KLU A;  3P8C E;  3H1K E;  1SLQ A;  4A7P A;  2QM8 A;  2HPC A;  2OYI C;  1RH5 B;  3BVH A;  2FYU E;  4QMA A;  3ITK A;  1RE4 C;  1H89 A;  4GDO A;  3L73 E;  4JPZ B;  1KD1 Q;  2KLV A;  3G3Z A;  3LW5 J;  1AV1 A;  2IBZ D;  2HOD B;  5GTH E;  1IJD B;  3H1I E;  3MGN A;  1HTL C;  1S5L X;  3B5N A;  3RK3 D;  2MKV A;  2Z5H A;  2DE5 D;  3C9I A;  1OW8 A;  3L72 G;  4PV1 D;  4WY4 D;  2ZYA A;  1EQ7 A;  4QDF B;  4I7Z C;  3KQG A;  3H1K D;  1DD4 A;  2O01 J;  2FXP A;  3Q5R A;  1NKN A;  1FZG A;  1PPJ G;  2FXM A;  1OMI A;  1YHQ P;  2ZAE B;  1IK9 A;  3BCC E;  2N9Y B;  3WU2 H;  2K1A A;  4U3F G;  2KSE A;  4DJG A;  1RF1 B;  2W6B A;  4ZNC A;  1S1C X;  2M3B A;  5KJ7 D;  5CCH A;  2YO3 A;  4PD4 E;  3USS A;  1NTK G;  1JOC A;  2Y0E A;  2KP8 A;  5AVR B;  2QVA A;  2B9B A;  1IFI A;  4ZKP A;  1GD2 E;  2HML A;  3L71 G;  4LGD E;  3ZDM A;  1BE3 J;  2IBZ G;  5H2F E;  1L0L D;  4H44 C;  1BCC J;  2OAR A;  3B71 A;  1SP4 A;  3VYI A;  1LP1 B;  4MN4 C;  1QLE D;  3FXD A;  3PP5 A;  4OGQ C;  2V4H A;  3VP9 A;  1SQV J;  3UIA A;  1GDT A;  2C9N Y;  1Y8A A;  5KLI B;  3H1K G;  5AW0 B;  2H7H A;  3L71 J;  4I7Z B;  1FQT A;  1SQP D;  2G3A A;  2ZT9 B;  3GMA A;  3B4S A;  3SFE C;  4QUQ A;  3AEB C;  3CPW O;  3CWB E;  1SQQ G;  1UUW A;  2D2C C;  2K37 A;  4HM2 A;  3I5C A;  2Y9Z A;  3L75 G;  2K9J A;  5KAF E;  2POH A;  3GKE A;  2M5A A;  2IX7 C;  3D6Y A;  2YKQ A;  3TGU E;  1KMI Z;  2LR2 A;  2NPS D;  1NAF A;  3L75 E;  1PGQ A;  3M0A A;  3TNU B;  5CBO A;  2BCC D;  1OW7 A;  3N7N A;  2P1J A;  5BU5 A;  2WPQ A;  2I1K A;  1KB9 D;  4K3A A;  5AVT B;  2P67 A;  4PV1 B;  4WY4 B;  5KTB A;  3L72 E;  2W8Z A;  4NBD D;  3GZY A;  2PGD A;  2A45 I;  2XRX A;  3CCV P;  4RKU J;  1N73 B;  3CWB J;  4RO0 A;  1EG9 A;  3GHG A;  5KLV K;  2M5A B;  4WB4 A;  5KAI H;  3A7O A;  2YIU B;  1BGY D;  1M1J A;  1URQ D;  3S9O A;  1JY3 N;  4WBA A;  2ZT9 D;  4I6M C;  1BCC D;  1KC8 Q;  1QVG O;  2JWA A;  1YJN P;  1GU4 A;  1NU1 G;  3BCC G;  4NPD A;  1G8K B;  2KYV A;  4BRY A;  4QDC A;  3JCU E;  5AVZ B;  3GG2 A;  2HOD A;  1M8O B;  5KAI E;  3VMZ A;  4L73 A;  3GLM A;  3BCC D;  4IFM A;  1LNQ A;  2P7J A;  4U7J A;  1T2K D;  3RGU A;  4GOE A;  5AW3 B;  3IR9 A;  1JMM A;  1AFO A;  3GL2 A;  1OW6 A;  2E75 D;  1WRG A;  2HG5 D;  3HTK B;  1KB9 H;  3CL3 D;  1Q2N A;  4H0L B;  1XTG B;  1M1J B;  4WWI A;  2E5T A;  2FYU G;  2O3J A;  3SWY A;  1KYO E;  1A02 F;  3SWK A;  1Y47 A;  1QX8 A;  5C39 A;  1BE3 G;  3F89 A;  2FBW C;  3O6Q B;  3L37 A;  5KAF H;  2UWJ E;  2OYI A;  1VQP P;  3A2A A;  3TGU J;  5AW8 B;  5KLI C;  2GBW A;  1ZOY C;  3GF3 A;  1UUV A;  1J1E C;  2KOG A;  1IFM A;  2KS1 A;  1Q82 Q;  1RQU A;  3RK3 C;  2N1T D;  2YKP A;  1BSN A;  3FXE A;  4DZO A;  3ABV C;  3AE3 C;  2NUM A;  2A06 G;  4PD4 I;  3A0B E;  3MUD A;  5CCG D;  2ZJS E;  2WSE J;  2V7Q J;  3EQ2 A;  3GOB A;  2R32 A;  3VCA A;  1L2P A;  2W6J H;  4D6T J;  3KDP B;  1GU5 A;  2NZ2 A;  2E42 A;  1YYC A;  1NTM E;  3CC7 P;  4NBH D;  1PPJ E;  3RL0 B;  1RF1 C;  4OH8 B;  2YFI A;  1YI2 P;  4C7N A;  4GIF A;  2QRX A;  2A06 D;  2JP3 A;  1KTM A;  5AW6 B;  1IC2 A;  3V4Q A;  1CI6 A;  1LTB C;  1URQ A;  5B5E E;  1DH3 A;  2O1K A;  4D6T D;  2HMJ A;  3V2R A;  3MUD C;  3HE5 A;  2L91 A;  4QDD A;  2ZYL A;  1NTK E;  2GA1 A;  3I56 P;  4HM7 A;  1FOS F;  1BGY G;  3CCM P;  3P8M C;  1PP9 J;  2B87 A;  1MZ9 A;  2B88 A;  1NTK D;  1HUC A;  4NPE A;  5KLV D;  2IBZ E;  1HBW A;  2A45 G;  4EMJ B;  1P84 H;  1T8Z A;  3KHU A;  4XE5 B;  1G2C A;  1S9K E;  2O01 H;  2RKL A;  4M3L A;  1LP1 A;  1HVV A;  2XR8 A;  1E5W A;  4DT0 A;  1ZN5 A;  2QJK B;  3AEA C;  4HKZ H;  2YXQ B;  1X79 B;  4NBG D;  5E79 H;  3TK1 A;  1U57 A;  1L4A D;  3CXH E;  1HH0 A;  3M0D A;  3C1L A;  1VF5 D;  1VCK A;  2AXT H;  2JJL A;  4HJL A;  2NPS A;  3L74 D;  3N0Q A;  2JO6 A;  1M57 D;  2Y0C A;  1OZH A;  4H0L D;  1SQX K;  5TIS H;  2CKF A;  4YXW H;  4RES B;  1Q90 D;  5L8R J;  3G4S P;  3HD7 A;  3H1I G;  3IN6 A;  2AXC A;  4U3F D;  1X9V A;  3VCP A;  3AE8 C;  2P58 A;  1LTA C;  1IFJ A;  5APV A;  2NVE A;  4YTP C;  5CCG A;  3M91 A;  1SVF A;  5AEW A;  1SQV E;  3FWN A;  4BRY B;  2WTY A;  3H1H J;  2FYU J;  1S72 P;  3B5N B;  5CHX A;  2YVJ B;  1U7J A;  5KKZ B;  2Q1K A;  4L74 A;  2PP6 A;  3GZX A;  3KZI H;  2I8D A;  4CPG A;  1HF9 A;  1GL2 C;  1UIX A;  1N7S A;  4IL6 H;  1PGP A;  1CSB A;  2HMM A;  3O8Z A;  3HE4 B;  4Y28 J;  1SFC A;  4Y99 B;  1NTK J;  4B86 A;  2BMQ A;  1DD3 A;  2Q3W A;  3TYY A;  2E74 B;  3AE4 C;  1N86 A;  1QL2 A;  1OX3 A;  1NTZ D;  3P32 A;  5AW9 B;  3R4Y A;  3P8C D;  1MFT A;  2Q9I A;  4C7R A;  1OFC X;  2E5Y A;  2IZ0 A;  2W27 A;  1LT9 B;  2IPP A;  1X8Y A;  1NYK A;  3TNU A;  3BCC J;  2E74 C;  3F5H A;  5TJH A;  1KIL A;  2GUS A;  4L76 A;  3CC2 P;  3KZI E;  3HUS B;  1O7G A;  1HGV A;  1LTJ A;  2GBX A;  3D70 A;  4W80 A;  3BAS A;  5AVQ B;  1KIL C;  2Q3E A;  2Q6Q A;  1L0N K;  2H88 C;  3FX0 A;  4HM0 A;  3V6I A;  3G6E P;  1GL2 A;  3SSU A;  1ZR2 A;  1LWU B;  3CCE P;  3FOU A;  1SQP J;  1Q90 C;  2N9B A;  1FZA A;  3PRJ A;  1ZXG A;  4HM1 A;  3IF4 A;  3RL0 C;  3KXD A;  4H0L C;  4P1B H;  2R3S A;  1VQL P;  1VF5 B;  1FS0 E;  3AE5 C;  2J58 A;  1SQQ K;  2D2C B;  3CCU P;  3AE1 C;  4KJM A;  4Y99 C;  5CXM A;  1N7S B;  2FYU D;  3EWK A;  2WSC J;  2E76 C;  3A0H E;  2DW3 A;  3KPE A; 
#chains in the Genus database with same CATH homology
 3C8V A;  1EG9 A;  1L0L E;  3AEE C;  3O6Q A;  2HMO A;  3S9O A;  3AEC C;  2ZT9 D;  3IAO A;  1AJY A;  2B1X A;  3DQY A;  1G8K B;  3EN1 A;  2YIU C;  4QDC A;  4QUP A;  1SQB E;  1JM1 A;  3VMI D;  4OGQ B;  4H44 B;  5AEU A;  2BMR A;  5HL4 A;  2WPV B;  3H1H E;  1ZME C;  3GLM A;  1Y9B A;  1K04 A;  1KQF B;  3Q5P A;  4U7J A;  1NGM B;  1VL2 A;  1RFS A;  4QCK A;  3GL2 A;  1FDO A;  1OW6 A;  2BCC E;  2E75 D;  2BMO A;  1VM9 A;  1O7P A;  2H89 C;  4H0L B;  3G9R A;  1O7N A;  2D2C D;  1KYO E;  1TU3 F;  2WQY C;  3FGA D;  2OQQ A;  1O7H A;  1KB9 E;  2E76 B;  3AEF C;  2FBW C;  3GB4 A;  2J5U A;  4HM3 A;  1HJ0 A;  5KLI C;  2GBW A;  1ZOY C;  3GF3 A;  1UUV A;  3L71 E;  4P1C H;  1PL5 A;  1RQU A;  4AIV A;  4H13 B;  1YQ3 C;  3AEG C;  1JB0 J;  1ZP0 C;  3ABV C;  3AE3 C;  2NUM A;  3CX5 E;  2WSE J;  2V7Q J;  4H44 D;  1DIP A;  3GOB A;  3VCA A;  2I7F A;  1L0N E;  3SFD C;  4H13 C;  5KKZ C;  2NZ2 A;  1IK7 A;  1NTM E;  1WQL A;  4HM6 A;  4NBH D;  1PPJ E;  1SQP E;  3D71 A;  1NU1 E;  2YFI A;  3Q5S A;  2E75 C;  2JP3 A;  1KTM A;  3AE9 C;  2HMN A;  2HMJ A;  2QJY C;  2QIW A;  1WMK A;  2B24 A;  4QDD A;  2ZYL A;  3GL0 A;  1NTK E;  3Q2Y A;  4TT3 H;  1R8E A;  2XSH A;  3C0D A;  5KLV E;  1KIL E;  4HM7 A;  1BCC E;  1NYH A;  4YXD C;  2FYN C;  4R4M A;  1BE3 E;  3Q3D A;  3AE2 C;  1EXJ A;  1SJG A;  3H1K E;  2IBZ E;  4HM4 A;  2ZT9 C;  4NB9 D;  4EMJ B;  2FYU E;  4GDO A;  4NB8 D;  3L73 E;  4H13 D;  3LW5 J;  2YFL A;  4OGQ D;  1YQ4 C;  3D89 A;  1VF5 C;  5M1B A;  3AED C;  2XR8 A;  3H1I E;  2NVF A;  4IL6 X;  4HM5 A;  2A06 E;  2E4P A;  1S5L X;  2DE6 D;  3AEA C;  4NBG D;  1PP9 E;  2MKV A;  1U57 A;  2DE5 D;  3CXH E;  4NBE D;  1OW8 A;  2NWF A;  1VF5 D;  3H1L E;  1VCK A;  4PV1 D;  4HJL A;  3EQQ A;  3N0Q A;  2JO6 A;  4H0L D;  4NBF D;  4QDF B;  2CKF A;  2HMK A;  4I7Z C;  4HM8 A;  1Q90 D;  3VMG D;  1DD4 A;  4NBA D;  5L8R J;  2O01 J;  3IN6 A;  5BOK A;  2FXP A;  3Q5R A;  1ULJ A;  3VCP A;  3AE7 C;  3AE8 C;  1OMI A;  2NVE A;  4YTP C;  3T97 B;  4QUR A;  1MKM A;  1SQQ E;  3GTS A;  4NBC D;  1O7M A;  3RL0 g;  1EZV E;  3BCC E;  2QSI A;  5AEW A;  1SQV E;  1S1C X;  2YVJ B;  4PD4 E;  4R4L A;  2WSF J;  4NBB D;  3L74 E;  2QPZ A;  3GZX A;  1HF9 A;  2HML A;  4Z1M H;  1UIX A;  3L70 E;  2NVG A;  2HMM A;  3D6Z A;  4Y28 J;  4H44 C;  3B71 A;  1PIX A;  2E75 B;  3AE6 C;  2YMK A;  1EXI A;  1ZRT E;  2BMQ A;  1DD3 A;  4OGQ C;  2Q3W A;  2E74 B;  3AE4 C;  1NTZ E;  1RIE A;  3R4Y A;  4AAY B;  1K05 A;  3AZC A;  1KQG B;  2YFJ A;  3GCE A;  3Q1M A;  2XSO A;  1NYK A;  1O7W A;  2E76 D;  4I7Z B;  2JZA A;  1PV3 A;  2E74 C;  4U3F E;  3GTE A;  1FQT A;  2BEQ D;  2G3A A;  2ZT9 B;  4HKV A;  3GMA A;  4XFJ A;  4KT0 J;  3SFE C;  4QUQ A;  1SQX E;  1O7G A;  3AEB C;  3CWB E;  2DE7 D;  2GBX A;  3D70 A;  1UUW A;  2D2C C;  2E4Q A;  2H88 C;  4HM0 A;  1NDO A;  4HM2 A;  2QJK C;  2QJP C;  2K9Y A;  1RQV A;  2IDB A;  3GKE A;  3RK3 E;  3FOU A;  3D6Y A;  2JO1 A;  1P84 E;  3TGU E;  1KMI Z;  1Q90 C;  2P10 A;  2G8Y A;  1KOR A;  3L75 E;  4HM1 A;  2NUK A;  4H0L C;  4P1B H;  1OW7 A;  1FDI A;  4PV1 C;  1VF5 B;  1ULI A;  3H25 A;  3AE5 C;  4PV1 B;  1G8J B;  3L72 E;  4NBD D;  3GF7 A;  3H1J E;  3GZY A;  2D2C B;  3AE1 C;  5CXM A;  2XRX A;  1GMJ A;  4QDF A;  3EWK A;  2E74 D;  3VMH D;  2WSC J;  2BEZ F;  2E76 C;  4RKU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...