2D2CD

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2d2cD02
2FYUE 4AAYB 3VMGD 2IBZE 1Q90C 3H1LE 2E75D 2BMRA 2BMQA 4NBHD 4H44C 1NTKE 4QDCA 1L0NE 3VMHD 2HMJA 4NBCD 2DE5D 1RIEA 4QCKA 1ULJA 2JZAA 4H0LC 2YMKA 3H1IE 3H1JE 1O7WA 2NWFA 3H1HE 2YIUC 2XRXA 2XSOA 2B24A 2BMOA 2NUMA 2E76C 1PP9E 3CWBE 4QUQA 3GTSA 2NVGA 1O7GA 1FQTA 1SQXE 2D2CC 4HM5A 3VCAA 2GBXA 1O7NA 3GTEA 2E4PA 3VCPA 2YFLA 5BOKA 2YFJA 3GKEA 4NBAD 4HKVA 1JM1A 4H44D 4PV1C 2XSHA 4QURA 4HJLA 1RFSA 2NUKA 4HM7A 1SJGA 3L73E 4HM1A 4H13C 2FYNC 4P1BH 3GCEA 2E74D 2GBWA 4EMJB 1PPJE 2QPZA 2QJKC 1VF5D 4AIVA 2YVJB 2NVEA 4NBED 2NVFA 5HL4A 1BE3E 3DQYA 2E4QA 5CXMA 1VF5C 3VMID 5AEWA 1NDOA 4NBDD 4NB8D 4HM6A 1KYOE 3GL0A 4HM2A 3L72E 3GZYA 2D2CD 1EG9A 2YFIA 2ZYLA 4OGQC 4NBFD 1SQQE 2HMKA 2Q3WA 4HM8A 4HM3A 4NBGD 2B1XA 3GZXA 2E74C 2HMOA 3CX5E 4QDFA 4HM4A 1O7HA 1L0LE 2A06E 3GB4A 4QDFB 5KLIC 3L74E 1WQLA 3EN1A 4I7ZC 3D89A 2E76D 1G8KB 1SQPE 2ZT9D 1BCCE 2I7FA 1UUWA 3GOBA 3H1KE 4HM0A 1O7MA 1NYKA 4U3FE 1SQBE 2ZT9C 3N0QA 3L75E 3AZCA 3EQQA 2JO6A 1NTME 2DE7D 4PV1D 2HMMA 1ULIA 1VM9A 1SQVE 1G8JB 2BCCE 3L70E 4OGQD 3C0DA 2QJYC 4NBBD 4H13D 4NB9D 2HMLA 3GL2A 4H0LD 4PD4E 4QDDA 1NU1E 2XR8A 2DE6D 3FOUA 5AEUA 5KLVE 3TGUE 2CKFA 1O7PA 1UUVA 3BCCE 5KKZC 1VCKA 3CXHE 1NTZE 1KB9E 2QJPC 1EZVE 4P1CH 2E75C 1ZRTE 4QUPA 3L71E 2HMNA 1P84E
chains in the Genus database with same CATH superfamily
3B4SA 2IBZI 3H1LE 4WY4D 1GZLA 4LGDE 5KAFE 5B66E 1PP9D 2YMKA 3L74J 2YO2A 1SLQA 2KUBA 3H1IJ 2B87B 1CW5A 3TDKA 5CCGA 1LT1A 2J58A 3PP5A 2ITAA 3PRJA 1W5CE 1CSBA 3V4WA 1RF0A 4CPGA 1Q2NA 5AW6B 4W7YA 1VQ7P 2QJKC 2WPQA 3EWKA 2NVEA 2B88A 3O8ZA 3W68A 1G2CA 1N73C 4NB8D 2I1KA 1ZR2A 1KMIZ 2HR3A 2GM4A 2D2CB 1FZEA 1D7MA 2G3AA 2M5AA 1RHZB 3CX5E 1O7HA 1L0LE 1L4AA 1FAVA 1WQLA 2FXOA 2BASA 2K3RA 4OVNF 2ZT9D 2KB7P 2IX7C 3H1KE 3GW6A 1ZMEC 1LP1A 2ZT9C 1OW7A 2YKPA 3EQQA 5AW1B 3CCEP 1G8JB 2OARA 1GK6A 2C0XA 1LWUC 5AVXB 1OMIA 1LTJC 3QWOC 2E74B 1EZVE 1ZRTE 2ZYDA 4PJ0H 4U3FG 2KSEA 5KLVD 3VMGD 2IBZE 3E1RA 3FWNA 3GHGA 1SQXJ 2QE7H 3FX0A 3RL0B 1DX7A 2DE5D 1CI6A 1BCCG 2AEMA 5AVWB 2JWDA 4WWIA 2R32A 5AVUB 3IFMA 2BMOA 3WUVA 2WVRA 1O7NA 1KILE 2CPBA 4L75A 2V4HA 1M1JC 2NPSC 4H44D 1JNMA 2HYNA 2NUKA 3N7NA 4P1BH 3PHLA 1RF1B 5CCGD 1FE6A 1AFOA 3DQYA 1LNQA 3AE8C 1J2JB 4PD4D 4N3YB 3BCCD 5APWA 5AW0B 1SQQE 3D6ZA 5KLVK 1U7JA 1GMJA 3KHUA 3GB4A 2K9JB 2WSFH 2XNXA 1N2DC 1VQ6P 1PP9G 3L74E 1EDKA 3L75J 1OVVA 1HH0A 1M1JA 3P7KA 2K9JA 5CJ4A 1N7SC 1FOSE 1KQGB 1JCCA 2H43A 1K04A 5GTIH 2QJYC 3TK1A 1W2BO 1T6AA 3PH0A 3BCCE 1JM0A 3H1ID 3MIWA 2W27A 1T2KD 3TGUD 1XTGB 1WT6A 1LWUB 4NBHD 4XE5B 2YIUB 1M8OB 4NBCD 1NTMK 1JY3O 4QCKA 3H1HE 4I2LC 3M0DC 1SFCD 2FYUJ 2PRRA 3GTSA 1G2CB 3USSA 1SQPG 3B5NB 2LR2A 2KZJA 2YFJA 2OTKE 3CPWO 1NKZB 4EMJB 4Y28J 1ZLLA 3A0HH 4Z1MH 3R4YA 1IFIA 4UB6E 1A02J 1M56D 3P8MC 3TF5A 1KORA 1AVYA 5APYA 5AVRB 3M9BA 2HMOA 2CPSA 1RE3C 3RK3E 1NKNA 1VDFA 1WRGA 1HJ0A 2IFMA 2K9YA 2LXBA 1SQPE 3GOBA 2NPSB 1OVUA 1JCDA 1ULIA 1SQVE 3H1KJ 1P84H 5CMZA 2HMLA 1HGVA 1LWUA 1VQOP 3ITKA 3SWFA 2A45G 1E5WA 3LIDA 2HMNA 3AE2C 3WU2E 3E7KA 1SQPK 2PFXA 1K73Q 2HODA 2WSSH 1KN7A 1K05A 1IFDA 2XNDH 1PV3A 3T97A 2Q9IA 2N9YB 3MD0A 2YIUC 3S4RA 2XSOA 3C8VA 3U1CA 1UIIA 1O7GA 5H2FE 1MKMA 2FYZA 2Y0CA 3BASA 2KS1B 3GKEA 4HKVA 1GDTA 1JM1A 1H88A 1L0LK 4EIJA 2NRGA 2GBWA 3SWKA 1VL2A 2KXPB 4EYYQ 5CBNA 3Q5PA 2M3EA 1FZFA 2L91A 1IFMA 2YXQB 1AVOA 4OGQC 5K5GB 2O1JA 2B87A 1BGYG 3A0BH 4GDOA 4DT0A 2Q5UA 3ZDMA 1KYOH 2OGUA 3H1JJ 3GMAA 4I7ZC 2V7QJ 3TSIA 4GOEA 5AW2B 4U3FE 1VQ5P 3EFFK 2NPSD 3LIEA 3CCQP 3BRVB 3HD7C 4YXDC 3GL2A 4H0LD 4EI2A 1YJNP 2POHA 5KKZC 2ZYGA 5L8RJ 2WPVB 2GA1A 4IL6E 1JY2P 3RK3C 1MFTA 3A3YB 1P84E 2PP6A 1X22A 3T97B 4N78D 2HMJA 1EDIA 3KQGA 1ULJA 5BU5A 1L0LG 2P1JA 3AECC 3AEAC 3VYIA 4UB8E 1M90Q 2E76C 2E5YA 2D2CC 1RF1C 5KKZB 1M1KQ 2BCCJ 5AVTB 2QIWA 2OYIA 1EXIA 1YITP 3GCEA 1PPJE 2SPZA 2H8PD 1ZP0C 3G9RA 4D6TJ 3L73J 5KAFH 4NBED 1BE3E 3OJAB 3H1HG 1FZCC 4GKGA 3U1AA 4M3LA 4Y99B 1IK9A 1CI6B 4KJMA 2YKQA 4PJ0E 3OW2O 1NU1J 2A45H 4HM3A 2E74C 3L75D 2A06E 3L70J 2KNCA 3B8EB 3GF3A 2G8YA 3O6QB 3CCMP 1FS0E 3EFGA 5BU8B 3CCUP 2ZYAA 4JYCA 3OAKA 3VOPA 2DE7D 3C0DA 1SQBG 4NB9D 1YIJP 1RQVA 3O6QA 2FYUD 4EDFA 3ABVC 3H1LG 3FXDA 4XFJA 1FU1A 3AE9C 1QLED 1P84I 3F89A 4R4LA 2K88A 2XV5A 1T3JA 1SQQG 2WSEJ 4L76A 3CWBD 2J5UA 1RY3A 2NUMA 3CWBE 1ZV8A 3VCAA 1J1DC 3U59A 1S4XA 3AE7C 1RFSA 4HJLA 1ZXGA 3L73E 1KB9H 1DIPA 2FYNC 4DOJA 1IFJA 3Q5SA 1NTKD 1QX8A 2Y9YA 1KFMA 1ZW0A 1AJYA 2E4QA 2NZ2A 1NTKG 1SQVD 3CX5H 2QG4A 2Q3EA 3L37A 5B5EE 1KQSO 1NVOA 2ZJSE 1AA0A 1BDCA 3H1JG 1H8AA 2M5AB 3HE5B 5AW7B 1LP1B 1KV4A 1GL2C 1BGYD 1H0TB 3CMEP 5KJ7D 1Z56A 1GL2D 3L73D 1SQVJ 3V2RA 5GTIE 5CJ0A 1Q82Q 5CBOA 1QVFO 2WWWA 2WT7A 4U7JA 1L0NJ 2JR8A 1EDJA 2H88C 1ZR4A 2CK3H 3Q1MA 2IYPA 4BRYB 3D71A 1QGKB 1LTJA 4PD4I 3NXSA 3L71J 1L0NK 4IOIH 1UUVA 1VCKA 3CXHI 2O01H 3V4QA 1KB9I 4IFMA 1Y9BA 1AV1A 1FZBA 2LKMA 1YTZI 4RKUJ 2BMQA 4I1LA 2E75B 1NTKE 4UB8H 1NTZD 1IO4A 3H1JE 1N7SB 3NTNA 3CD6P 3KXDA 2N9BA 5KLIB 2M8RA 1FDOA 2RKLA 1NU1K 2W6AA 3CMAP 2OYIC 1SP4A 1MZ9A 1YYCA 4NBAD 4GOFA 2Y9ZA 1URQA 3HD7D 3L73G 5EFWB 3M06A 3CC2P 4HKZH 3H1HJ 3I55P 2NVFA 5B66H 2IPPA 2RH0A 1LTSC 3BATA 1KYOE 3RL0D 1K9MQ 4HM2A 2FKWB 3TGUG 2MKVA 2KK7A 3FGAD 4WB4A 3B5NC 2FBWC 1M57D 1ZOYC 1BCCD 1LTTC 2W6BA 3BRTB 1KILC 3GG2A 1NGMB 5DJTB 2E76D 2R5BA 3FXEA 5AW9B 4OH8B 3G4SP 3VMZA 1O7MA 1HJBA 1JY2N 2JO1A 3A7OA 1OFCX 4R4MA 1NTME 5KLVJ 4H13B 3WUUA 2JKVA 1HUCA 4H0LB 2IFNA 1GK4A 4D6TE 2OTJP 2M0BA 5AEUA 3K5BA 3CXHE 3RK2D 1FZCA 3HUSA 3Q3DA 1DD4A 1EQ7A 2C9LY 2Q3IA 3JSVC 4QUPA 3L71E 2KIKA 3JCUE 1SQQJ 5AVQB 1S3JA 2AXTH 4EOTA 1YJWP 4QDCA 1BE3G 2FFDA 2JEEA 1NO4A 1PPJG 1DD3A 2VRSA 1PGJA 1SQXE 1FQTA 1KILA 3H32A 3Q2YA 3L36A 2Q1KA 1LTAC 3MHVA 4GIFA 2IZ1A 4UB6H 1N7LA 1HF9A 2UWJE 2QVAA 2IZ0A 3AE5C 4I6MC 3RL0g 1L4AD 3B71A 1PGQA 2I1JA 1PIXA 3SSUA 4NBFD 3MP7B 3CX5I 2H89C 1DH3A 1Q81Q 2ZT9B 3MGNA 4HJGH 1HWTC 2KS1A 4ASWA 2Z5IA 2KYVA 2HMMA 3OA7A 1JTHB 3H32B 4D6TG 3L72D 2Z4EA 1SQQK 2O1KA 4XA4A 4LLHA 1J1EC 1EZVI 1VQKP 1NAFA 1S9KE 1SS1A 3MUDC 2JJLA 3SFDC 4ASVA 3L70G 4AQRD 2NWFA 2WSCJ 1A02F 2OYHC 3VP9A 4K3AA 1PP9E 1NTZJ 3EQ2A 3TNUB 4TT3H 5APTA 1LTIC 2HG5D 1URQD 1FZAA 1YTZT 2K37A 4YXWH 3SFEC 2E43A 2IYOA 4HM1A 2Q6QA 2OTLP 2ZXEB 3L71D 1LTBC 5HL4A 2WSCH 5AW3B 2P7JA 1VQNP 5CXMA 4AYCA 3B5NA 3RGUA 2R5DA 1VQ9P 1JMMA 3E1IA 1JUNA 2YNYA 1VQ8P 3LW5H 4L74A 1FOSF 1USEA 2NPSA 1EXJA 5CCGC 3RK3B 3H6PA 2KLVA 1AQTA 2XKMA 2BCCE 4IL6H 1LJ2A 4ZKPA 1NU1E 2DE6D 1NTKJ 1G1JA 1JB0J 1JY3N 1SQXK 3IAOA 1PZQA 4P1CH 1NU1D 1T8ZA 1VF5B 1RE4A 2LXCB 4U3FJ 4YPCA 1N7SD 1G1IA 4WY4B 1NYHA 1IC2A 1O7WA 2ZFCA 4C7NB 5E79E 1N7SA 4ZKUA 1BCCJ 3AEBC 1KILD 2NVGA 3CC7P 2GBXA 2OYHB 3PTZA 2E76B 1LTJB 1T2KC 3GHGB 4W80A 3HD7B 1NWQA 3R2PA 5AVYB 2GUVA 2HPCA 1JTHA 5TJHA 4H13C 2H7HA 3KZIH 1GD2E 1IZNB 3BCCJ 1QEXA 3UIAA 5AVSB 3N4XA 3AEDC 3H1LD 2N1TD 3VMID 1EZVG 2QJPB 5TISE 2XU6A 5GTHE 2WQYC 2N1TC 3HUSB 2ZYLA 3PJSK 1NAYA 2C0WA 2Q3WA 3LW5J 2IDBA 1RQUA 2O3JA 3H1IG 2QSIA 3S9OA 1IK7A 5KAIH 3EN1A 1VQPP 1G8KB 3WUTA 3F5HA 3L75G 2FFDB 1EZVD 1S1CX 3SWYA 4WY4C 2RN0A 1SQXD 4U3FD 3RK2B 1BSNA 3TGUE 1QL2A 3V2PA 1FJPA 1OVRA 5CHXA 3A0BE 4HB1A 1N73B 4WY4A 2B9BA 1M1JB 4C46A 4NPDA 1SQBK 1L4AB 1JMBA 1OW8A 3VMHD 1MFZA 2A06G 4H0LC 1NH4A 1BGYJ 2OYHA 1SQPJ 1EDLA 3V2QA 3CCRP 3L72G 3HE4B 1K8AQ 3M0DA 5E79H 2FXMA 4O9BA 4HH2A 1PL5A 3CI9A 4WVZA 4ZNCA 1JY2O 3GHGC 1VF5D 3P8CE 1IFPA 1VF5C 4WBAA 2KI7B 1SQXG 3L72E 1BE3J 3P8CD 3AE1C 2WZ7A 3HUSC 4QDFA 2YMYA 3CWBG 2WT7B 1ZN5A 1HBWA 2I7FA 1LT9C 2A06D 5KTBA 2QM8A 4PV1B 1HVVA 3H1KG 1LTGC 3G71P 1IJDB 2KP8A 2BCCG 2W90A 4OGQD 1Y47A 3AE3C 4QDDA 3TNUA 2B89A 2XR8A 2ZXXA 5KLVE 1NTMG 1O7PA 3G3ZA 1N73A 2QJPC 2QJYB 4GT1A 1HTLC 1KC8Q 2FYUE 4AAYB 1BE3D 2M3BA 1JO5A 4H44C 3L74D 3WU2H 1PP9J 3H1IE 4KT0J 2AEFA 1KQLA 3CCJP 5CCHC 1TU3F 1RF1A 1FC2C 4QUQA 3HD7A 1NTZK 2W83C 2KNCB 4QMAA 1URQB 1SVFA 3GTEA 2QM7A 2HLOA 2QRXA 3RK3D 4QURA 1CZQA 1AQ5A 1SJGA 1X0TA 5AW5B 4AIVA 2AEJA 1FDMA 3VMYA 4NBDD 5AVZB 3GL0A 3FWLA 2D2CD 5C39A 2FYUG 1KFNA 1LGHB 3S1KA 1QVGO 1FZGA 3D6YA 2OYIB 3IN6A 1JY3P 1PPJD 1WMKA 3Q5RA 5APSA 1UUWA 3MTUE 1SQBE 2AXCA 1KILB 3L75E 3AZCA 4AUWA 2JO6A 3AE6C 1N86A 1LT9B 4RJTA 1JOCA 4W7ZA 4H13D 2PAJA 1YQ3C 2FYNB 1NTKK 1H0TA 2P67A 1P84D 2R44A 1SFCC 1L2PA 5DJUB 3A5TA 1VQ4P 2YO3A 4N78E 1HGZA 2BEZF 1H89A 1PGOA 2BMRA 2Q7CA 2N1TB 5H2FH 3V5BA 1RIEA 5APVA 1SQPD 1OIPA 2XRXA 1SQBD 1L0LJ 3D70A 1SQQD 4IFFA 1S72P 1FDIA 3GF7A 3CL3D 5BOKA 4OGQB 1XTCC 2KLUA 1JEKA 1YI2P 1OWAA 2OYOA 1FBMA 1L0NG 3I56P 1GTWA 5AW4B 1OXZA 1U57A 2YVJB 3BVHA 1NDOA 3MZWB 3GZYA 3M9QA 1J1DB 3GLMA 2Y0EA 3H25A 1J1EB 5B5EH 4C7RA 1NU1G 2OQQA 3AEGC 1L0ND 2WMMA 3CCSP 4LC1A 2AXTE 1VQLP 3HTKA 2E42A 3CCLP 3RL0C 2WSEH 3H1HD 1X8YA 2DW3A 4BRYA 2PGDA 3BCCG 3L70E 2YXRB 1BGYE 3P32A 3H1LJ 3HTKB 3FOUA 2GUSA 3M91A 2ZVNB 1NTZE 5AW8B 3KZIE 2E75C 3RBXA 2KZIA 2E75D 1KB9D 5BVZA 3TGUJ 4HYTB 1QL1A 2JZAA 4JQ0D 1KZUB 3IF4A 1S5LE 2B24A 1NHLA 4IL6X 3RK2C 1YQ4C 2E5TA 2O01N 1GU5A 2R3SA 2C9NY 2E4PA 3HRNA 1M7LA 2K1AA 3JC22 4PV1C 1YJ9P 2P58A 4L73A 2FY8A 2P2UA 3KPEA 1GU4A 2V7QH 2ZAEB 1YHQP 4NPEA 4RESB 3CCVP 3IR9A 1KYOI 4HM6A 3VP8A 3VTPC 4B86A 2HMKA 1PFIA 1VPCA 2WSFJ 1W2EA 4HM8A 1FZCB 3GZXA 2Y0DA 2L5GB 1NJIQ 5CCHD 5KJ7A 3HE4A 3I5CA 3L72J 1OX3A 2RMZA 2IBZG 1VQMP 4D6TD 2WPSA 4HM0A 1NYKA 1SQVG 1DEEG 3L4FA 1EC5A 4BXLA 3NMDA 2QEXP 1MV8A 5GTHH 2XDJA 1DEBA 2QA4P 4DZOA 4JF7A 5AVVB 3L71G 1Q90D 5APQA 1GW4A 1L0LD 1Q90C 4C7NA 4BWNA 1Q86Q 3KDPB 1L0NE 3TYYA 1USDA 3CWBJ 1R8EA 3HE5A 3II6A 2HODB 5APXA 3L74G 4TLFA 4HM5A 1R5SA 3L70D 2YFLA 3AEEC 2FXPA 2KOGA 1KD1Q 1SQBJ 2N1TA 1U7MA 2XSHA 4H44B 1NTMJ 2WTYA 2E74D 2HPCB 2IBZD 2O01J 4K35A 4JYBA 4DCKA 5KJ7C 1OW6A 1X79B 2A45I 4PD4H 3V2NA 3A0HE 3W67A 1PGPA 3H1JD 4OWFA 3VN0A 3CXHD 1EG9A 2W8ZA 1FJKA 2J59M 2B1XA 1SQVK 2ZVOB 2W6JH 4GODA 2WITA 1YBKA 2Z5HA 1N8RQ 3C1LA 3D89A 3RBZA 3AE4C 1BDDA 1BCCE 1S5LX 1GL2B 5KLVG 1NTZG 1L4AC 1Q7YQ 5CCHA 1VM9A 3QH9A 4KHXA 4IFDK 3CXHH 1MUUA 5M1BA 2YKOA 4PD4E 4N6JA 1NOHA 2BEQD 2BCCD 2QJKB 1KB9E 3PLNA 1T3UA 1SFCA 2P10A 1R5LA 1KQFB 2WPRA 3JCUH 3M0AA 3WMM0 1UIXA 2FYUK 1LT9A 3L35A 1IFNA 1NTMD 1SFCB 2FFDC 4NPFX 1RH5B 1S5LH 3VCPA 1Y8AA 3B5ND 5KAIE 2HFED 3VMXA 4HM7A 2JWAA 3CC4P 3H1KD 1KYOD 4I7ZB 2JDIH 2QPZA 3AEFC 3MUDA 4JPZB 4Y99C 5AEWA 1BSHA 1GW3A 3C9IA 2MJZA 2YFIA 3M9HA 1KTMA 1ZRTD 2JP3A 4A7PA 1S2EA 1URQC 3A2AA 4NBGD 2I8DA 1S9KD 4HM4A 4QDFB 1GL2A 1X9VA 5KLIC 3V6IA 4DJGA 5APUA 1RE3A 4YTPC 1RF0C 3NFQA 2R3CA 4ZMDA 3VMAA 1E79H 2KSJA 3N0QA 3CX5D 4RO0A 1OZHA 4PV1D 2XZRA 5TISH 3G6EP 4NBBD 3KYQA 2CKFA 1RE4C 4MN4C 3CLQA 4JBZA
chains in the Genus database with same CATH topology
2BEZF 3H1LE 2BMRA 3T97B 3SFDC 2HMJA 1RIEA 1ULJA 2YMKA 3AECC 2NWFA 3AEAC 2WSCJ 2XRXA 3D70A 2E76C 1PP9E 2D2CC 4TT3H 1FDIA 3GF7A 5BOKA 4OGQB 3SFEC 2QIWA 4HM1A 1EXIA 3GCEA 1PPJE 1U57A 2QJKC 3EWKA 1ZP0C 3G9RA 2YVJB 2NVEA 4NBED 5HL4A 1BE3E 5CXMA 1NDOA 4NB8D 3GZYA 1KMIZ 3GLMA 2D2CB 2G3AA 4HM3A 2E74C 3H25A 3CX5E 1O7HA 1L0LE 2A06E 2OQQA 3AEGC 1WQLA 1EXJA 3GF3A 2G8YA 2ZT9D 3H1KE 1ZMEC 2ZT9C 1OW7A 3EQQA 2DE7D 2BCCE 1G8JB 3L70E 3C0DA 4NB9D 1NU1E 1RQVA 2DE6D 3FOUA 3O6QA 3ABVC 1JB0J 1NTZE 1OMIA 3IAOA 4XFJA 2E74B 1EZVE 4P1CH 2E75C 1ZRTE 3AE9C 1VF5B 4R4LA 3VMGD 2IBZE 2E75D 2WSEJ 2DE5D 1NYHA 2JZAA 1O7WA 2J5UA 2B24A 2BMOA 4IL6X 2NUMA 3AEBC 3CWBE 2NVGA 1YQ4C 3VCAA 2GBXA 1O7NA 2E4PA 1KILE 2E76B 4H44D 4PV1C 3AE7C 1RFSA 2NUKA 4HJLA 3L73E 4H13C 2FYNC 1DIPA 4P1BH 3Q5SA 3AEDC 1AJYA 3DQYA 2E4QA 2NZ2A 3VMID 3AE8C 4HM6A 2WQYC 2ZYLA 1SQQE 3D6ZA 2HMKA 2WSFJ 2Q3WA 4HM8A 3LW5J 2IDBA 3GZXA 1GMJA 1RQUA 3GB4A 2QSIA 3S9OA 1IK7A 3L74E 3EN1A 1G8KB 4HM0A 1NYKA 4U7JA 1KQGB 1S1CX 2H88C 3Q1MA 1K04A 3D71A 2QJYC 3TGUE 1UUVA 3BCCE 1VCKA 1Y9BA 1Q90D 4RKUJ 1Q90C 2BMQA 4NBHD 2E75B 1NTKE 1OW8A 1L0NE 3VMHD 4NBCD 4QCKA 4H0LC 3H1JE 3H1HE 1R8EA 1FDOA 3GTSA 4HM5A 2YFLA 3AEEC 2YFJA 4NBAD 2FXPA 2XSHA 1PL5A 4H44B 2E74D 4Y28J 4EMJB 2O01J 4Z1MH 1VF5D 3R4YA 1OW6A 2NVFA 1VF5C 1KYOE 4HM2A 3L72E 1EG9A 2MKVA 3FGAD 3AE1C 1KORA 2B1XA 2HMOA 2FBWC 4QDFA 3RK3E 1ZOYC 1NGMB 1HJ0A 3D89A 2K9YA 2E76D 3AE4C 1SQPE 1BCCE 2I7FA 3GOBA 1O7MA 1S5LX 2JO1A 4R4MA 4PV1B 1NTME 1ULIA 4H13B 1SQVE 1VM9A 4H0LB 4OGQD 3AE3C 5M1BA 2HMLA 4PD4E 4QDDA 2XR8A 5AEUA 5KLVE 2BEQD 1O7PA 3CXHE 1KB9E 2QJPC 3Q3DA 1DD4A 4QUPA 3L71E 2HMNA 3AE2C 2FYUE 4AAYB 2P10A 4H44C 1K05A 1KQFB 4QDCA 1PV3A 4KT0J 3H1IE 1TU3F 2YIUC 1DD3A 2XSOA 1UIXA 4QUQA 3C8VA 1O7GA 1MKMA 1FQTA 1SQXE 3GTEA 3VCPA 3GKEA 4HKVA 1JM1A 3Q2YA 4QURA 4HM7A 1SJGA 4I7ZB 2GBWA 2QPZA 1VL2A 3AEFC 1HF9A 4AIVA 3AE5C 3RL0g 3Q5PA 5AEWA 4NBDD 3B71A 3GL0A 2D2CD 1PIXA 2YFIA 4OGQC 1KTMA 4NBFD 2JP3A 4NBGD 4GDOA 2H89C 4HM4A 3D6YA 4QDFB 5KLIC 3GMAA 2ZT9B 4I7ZC 2V7QJ 3IN6A 4YTPC 1WMKA 3Q5RA 1UUWA 4U3FE 1SQBE 3N0QA 3L75E 3AZCA 2JO6A 3AE6C 4PV1D 2HMMA 4YXDC 4NBBD 4H13D 3GL2A 4H0LD 1YQ3C 2CKFA 5KKZC 5L8RJ 2WPVB 1P84E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU E;  4AAY B;  3VMG D;  2IBZ E;  1Q90 C;  3H1L E;  2E75 D;  2BMR A;  2BMQ A;  4NBH D;  4H44 C;  1NTK E;  4QDC A;  1L0N E;  3VMH D;  2HMJ A;  4NBC D;  2DE5 D;  1RIE A;  4QCK A;  1ULJ A;  2JZA A;  4H0L C;  2YMK A;  3H1I E;  3H1J E;  1O7W A;  2NWF A;  3H1H E;  2YIU C;  2XRX A;  2XSO A;  2B24 A;  2BMO A;  2NUM A;  2E76 C;  1PP9 E;  3CWB E;  4QUQ A;  3GTS A;  2NVG A;  1O7G A;  1FQT A;  1SQX E;  2D2C C;  4HM5 A;  3VCA A;  2GBX A;  1O7N A;  3GTE A;  2E4P A;  3VCP A;  2YFL A;  5BOK A;  2YFJ A;  3GKE A;  4NBA D;  4HKV A;  1JM1 A;  4H44 D;  4PV1 C;  2XSH A;  4QUR A;  4HJL A;  1RFS A;  2NUK A;  4HM7 A;  1SJG A;  3L73 E;  4HM1 A;  4H13 C;  2FYN C;  4P1B H;  3GCE A;  2E74 D;  2GBW A;  4EMJ B;  1PPJ E;  2QPZ A;  2QJK C;  1VF5 D;  4AIV A;  2YVJ B;  2NVE A;  4NBE D;  2NVF A;  5HL4 A;  1BE3 E;  3DQY A;  2E4Q A;  5CXM A;  1VF5 C;  3VMI D;  5AEW A;  1NDO A;  4NBD D;  4NB8 D;  4HM6 A;  1KYO E;  3GL0 A;  4HM2 A;  3L72 E;  3GZY A;  2D2C D;  1EG9 A;  2YFI A;  2ZYL A;  4OGQ C;  4NBF D;  1SQQ E;  2HMK A;  2Q3W A;  4HM8 A;  4HM3 A;  4NBG D;  2B1X A;  3GZX A;  2E74 C;  2HMO A;  3CX5 E;  4QDF A;  4HM4 A;  1O7H A;  1L0L E;  2A06 E;  3GB4 A;  4QDF B;  5KLI C;  3L74 E;  1WQL A;  3EN1 A;  4I7Z C;  3D89 A;  2E76 D;  1G8K B;  1SQP E;  2ZT9 D;  1BCC E;  2I7F A;  1UUW A;  3GOB A;  3H1K E;  4HM0 A;  1O7M A;  1NYK A;  4U3F E;  1SQB E;  2ZT9 C;  3N0Q A;  3L75 E;  3AZC A;  3EQQ A;  2JO6 A;  1NTM E;  2DE7 D;  4PV1 D;  2HMM A;  1ULI A;  1VM9 A;  1SQV E;  1G8J B;  2BCC E;  3L70 E;  4OGQ D;  3C0D A;  2QJY C;  4NBB D;  4H13 D;  4NB9 D;  2HML A;  3GL2 A;  4H0L D;  4PD4 E;  4QDD A;  1NU1 E;  2XR8 A;  2DE6 D;  3FOU A;  5AEU A;  5KLV E;  3TGU E;  2CKF A;  1O7P A;  1UUV A;  3BCC E;  5KKZ C;  1VCK A;  3CXH E;  1NTZ E;  1KB9 E;  2QJP C;  1EZV E;  4P1C H;  2E75 C;  1ZRT E;  4QUP A;  3L71 E;  2HMN A;  1P84 E; 
#chains in the Genus database with same CATH topology
 3B4S A;  2IBZ I;  3H1L E;  4WY4 D;  1GZL A;  4LGD E;  5KAF E;  5B66 E;  1PP9 D;  2YMK A;  3L74 J;  2YO2 A;  1SLQ A;  2KUB A;  3H1I J;  2B87 B;  1CW5 A;  3TDK A;  5CCG A;  1LT1 A;  2J58 A;  3PP5 A;  2ITA A;  3PRJ A;  1W5C E;  1CSB A;  3V4W A;  1RF0 A;  4CPG A;  1Q2N A;  5AW6 B;  4W7Y A;  1VQ7 P;  2QJK C;  2WPQ A;  3EWK A;  2NVE A;  2B88 A;  3O8Z A;  3W68 A;  1G2C A;  1N73 C;  4NB8 D;  2I1K A;  1ZR2 A;  1KMI Z;  2HR3 A;  2GM4 A;  2D2C B;  1FZE A;  1D7M A;  2G3A A;  2M5A A;  1RHZ B;  3CX5 E;  1O7H A;  1L0L E;  1L4A A;  1FAV A;  1WQL A;  2FXO A;  2BAS A;  2K3R A;  4OVN F;  2ZT9 D;  2KB7 P;  2IX7 C;  3H1K E;  3GW6 A;  1ZME C;  1LP1 A;  2ZT9 C;  1OW7 A;  2YKP A;  3EQQ A;  5AW1 B;  3CCE P;  1G8J B;  2OAR A;  1GK6 A;  2C0X A;  1LWU C;  5AVX B;  1OMI A;  1LTJ C;  3QWO C;  2E74 B;  1EZV E;  1ZRT E;  2ZYD A;  4PJ0 H;  4U3F G;  2KSE A;  5KLV D;  3VMG D;  2IBZ E;  3E1R A;  3FWN A;  3GHG A;  1SQX J;  2QE7 H;  3FX0 A;  3RL0 B;  1DX7 A;  2DE5 D;  1CI6 A;  1BCC G;  2AEM A;  5AVW B;  2JWD A;  4WWI A;  2R32 A;  5AVU B;  3IFM A;  2BMO A;  3WUV A;  2WVR A;  1O7N A;  1KIL E;  2CPB A;  4L75 A;  2V4H A;  1M1J C;  2NPS C;  4H44 D;  1JNM A;  2HYN A;  2NUK A;  3N7N A;  4P1B H;  3PHL A;  1RF1 B;  5CCG D;  1FE6 A;  1AFO A;  3DQY A;  1LNQ A;  3AE8 C;  1J2J B;  4PD4 D;  4N3Y B;  3BCC D;  5APW A;  5AW0 B;  1SQQ E;  3D6Z A;  5KLV K;  1U7J A;  1GMJ A;  3KHU A;  3GB4 A;  2K9J B;  2WSF H;  2XNX A;  1N2D C;  1VQ6 P;  1PP9 G;  3L74 E;  1EDK A;  3L75 J;  1OVV A;  1HH0 A;  1M1J A;  3P7K A;  2K9J A;  5CJ4 A;  1N7S C;  1FOS E;  1KQG B;  1JCC A;  2H43 A;  1K04 A;  5GTI H;  2QJY C;  3TK1 A;  1W2B O;  1T6A A;  3PH0 A;  3BCC E;  1JM0 A;  3H1I D;  3MIW A;  2W27 A;  1T2K D;  3TGU D;  1XTG B;  1WT6 A;  1LWU B;  4NBH D;  4XE5 B;  2YIU B;  1M8O B;  4NBC D;  1NTM K;  1JY3 O;  4QCK A;  3H1H E;  4I2L C;  3M0D C;  1SFC D;  2FYU J;  2PRR A;  3GTS A;  1G2C B;  3USS A;  1SQP G;  3B5N B;  2LR2 A;  2KZJ A;  2YFJ A;  2OTK E;  3CPW O;  1NKZ B;  4EMJ B;  4Y28 J;  1ZLL A;  3A0H H;  4Z1M H;  3R4Y A;  1IFI A;  4UB6 E;  1A02 J;  1M56 D;  3P8M C;  3TF5 A;  1KOR A;  1AVY A;  5APY A;  5AVR B;  3M9B A;  2HMO A;  2CPS A;  1RE3 C;  3RK3 E;  1NKN A;  1VDF A;  1WRG A;  1HJ0 A;  2IFM A;  2K9Y A;  2LXB A;  1SQP E;  3GOB A;  2NPS B;  1OVU A;  1JCD A;  1ULI A;  1SQV E;  3H1K J;  1P84 H;  5CMZ A;  2HML A;  1HGV A;  1LWU A;  1VQO P;  3ITK A;  3SWF A;  2A45 G;  1E5W A;  3LID A;  2HMN A;  3AE2 C;  3WU2 E;  3E7K A;  1SQP K;  2PFX A;  1K73 Q;  2HOD A;  2WSS H;  1KN7 A;  1K05 A;  1IFD A;  2XND H;  1PV3 A;  3T97 A;  2Q9I A;  2N9Y B;  3MD0 A;  2YIU C;  3S4R A;  2XSO A;  3C8V A;  3U1C A;  1UII A;  1O7G A;  5H2F E;  1MKM A;  2FYZ A;  2Y0C A;  3BAS A;  2KS1 B;  3GKE A;  4HKV A;  1GDT A;  1JM1 A;  1H88 A;  1L0L K;  4EIJ A;  2NRG A;  2GBW A;  3SWK A;  1VL2 A;  2KXP B;  4EYY Q;  5CBN A;  3Q5P A;  2M3E A;  1FZF A;  2L91 A;  1IFM A;  2YXQ B;  1AVO A;  4OGQ C;  5K5G B;  2O1J A;  2B87 A;  1BGY G;  3A0B H;  4GDO A;  4DT0 A;  2Q5U A;  3ZDM A;  1KYO H;  2OGU A;  3H1J J;  3GMA A;  4I7Z C;  2V7Q J;  3TSI A;  4GOE A;  5AW2 B;  4U3F E;  1VQ5 P;  3EFF K;  2NPS D;  3LIE A;  3CCQ P;  3BRV B;  3HD7 C;  4YXD C;  3GL2 A;  4H0L D;  4EI2 A;  1YJN P;  2POH A;  5KKZ C;  2ZYG A;  5L8R J;  2WPV B;  2GA1 A;  4IL6 E;  1JY2 P;  3RK3 C;  1MFT A;  3A3Y B;  1P84 E;  2PP6 A;  1X22 A;  3T97 B;  4N78 D;  2HMJ A;  1EDI A;  3KQG A;  1ULJ A;  5BU5 A;  1L0L G;  2P1J A;  3AEC C;  3AEA C;  3VYI A;  4UB8 E;  1M90 Q;  2E76 C;  2E5Y A;  2D2C C;  1RF1 C;  5KKZ B;  1M1K Q;  2BCC J;  5AVT B;  2QIW A;  2OYI A;  1EXI A;  1YIT P;  3GCE A;  1PPJ E;  2SPZ A;  2H8P D;  1ZP0 C;  3G9R A;  4D6T J;  3L73 J;  5KAF H;  4NBE D;  1BE3 E;  3OJA B;  3H1H G;  1FZC C;  4GKG A;  3U1A A;  4M3L A;  4Y99 B;  1IK9 A;  1CI6 B;  4KJM A;  2YKQ A;  4PJ0 E;  3OW2 O;  1NU1 J;  2A45 H;  4HM3 A;  2E74 C;  3L75 D;  2A06 E;  3L70 J;  2KNC A;  3B8E B;  3GF3 A;  2G8Y A;  3O6Q B;  3CCM P;  1FS0 E;  3EFG A;  5BU8 B;  3CCU P;  2ZYA A;  4JYC A;  3OAK A;  3VOP A;  2DE7 D;  3C0D A;  1SQB G;  4NB9 D;  1YIJ P;  1RQV A;  3O6Q A;  2FYU D;  4EDF A;  3ABV C;  3H1L G;  3FXD A;  4XFJ A;  1FU1 A;  3AE9 C;  1QLE D;  1P84 I;  3F89 A;  4R4L A;  2K88 A;  2XV5 A;  1T3J A;  1SQQ G;  2WSE J;  4L76 A;  3CWB D;  2J5U A;  1RY3 A;  2NUM A;  3CWB E;  1ZV8 A;  3VCA A;  1J1D C;  3U59 A;  1S4X A;  3AE7 C;  1RFS A;  4HJL A;  1ZXG A;  3L73 E;  1KB9 H;  1DIP A;  2FYN C;  4DOJ A;  1IFJ A;  3Q5S A;  1NTK D;  1QX8 A;  2Y9Y A;  1KFM A;  1ZW0 A;  1AJY A;  2E4Q A;  2NZ2 A;  1NTK G;  1SQV D;  3CX5 H;  2QG4 A;  2Q3E A;  3L37 A;  5B5E E;  1KQS O;  1NVO A;  2ZJS E;  1AA0 A;  1BDC A;  3H1J G;  1H8A A;  2M5A B;  3HE5 B;  5AW7 B;  1LP1 B;  1KV4 A;  1GL2 C;  1BGY D;  1H0T B;  3CME P;  5KJ7 D;  1Z56 A;  1GL2 D;  3L73 D;  1SQV J;  3V2R A;  5GTI E;  5CJ0 A;  1Q82 Q;  5CBO A;  1QVF O;  2WWW A;  2WT7 A;  4U7J A;  1L0N J;  2JR8 A;  1EDJ A;  2H88 C;  1ZR4 A;  2CK3 H;  3Q1M A;  2IYP A;  4BRY B;  3D71 A;  1QGK B;  1LTJ A;  4PD4 I;  3NXS A;  3L71 J;  1L0N K;  4IOI H;  1UUV A;  1VCK A;  3CXH I;  2O01 H;  3V4Q A;  1KB9 I;  4IFM A;  1Y9B A;  1AV1 A;  1FZB A;  2LKM A;  1YTZ I;  4RKU J;  2BMQ A;  4I1L A;  2E75 B;  1NTK E;  4UB8 H;  1NTZ D;  1IO4 A;  3H1J E;  1N7S B;  3NTN A;  3CD6 P;  3KXD A;  2N9B A;  5KLI B;  2M8R A;  1FDO A;  2RKL A;  1NU1 K;  2W6A A;  3CMA P;  2OYI C;  1SP4 A;  1MZ9 A;  1YYC A;  4NBA D;  4GOF A;  2Y9Z A;  1URQ A;  3HD7 D;  3L73 G;  5EFW B;  3M06 A;  3CC2 P;  4HKZ H;  3H1H J;  3I55 P;  2NVF A;  5B66 H;  2IPP A;  2RH0 A;  1LTS C;  3BAT A;  1KYO E;  3RL0 D;  1K9M Q;  4HM2 A;  2FKW B;  3TGU G;  2MKV A;  2KK7 A;  3FGA D;  4WB4 A;  3B5N C;  2FBW C;  1M57 D;  1ZOY C;  1BCC D;  1LTT C;  2W6B A;  3BRT B;  1KIL C;  3GG2 A;  1NGM B;  5DJT B;  2E76 D;  2R5B A;  3FXE A;  5AW9 B;  4OH8 B;  3G4S P;  3VMZ A;  1O7M A;  1HJB A;  1JY2 N;  2JO1 A;  3A7O A;  1OFC X;  4R4M A;  1NTM E;  5KLV J;  4H13 B;  3WUU A;  2JKV A;  1HUC A;  4H0L B;  2IFN A;  1GK4 A;  4D6T E;  2OTJ P;  2M0B A;  5AEU A;  3K5B A;  3CXH E;  3RK2 D;  1FZC A;  3HUS A;  3Q3D A;  1DD4 A;  1EQ7 A;  2C9L Y;  2Q3I A;  3JSV C;  4QUP A;  3L71 E;  2KIK A;  3JCU E;  1SQQ J;  5AVQ B;  1S3J A;  2AXT H;  4EOT A;  1YJW P;  4QDC A;  1BE3 G;  2FFD A;  2JEE A;  1NO4 A;  1PPJ G;  1DD3 A;  2VRS A;  1PGJ A;  1SQX E;  1FQT A;  1KIL A;  3H32 A;  3Q2Y A;  3L36 A;  2Q1K A;  1LTA C;  3MHV A;  4GIF A;  2IZ1 A;  4UB6 H;  1N7L A;  1HF9 A;  2UWJ E;  2QVA A;  2IZ0 A;  3AE5 C;  4I6M C;  3RL0 g;  1L4A D;  3B71 A;  1PGQ A;  2I1J A;  1PIX A;  3SSU A;  4NBF D;  3MP7 B;  3CX5 I;  2H89 C;  1DH3 A;  1Q81 Q;  2ZT9 B;  3MGN A;  4HJG H;  1HWT C;  2KS1 A;  4ASW A;  2Z5I A;  2KYV A;  2HMM A;  3OA7 A;  1JTH B;  3H32 B;  4D6T G;  3L72 D;  2Z4E A;  1SQQ K;  2O1K A;  4XA4 A;  4LLH A;  1J1E C;  1EZV I;  1VQK P;  1NAF A;  1S9K E;  1SS1 A;  3MUD C;  2JJL A;  3SFD C;  4ASV A;  3L70 G;  4AQR D;  2NWF A;  2WSC J;  1A02 F;  2OYH C;  3VP9 A;  4K3A A;  1PP9 E;  1NTZ J;  3EQ2 A;  3TNU B;  4TT3 H;  5APT A;  1LTI C;  2HG5 D;  1URQ D;  1FZA A;  1YTZ T;  2K37 A;  4YXW H;  3SFE C;  2E43 A;  2IYO A;  4HM1 A;  2Q6Q A;  2OTL P;  2ZXE B;  3L71 D;  1LTB C;  5HL4 A;  2WSC H;  5AW3 B;  2P7J A;  1VQN P;  5CXM A;  4AYC A;  3B5N A;  3RGU A;  2R5D A;  1VQ9 P;  1JMM A;  3E1I A;  1JUN A;  2YNY A;  1VQ8 P;  3LW5 H;  4L74 A;  1FOS F;  1USE A;  2NPS A;  1EXJ A;  5CCG C;  3RK3 B;  3H6P A;  2KLV A;  1AQT A;  2XKM A;  2BCC E;  4IL6 H;  1LJ2 A;  4ZKP A;  1NU1 E;  2DE6 D;  1NTK J;  1G1J A;  1JB0 J;  1JY3 N;  1SQX K;  3IAO A;  1PZQ A;  4P1C H;  1NU1 D;  1T8Z A;  1VF5 B;  1RE4 A;  2LXC B;  4U3F J;  4YPC A;  1N7S D;  1G1I A;  4WY4 B;  1NYH A;  1IC2 A;  1O7W A;  2ZFC A;  4C7N B;  5E79 E;  1N7S A;  4ZKU A;  1BCC J;  3AEB C;  1KIL D;  2NVG A;  3CC7 P;  2GBX A;  2OYH B;  3PTZ A;  2E76 B;  1LTJ B;  1T2K C;  3GHG B;  4W80 A;  3HD7 B;  1NWQ A;  3R2P A;  5AVY B;  2GUV A;  2HPC A;  1JTH A;  5TJH A;  4H13 C;  2H7H A;  3KZI H;  1GD2 E;  1IZN B;  3BCC J;  1QEX A;  3UIA A;  5AVS B;  3N4X A;  3AED C;  3H1L D;  2N1T D;  3VMI D;  1EZV G;  2QJP B;  5TIS E;  2XU6 A;  5GTH E;  2WQY C;  2N1T C;  3HUS B;  2ZYL A;  3PJS K;  1NAY A;  2C0W A;  2Q3W A;  3LW5 J;  2IDB A;  1RQU A;  2O3J A;  3H1I G;  2QSI A;  3S9O A;  1IK7 A;  5KAI H;  3EN1 A;  1VQP P;  1G8K B;  3WUT A;  3F5H A;  3L75 G;  2FFD B;  1EZV D;  1S1C X;  3SWY A;  4WY4 C;  2RN0 A;  1SQX D;  4U3F D;  3RK2 B;  1BSN A;  3TGU E;  1QL2 A;  3V2P A;  1FJP A;  1OVR A;  5CHX A;  3A0B E;  4HB1 A;  1N73 B;  4WY4 A;  2B9B A;  1M1J B;  4C46 A;  4NPD A;  1SQB K;  1L4A B;  1JMB A;  1OW8 A;  3VMH D;  1MFZ A;  2A06 G;  4H0L C;  1NH4 A;  1BGY J;  2OYH A;  1SQP J;  1EDL A;  3V2Q A;  3CCR P;  3L72 G;  3HE4 B;  1K8A Q;  3M0D A;  5E79 H;  2FXM A;  4O9B A;  4HH2 A;  1PL5 A;  3CI9 A;  4WVZ A;  4ZNC A;  1JY2 O;  3GHG C;  1VF5 D;  3P8C E;  1IFP A;  1VF5 C;  4WBA A;  2KI7 B;  1SQX G;  3L72 E;  1BE3 J;  3P8C D;  3AE1 C;  2WZ7 A;  3HUS C;  4QDF A;  2YMY A;  3CWB G;  2WT7 B;  1ZN5 A;  1HBW A;  2I7F A;  1LT9 C;  2A06 D;  5KTB A;  2QM8 A;  4PV1 B;  1HVV A;  3H1K G;  1LTG C;  3G71 P;  1IJD B;  2KP8 A;  2BCC G;  2W90 A;  4OGQ D;  1Y47 A;  3AE3 C;  4QDD A;  3TNU A;  2B89 A;  2XR8 A;  2ZXX A;  5KLV E;  1NTM G;  1O7P A;  3G3Z A;  1N73 A;  2QJP C;  2QJY B;  4GT1 A;  1HTL C;  1KC8 Q;  2FYU E;  4AAY B;  1BE3 D;  2M3B A;  1JO5 A;  4H44 C;  3L74 D;  3WU2 H;  1PP9 J;  3H1I E;  4KT0 J;  2AEF A;  1KQL A;  3CCJ P;  5CCH C;  1TU3 F;  1RF1 A;  1FC2 C;  4QUQ A;  3HD7 A;  1NTZ K;  2W83 C;  2KNC B;  4QMA A;  1URQ B;  1SVF A;  3GTE A;  2QM7 A;  2HLO A;  2QRX A;  3RK3 D;  4QUR A;  1CZQ A;  1AQ5 A;  1SJG A;  1X0T A;  5AW5 B;  4AIV A;  2AEJ A;  1FDM A;  3VMY A;  4NBD D;  5AVZ B;  3GL0 A;  3FWL A;  2D2C D;  5C39 A;  2FYU G;  1KFN A;  1LGH B;  3S1K A;  1QVG O;  1FZG A;  3D6Y A;  2OYI B;  3IN6 A;  1JY3 P;  1PPJ D;  1WMK A;  3Q5R A;  5APS A;  1UUW A;  3MTU E;  1SQB E;  2AXC A;  1KIL B;  3L75 E;  3AZC A;  4AUW A;  2JO6 A;  3AE6 C;  1N86 A;  1LT9 B;  4RJT A;  1JOC A;  4W7Z A;  4H13 D;  2PAJ A;  1YQ3 C;  2FYN B;  1NTK K;  1H0T A;  2P67 A;  1P84 D;  2R44 A;  1SFC C;  1L2P A;  5DJU B;  3A5T A;  1VQ4 P;  2YO3 A;  4N78 E;  1HGZ A;  2BEZ F;  1H89 A;  1PGO A;  2BMR A;  2Q7C A;  2N1T B;  5H2F H;  3V5B A;  1RIE A;  5APV A;  1SQP D;  1OIP A;  2XRX A;  1SQB D;  1L0L J;  3D70 A;  1SQQ D;  4IFF A;  1S72 P;  1FDI A;  3GF7 A;  3CL3 D;  5BOK A;  4OGQ B;  1XTC C;  2KLU A;  1JEK A;  1YI2 P;  1OWA A;  2OYO A;  1FBM A;  1L0N G;  3I56 P;  1GTW A;  5AW4 B;  1OXZ A;  1U57 A;  2YVJ B;  3BVH A;  1NDO A;  3MZW B;  3GZY A;  3M9Q A;  1J1D B;  3GLM A;  2Y0E A;  3H25 A;  1J1E B;  5B5E H;  4C7R A;  1NU1 G;  2OQQ A;  3AEG C;  1L0N D;  2WMM A;  3CCS P;  4LC1 A;  2AXT E;  1VQL P;  3HTK A;  2E42 A;  3CCL P;  3RL0 C;  2WSE H;  3H1H D;  1X8Y A;  2DW3 A;  4BRY A;  2PGD A;  3BCC G;  3L70 E;  2YXR B;  1BGY E;  3P32 A;  3H1L J;  3HTK B;  3FOU A;  2GUS A;  3M91 A;  2ZVN B;  1NTZ E;  5AW8 B;  3KZI E;  2E75 C;  3RBX A;  2KZI A;  2E75 D;  1KB9 D;  5BVZ A;  3TGU J;  4HYT B;  1QL1 A;  2JZA A;  4JQ0 D;  1KZU B;  3IF4 A;  1S5L E;  2B24 A;  1NHL A;  4IL6 X;  3RK2 C;  1YQ4 C;  2E5T A;  2O01 N;  1GU5 A;  2R3S A;  2C9N Y;  2E4P A;  3HRN A;  1M7L A;  2K1A A;  3JC2 2;  4PV1 C;  1YJ9 P;  2P58 A;  4L73 A;  2FY8 A;  2P2U A;  3KPE A;  1GU4 A;  2V7Q H;  2ZAE B;  1YHQ P;  4NPE A;  4RES B;  3CCV P;  3IR9 A;  1KYO I;  4HM6 A;  3VP8 A;  3VTP C;  4B86 A;  2HMK A;  1PFI A;  1VPC A;  2WSF J;  1W2E A;  4HM8 A;  1FZC B;  3GZX A;  2Y0D A;  2L5G B;  1NJI Q;  5CCH D;  5KJ7 A;  3HE4 A;  3I5C A;  3L72 J;  1OX3 A;  2RMZ A;  2IBZ G;  1VQM P;  4D6T D;  2WPS A;  4HM0 A;  1NYK A;  1SQV G;  1DEE G;  3L4F A;  1EC5 A;  4BXL A;  3NMD A;  2QEX P;  1MV8 A;  5GTH H;  2XDJ A;  1DEB A;  2QA4 P;  4DZO A;  4JF7 A;  5AVV B;  3L71 G;  1Q90 D;  5APQ A;  1GW4 A;  1L0L D;  1Q90 C;  4C7N A;  4BWN A;  1Q86 Q;  3KDP B;  1L0N E;  3TYY A;  1USD A;  3CWB J;  1R8E A;  3HE5 A;  3II6 A;  2HOD B;  5APX A;  3L74 G;  4TLF A;  4HM5 A;  1R5S A;  3L70 D;  2YFL A;  3AEE C;  2FXP A;  2KOG A;  1KD1 Q;  1SQB J;  2N1T A;  1U7M A;  2XSH A;  4H44 B;  1NTM J;  2WTY A;  2E74 D;  2HPC B;  2IBZ D;  2O01 J;  4K35 A;  4JYB A;  4DCK A;  5KJ7 C;  1OW6 A;  1X79 B;  2A45 I;  4PD4 H;  3V2N A;  3A0H E;  3W67 A;  1PGP A;  3H1J D;  4OWF A;  3VN0 A;  3CXH D;  1EG9 A;  2W8Z A;  1FJK A;  2J59 M;  2B1X A;  1SQV K;  2ZVO B;  2W6J H;  4GOD A;  2WIT A;  1YBK A;  2Z5H A;  1N8R Q;  3C1L A;  3D89 A;  3RBZ A;  3AE4 C;  1BDD A;  1BCC E;  1S5L X;  1GL2 B;  5KLV G;  1NTZ G;  1L4A C;  1Q7Y Q;  5CCH A;  1VM9 A;  3QH9 A;  4KHX A;  4IFD K;  3CXH H;  1MUU A;  5M1B A;  2YKO A;  4PD4 E;  4N6J A;  1NOH A;  2BEQ D;  2BCC D;  2QJK B;  1KB9 E;  3PLN A;  1T3U A;  1SFC A;  2P10 A;  1R5L A;  1KQF B;  2WPR A;  3JCU H;  3M0A A;  3WMM 0;  1UIX A;  2FYU K;  1LT9 A;  3L35 A;  1IFN A;  1NTM D;  1SFC B;  2FFD C;  4NPF X;  1RH5 B;  1S5L H;  3VCP A;  1Y8A A;  3B5N D;  5KAI E;  2HFE D;  3VMX A;  4HM7 A;  2JWA A;  3CC4 P;  3H1K D;  1KYO D;  4I7Z B;  2JDI H;  2QPZ A;  3AEF C;  3MUD A;  4JPZ B;  4Y99 C;  5AEW A;  1BSH A;  1GW3 A;  3C9I A;  2MJZ A;  2YFI A;  3M9H A;  1KTM A;  1ZRT D;  2JP3 A;  4A7P A;  1S2E A;  1URQ C;  3A2A A;  4NBG D;  2I8D A;  1S9K D;  4HM4 A;  4QDF B;  1GL2 A;  1X9V A;  5KLI C;  3V6I A;  4DJG A;  5APU A;  1RE3 A;  4YTP C;  1RF0 C;  3NFQ A;  2R3C A;  4ZMD A;  3VMA A;  1E79 H;  2KSJ A;  3N0Q A;  3CX5 D;  4RO0 A;  1OZH A;  4PV1 D;  2XZR A;  5TIS H;  3G6E P;  4NBB D;  3KYQ A;  2CKF A;  1RE4 C;  4MN4 C;  3CLQ A;  4JBZ A; 
#chains in the Genus database with same CATH homology
 2BEZ F;  3H1L E;  2BMR A;  3T97 B;  3SFD C;  2HMJ A;  1RIE A;  1ULJ A;  2YMK A;  3AEC C;  2NWF A;  3AEA C;  2WSC J;  2XRX A;  3D70 A;  2E76 C;  1PP9 E;  2D2C C;  4TT3 H;  1FDI A;  3GF7 A;  5BOK A;  4OGQ B;  3SFE C;  2QIW A;  4HM1 A;  1EXI A;  3GCE A;  1PPJ E;  1U57 A;  2QJK C;  3EWK A;  1ZP0 C;  3G9R A;  2YVJ B;  2NVE A;  4NBE D;  5HL4 A;  1BE3 E;  5CXM A;  1NDO A;  4NB8 D;  3GZY A;  1KMI Z;  3GLM A;  2D2C B;  2G3A A;  4HM3 A;  2E74 C;  3H25 A;  3CX5 E;  1O7H A;  1L0L E;  2A06 E;  2OQQ A;  3AEG C;  1WQL A;  1EXJ A;  3GF3 A;  2G8Y A;  2ZT9 D;  3H1K E;  1ZME C;  2ZT9 C;  1OW7 A;  3EQQ A;  2DE7 D;  2BCC E;  1G8J B;  3L70 E;  3C0D A;  4NB9 D;  1NU1 E;  1RQV A;  2DE6 D;  3FOU A;  3O6Q A;  3ABV C;  1JB0 J;  1NTZ E;  1OMI A;  3IAO A;  4XFJ A;  2E74 B;  1EZV E;  4P1C H;  2E75 C;  1ZRT E;  3AE9 C;  1VF5 B;  4R4L A;  3VMG D;  2IBZ E;  2E75 D;  2WSE J;  2DE5 D;  1NYH A;  2JZA A;  1O7W A;  2J5U A;  2B24 A;  2BMO A;  4IL6 X;  2NUM A;  3AEB C;  3CWB E;  2NVG A;  1YQ4 C;  3VCA A;  2GBX A;  1O7N A;  2E4P A;  1KIL E;  2E76 B;  4H44 D;  4PV1 C;  3AE7 C;  1RFS A;  2NUK A;  4HJL A;  3L73 E;  4H13 C;  2FYN C;  1DIP A;  4P1B H;  3Q5S A;  3AED C;  1AJY A;  3DQY A;  2E4Q A;  2NZ2 A;  3VMI D;  3AE8 C;  4HM6 A;  2WQY C;  2ZYL A;  1SQQ E;  3D6Z A;  2HMK A;  2WSF J;  2Q3W A;  4HM8 A;  3LW5 J;  2IDB A;  3GZX A;  1GMJ A;  1RQU A;  3GB4 A;  2QSI A;  3S9O A;  1IK7 A;  3L74 E;  3EN1 A;  1G8K B;  4HM0 A;  1NYK A;  4U7J A;  1KQG B;  1S1C X;  2H88 C;  3Q1M A;  1K04 A;  3D71 A;  2QJY C;  3TGU E;  1UUV A;  3BCC E;  1VCK A;  1Y9B A;  1Q90 D;  4RKU J;  1Q90 C;  2BMQ A;  4NBH D;  2E75 B;  1NTK E;  1OW8 A;  1L0N E;  3VMH D;  4NBC D;  4QCK A;  4H0L C;  3H1J E;  3H1H E;  1R8E A;  1FDO A;  3GTS A;  4HM5 A;  2YFL A;  3AEE C;  2YFJ A;  4NBA D;  2FXP A;  2XSH A;  1PL5 A;  4H44 B;  2E74 D;  4Y28 J;  4EMJ B;  2O01 J;  4Z1M H;  1VF5 D;  3R4Y A;  1OW6 A;  2NVF A;  1VF5 C;  1KYO E;  4HM2 A;  3L72 E;  1EG9 A;  2MKV A;  3FGA D;  3AE1 C;  1KOR A;  2B1X A;  2HMO A;  2FBW C;  4QDF A;  3RK3 E;  1ZOY C;  1NGM B;  1HJ0 A;  3D89 A;  2K9Y A;  2E76 D;  3AE4 C;  1SQP E;  1BCC E;  2I7F A;  3GOB A;  1O7M A;  1S5L X;  2JO1 A;  4R4M A;  4PV1 B;  1NTM E;  1ULI A;  4H13 B;  1SQV E;  1VM9 A;  4H0L B;  4OGQ D;  3AE3 C;  5M1B A;  2HML A;  4PD4 E;  4QDD A;  2XR8 A;  5AEU A;  5KLV E;  2BEQ D;  1O7P A;  3CXH E;  1KB9 E;  2QJP C;  3Q3D A;  1DD4 A;  4QUP A;  3L71 E;  2HMN A;  3AE2 C;  2FYU E;  4AAY B;  2P10 A;  4H44 C;  1K05 A;  1KQF B;  4QDC A;  1PV3 A;  4KT0 J;  3H1I E;  1TU3 F;  2YIU C;  1DD3 A;  2XSO A;  1UIX A;  4QUQ A;  3C8V A;  1O7G A;  1MKM A;  1FQT A;  1SQX E;  3GTE A;  3VCP A;  3GKE A;  4HKV A;  1JM1 A;  3Q2Y A;  4QUR A;  4HM7 A;  1SJG A;  4I7Z B;  2GBW A;  2QPZ A;  1VL2 A;  3AEF C;  1HF9 A;  4AIV A;  3AE5 C;  3RL0 g;  3Q5P A;  5AEW A;  4NBD D;  3B71 A;  3GL0 A;  2D2C D;  1PIX A;  2YFI A;  4OGQ C;  1KTM A;  4NBF D;  2JP3 A;  4NBG D;  4GDO A;  2H89 C;  4HM4 A;  3D6Y A;  4QDF B;  5KLI C;  3GMA A;  2ZT9 B;  4I7Z C;  2V7Q J;  3IN6 A;  4YTP C;  1WMK A;  3Q5R A;  1UUW A;  4U3F E;  1SQB E;  3N0Q A;  3L75 E;  3AZC A;  2JO6 A;  3AE6 C;  4PV1 D;  2HMM A;  4YXD C;  4NBB D;  4H13 D;  3GL2 A;  4H0L D;  1YQ3 C;  2CKF A;  5KKZ C;  5L8R J;  2WPV B;  1P84 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...