2D2CD

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2d2cD02
4NBFD 1SJGA 4HM0A 1O7NA 3GKEA 4P1CH 2DE5D 2E76C 2HMNA 4NBBD 2IBZE 3EQQA 3L73E 4HM6A 4HM4A 1VF5D 4HM3A 2QPZA 4NBGD 2YFIA 5KKZC 2GBXA 2XRXA 3L72E 3DQYA 1NYKA 1SQPE 2YFLA 4QDCA 3L75E 3GL0A 4H44C 4NBHD 1L0LE 2E75D 1EG9A 1G8JB 2XR8A 1NTKE 2YFJA 3VMHD 2NVGA 2DE7D 1O7MA 1VCKA 2E4PA 4H13D 1RFSA 2DE6D 1SQQE 4PD4E 3VMID 4HM5A 2HMMA 2YIUC 3GZYA 2E4QA 2B24A 2BCCE 1ULIA 4I7ZC 2A06E 4H0LD 2ZT9C 2BMQA 4AIVA 2QJPC 1VM9A 3GZXA 4PV1C 1NU1E 1PPJE 3VMGD 2FYUE 2E74C 1SQBE 3GTEA 1WQLA 3H1HE 4QDDA 3H1KE 2NVFA 1O7PA 3H1IE 2BMOA 2D2CD 1Q90C 4HM8A 2XSOA 4NBAD 4HM1A 1L0NE 4EMJB 1P84E 1RIEA 4QDFA 4AAYB 3FOUA 2QJYC 3CX5E 3CXHE 3H1JE 4QUQA 2HMLA 2ZYLA 3L71E 1VF5C 4NBDD 2NWFA 4U3FE 4HM2A 1JM1A 4OGQD 1FQTA 1KB9E 3H1LE 4QCKA 3C0DA 5KLIC 2I7FA 3GB4A 2E75C 2E76D 2JZAA 4NB9D 1O7HA 1NTZE 1G8KB 1PP9E 4P1BH 4H13C 3GOBA 1SQXE 3CWBE 3VCPA 1NDOA 2NUMA 2GBWA 5KLVE 4QURA 4QDFB 4HKVA 4H44D 2CKFA 3GCEA 4H0LC 1O7WA 4HM7A 5HL4A 5CXMA 2XSHA 3D89A 2JO6A 3L74E 1ZRTE 1NTME 5AEUA 4NB8D 1KYOE 2QJKC 1EZVE 2B1XA 2YVJB 4QUPA 1O7GA 1BE3E 2D2CC 5BOKA 2YMKA 2HMKA 4HJLA 2ZT9D 3N0QA 1UUVA 3L70E 5AEWA 2Q3WA 3EN1A 2BMRA 1ULJA 4PV1D 2HMOA 4NBED 3GL2A 2NVEA 1SQVE 2FYNC 2E74D 2HMJA 3BCCE 3TGUE 3VCAA 4NBCD 1BCCE 2NUKA 4OGQC 3AZCA 3GTSA 1UUWA
chains in the Genus database with same CATH superfamily
2Q3IA 3GKEA 3HRNA 2DE5D 4C46A 1NTZJ 1PP9J 1JY3O 5CHXA 2QPZA 3I5CA 3VYIA 4D6TG 5DJUB 3V5BA 2YFJA 1X0TA 1DIPA 1AA0A 3P8MC 3VMID 3VOPA 3RK2C 2DW3A 2WVRA 1P84D 1M8OB 1LT1A 1SLQA 3JSVC 1SQQD 3H1HG 3A5TA 3I56P 1SQPG 3AEBC 1Q90C 1UIXA 3U59A 3C8VA 3AE1C 2E74B 3H1KD 1YTZI 3CXHE 4EIJA 5KAIH 5AW6B 1K05A 4NBDD 4HM2A 2L5GB 3L72J 1DD3A 1LTAC 3S4RA 2AEFA 3PH0A 3AEFC 5AW7B 1EC5A 1LT9A 3Q5SA 2FXOA 3F5HA 4OH8B 4K35A 4DCKA 2JEEA 3FWNA 2O01N 2Y0DA 1SQBK 3AE7C 1NKZB 1KFMA 3L70E 4JYBA 5CMZA 1GD2E 4C7NA 5AVXB 3VCAA 2OYIB 1URQC 5E79H 4D6TD 2N1TC 3T97B 2AXTH 4Z1MH 5BU8B 2IBZE 1RF0A 1M1JB 5DJTB 3GMAA 4HM3A 2YFIA 5KKZC 1RE4A 3V2QA 1DH3A 5APSA 3GL0A 4C7NB 1Q86Q 2Q6QA 3H1HD 1SQPD 3MUDA 2IZ0A 1SQQE 2BCCG 4Y99C 2YIUC 1KILD 1GTWA 1Y47A 1FZGA 1PPJG 1JY3P 2IYOA 1YJWP 2QE7H 2QVAA 2J5UA 3H1KE 4K3AA 1S5LH 4DT0A 3RL0g 1L0NE 3FOUA 2JKVA 3B8EB 1NU1J 5AW4B 2J59M 2ZJSE 4OGQD 3SWYA 2P1JA 3HD7D 2R44A 4GOEA 3M0DA 1OMIA 3AEAC 3K5BA 3KPEA 3CCLP 4WY4C 1KYOD 3KXDA 1FZCC 5KLVG 5KLIB 2JDIH 3WU2H 3GCEA 1IFPA 1KD1Q 2QG4A 4HB1A 2Q5UA 2KXPB 4NB8D 1EZVE 1EXJA 2Q7CA 1GK4A 1ZLLA 2PGDA 1IFDA 1JEKA 1XTGB 2KS1A 1SQVE 3CXHI 1L4AD 1Q2NA 1Q81Q 2HODA 3UIAA 1S4XA 2KNCA 3BCCJ 2BCCD 5CBOA 2KOGA 1IK7A 4QDCA 1SQPE 3CXHH 2R3CA 1L0LE 2JR8A 2KS1B 4JBZA 1MFTA 1PPJD 2DE7D 2KSEA 2NPSD 2B24A 3USSA 2A06E 2HG5D 1VM9A 2PFXA 2LKMA 3H1IG 2OYHA 4DJGA 2H88C 4R4LA 1LGHB 2BMOA 1FJKA 3HUSB 1VQOP 4EMJB 2SPZA 2QJYC 2IBZI 3LIEA 4A7PA 1LTJB 1OW8A 1JM1A 5KLVD 1DEBA 2IPPA 4D6TJ 1H0TB 1ZP0C 1KZUB 2IZ1A 1HF9A 1P84I 2N9YB 2LXBA 2NUMA 3CC4P 3KYQA 1SQQK 2CKFA 1VQ9P 5CCGA 1W5CE 3P8CE 4HM7A 2O01H 2KZIA 5EFWB 1ZRTE 3H1HJ 1IJDB 3B71A 1OVRA 1GL2A 4QUPA 3G71P 1P84H 1JM0A 1YQ4C 1OWAA 2HMJA 1Z56A 1L0NK 1BSHA 2M5AA 1M56D 1IK9A 4NPFX 1BSNA 3PP5A 2B9BA 1O7NA 1EDIA 2C0WA 1GW3A 2J58A 4HM6A 3EWKA 4HYTB 1J1EB 1VF5D 1HGZA 3G6EP 1KTMA 1H88A 1N7LA 1FJPA 1LTSC 1NTKG 2O1JA 2FXPA 1EG9A 2M5AB 3TNUA 1X22A 2E4PA 4JYCA 3H1ID 2BEQD 4HM5A 3N4XA 3GF7A 3WUVA 1S9KE 3CX5D 1IFJA 4HKZH 2E74C 3GTEA 2K37A 2FFDB 1KQLA 3OW2O 1O7PA 3Q3DA 1SQVK 2D2CD 2YXRB 1J2JB 4HM1A 2WTYA 2I8DA 2HMLA 2Y0EA 3RL0D 1X8YA 4RKUJ 2A45G 3C0DA 3A0HE 1SQPK 2XNDH 1LTBC 1L0LK 5TJHA 3ITKA 2JWDA 1VQKP 1YTZT 1SQXE 3CWBE 2C0XA 1VQPP 3M0AA 1VQLP 3L36A 3WUUA 2KYVA 1N2DC 5L8RJ 1KILB 5APTA 1JY2N 3AE3C 4MN4C 1NJIQ 3TF5A 2OYIC 4HJLA 3CMAP 4LGDE 3OJAB 3MIWA 1PIXA 3EQ2A 1M1JC 1ZV8A 1LP1B 1NTKD 1BE3J 1KYOI 4P1CH 2YMYA 3AECC 2HMNA 1FZEA 3RBZA 4OGQB 5AW2B 2PRRA 3HD7B 1N7SD 4IL6X 5KLVJ 3L75E 4NPDA 3P32A 3CL3D 4KHXA 4L75A 1O7MA 1JTHA 1IFIA 1L4AA 1KYOH 5CJ4A 3CI9A 1NU1G 1IC2A 2FYUG 4BWNA 1RQUA 3D71A 1KORA 3MUDC 1RH5B 4HM8A 1EXIA 1JTHB 1L4AB 3KDPB 5GTHH 3L71E 4U3FE 2Z5IA 2NPSA 2AXCA 3H1LE 3AE6C 5KLIC 2AXTE 1O7HA 4IFDK 1NTZE 1QGKB 1PP9E 2ZVOB 4P1BH 1PGJA 1DD4A 2R5BA 1JNMA 2WSEH 2B87A 3M0DC 2K9JA 4H44D 3O6QA 1VPCA 2NPSB 3D89A 1KQFB 1S1CX 2JWAA 4UB6E 1HVVA 1D7MA 2H43A 5AVRB 2Q9IA 2QEXP 3RBXA 5AEWA 3BCCG 1UIIA 3IF4A 4ZKPA 1M90Q 1HWTC 1E5WA 3L74J 1J1DB 5M1BA 1NH4A 1T3JA 2K9JB 1BGYJ 3AZCA 1YBKA 3O6QB 1SJGA 2Y9YA 4GT1A 1MFZA 5AVSB 3L35A 3L72E 3DQYA 4DOJA 4LC1A 1SQXK 4NBHD 2E75D 1NU1D 2FYUD 1JB0J 3FX0A 1QL1A 1G2CA 3HE4B 2FYZA 3A0HH 3CCQP 2R32A 3E1IA 3NXSA 2E4QA 1SVFA 2Z5HA 4H0LD 3WU2E 4AIVA 3GZXA 3HUSC 3AEGC 2AEMA 3VMAA 5AVUB 1LTJC 4LLHA 3FWLA 2WMMA 1LTGC 1RF1B 2N9BA 1HTLC 3CMEP 1SQBJ 1JCDA 2WSCH 1KQSO 1VL2A 1NTKJ 2JZAA 1VF5B 3SWFA 1A02J 3H1JJ 3HTKA 4GIFA 4IOIH 1NAFA 3CX5I 3VCPA 1AJYA 1HH0A 5AW8B 5CCGD 3LW5H 5AW0B 3CCEP 4RO0A 3BCCD 1RE3A 3PLNA 1NTMG 3O8ZA 1GL2D 2ITAA 3GHGA 2YVJB 2OARA 3HE5A 4OWFA 1HJBA 1R5LA 2CPSA 5CJ0A 1MZ9A 4PV1D 5APUA 2D2CB 1J1EC 4IL6E 3RL0B 1L2PA 3GHGB 3M9HA 2WITA 2Z4EA 3CPWO 1GMJA 2WSFH 1NTZK 1LT9B 2PP6A 1BCCJ 2POHA 1DX7A 3B5ND 1G8JB 1Q7YQ 2M8RA 1JCCA 2FKWB 2H89C 2QM8A 2FFDC 4M3LA 2B88A 1ZOYC 1EDKA 2BMQA 2I1JA 3VMGD 1T3UA 3CCSP 3S1KA 1A02F 4I7ZB 1N7SA 2RH0A 1P84E 2M3BA 2OTLP 4QDFA 4UB6H 1OXZA 1EDJA 4NB9D 1T8ZA 1IO4A 1NTMD 1N7SB 1G1IA 1QEXA 3VN0A 5BVZA 1KILC 4IFFA 4QDFB 4HKVA 5APQA 2A45I 2R5DA 5CXMA 2FYUJ 2P10A 1ZXGA 1BE3G 3BRTB 3L73D 4NBED 1ZW0A 2W90A 4NBCD 1AV1A 4OGQC 1PV3A 3Q2YA 1HJ0A 2W83C 3HD7C 5H2FE 2P2UA 3BVHA 3H32A 3JCUE 3L4FA 4D6TE 3AEEC 2XR8A 4TT3H 5GTIE 3QH9A 2YXQB 4H13D 5APVA 1LTTC 4H44B 5CCHA 1LJ2A 5KTBA 3GLMA 1PFIA 1FOSE 3H32B 1L4AC 1IFNA 3H1HE 2NVFA 2XSOA 1KILE 4JQ0D 3CCVP 2HODB 3C1LA 1S3JA 1NYHA 1YIJP 3IAOA 4WVZA 3FGAD 2KNCB 2QIWA 4AQRD 2I7FA 1AQTA 2ZYGA 2NPSC 3AE2C 1BE3D 1SS1A 4IL6H 2E75B 3U1AA 2KSJA 3L74G 3TK1A 2JO6A 1GU5A 1BGYG 1OW6A 3FXEA 1RQVA 2YKPA 3L37A 1KYOE 1J1DC 4EDFA 4H0LB 5KJ7D 1OW7A 1GK6A 4ZKUA 2OYHB 4YTPC 1SP4A 2NUKA 4JF7A 2V7QJ 4W80A 1K04A 4PD4D 1SQVJ 5GTHE 4NBGD 2MJZA 1Y8AA 2YKQA 1ZMEC 3W68A 1RFSA 1NTMJ 2P7JA 2DE6D 3MD0A 2BCCE 4JPZB 4NPEA 2XDJA 4XA4A 1SQBG 1MUUA 1GL2B 1PPJE 1RF1C 4QDDA 3EFFK 2G8YA 1Y9BA 2QA4P 2E5TA 1VQ6P 4R4MA 3SFDC 2FXMA 3B5NA 3H1JG 5B66E 4PV1B 3L73J 1N8RQ 1VF5C 2KUBA 5AW9B 1YITP 2NWFA 2RN0A 2FBWC 4XFJA 1QLED 1URQA 2M3EA 4RESB 4BXLA 3CC2P 2LR2A 2E76D 3L74D 1KB9D 1USEA 1BGYD 1GZLA 1XTCC 5H2FH 4CPGA 3B5NB 3TNUB 5KLVE 1Q82Q 2YNYA 1OIPA 4GOFA 1FDOA 3JCUH 5AEUA 1AVYA 3KHUA 2D2CC 1VQ4P 3E7KA 5GTIH 2ZT9D 1RE3C 3CD6P 1BCCG 2QJKB 3A0BE 3TGUG 3RL0C 4I6MC 2E43A 3GHGC 3BRVB 2XNXA 1JO5A 1PGPA 3P7KA 1UUWA 3G9RA 1LT9C 5KAFE 1RY3A 2XU6A 3V2NA 1IZNB 4EYYQ 3U1CA 2XRXA 3PJSK 3D6ZA 2WPQA 4N78D 3W67A 2HPCA 2K9YA 1SQBD 1MKMA 2LXCB 1DEEG 2KIKA 2WPRA 1OVVA 1T2KD 4I7ZC 3H1JD 3RK3D 2FY8A 3CC7P 1SFCD 1OZHA 3BASA 4ZNCA 3H1IE 1JMBA 2HPCB 2HLOA 4WWIA 4NBAD 1RF0C 3CX5E 3LIDA 2Y0CA 1RE4C 3OAKA 1N7SC 1N86A 1KB9E 2XV5A 3MP7B 1KMIZ 1BGYE 4L73A 5APWA 3PHLA 1ZN5A 1VDFA 1NDOA 1AFOA 2GBWA 4GKGA 4I1LA 4H13B 1JUNA 1BCCD 5B5EH 3D70A 3TGUD 1SQXJ 1FZFA 2B1XA 3L70G 1MV8A 3A2AA 1ZR4A 2RMZA 3VP9A 1OFCX 2K1AA 1FZBA 2ZVNB 3PRJA 5AW5B 3GTSA 1LNQA 2IBZG 2JO1A 1EQ7A 2IFNA 3G3ZA 3M9QA 4HM4A 2RKLA 1GDTA 3TSIA 1JY3N 5B66H 2OGUA 1NYKA 4YPCA 5KJ7A 3AE4C 4H44C 2W6JH 1NGMB 3FXDA 1NTKE 2NVGA 5KLVK 2B87B 3QWOC 2WPSA 1YI2P 1VQ8P 2HMMA 3GZYA 5CCHD 4EI2A 3TDKA 2C9LY 3CXHD 3WUTA 2XKMA 2E42A 1L0NG 1JMMA 1CI6A 1KQGB 2CK3H 3MTUE 1GW4A 3F89A 1BDCA 4Y28J 2G3AA 2E75C 3SFEC 3A0BH 1WRGA 3NTNA 1H8AA 1S2EA 5KAFH 2OTKE 5AVYB 1CI6B 2KLUA 3H25A 3L70D 1QVFO 1G2CB 4H0LC 3NMDA 2OYHC 1EZVG 4DZOA 1FU1A 3RK2D 3OA7A 1NVOA 2IBZD 1SQVG 3EN1A 4QMAA 4PJ0E 2HR3A 1G1JA 2ZYAA 1NWQA 4IFMA 3IFMA 1KB9I 1Q90D 2C9NY 4HM0A 2OYOA 1N73A 4AYCA 1JY2P 1FZAA 3N7NA 1FDIA 1L0LG 5CCGC 2E76B 3HTKB 3CX5H 1PGOA 1WMKA 1KB9H 5C39A 3Q5PA 2Y9ZA 1GL2C 3AE9C 1AVOA 2A06G 1N73B 1ULIA 2H8PD 1L0ND 3L73G 1PGQA 3PTZA 1NHLA 1LWUA 3SWKA 2Q1KA 1NU1E 4PV1C 2FYUE 3II6A 5TISE 3HE5B 3AEDC 3TGUJ 2QSIA 3AE8C 2ZT9B 2QJPB 2WSSH 5AW1B 2OYIA 3V4QA 2ZYLA 3T97A 3CCMP 1VQ5P 1URQD 1NKNA 2OQQA 1LWUB 2N1TD 2O3JA 1M1JA 3B5NC 5AVTB 3GB4A 5K5GB 1T6AA 1SFCA 1NTKK 1EZVD 3MHVA 3NFQA 2R3SA 4QURA 2W6AA 1SQVD 2GUVA 3V2PA 3CCJP 1KFNA 2QJKC 3RK3B 2HMKA 3N0QA 1UUVA 1SFCB 2BMRA 2HMOA 2QM7A 1FAVA 3BCCE 2B89A 1W2EA 2CPBA 1L0LD 2P58A 2FYNB 3M9BA 1GU4A 1QX8A 4HH2A 2IFMA 2A06D 2NRGA 2YFLA 2W6BA 4UB8E 2GUSA 4TLFA 4WY4D 4YXWH 2A45H 4ASWA 4GODA 1W2BO 3L70J 1U57A 1H89A 2ZXEB 2KZJA 1HGVA 4N6JA 2K3RA 1QVGO 3B4SA 1K9MQ 2O01J 1PZQA 2HFED 1YHQP 4WB4A 2IDBA 3MGNA 1BDDA 3P8CD 4PJ0H 1ZRTD 4B86A 1SQXG 3CWBG 2KP8A 3M91A 4H13C 1SQQJ 2H7HA 3ZDMA 3KQGA 3IR9A 3VP8A 5AVWB 1O7WA 1RHZB 2ZYDA 1NTME 3H1KJ 1NU1K 2FYUK 4BRYA 2GM4A 2YMKA 1L0NJ 2Q3WA 4YXDC 4RJTA 3Q1MA 2KB7P 3JC22 3HUSA 2XZRA 1NOHA 4W7ZA 4NBFD 4L76A 1LTJA 5TISH 4NBBD 3EQQA 3L73E 4BRYB 1H0TA 3L75G 1S9KD 4EOTA 2AEJA 1HUCA 1M57D 2ZAEB 4C7RA 2V4HA 2IX7C 3TYYA 5AVZB 1AQ5A 3WMM0 4L74A 5KJ7C 1VQNP 3BATA 1CZQA 5AW3B 3RK2B 4U7JA 5B5EE 3A3YB 3M06A 2WZ7A 3VMZA 1CW5A 3L71G 4U3FG 1RIEA 5APXA 4QUQA 1SQXD 3CWBD 3H1LG 1M1KQ 4QCKA 1SQPJ 5BU5A 2MKVA 3H6PA 1L0LJ 3S9OA 1NTZG 1PP9G 1VQ7P 1KC8Q 1U7MA 2WT7A 1FDMA 2HYNA 4AUWA 1PL5A 3KZIE 4GDOA 2UWJE 2O1KA 1HBWA 2E5YA 4UB8H 1S5LX 2N1TA 1O7GA 1BE3E 3A7OA 2I1KA 2FFDA 3AE5C 2IYPA 2E74D 2WT7B 3G4SP 1YJNP 3L75D 3CLQA 1OX3A 1EZVI 2E76C 4N3YB 3R4YA 2GA1A 1URQB 2Q3EA 3L72G 5APYA 2N1TB 2VRSA 1K73Q 2WPVB 1ZR2A 3RGUA 4ZMDA 3E1RA 1N73C 4O9BA 3VMHD 2BEZF 3VTPC 5KKZB 1VCKA 2V7QH 4PD4E 1FOSF 1NTMK 2ZXXA 1KILA 2ZT9C 2QJPC 3L71D 4U3FD 2OTJP 4Y99B 2YIUB 3H1LD 1WQLA 5AVQB 2KLVA 2L91A 1NAYA 2BCCJ 2WSEJ 1LWUC 1NTZD 1PP9D 3C9IA 1LP1A 1KN7A 3V4WA 4WY4A 1FZCA 1FQTA 2YKOA 1FBMA 4HJGH 4KJMA 1USDA 3HD7A 3GF3A 3GOBA 3SSUA 3CCRP 2BASA 4I2LC 1T2KC 1K8AQ 2WQYC 2WWWA 4WY4B 3RK3C 1SFCC 3L74E 1FZCB 1VQMP 1JOCA 1IFMA 5KAIE 1OVUA 1S72P 4OVNF 1LTIC 2YO3A 3GW6A 3GL2A 2NVEA 3MZWB 2FYNC 3L72D 2JJLA 3D6YA 1JY2O 2ZFCA 3V2RA 2W8ZA 3Q5RA 4KT0J 1X9VA 3CWBJ 2GBXA 1U7JA 1TU3F 3GG2A 1YJ9P 1R5SA 3ABVC 3CCUP 2KI7B 4ASVA 2WSCJ 5E79E 4N78E 1YQ3C 3V6IA 1SQBE 3VMYA 2W27A 4WBAA 2JP3A 3KZIH 1NO4A 1SQQG 3LW5J 1R8EA 4AAYB 2KK7A 3H1JE 1X79B 3RK3E 1FC2C 1FS0E 2K88A 2QRXA 3EFGA 3H1IJ 3L75J 2P67A 2QJYB 4W7YA 2NZ2A 3H1KG 1E79H 1YYCA 1G8KB 1EDLA 2YO2A 5CCHC 4PD4I 3HE4A 1WT6A 1M7LA 5HL4A 1S5LE 4XE5B 2XSHA 3IN6A 1CSBA 3I55P 2M0BA 5CBNA 5AVVB 2WSFJ 5BOKA 3R2PA 2PAJA 3VMXA 1ULJA 4PD4H 1QL2A 3L71J 4U3FJ 1FE6A 1RF1A 1KV4A 1BCCE 3H1LJ 3TGUE
chains in the Genus database with same CATH topology
3GKEA 4P1CH 2DE5D 3AECC 2HMNA 1K04A 4OGQB 2QPZA 4NBGD 4IL6X 2YFLA 3L75E 2YFJA 1ZMEC 1O7MA 1DIPA 1RFSA 2DE6D 3VMID 2BCCE 1U57A 1RQUA 3D71A 1KORA 1PPJE 3AEBC 4QDDA 2G8YA 1Y9BA 4R4MA 3SFDC 1Q90C 4HM8A 1UIXA 4PV1B 3C8VA 3AE1C 1EXIA 2E74B 3CXHE 2O01J 3L71E 1K05A 1VF5C 2NWFA 4NBDD 4U3FE 4HM2A 2FBWC 4XFJA 1DD3A 2IDBA 3H1LE 3AEFC 3AE6C 5KLIC 2E76D 3Q5SA 1O7HA 1NTZE 1PP9E 4P1BH 4H13C 1DD4A 5KLVE 4H44D 1O7WA 1FDOA 3O6QA 3D89A 1KQFB 1S1CX 1NTME 5AEUA 2D2CC 3AE7C 2YMKA 2ZT9D 3L70E 5AEWA 2Q3WA 4YXDC 3VCAA 3Q1MA 5M1BA 3AZCA 1UUWA 4NBFD 3G9RA 1SJGA 3T97B 4Z1MH 4NBBD 2IBZE 3EQQA 3L73E 3GMAA 4HM3A 2YFIA 5KKZC 2XRXA 3D6ZA 3L72E 3DQYA 3GL0A 4NBHD 2E75D 2K9YA 1JB0J 1MKMA 1SQQE 2YIUC 2E4QA 4I7ZC 4H0LD 4AIVA 3GZXA 3AEGC 2J5UA 4U7JA 3H1KE 3H1IE 3RL0g 4NBAD 1L0NE 1RIEA 3FOUA 3CX5E 4QUQA 4OGQD 1KB9E 4QCKA 1KMIZ 2MKVA 1VL2A 3S9OA 1OMIA 2JZAA 3AEAC 1VF5B 3VCPA 1AJYA 1NDOA 2GBWA 3GCEA 1PL5A 4H13B 4GDOA 3D70A 4NB8D 1S5LX 1EZVE 1EXJA 2B1XA 2YVJB 1O7GA 1BE3E 3AE5C 4PV1D 1SQVE 2E74D 2D2CB 3GTSA 2JO1A 2E76C 3R4YA 4HM4A 1GMJA 2WPVB 1IK7A 1NYKA 1SQPE 4QDCA 3AE4C 4H44C 1L0LE 1NGMB 1G8JB 1NTKE 3VMHD 2NVGA 2BEZF 2DE7D 1VCKA 4PD4E 2H89C 2HMMA 3GZYA 2B24A 1ZOYC 2A06E 2ZT9C 2BMQA 2QJPC 1VM9A 3VMGD 1WQLA 2H88C 4R4LA 4I7ZB 2BMOA 2WSEJ 4EMJB 1P84E 4QDFA 2QJYC 1KQGB 1OW8A 1JM1A 1FQTA 4Y28J 2G3AA 2E75C 3SFEC 1ZP0C 4NB9D 1HF9A 3GF3A 3GOBA 2NUMA 3H25A 4QDFB 4HKVA 2CKFA 2WQYC 4H0LC 4HM7A 5CXMA 2P10A 3L74E 1ZRTE 3B71A 4QUPA 1YQ4C 3EN1A 4NBED 3GL2A 2NVEA 2FYNC 2HMJA 4NBCD 4OGQC 1PV3A 3Q2YA 1HJ0A 1Q90D 4HM0A 1O7NA 3D6YA 4HM6A 3EWKA 1VF5D 3Q5RA 1KTMA 4KT0J 1FDIA 2GBXA 2E76B 1TU3F 3AEEC 2FXPA 1EG9A 2XR8A 1WMKA 4TT3H 3ABVC 2E4PA 4H13D 3Q5PA 2BEQD 3AE9C 4HM5A 4H44B 3GF7A 1ULIA 2WSCJ 3GLMA 1YQ3C 4PV1C 1NU1E 2FYUE 2E74C 1SQBE 3GTEA 3H1HE 2NVFA 3AEDC 1O7PA 3Q3DA 2JP3A 2QSIA 3AE8C 2ZT9B 2D2CD 2XSOA 1KILE 4HM1A 3LW5J 1R8EA 4AAYB 3H1JE 3RK3E 2HMLA 2ZYLA 1NYHA 4RKUJ 2OQQA 3IAOA 3FGAD 3C0DA 2QIWA 2I7FA 3GB4A 2NZ2A 1G8KB 1SQXE 3CWBE 3AE2C 2E75B 4QURA 5HL4A 2XSHA 2JO6A 5L8RJ 3IN6A 1OW6A 1RQVA 3AE3C 2QJKC 1KYOE 4H0LB 2WSFJ 1OW7A 5BOKA 2HMKA 4HJLA 3N0QA 1UUVA 2BMRA 1ULJA 2HMOA 3BCCE 1PIXA 4YTPC 1BCCE 2NUKA 3TGUE 2V7QJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBF D;  1SJG A;  4HM0 A;  1O7N A;  3GKE A;  4P1C H;  2DE5 D;  2E76 C;  2HMN A;  4NBB D;  2IBZ E;  3EQQ A;  3L73 E;  4HM6 A;  4HM4 A;  1VF5 D;  4HM3 A;  2QPZ A;  4NBG D;  2YFI A;  5KKZ C;  2GBX A;  2XRX A;  3L72 E;  3DQY A;  1NYK A;  1SQP E;  2YFL A;  4QDC A;  3L75 E;  3GL0 A;  4H44 C;  4NBH D;  1L0L E;  2E75 D;  1EG9 A;  1G8J B;  2XR8 A;  1NTK E;  2YFJ A;  3VMH D;  2NVG A;  2DE7 D;  1O7M A;  1VCK A;  2E4P A;  4H13 D;  1RFS A;  2DE6 D;  1SQQ E;  4PD4 E;  3VMI D;  4HM5 A;  2HMM A;  2YIU C;  3GZY A;  2E4Q A;  2B24 A;  2BCC E;  1ULI A;  4I7Z C;  2A06 E;  4H0L D;  2ZT9 C;  2BMQ A;  4AIV A;  2QJP C;  1VM9 A;  3GZX A;  4PV1 C;  1NU1 E;  1PPJ E;  3VMG D;  2FYU E;  2E74 C;  1SQB E;  3GTE A;  1WQL A;  3H1H E;  4QDD A;  3H1K E;  2NVF A;  1O7P A;  3H1I E;  2BMO A;  2D2C D;  1Q90 C;  4HM8 A;  2XSO A;  4NBA D;  4HM1 A;  1L0N E;  4EMJ B;  1P84 E;  1RIE A;  4QDF A;  4AAY B;  3FOU A;  2QJY C;  3CX5 E;  3CXH E;  3H1J E;  4QUQ A;  2HML A;  2ZYL A;  3L71 E;  1VF5 C;  4NBD D;  2NWF A;  4U3F E;  4HM2 A;  1JM1 A;  4OGQ D;  1FQT A;  1KB9 E;  3H1L E;  4QCK A;  3C0D A;  5KLI C;  2I7F A;  3GB4 A;  2E75 C;  2E76 D;  2JZA A;  4NB9 D;  1O7H A;  1NTZ E;  1G8K B;  1PP9 E;  4P1B H;  4H13 C;  3GOB A;  1SQX E;  3CWB E;  3VCP A;  1NDO A;  2NUM A;  2GBW A;  5KLV E;  4QUR A;  4QDF B;  4HKV A;  4H44 D;  2CKF A;  3GCE A;  4H0L C;  1O7W A;  4HM7 A;  5HL4 A;  5CXM A;  2XSH A;  3D89 A;  2JO6 A;  3L74 E;  1ZRT E;  1NTM E;  5AEU A;  4NB8 D;  1KYO E;  2QJK C;  1EZV E;  2B1X A;  2YVJ B;  4QUP A;  1O7G A;  1BE3 E;  2D2C C;  5BOK A;  2YMK A;  2HMK A;  4HJL A;  2ZT9 D;  3N0Q A;  1UUV A;  3L70 E;  5AEW A;  2Q3W A;  3EN1 A;  2BMR A;  1ULJ A;  4PV1 D;  2HMO A;  4NBE D;  3GL2 A;  2NVE A;  1SQV E;  2FYN C;  2E74 D;  2HMJ A;  3BCC E;  3TGU E;  3VCA A;  4NBC D;  1BCC E;  2NUK A;  4OGQ C;  3AZC A;  3GTS A;  1UUW A; 
#chains in the Genus database with same CATH topology
 2Q3I A;  3GKE A;  3HRN A;  2DE5 D;  4C46 A;  1NTZ J;  1PP9 J;  1JY3 O;  5CHX A;  2QPZ A;  3I5C A;  3VYI A;  4D6T G;  5DJU B;  3V5B A;  2YFJ A;  1X0T A;  1DIP A;  1AA0 A;  3P8M C;  3VMI D;  3VOP A;  3RK2 C;  2DW3 A;  2WVR A;  1P84 D;  1M8O B;  1LT1 A;  1SLQ A;  3JSV C;  1SQQ D;  3H1H G;  3A5T A;  3I56 P;  1SQP G;  3AEB C;  1Q90 C;  1UIX A;  3U59 A;  3C8V A;  3AE1 C;  2E74 B;  3H1K D;  1YTZ I;  3CXH E;  4EIJ A;  5KAI H;  5AW6 B;  1K05 A;  4NBD D;  4HM2 A;  2L5G B;  3L72 J;  1DD3 A;  1LTA C;  3S4R A;  2AEF A;  3PH0 A;  3AEF C;  5AW7 B;  1EC5 A;  1LT9 A;  3Q5S A;  2FXO A;  3F5H A;  4OH8 B;  4K35 A;  4DCK A;  2JEE A;  3FWN A;  2O01 N;  2Y0D A;  1SQB K;  3AE7 C;  1NKZ B;  1KFM A;  3L70 E;  4JYB A;  5CMZ A;  1GD2 E;  4C7N A;  5AVX B;  3VCA A;  2OYI B;  1URQ C;  5E79 H;  4D6T D;  2N1T C;  3T97 B;  2AXT H;  4Z1M H;  5BU8 B;  2IBZ E;  1RF0 A;  1M1J B;  5DJT B;  3GMA A;  4HM3 A;  2YFI A;  5KKZ C;  1RE4 A;  3V2Q A;  1DH3 A;  5APS A;  3GL0 A;  4C7N B;  1Q86 Q;  2Q6Q A;  3H1H D;  1SQP D;  3MUD A;  2IZ0 A;  1SQQ E;  2BCC G;  4Y99 C;  2YIU C;  1KIL D;  1GTW A;  1Y47 A;  1FZG A;  1PPJ G;  1JY3 P;  2IYO A;  1YJW P;  2QE7 H;  2QVA A;  2J5U A;  3H1K E;  4K3A A;  1S5L H;  4DT0 A;  3RL0 g;  1L0N E;  3FOU A;  2JKV A;  3B8E B;  1NU1 J;  5AW4 B;  2J59 M;  2ZJS E;  4OGQ D;  3SWY A;  2P1J A;  3HD7 D;  2R44 A;  4GOE A;  3M0D A;  1OMI A;  3AEA C;  3K5B A;  3KPE A;  3CCL P;  4WY4 C;  1KYO D;  3KXD A;  1FZC C;  5KLV G;  5KLI B;  2JDI H;  3WU2 H;  3GCE A;  1IFP A;  1KD1 Q;  2QG4 A;  4HB1 A;  2Q5U A;  2KXP B;  4NB8 D;  1EZV E;  1EXJ A;  2Q7C A;  1GK4 A;  1ZLL A;  2PGD A;  1IFD A;  1JEK A;  1XTG B;  2KS1 A;  1SQV E;  3CXH I;  1L4A D;  1Q2N A;  1Q81 Q;  2HOD A;  3UIA A;  1S4X A;  2KNC A;  3BCC J;  2BCC D;  5CBO A;  2KOG A;  1IK7 A;  4QDC A;  1SQP E;  3CXH H;  2R3C A;  1L0L E;  2JR8 A;  2KS1 B;  4JBZ A;  1MFT A;  1PPJ D;  2DE7 D;  2KSE A;  2NPS D;  2B24 A;  3USS A;  2A06 E;  2HG5 D;  1VM9 A;  2PFX A;  2LKM A;  3H1I G;  2OYH A;  4DJG A;  2H88 C;  4R4L A;  1LGH B;  2BMO A;  1FJK A;  3HUS B;  1VQO P;  4EMJ B;  2SPZ A;  2QJY C;  2IBZ I;  3LIE A;  4A7P A;  1LTJ B;  1OW8 A;  1JM1 A;  5KLV D;  1DEB A;  2IPP A;  4D6T J;  1H0T B;  1ZP0 C;  1KZU B;  2IZ1 A;  1HF9 A;  1P84 I;  2N9Y B;  2LXB A;  2NUM A;  3CC4 P;  3KYQ A;  1SQQ K;  2CKF A;  1VQ9 P;  5CCG A;  1W5C E;  3P8C E;  4HM7 A;  2O01 H;  2KZI A;  5EFW B;  1ZRT E;  3H1H J;  1IJD B;  3B71 A;  1OVR A;  1GL2 A;  4QUP A;  3G71 P;  1P84 H;  1JM0 A;  1YQ4 C;  1OWA A;  2HMJ A;  1Z56 A;  1L0N K;  1BSH A;  2M5A A;  1M56 D;  1IK9 A;  4NPF X;  1BSN A;  3PP5 A;  2B9B A;  1O7N A;  1EDI A;  2C0W A;  1GW3 A;  2J58 A;  4HM6 A;  3EWK A;  4HYT B;  1J1E B;  1VF5 D;  1HGZ A;  3G6E P;  1KTM A;  1H88 A;  1N7L A;  1FJP A;  1LTS C;  1NTK G;  2O1J A;  2FXP A;  1EG9 A;  2M5A B;  3TNU A;  1X22 A;  2E4P A;  4JYC A;  3H1I D;  2BEQ D;  4HM5 A;  3N4X A;  3GF7 A;  3WUV A;  1S9K E;  3CX5 D;  1IFJ A;  4HKZ H;  2E74 C;  3GTE A;  2K37 A;  2FFD B;  1KQL A;  3OW2 O;  1O7P A;  3Q3D A;  1SQV K;  2D2C D;  2YXR B;  1J2J B;  4HM1 A;  2WTY A;  2I8D A;  2HML A;  2Y0E A;  3RL0 D;  1X8Y A;  4RKU J;  2A45 G;  3C0D A;  3A0H E;  1SQP K;  2XND H;  1LTB C;  1L0L K;  5TJH A;  3ITK A;  2JWD A;  1VQK P;  1YTZ T;  1SQX E;  3CWB E;  2C0X A;  1VQP P;  3M0A A;  1VQL P;  3L36 A;  3WUU A;  2KYV A;  1N2D C;  5L8R J;  1KIL B;  5APT A;  1JY2 N;  3AE3 C;  4MN4 C;  1NJI Q;  3TF5 A;  2OYI C;  4HJL A;  3CMA P;  4LGD E;  3OJA B;  3MIW A;  1PIX A;  3EQ2 A;  1M1J C;  1ZV8 A;  1LP1 B;  1NTK D;  1BE3 J;  1KYO I;  4P1C H;  2YMY A;  3AEC C;  2HMN A;  1FZE A;  3RBZ A;  4OGQ B;  5AW2 B;  2PRR A;  3HD7 B;  1N7S D;  4IL6 X;  5KLV J;  3L75 E;  4NPD A;  3P32 A;  3CL3 D;  4KHX A;  4L75 A;  1O7M A;  1JTH A;  1IFI A;  1L4A A;  1KYO H;  5CJ4 A;  3CI9 A;  1NU1 G;  1IC2 A;  2FYU G;  4BWN A;  1RQU A;  3D71 A;  1KOR A;  3MUD C;  1RH5 B;  4HM8 A;  1EXI A;  1JTH B;  1L4A B;  3KDP B;  5GTH H;  3L71 E;  4U3F E;  2Z5I A;  2NPS A;  2AXC A;  3H1L E;  3AE6 C;  5KLI C;  2AXT E;  1O7H A;  4IFD K;  1NTZ E;  1QGK B;  1PP9 E;  2ZVO B;  4P1B H;  1PGJ A;  1DD4 A;  2R5B A;  1JNM A;  2WSE H;  2B87 A;  3M0D C;  2K9J A;  4H44 D;  3O6Q A;  1VPC A;  2NPS B;  3D89 A;  1KQF B;  1S1C X;  2JWA A;  4UB6 E;  1HVV A;  1D7M A;  2H43 A;  5AVR B;  2Q9I A;  2QEX P;  3RBX A;  5AEW A;  3BCC G;  1UII A;  3IF4 A;  4ZKP A;  1M90 Q;  1HWT C;  1E5W A;  3L74 J;  1J1D B;  5M1B A;  1NH4 A;  1T3J A;  2K9J B;  1BGY J;  3AZC A;  1YBK A;  3O6Q B;  1SJG A;  2Y9Y A;  4GT1 A;  1MFZ A;  5AVS B;  3L35 A;  3L72 E;  3DQY A;  4DOJ A;  4LC1 A;  1SQX K;  4NBH D;  2E75 D;  1NU1 D;  2FYU D;  1JB0 J;  3FX0 A;  1QL1 A;  1G2C A;  3HE4 B;  2FYZ A;  3A0H H;  3CCQ P;  2R32 A;  3E1I A;  3NXS A;  2E4Q A;  1SVF A;  2Z5H A;  4H0L D;  3WU2 E;  4AIV A;  3GZX A;  3HUS C;  3AEG C;  2AEM A;  3VMA A;  5AVU B;  1LTJ C;  4LLH A;  3FWL A;  2WMM A;  1LTG C;  1RF1 B;  2N9B A;  1HTL C;  3CME P;  1SQB J;  1JCD A;  2WSC H;  1KQS O;  1VL2 A;  1NTK J;  2JZA A;  1VF5 B;  3SWF A;  1A02 J;  3H1J J;  3HTK A;  4GIF A;  4IOI H;  1NAF A;  3CX5 I;  3VCP A;  1AJY A;  1HH0 A;  5AW8 B;  5CCG D;  3LW5 H;  5AW0 B;  3CCE P;  4RO0 A;  3BCC D;  1RE3 A;  3PLN A;  1NTM G;  3O8Z A;  1GL2 D;  2ITA A;  3GHG A;  2YVJ B;  2OAR A;  3HE5 A;  4OWF A;  1HJB A;  1R5L A;  2CPS A;  5CJ0 A;  1MZ9 A;  4PV1 D;  5APU A;  2D2C B;  1J1E C;  4IL6 E;  3RL0 B;  1L2P A;  3GHG B;  3M9H A;  2WIT A;  2Z4E A;  3CPW O;  1GMJ A;  2WSF H;  1NTZ K;  1LT9 B;  2PP6 A;  1BCC J;  2POH A;  1DX7 A;  3B5N D;  1G8J B;  1Q7Y Q;  2M8R A;  1JCC A;  2FKW B;  2H89 C;  2QM8 A;  2FFD C;  4M3L A;  2B88 A;  1ZOY C;  1EDK A;  2BMQ A;  2I1J A;  3VMG D;  1T3U A;  3CCS P;  3S1K A;  1A02 F;  4I7Z B;  1N7S A;  2RH0 A;  1P84 E;  2M3B A;  2OTL P;  4QDF A;  4UB6 H;  1OXZ A;  1EDJ A;  4NB9 D;  1T8Z A;  1IO4 A;  1NTM D;  1N7S B;  1G1I A;  1QEX A;  3VN0 A;  5BVZ A;  1KIL C;  4IFF A;  4QDF B;  4HKV A;  5APQ A;  2A45 I;  2R5D A;  5CXM A;  2FYU J;  2P10 A;  1ZXG A;  1BE3 G;  3BRT B;  3L73 D;  4NBE D;  1ZW0 A;  2W90 A;  4NBC D;  1AV1 A;  4OGQ C;  1PV3 A;  3Q2Y A;  1HJ0 A;  2W83 C;  3HD7 C;  5H2F E;  2P2U A;  3BVH A;  3H32 A;  3JCU E;  3L4F A;  4D6T E;  3AEE C;  2XR8 A;  4TT3 H;  5GTI E;  3QH9 A;  2YXQ B;  4H13 D;  5APV A;  1LTT C;  4H44 B;  5CCH A;  1LJ2 A;  5KTB A;  3GLM A;  1PFI A;  1FOS E;  3H32 B;  1L4A C;  1IFN A;  3H1H E;  2NVF A;  2XSO A;  1KIL E;  4JQ0 D;  3CCV P;  2HOD B;  3C1L A;  1S3J A;  1NYH A;  1YIJ P;  3IAO A;  4WVZ A;  3FGA D;  2KNC B;  2QIW A;  4AQR D;  2I7F A;  1AQT A;  2ZYG A;  2NPS C;  3AE2 C;  1BE3 D;  1SS1 A;  4IL6 H;  2E75 B;  3U1A A;  2KSJ A;  3L74 G;  3TK1 A;  2JO6 A;  1GU5 A;  1BGY G;  1OW6 A;  3FXE A;  1RQV A;  2YKP A;  3L37 A;  1KYO E;  1J1D C;  4EDF A;  4H0L B;  5KJ7 D;  1OW7 A;  1GK6 A;  4ZKU A;  2OYH B;  4YTP C;  1SP4 A;  2NUK A;  4JF7 A;  2V7Q J;  4W80 A;  1K04 A;  4PD4 D;  1SQV J;  5GTH E;  4NBG D;  2MJZ A;  1Y8A A;  2YKQ A;  1ZME C;  3W68 A;  1RFS A;  1NTM J;  2P7J A;  2DE6 D;  3MD0 A;  2BCC E;  4JPZ B;  4NPE A;  2XDJ A;  4XA4 A;  1SQB G;  1MUU A;  1GL2 B;  1PPJ E;  1RF1 C;  4QDD A;  3EFF K;  2G8Y A;  1Y9B A;  2QA4 P;  2E5T A;  1VQ6 P;  4R4M A;  3SFD C;  2FXM A;  3B5N A;  3H1J G;  5B66 E;  4PV1 B;  3L73 J;  1N8R Q;  1VF5 C;  2KUB A;  5AW9 B;  1YIT P;  2NWF A;  2RN0 A;  2FBW C;  4XFJ A;  1QLE D;  1URQ A;  2M3E A;  4RES B;  4BXL A;  3CC2 P;  2LR2 A;  2E76 D;  3L74 D;  1KB9 D;  1USE A;  1BGY D;  1GZL A;  1XTC C;  5H2F H;  4CPG A;  3B5N B;  3TNU B;  5KLV E;  1Q82 Q;  2YNY A;  1OIP A;  4GOF A;  1FDO A;  3JCU H;  5AEU A;  1AVY A;  3KHU A;  2D2C C;  1VQ4 P;  3E7K A;  5GTI H;  2ZT9 D;  1RE3 C;  3CD6 P;  1BCC G;  2QJK B;  3A0B E;  3TGU G;  3RL0 C;  4I6M C;  2E43 A;  3GHG C;  3BRV B;  2XNX A;  1JO5 A;  1PGP A;  3P7K A;  1UUW A;  3G9R A;  1LT9 C;  5KAF E;  1RY3 A;  2XU6 A;  3V2N A;  1IZN B;  4EYY Q;  3U1C A;  2XRX A;  3PJS K;  3D6Z A;  2WPQ A;  4N78 D;  3W67 A;  2HPC A;  2K9Y A;  1SQB D;  1MKM A;  2LXC B;  1DEE G;  2KIK A;  2WPR A;  1OVV A;  1T2K D;  4I7Z C;  3H1J D;  3RK3 D;  2FY8 A;  3CC7 P;  1SFC D;  1OZH A;  3BAS A;  4ZNC A;  3H1I E;  1JMB A;  2HPC B;  2HLO A;  4WWI A;  4NBA D;  1RF0 C;  3CX5 E;  3LID A;  2Y0C A;  1RE4 C;  3OAK A;  1N7S C;  1N86 A;  1KB9 E;  2XV5 A;  3MP7 B;  1KMI Z;  1BGY E;  4L73 A;  5APW A;  3PHL A;  1ZN5 A;  1VDF A;  1NDO A;  1AFO A;  2GBW A;  4GKG A;  4I1L A;  4H13 B;  1JUN A;  1BCC D;  5B5E H;  3D70 A;  3TGU D;  1SQX J;  1FZF A;  2B1X A;  3L70 G;  1MV8 A;  3A2A A;  1ZR4 A;  2RMZ A;  3VP9 A;  1OFC X;  2K1A A;  1FZB A;  2ZVN B;  3PRJ A;  5AW5 B;  3GTS A;  1LNQ A;  2IBZ G;  2JO1 A;  1EQ7 A;  2IFN A;  3G3Z A;  3M9Q A;  4HM4 A;  2RKL A;  1GDT A;  3TSI A;  1JY3 N;  5B66 H;  2OGU A;  1NYK A;  4YPC A;  5KJ7 A;  3AE4 C;  4H44 C;  2W6J H;  1NGM B;  3FXD A;  1NTK E;  2NVG A;  5KLV K;  2B87 B;  3QWO C;  2WPS A;  1YI2 P;  1VQ8 P;  2HMM A;  3GZY A;  5CCH D;  4EI2 A;  3TDK A;  2C9L Y;  3CXH D;  3WUT A;  2XKM A;  2E42 A;  1L0N G;  1JMM A;  1CI6 A;  1KQG B;  2CK3 H;  3MTU E;  1GW4 A;  3F89 A;  1BDC A;  4Y28 J;  2G3A A;  2E75 C;  3SFE C;  3A0B H;  1WRG A;  3NTN A;  1H8A A;  1S2E A;  5KAF H;  2OTK E;  5AVY B;  1CI6 B;  2KLU A;  3H25 A;  3L70 D;  1QVF O;  1G2C B;  4H0L C;  3NMD A;  2OYH C;  1EZV G;  4DZO A;  1FU1 A;  3RK2 D;  3OA7 A;  1NVO A;  2IBZ D;  1SQV G;  3EN1 A;  4QMA A;  4PJ0 E;  2HR3 A;  1G1J A;  2ZYA A;  1NWQ A;  4IFM A;  3IFM A;  1KB9 I;  1Q90 D;  2C9N Y;  4HM0 A;  2OYO A;  1N73 A;  4AYC A;  1JY2 P;  1FZA A;  3N7N A;  1FDI A;  1L0L G;  5CCG C;  2E76 B;  3HTK B;  3CX5 H;  1PGO A;  1WMK A;  1KB9 H;  5C39 A;  3Q5P A;  2Y9Z A;  1GL2 C;  3AE9 C;  1AVO A;  2A06 G;  1N73 B;  1ULI A;  2H8P D;  1L0N D;  3L73 G;  1PGQ A;  3PTZ A;  1NHL A;  1LWU A;  3SWK A;  2Q1K A;  1NU1 E;  4PV1 C;  2FYU E;  3II6 A;  5TIS E;  3HE5 B;  3AED C;  3TGU J;  2QSI A;  3AE8 C;  2ZT9 B;  2QJP B;  2WSS H;  5AW1 B;  2OYI A;  3V4Q A;  2ZYL A;  3T97 A;  3CCM P;  1VQ5 P;  1URQ D;  1NKN A;  2OQQ A;  1LWU B;  2N1T D;  2O3J A;  1M1J A;  3B5N C;  5AVT B;  3GB4 A;  5K5G B;  1T6A A;  1SFC A;  1NTK K;  1EZV D;  3MHV A;  3NFQ A;  2R3S A;  4QUR A;  2W6A A;  1SQV D;  2GUV A;  3V2P A;  3CCJ P;  1KFN A;  2QJK C;  3RK3 B;  2HMK A;  3N0Q A;  1UUV A;  1SFC B;  2BMR A;  2HMO A;  2QM7 A;  1FAV A;  3BCC E;  2B89 A;  1W2E A;  2CPB A;  1L0L D;  2P58 A;  2FYN B;  3M9B A;  1GU4 A;  1QX8 A;  4HH2 A;  2IFM A;  2A06 D;  2NRG A;  2YFL A;  2W6B A;  4UB8 E;  2GUS A;  4TLF A;  4WY4 D;  4YXW H;  2A45 H;  4ASW A;  4GOD A;  1W2B O;  3L70 J;  1U57 A;  1H89 A;  2ZXE B;  2KZJ A;  1HGV A;  4N6J A;  2K3R A;  1QVG O;  3B4S A;  1K9M Q;  2O01 J;  1PZQ A;  2HFE D;  1YHQ P;  4WB4 A;  2IDB A;  3MGN A;  1BDD A;  3P8C D;  4PJ0 H;  1ZRT D;  4B86 A;  1SQX G;  3CWB G;  2KP8 A;  3M91 A;  4H13 C;  1SQQ J;  2H7H A;  3ZDM A;  3KQG A;  3IR9 A;  3VP8 A;  5AVW B;  1O7W A;  1RHZ B;  2ZYD A;  1NTM E;  3H1K J;  1NU1 K;  2FYU K;  4BRY A;  2GM4 A;  2YMK A;  1L0N J;  2Q3W A;  4YXD C;  4RJT A;  3Q1M A;  2KB7 P;  3JC2 2;  3HUS A;  2XZR A;  1NOH A;  4W7Z A;  4NBF D;  4L76 A;  1LTJ A;  5TIS H;  4NBB D;  3EQQ A;  3L73 E;  4BRY B;  1H0T A;  3L75 G;  1S9K D;  4EOT A;  2AEJ A;  1HUC A;  1M57 D;  2ZAE B;  4C7R A;  2V4H A;  2IX7 C;  3TYY A;  5AVZ B;  1AQ5 A;  3WMM 0;  4L74 A;  5KJ7 C;  1VQN P;  3BAT A;  1CZQ A;  5AW3 B;  3RK2 B;  4U7J A;  5B5E E;  3A3Y B;  3M06 A;  2WZ7 A;  3VMZ A;  1CW5 A;  3L71 G;  4U3F G;  1RIE A;  5APX A;  4QUQ A;  1SQX D;  3CWB D;  3H1L G;  1M1K Q;  4QCK A;  1SQP J;  5BU5 A;  2MKV A;  3H6P A;  1L0L J;  3S9O A;  1NTZ G;  1PP9 G;  1VQ7 P;  1KC8 Q;  1U7M A;  2WT7 A;  1FDM A;  2HYN A;  4AUW A;  1PL5 A;  3KZI E;  4GDO A;  2UWJ E;  2O1K A;  1HBW A;  2E5Y A;  4UB8 H;  1S5L X;  2N1T A;  1O7G A;  1BE3 E;  3A7O A;  2I1K A;  2FFD A;  3AE5 C;  2IYP A;  2E74 D;  2WT7 B;  3G4S P;  1YJN P;  3L75 D;  3CLQ A;  1OX3 A;  1EZV I;  2E76 C;  4N3Y B;  3R4Y A;  2GA1 A;  1URQ B;  2Q3E A;  3L72 G;  5APY A;  2N1T B;  2VRS A;  1K73 Q;  2WPV B;  1ZR2 A;  3RGU A;  4ZMD A;  3E1R A;  1N73 C;  4O9B A;  3VMH D;  2BEZ F;  3VTP C;  5KKZ B;  1VCK A;  2V7Q H;  4PD4 E;  1FOS F;  1NTM K;  2ZXX A;  1KIL A;  2ZT9 C;  2QJP C;  3L71 D;  4U3F D;  2OTJ P;  4Y99 B;  2YIU B;  3H1L D;  1WQL A;  5AVQ B;  2KLV A;  2L91 A;  1NAY A;  2BCC J;  2WSE J;  1LWU C;  1NTZ D;  1PP9 D;  3C9I A;  1LP1 A;  1KN7 A;  3V4W A;  4WY4 A;  1FZC A;  1FQT A;  2YKO A;  1FBM A;  4HJG H;  4KJM A;  1USD A;  3HD7 A;  3GF3 A;  3GOB A;  3SSU A;  3CCR P;  2BAS A;  4I2L C;  1T2K C;  1K8A Q;  2WQY C;  2WWW A;  4WY4 B;  3RK3 C;  1SFC C;  3L74 E;  1FZC B;  1VQM P;  1JOC A;  1IFM A;  5KAI E;  1OVU A;  1S72 P;  4OVN F;  1LTI C;  2YO3 A;  3GW6 A;  3GL2 A;  2NVE A;  3MZW B;  2FYN C;  3L72 D;  2JJL A;  3D6Y A;  1JY2 O;  2ZFC A;  3V2R A;  2W8Z A;  3Q5R A;  4KT0 J;  1X9V A;  3CWB J;  2GBX A;  1U7J A;  1TU3 F;  3GG2 A;  1YJ9 P;  1R5S A;  3ABV C;  3CCU P;  2KI7 B;  4ASV A;  2WSC J;  5E79 E;  4N78 E;  1YQ3 C;  3V6I A;  1SQB E;  3VMY A;  2W27 A;  4WBA A;  2JP3 A;  3KZI H;  1NO4 A;  1SQQ G;  3LW5 J;  1R8E A;  4AAY B;  2KK7 A;  3H1J E;  1X79 B;  3RK3 E;  1FC2 C;  1FS0 E;  2K88 A;  2QRX A;  3EFG A;  3H1I J;  3L75 J;  2P67 A;  2QJY B;  4W7Y A;  2NZ2 A;  3H1K G;  1E79 H;  1YYC A;  1G8K B;  1EDL A;  2YO2 A;  5CCH C;  4PD4 I;  3HE4 A;  1WT6 A;  1M7L A;  5HL4 A;  1S5L E;  4XE5 B;  2XSH A;  3IN6 A;  1CSB A;  3I55 P;  2M0B A;  5CBN A;  5AVV B;  2WSF J;  5BOK A;  3R2P A;  2PAJ A;  3VMX A;  1ULJ A;  4PD4 H;  1QL2 A;  3L71 J;  4U3F J;  1FE6 A;  1RF1 A;  1KV4 A;  1BCC E;  3H1L J;  3TGU E; 
#chains in the Genus database with same CATH homology
 3GKE A;  4P1C H;  2DE5 D;  3AEC C;  2HMN A;  1K04 A;  4OGQ B;  2QPZ A;  4NBG D;  4IL6 X;  2YFL A;  3L75 E;  2YFJ A;  1ZME C;  1O7M A;  1DIP A;  1RFS A;  2DE6 D;  3VMI D;  2BCC E;  1U57 A;  1RQU A;  3D71 A;  1KOR A;  1PPJ E;  3AEB C;  4QDD A;  2G8Y A;  1Y9B A;  4R4M A;  3SFD C;  1Q90 C;  4HM8 A;  1UIX A;  4PV1 B;  3C8V A;  3AE1 C;  1EXI A;  2E74 B;  3CXH E;  2O01 J;  3L71 E;  1K05 A;  1VF5 C;  2NWF A;  4NBD D;  4U3F E;  4HM2 A;  2FBW C;  4XFJ A;  1DD3 A;  2IDB A;  3H1L E;  3AEF C;  3AE6 C;  5KLI C;  2E76 D;  3Q5S A;  1O7H A;  1NTZ E;  1PP9 E;  4P1B H;  4H13 C;  1DD4 A;  5KLV E;  4H44 D;  1O7W A;  1FDO A;  3O6Q A;  3D89 A;  1KQF B;  1S1C X;  1NTM E;  5AEU A;  2D2C C;  3AE7 C;  2YMK A;  2ZT9 D;  3L70 E;  5AEW A;  2Q3W A;  4YXD C;  3VCA A;  3Q1M A;  5M1B A;  3AZC A;  1UUW A;  4NBF D;  3G9R A;  1SJG A;  3T97 B;  4Z1M H;  4NBB D;  2IBZ E;  3EQQ A;  3L73 E;  3GMA A;  4HM3 A;  2YFI A;  5KKZ C;  2XRX A;  3D6Z A;  3L72 E;  3DQY A;  3GL0 A;  4NBH D;  2E75 D;  2K9Y A;  1JB0 J;  1MKM A;  1SQQ E;  2YIU C;  2E4Q A;  4I7Z C;  4H0L D;  4AIV A;  3GZX A;  3AEG C;  2J5U A;  4U7J A;  3H1K E;  3H1I E;  3RL0 g;  4NBA D;  1L0N E;  1RIE A;  3FOU A;  3CX5 E;  4QUQ A;  4OGQ D;  1KB9 E;  4QCK A;  1KMI Z;  2MKV A;  1VL2 A;  3S9O A;  1OMI A;  2JZA A;  3AEA C;  1VF5 B;  3VCP A;  1AJY A;  1NDO A;  2GBW A;  3GCE A;  1PL5 A;  4H13 B;  4GDO A;  3D70 A;  4NB8 D;  1S5L X;  1EZV E;  1EXJ A;  2B1X A;  2YVJ B;  1O7G A;  1BE3 E;  3AE5 C;  4PV1 D;  1SQV E;  2E74 D;  2D2C B;  3GTS A;  2JO1 A;  2E76 C;  3R4Y A;  4HM4 A;  1GMJ A;  2WPV B;  1IK7 A;  1NYK A;  1SQP E;  4QDC A;  3AE4 C;  4H44 C;  1L0L E;  1NGM B;  1G8J B;  1NTK E;  3VMH D;  2NVG A;  2BEZ F;  2DE7 D;  1VCK A;  4PD4 E;  2H89 C;  2HMM A;  3GZY A;  2B24 A;  1ZOY C;  2A06 E;  2ZT9 C;  2BMQ A;  2QJP C;  1VM9 A;  3VMG D;  1WQL A;  2H88 C;  4R4L A;  4I7Z B;  2BMO A;  2WSE J;  4EMJ B;  1P84 E;  4QDF A;  2QJY C;  1KQG B;  1OW8 A;  1JM1 A;  1FQT A;  4Y28 J;  2G3A A;  2E75 C;  3SFE C;  1ZP0 C;  4NB9 D;  1HF9 A;  3GF3 A;  3GOB A;  2NUM A;  3H25 A;  4QDF B;  4HKV A;  2CKF A;  2WQY C;  4H0L C;  4HM7 A;  5CXM A;  2P10 A;  3L74 E;  1ZRT E;  3B71 A;  4QUP A;  1YQ4 C;  3EN1 A;  4NBE D;  3GL2 A;  2NVE A;  2FYN C;  2HMJ A;  4NBC D;  4OGQ C;  1PV3 A;  3Q2Y A;  1HJ0 A;  1Q90 D;  4HM0 A;  1O7N A;  3D6Y A;  4HM6 A;  3EWK A;  1VF5 D;  3Q5R A;  1KTM A;  4KT0 J;  1FDI A;  2GBX A;  2E76 B;  1TU3 F;  3AEE C;  2FXP A;  1EG9 A;  2XR8 A;  1WMK A;  4TT3 H;  3ABV C;  2E4P A;  4H13 D;  3Q5P A;  2BEQ D;  3AE9 C;  4HM5 A;  4H44 B;  3GF7 A;  1ULI A;  2WSC J;  3GLM A;  1YQ3 C;  4PV1 C;  1NU1 E;  2FYU E;  2E74 C;  1SQB E;  3GTE A;  3H1H E;  2NVF A;  3AED C;  1O7P A;  3Q3D A;  2JP3 A;  2QSI A;  3AE8 C;  2ZT9 B;  2D2C D;  2XSO A;  1KIL E;  4HM1 A;  3LW5 J;  1R8E A;  4AAY B;  3H1J E;  3RK3 E;  2HML A;  2ZYL A;  1NYH A;  4RKU J;  2OQQ A;  3IAO A;  3FGA D;  3C0D A;  2QIW A;  2I7F A;  3GB4 A;  2NZ2 A;  1G8K B;  1SQX E;  3CWB E;  3AE2 C;  2E75 B;  4QUR A;  5HL4 A;  2XSH A;  2JO6 A;  5L8R J;  3IN6 A;  1OW6 A;  1RQV A;  3AE3 C;  2QJK C;  1KYO E;  4H0L B;  2WSF J;  1OW7 A;  5BOK A;  2HMK A;  4HJL A;  3N0Q A;  1UUV A;  2BMR A;  1ULJ A;  2HMO A;  3BCC E;  1PIX A;  4YTP C;  1BCC E;  2NUK A;  3TGU E;  2V7Q J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...