2D2CD

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2d2cD02
3L71E 1WQLA 1PPJE 4QDFB 1L0NE 2NVGA 2YFLA 4H13C 1O7WA 2NUKA 3GOBA 1G8JB 2IBZE 4QURA 2ZYLA 2DE5D 3AZCA 2QJPC 4HJLA 4NBCD 4PV1C 3FOUA 4HM1A 4U3FE 2BCCE 4HM4A 4NBHD 3L72E 1NTZE 3VCAA 1RFSA 3DQYA 2E76D 5KKZC 2I7FA 4AAYB 3EN1A 1UUVA 4AIVA 1RIEA 3CX5E 2HMOA 2NWFA 1KB9E 2HMJA 4P1BH 1NDOA 5AEWA 1SQPE 3N0QA 3GTEA 1UUWA 3L74E 4HM2A 3GB4A 1NU1E 3BCCE 1NTKE 2BMQA 2ZT9D 1NTME 4NBED 4H0LD 2E4QA 5KLVE 2YFIA 4NBBD 1ULJA 3EQQA 1ZRTE 4H44D 4OGQC 4NBAD 2XRXA 1O7MA 1SQVE 2XR8A 3VMGD 5BOKA 1SQXE 2E74D 2GBXA 1VF5D 2HMKA 2JO6A 3VMHD 4PD4E 2A06E 1BCCE 2B24A 4HM8A 1O7NA 1EG9A 2YVJB 3TGUE 2Q3WA 1KYOE 4QDFA 3GZXA 2NVEA 2FYNC 2BMRA 2E76C 3GZYA 3L70E 2BMOA 4NBGD 1P84E 2NVFA 3GTSA 3GL2A 3GL0A 2QPZA 3GKEA 2GBWA 1SJGA 4QUPA 2D2CD 2YFJA 4QDDA 1VCKA 1EZVE 3CXHE 2JZAA 2ZT9C 1FQTA 1O7HA 3CWBE 4NB8D 2QJKC 2E75D 3H1IE 3L73E 1NYKA 4HKVA 4HM5A 4NBFD 5AEUA 1VM9A 2XSHA 4H13D 5CXMA 1VF5C 3VCPA 2DE7D 2B1XA 1O7GA 2NUMA 1JM1A 1SQQE 4QDCA 2E4PA 1BE3E 2CKFA 4HM6A 4OGQD 1SQBE 2FYUE 3H1KE 2HMNA 4HM0A 3VMID 1O7PA 2HMMA 4PV1D 5HL4A 3H1JE 3D89A 2DE6D 1L0LE 2XSOA 4HM7A 4QUQA 4EMJB 4NB9D 2YMKA 4H0LC 3C0DA 3H1HE 2D2CC 4HM3A 4P1CH 2HMLA 4H44C 3GCEA 2QJYC 3L75E 4NBDD 1G8KB 1PP9E 1ULIA 4I7ZC 2E75C 4QCKA 2E74C 3H1LE 5KLIC 2YIUC 1Q90C
chains in the Genus database with same CATH superfamily
3O8ZA 3CX5D 1LTJB 2ZVOB 3L74D 2Q1KA 1NU1D 1NKNA 5AVZB 1HTLC 3AZCA 3WU2H 2BCCJ 1DH3A 1FZAA 1NYHA 3V2PA 3FOUA 1EZVD 3DQYA 2NPSB 2WZ7A 3VN0A 2I7FA 2O1KA 2A06D 2KYVA 1FS0E 4WB4A 1YIJP 3AEFC 5APVA 1NWQA 2IBZI 2H8PD 1EXJA 1M1JB 1SFCD 4NBBD 3I5CA 1SP4A 3SFDC 1VF5D 5BVZA 2B24A 1MFZA 4YTPC 2B88A 2R32A 3H32B 3FWLA 1ZN5A 5KAFH 1VQ9P 1NTZK 1EXIA 3H1JD 3K5BA 2B89A 1Q90D 4HKVA 5EFWB 1LTJC 2XSHA 1HUCA 1PP9D 1NTMK 2WMMA 2Y0CA 1JTHB 1PPJD 4PV1D 3ABVC 1JUNA 2B87A 4WVZA 4HM7A 1WRGA 3GLMA 1K73Q 4WBAA 3KYQA 1M1JC 3VMAA 2YFLA 1N7LA 2IZ1A 1KB9D 4HKZH 2WPSA 1N86A 1Z56A 1YBKA 4U3FE 5APWA 1OW7A 2CK3H 2Y0EA 2N9BA 4GOFA 4BWNA 4PJ0E 1BGYJ 5AEWA 1GL2B 2WVRA 2E74B 3WUUA 5BOKA 1M8OB 1O7NA 3H1ID 3L37A 1JO5A 3V6IA 1PL5A 1ZV8A 3C1LA 3C9IA 1P84E 2GA1A 3A7OA 2WPVB 1GD2E 4U3FG 1KN7A 4QDDA 5APSA 1DX7A 3V4WA 1O7HA 1M56D 3L73E 4U3FD 4PJ0H 4RESB 1JEKA 5AEUA 1T3JA 5DJTB 3AEDC 5AW6B 2W90A 3D6ZA 1OVRA 3MZWB 2B9BA 1ZMEC 2IFNA 3H1HJ 1T3UA 5AW3B 2K1AA 2QJYC 1NTZD 2K3RA 2E74C 3L71J 1NTKJ 1AVOA 1RF0C 1HVVA 1P84D 1L0LG 2RKLA 3G4SP 1NTMD 3L73G 1RE3C 2I1KA 3TK1A 1K9MQ 1NAFA 3L74J 1SQPE 2RH0A 1NU1J 1OW6A 3HD7D 1FC2C 4ZNCA 1A02J 3FXEA 2KS1B 3AECC 5B5EH 3TDKA 3SWFA 3RK2D 3GG2A 1K05A 3IFMA 3HTKA 2ZYAA 1KILB 2BMOA 2YO3A 2G8YA 2NVFA 1LT9C 3B5NA 2QPZA 2GBWA 1H0TA 3UIAA 2IFMA 4LLHA 2WWWA 1J1DB 1NKZB 1SQPG 4R4MA 4H13D 5CCHC 2ZAEB 3KZIE 2L5GB 2N1TD 1PGJA 4HM0A 4W80A 3H1JJ 3CXHI 4YXDC 1T2KD 1IO4A 1FZGA 3B71A 1KTMA 4PD4I 4M3LA 1PP9J 3CCLP 2WT7A 2UWJE 4I7ZC 1H8AA 2M3EA 1PGOA 1L0NJ 5AW9B 1T6AA 3CCMP 3TNUB 3N7NA 4KJMA 1KILC 4IL6H 3T97B 2E76D 1SQQK 5CBNA 2DW3A 2LKMA 1S9KE 2WSSH 2PAJA 4B86A 2I8DA 2QRXA 4C7NA 3HD7A 1EDKA 3VMGD 3FXDA 1VQ8P 3VMHD 3TF5A 3Q1MA 4HM8A 4D6TD 1LTIC 2XNDH 2AEJA 2P67A 2NVEA 2K9JA 1Y9BA 2KNCB 4RO0A 3P32A 3P8MC 5CCGC 1J2JB 3TGUG 3H1IJ 1FZCA 1DIPA 2V7QJ 1IFJA 1X0TA 3VTPC 3CX5I 2JR8A 4HM6A 4GIFA 1S9KD 1NO4A 3D70A 1RE4C 1QL1A 4Y99B 1EZVI 2JWDA 5HL4A 2DE6D 4NB9D 4OVNF 3F89A 3CCVP 4WY4B 3BRTB 4NBDD 1SVFA 2WSEH 2OYIC 2FYUK 2WTYA 5BU8B 1HGZA 4ZKPA 2J5UA 5AW5B 1BSHA 2ZJSE 5E79E 1X9VA 1NTZJ 4NPDA 3EFFK 1Q82Q 1BCCD 5AW8B 1G2CB 3M9HA 2RN0A 4ZMDA 1R8EA 3MUDA 1UUWA 2NPSD 5BU5A 1NTMJ 3BCCE 2ZT9D 1K04A 1IFPA 1GMJA 2A45H 3CCUP 1ZRTE 5TJHA 1LP1B 4JBZA 1S72P 1OZHA 2OTLP 2JKVA 1KYOE 3GZXA 1N7SA 2WSCJ 1EDLA 3LW5H 2BMRA 2O3JA 1RQVA 2D2CB 1RH5B 3P8CE 1BE3D 2JEEA 4WY4C 1DD4A 3RK3C 2LR2A 1BSNA 5L8RJ 4QMAA 1HJBA 3QH9A 4JQ0D 1NYKA 3D6YA 4Z1MH 1KB9I 3RL0D 4KT0J 3BCCG 3NFQA 2W83C 2FYUE 2POHA 2R5BA 5CJ4A 2IX7C 1FU1A 1ZOYC 2GUVA 4L73A 1JY3P 3D89A 4HH2A 1ZRTD 3CCJP 3HE4B 3WU2E 4P1CH 1G1JA 3H1LJ 4QCKA 1KYOD 1JNMA 1AVYA 1JM0A 2HYNA 1KQFB 3P7KA 1LTBC 1JCCA 2OQQA 1KD1Q 1LTJA 1QVGO 3R4YA 4GDOA 1ZR2A 2JP3A 4NBED 2FYUD 3MHVA 1KORA 2E4QA 2Q3IA 3VOPA 4JPZB 1GL2D 1S5LX 1FZEA 2NPSA 3M06A 3W68A 5KAFE 2E74D 3CX5H 3C8VA 3U1CA 1L4AB 1VQ4P 1M1JA 4K3AA 2H7HA 2O01H 4I2LC 4D6TJ 1CI6B 1MKMA 1JCDA 3L35A 3H32A 4N78D 3VMZA 1VM9A 3AE9C 3VCPA 1RF1B 1P84I 1GTWA 1SQBE 2M5AB 2YNYA 3IF4A 2M0BA 2J59M 2JO1A 2C9LY 1DEEG 3L75E 1ULIA 2E75C 1JTHA 1N73C 3FWNA 1J1EB 1W5CE 3G9RA 1O7WA 1KILE 1L0LK 2OARA 1OXZA 4IOIH 1L4AC 5B66H 2KOGA 1YQ4C 1JOCA 1LWUA 5APQA 2Y9ZA 3AE5C 3A2AA 4GODA 2HODB 1SQBG 2YO2A 4BRYB 3CL3D 3GB4A 3II6A 2BMQA 5KLIB 3GMAA 3PHLA 2G3AA 3L72G 4A7PA 1Q7YQ 1LJ2A 1SQVE 3NMDA 3L75G 2AXTE 1BCCJ 1RF1C 3N4XA 1GL2A 3AE2C 1OVVA 1RF0A 2QJYB 2Q9IA 2NZ2A 2ZXEB 1GU5A 1DD3A 2YFJA 1LNQA 3M0AA 2JZAA 4JYBA 1RE3A 1G1IA 1J1EC 1VQLP 2C9NY 2YKOA 3L70G 4EYYQ 1BDDA 1SQPK 1SQQJ 1FDMA 1BE3J 3B5ND 2E4PA 2HMNA 1SQVG 2JWAA 1L2PA 2AXTH 2IYOA 1L0LE 2XSOA 1SQVD 1ZXGA 3H1KG 4NPEA 2FFDB 5KLIC 1SFCB 3G3ZA 3CD6P 1VF5B 3E1RA 1KQGB 2QJPC 1UIXA 1NHLA 1YJNP 1LT9B 4EI2A 1PZQA 1K8AQ 5B5EE 3EN1A 3L36A 4AIVA 5APUA 4P1BH 2FYZA 2IBZG 3GHGB 3RBZA 3JCUE 1KC8Q 5KJ7C 1YI2P 2XKMA 3PJSK 2WITA 3EQQA 1MV8A 1L0LD 4ASVA 3AE6C 2Z5HA 2PFXA 4IFDK 1M1KQ 3L73D 1U57A 3HE5B 1NJIQ 5AW0B 5KLVG 3A5TA 2FYUJ 4C46A 2KI7B 3CI9A 1FDOA 2KS1A 3GL2A 2KSEA 3IN6A 4I7ZB 1SQXG 1NOHA 4GOEA 1FZFA 1NH4A 1VQOP 2Q3EA 1FQTA 3CWBE 3TYYA 3MIWA 2FFDC 1IK7A 1SFCC 1OFCX 1XTCC 1VL2A 1N2DC 4NBFD 1VF5C 1VQKP 3TSIA 2NUMA 3JCUH 2R44A 2IDBA 1QX8A 2KLVA 5K5GB 1Q81Q 4W7ZA 3D71A 2Y9YA 5AW2B 3KPEA 2BASA 1LGHB 1W2BO 3HUSB 4HM3A 3GHGC 4IL6E 3NTNA 3CLQA 2AXCA 4OH8B 3OAKA 3A0BH 1IJDB 1Q90C 1AQ5A 2NVGA 2FKWB 1ZW0A 1SQPD 2E5TA 4KHXA 2KZIA 3PTZA 3CWBG 3CC2P 4PV1C 2BCCE 2AEFA 3MTUE 2KZJA 3VCAA 3TNUA 3BVHA 3VP9A 3BASA 3Q5PA 4BXLA 3OA7A 1PFIA 1IK9A 3AE1C 3T97A 2XRXA 3I56P 4NPFX 3MGNA 1EDJA 2GBXA 4Y28J 1JY2O 1LTSC 4AQRD 3TGUE 1YQ3C 2Y0DA 2QVAA 1N8RQ 4TT3H 2OYIB 3HUSC 1JMMA 2BCCG 4DJGA 2D2CD 5APTA 1SS1A 1N7SD 2LXBA 2HLOA 5H2FE 2KNCA 1KYOI 4OGQB 3H25A 2B1XA 4I1LA 2O1JA 1E79H 5AVWB 1NAYA 2KLUA 3CCRP 3O6QB 2NRGA 2C0WA 1HWTC 1IFNA 5GTIH 4U7JA 3TGUD 2QJKB 2XZRA 3E7KA 3WUVA 2K37A 3GOBA 2DE5D 4U3FJ 1YTZT 5H2FH 1JY3O 1ZLLA 1WMKA 1IFMA 3RK3B 4I6MC 2ZVNB 1IFDA 3PH0A 4DZOA 2HMOA 3IAOA 2HMJA 1BGYE 4H44B 1TU3F 1D7MA 3EWKA 4H13B 4OGQC 1S2EA 2XR8A 1T8ZA 4PD4E 1R5SA 2N1TB 2HG5D 4QDFA 1KZUB 1YHQP 2IYPA 3Q5SA 1L4AD 3MP7B 3GL0A 3KXDA 1LP1A 2CPBA 1UIIA 2A45G 3KDPB 2W8ZA 4OWFA 1VCKA 2OYHB 2OGUA 2QG4A 3L73J 3VMYA 3NXSA 4NB8D 2QJKC 2Q7CA 1QGKB 1PGQA 4HM5A 2KK7A 4YPCA 1BGYG 1USEA 1E5WA 3CCQP 3V2RA 3M0DA 1JM1A 4QDCA 1IC2A 3VMID 3CXHH 2OYOA 1FZCC 2ZYDA 2KSJA 2XDJA 4PD4H 3H1HE 4H44C 1SLQA 2XV5A 5CXMA 1EC5A 1VQ5P 3GTEA 3L71E 5KTBA 3H6PA 2BEZF 4H13C 2HPCB 2PRRA 1FDIA 3HE4A 5KAIE 2N1TC 3BCCD 1FOSF 1R5LA 1X22A 1U7JA 1RHZB 1IZNB 1T2KC 3LIDA 3HRNA 4L76A 5APYA 4UB6E 1DEBA 3CX5E 3V4QA 1SQPJ 4H0LB 1S5LH 1LT1A 1SQBK 3N0QA 3PLNA 3L74E 1GW4A 2OYHC 1NU1E 4W7YA 3MD0A 2SPZA 3P8CD 3H1HG 1H88A 3AEBC 2GUSA 3B8EB 2HMKA 2JO6A 2A06E 2YVJB 3L71G 3G71P 1FJPA 1NTKG 2E76C 2QSIA 4TLFA 3L71D 1HBWA 4RKUJ 4UB8H 2AEMA 4XFJA 5KAIH 2E75B 1N73B 4QUPA 1L4AA 3CC4P 2KUBA 1GK4A 4UB6H 2FXPA 2N9YB 3L74G 1URQB 3Q3DA 1NU1G 3CMAP 2M3BA 1VQPP 1RY3A 1EZVG 4LGDE 2HMMA 1CI6A 3JSVC 1SQVK 3CC7P 3H1JE 2A06G 4H0LC 5B66E 1RF1A 2H88C 1RQUA 3GF7A 1PP9E 2ZT9B 2M5AA 3USSA 2IPPA 1JY2N 1PPJE 1L0NE 3KHUA 1KQLA 3U59A 1A02F 4HJLA 4HM1A 2WQYC 4EIJA 4NBHD 3TGUJ 4JYCA 3L72E 1RFSA 3EFGA 1UUVA 3V5BA 1KB9E 1NDOA 1IFIA 1KV4A 3H1JG 1USDA 2R3CA 3GW6A 3AE7C 1URQC 3RL0B 2HODA 2XNXA 2W6AA 1PP9G 5CCHD 2YKQA 1KQSO 2Q6QA 4BRYA 2Q3WA 1PPJG 3CCEP 3V2NA 1L0NG 2WSEJ 5KLVK 4EOTA 4R4LA 5AVRB 3WMM0 3L70E 2J58A 4NBGD 3GTSA 1L0ND 3EQ2A 3JC22 1SQBD 1VDFA 1SQXK 2HR3A 5AVVB 2NPSC 1LTAC 1OMIA 1M7LA 2ZT9C 3H1IE 3VYIA 3L72D 2B87B 1JY3N 2QJPB 1KB9H 4ZKUA 2Z5IA 1QEXA 1LWUB 3L75D 1CZQA 3SFEC 3VMXA 3H1KE 1CW5A 2WSFJ 1EDIA 5KJ7A 1AJYA 1KILD 1M90Q 1FJKA 1AA0A 1PV3A 2PP6A 3IR9A 1G8KB 4DT0A 3LW5J 2ITAA 3GF3A 3L70D 3RL0C 2IBZE 4QURA 1HGVA 3QWOC 1JMBA 2OTKE 3H1IG 2E43A 4NBCD 4GKGA 2V7QH 2MJZA 2FFDA 1WT6A 1X8YA 1SFCA 1NTZE 3AE8C 3RGUA 2KIKA 4IFMA 2BEQD 3F5HA 5AW7B 1RIEA 1QL2A 2NWFA 3ZDMA 3BCCJ 2M8RA 5CCGD 5KLVE 3AEEC 3H1KD 1NTME 1GU4A 1H89A 1LT9A 2YFIA 1VQMP 1SQXE 3Q5RA 1LWUC 1EG9A 3GHGA 1VPCA 5C39A 5CCHA 5M1BA 1YITP 5CJ0A 1SJGA 2IBZD 2ZXXA 1NTZG 3HE5A 2FXOA 1Y8AA 4ASWA 2FY8A 1GL2C 2KXPB 1YJ9P 2R3SA 1KFNA 1XTGB 2L91A 4PV1B 1P84H 2DE7D 1O7GA 1NTMG 3ITKA 3RK3E 3A0BE 4OGQD 3RL0g 1O7PA 5KLVD 3CMEP 4O9BA 4YXWH 1W2EA 3RBXA 1SQXD 2KB7P 1KILA 1U7MA 2E42A 5TISE 3GCEA 2WSCH 3H1LE 4IFFA 1HF9A 3S1KA 1WQLA 4DOJA 1ZP0C 2NUKA 4RJTA 2I1JA 2O01J 2ZYLA 3HUSA 3PP5A 4N6JA 4WWIA 4HM4A 3R2PA 3LIEA 4AAYB 4C7RA 4CPGA 4GT1A 2E5YA 4AYCA 4LC1A 4HM2A 4WY4D 3HTKB 3RK3D 1AQTA 2YIUB 5AVSB 1CSBA 2A45I 1ULJA 4H44D 4NBAD 1OVUA 5CCGA 3B5NB 2QM7A 5TISH 1H0TB 3H1LG 2K88A 1LTTC 3CWBD 1GDTA 2QEXP 3GZYA 3H1LD 5KKZB 3L4FA 1Y47A 3CCSP 1LTGC 1S1CX 1RE4A 3GKEA 2HFED 5APXA 1MFTA 4D6TE 1GZLA 1OW8A 2CPSA 5DJUB 2GM4A 3SWYA 3A3YB 5GTIE 2QE7H 2OYIA 3SWKA 1SQBJ 4K35A 1Q2NA 2CKFA 2WT7B 1YJWP 2C0XA 3WUTA 2IZ0A 1FE6A 3L72J 4QUQA 3L75J 2BCCD 2HMLA 3A0HE 1S3JA 5AVTB 3KZIH 2YIUC 1HJ0A 3BATA 2KP8A 1M57D 3O6QA 1G8JB 1J1DC 3B5NC 2RMZA 4D6TG 2QM8A 3S9OA 2ZFCA 1AV1A 5KKZC 4C7NB 3AEAC 3HD7B 1BDCA 1PIXA 3L70J 1AFOA 3AE4C 4IL6X 1S4XA 2YKPA 2K9JB 2O01N 4H0LD 2V4HA 3RK2B 1SQVJ 4WY4A 1O7MA 2JJLA 5CMZA 3A0HH 4AUWA 1BCCE 3PRJA 2OTJP 1JB0J 1FZCB 3SSUA 3H1KJ 1NTKK 4L75A 2W27A 3M9QA 2H89C 1KMIZ 2QA4P 1PGPA 2P10A 1FAVA 2N1TA 1FOSE 5CHXA 3CXHE 2E75D 1G2CA 3I55P 3OW2O 1YTZI 4XE5B 2Q5UA 5CBOA 1FZBA 1SQQE 4HJGH 1NU1K 1YYCA 1BE3E 3AEGC 2OYHA 1URQD 2FYNB 2YXRB 4HYTB 3M91A 1L0LJ 3HD7C 2FBWC 2R5DA 1BCCG 1JY2P 4EMJB 1QVFO 3C0DA 1NVOA 4JF7A 1MZ9A 2WPRA 1GW3A 5GTHE 3RK2C 4QDFB 5KLVJ 5AW1B 2H43A 2WSFH 1S5LE 1BGYD 4XA4A 2JDIH 1KFMA 1X79B 1OWAA 2E76B 1SQXJ 2MKVA 2QIWA 2P1JA 1NGMB 3CXHD 3Q2YA 1SQQG 4EDFA 4PD4D 1MUUA 1BE3G 2HPCA 1EQ7A 4Y99C 2P58A 1VQ6P 4L74A 3V2QA 2P2UA 1SQQD 1N7SB 4HB1A 3FGAD 3W67A 1NTKE 3B4SA 5E79H 4UB8E 5AVQB 5AW4B 3E1IA 2YMYA 3S4RA 2LXCB 5GTHH 3BRVB 3FX0A 2YXQB 2FXMA 2FYNC 1L0NK 1HH0A 2P7JA 2VRSA 4MN4C 2K9YA 3OJAB 5AVXB 2PGDA 2Z4EA 1OX3A 1GK6A 2XU6A 3AE3C 1EZVE 3CWBJ 1OIPA 2ZYGA 1KYOH 5AVYB 3H1HD 1ZR4A 1QLED 4N3YB 3MUDC 1FBMA 3M9BA 1Q86Q 1N73A 2W6BA 3KQGA 2W6JH 3CPWO 1VQ7P 1NTKD 4N78E 3U1AA 2YMKA 1URQA 5AVUB 3G6EP 2WPQA 2D2CC 1VQNP 1N7SC 4DCKA 3M0DC 3VP8A 2FYUG 5KJ7D
chains in the Genus database with same CATH topology
2NVGA 3GF3A 2J5UA 2IBZE 4QURA 3AZCA 4NBCD 1NYHA 4PV1C 3FOUA 2BCCE 1NTZE 3VCAA 3DQYA 3AE8C 2I7FA 2BEQD 1RIEA 3Q5PA 2NWFA 3AEFC 1R8EA 1UUWA 5KLVE 3BCCE 3AEEC 2ZT9D 1K04A 1NTME 1GMJA 3AE1C 1EXJA 2YFIA 4NBBD 1ZRTE 2XRXA 3SFDC 3Q5RA 1SQXE 2GBXA 1VF5D 4Y28J 2B24A 4YTPC 1EG9A 3TGUE 1YQ3C 1KYOE 3GZXA 2WSCJ 2BMRA 5M1BA 1RQVA 2D2CB 4TT3H 1SJGA 2D2CD 1DD4A 1EXIA 5L8RJ 1Q90D 1NYKA 4HKVA 4OGQB 3D6YA 2XSHA 3H25A 4Z1MH 4PV1B 2DE7D 2B1XA 1O7GA 4KT0J 3RK3E 4OGQD 3RL0g 2FYUE 1O7PA 4PV1D 3ABVC 1ZOYC 3D89A 4HM7A 4P1CH 3GLMA 3GCEA 4U7JA 4QCKA 3H1LE 1HF9A 1WQLA 2YFLA 1ZP0C 3GOBA 2NUKA 2O01J 2ZYLA 2DE5D 1KQFB 4U3FE 4HM4A 2OQQA 1OW7A 4AAYB 1WMKA 3R4YA 4GDOA 2HMOA 3IAOA 2HMJA 5AEWA 4H44B 4HM2A 1TU3F 2JP3A 2E74B 4NBED 1KORA 2E4QA 3EWKA 1ULJA 1S5LX 4H13B 4H44D 4OGQC 4NBAD 2XR8A 5BOKA 2E74D 4PD4E 1O7NA 3C8VA 4QDFA 3GZYA 1PL5A 3Q5SA 1P84E 3GL0A 1S1CX 2WPVB 3GKEA 4QDDA 1VCKA 1MKMA 1O7HA 4NB8D 2QJKC 3L73E 1OW8A 4HM5A 5AEUA 1VM9A 3AEDC 3AE9C 3VCPA 1JM1A 4QDCA 2CKFA 1SQBE 3VMID 3D6ZA 1ZMEC 4QUQA 3H1HE 2JO1A 2HMLA 4H44C 2QJYC 3L75E 1ULIA 2E75C 2E74C 5CXMA 3GTEA 2YIUC 3L71E 2BEZF 3G9RA 1HJ0A 4H13C 1O7WA 1KILE 3O6QA 1G8JB 1FDIA 3S9OA 1YQ4C 5KKZC 3AE5C 3AEAC 3CX5E 1PIXA 4H0LB 3AE4C 1SQPE 3N0QA 4IL6X 3L74E 1OW6A 3GB4A 1NU1E 2BMQA 4H0LD 3GMAA 2G3AA 1O7MA 3AECC 1SQVE 3AEBC 2HMKA 2JO6A 2A06E 1BCCE 3AE2C 2YVJB 1K05A 1JB0J 2E76C 2QSIA 2BMOA 2G8YA 2H89C 2NVFA 4RKUJ 4XFJA 1KMIZ 2E75B 2NZ2A 2P10A 2QPZA 2GBWA 4QUPA 1DD3A 2YFJA 3CXHE 2JZAA 2E75D 2FXPA 4R4MA 4H13D 1SQQE 3Q3DA 2E4PA 1BE3E 4HM0A 3AEGC 2HMNA 2HMMA 4YXDC 3H1JE 2FBWC 1L0LE 2XSOA 3B71A 1KTMA 4EMJB 4H0LC 3C0DA 2H88C 1RQUA 3GF7A 1PP9E 2ZT9B 4I7ZC 5KLIC 1PPJE 4QDFB 1L0NE 1VF5B 2E76B 1KQGB 2MKVA 2QJPC 4HJLA 2QIWA 1UIXA 4HM1A 2WQYC 1NGMB 4NBHD 3L72E 3T97B 1RFSA 2E76D 3Q2YA 3EN1A 1UUVA 4AIVA 4P1BH 1KB9E 1NDOA 3FGAD 1NTKE 3AE7C 3EQQA 3VMGD 3AE6C 3VMHD 3Q1MA 4HM8A 2Q3WA 1U57A 2NVEA 2FYNC 1Y9BA 2WSEJ 4R4LA 3L70E 2K9YA 4NBGD 3GTSA 1FDOA 3GL2A 3IN6A 4I7ZB 3AE3C 1OMIA 1EZVE 2ZT9C 1DIPA 2V7QJ 1FQTA 3CWBE 1IK7A 3H1IE 1VL2A 4NBFD 1VF5C 2NUMA 3SFEC 2IDBA 4HM6A 3H1KE 3D70A 2WSFJ 3D71A 1AJYA 5HL4A 2DE6D 4NB9D 2YMKA 2D2CC 4HM3A 1PV3A 4NBDD 1G8KB 1Q90C 3LW5J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 E;  1WQL A;  1PPJ E;  4QDF B;  1L0N E;  2NVG A;  2YFL A;  4H13 C;  1O7W A;  2NUK A;  3GOB A;  1G8J B;  2IBZ E;  4QUR A;  2ZYL A;  2DE5 D;  3AZC A;  2QJP C;  4HJL A;  4NBC D;  4PV1 C;  3FOU A;  4HM1 A;  4U3F E;  2BCC E;  4HM4 A;  4NBH D;  3L72 E;  1NTZ E;  3VCA A;  1RFS A;  3DQY A;  2E76 D;  5KKZ C;  2I7F A;  4AAY B;  3EN1 A;  1UUV A;  4AIV A;  1RIE A;  3CX5 E;  2HMO A;  2NWF A;  1KB9 E;  2HMJ A;  4P1B H;  1NDO A;  5AEW A;  1SQP E;  3N0Q A;  3GTE A;  1UUW A;  3L74 E;  4HM2 A;  3GB4 A;  1NU1 E;  3BCC E;  1NTK E;  2BMQ A;  2ZT9 D;  1NTM E;  4NBE D;  4H0L D;  2E4Q A;  5KLV E;  2YFI A;  4NBB D;  1ULJ A;  3EQQ A;  1ZRT E;  4H44 D;  4OGQ C;  4NBA D;  2XRX A;  1O7M A;  1SQV E;  2XR8 A;  3VMG D;  5BOK A;  1SQX E;  2E74 D;  2GBX A;  1VF5 D;  2HMK A;  2JO6 A;  3VMH D;  4PD4 E;  2A06 E;  1BCC E;  2B24 A;  4HM8 A;  1O7N A;  1EG9 A;  2YVJ B;  3TGU E;  2Q3W A;  1KYO E;  4QDF A;  3GZX A;  2NVE A;  2FYN C;  2BMR A;  2E76 C;  3GZY A;  3L70 E;  2BMO A;  4NBG D;  1P84 E;  2NVF A;  3GTS A;  3GL2 A;  3GL0 A;  2QPZ A;  3GKE A;  2GBW A;  1SJG A;  4QUP A;  2D2C D;  2YFJ A;  4QDD A;  1VCK A;  1EZV E;  3CXH E;  2JZA A;  2ZT9 C;  1FQT A;  1O7H A;  3CWB E;  4NB8 D;  2QJK C;  2E75 D;  3H1I E;  3L73 E;  1NYK A;  4HKV A;  4HM5 A;  4NBF D;  5AEU A;  1VM9 A;  2XSH A;  4H13 D;  5CXM A;  1VF5 C;  3VCP A;  2DE7 D;  2B1X A;  1O7G A;  2NUM A;  1JM1 A;  1SQQ E;  4QDC A;  2E4P A;  1BE3 E;  2CKF A;  4HM6 A;  4OGQ D;  1SQB E;  2FYU E;  3H1K E;  2HMN A;  4HM0 A;  3VMI D;  1O7P A;  2HMM A;  4PV1 D;  5HL4 A;  3H1J E;  3D89 A;  2DE6 D;  1L0L E;  2XSO A;  4HM7 A;  4QUQ A;  4EMJ B;  4NB9 D;  2YMK A;  4H0L C;  3C0D A;  3H1H E;  2D2C C;  4HM3 A;  4P1C H;  2HML A;  4H44 C;  3GCE A;  2QJY C;  3L75 E;  4NBD D;  1G8K B;  1PP9 E;  1ULI A;  4I7Z C;  2E75 C;  4QCK A;  2E74 C;  3H1L E;  5KLI C;  2YIU C;  1Q90 C; 
#chains in the Genus database with same CATH topology
 3O8Z A;  3CX5 D;  1LTJ B;  2ZVO B;  3L74 D;  2Q1K A;  1NU1 D;  1NKN A;  5AVZ B;  1HTL C;  3AZC A;  3WU2 H;  2BCC J;  1DH3 A;  1FZA A;  1NYH A;  3V2P A;  3FOU A;  1EZV D;  3DQY A;  2NPS B;  2WZ7 A;  3VN0 A;  2I7F A;  2O1K A;  2A06 D;  2KYV A;  1FS0 E;  4WB4 A;  1YIJ P;  3AEF C;  5APV A;  1NWQ A;  2IBZ I;  2H8P D;  1EXJ A;  1M1J B;  1SFC D;  4NBB D;  3I5C A;  1SP4 A;  3SFD C;  1VF5 D;  5BVZ A;  2B24 A;  1MFZ A;  4YTP C;  2B88 A;  2R32 A;  3H32 B;  3FWL A;  1ZN5 A;  5KAF H;  1VQ9 P;  1NTZ K;  1EXI A;  3H1J D;  3K5B A;  2B89 A;  1Q90 D;  4HKV A;  5EFW B;  1LTJ C;  2XSH A;  1HUC A;  1PP9 D;  1NTM K;  2WMM A;  2Y0C A;  1JTH B;  1PPJ D;  4PV1 D;  3ABV C;  1JUN A;  2B87 A;  4WVZ A;  4HM7 A;  1WRG A;  3GLM A;  1K73 Q;  4WBA A;  3KYQ A;  1M1J C;  3VMA A;  2YFL A;  1N7L A;  2IZ1 A;  1KB9 D;  4HKZ H;  2WPS A;  1N86 A;  1Z56 A;  1YBK A;  4U3F E;  5APW A;  1OW7 A;  2CK3 H;  2Y0E A;  2N9B A;  4GOF A;  4BWN A;  4PJ0 E;  1BGY J;  5AEW A;  1GL2 B;  2WVR A;  2E74 B;  3WUU A;  5BOK A;  1M8O B;  1O7N A;  3H1I D;  3L37 A;  1JO5 A;  3V6I A;  1PL5 A;  1ZV8 A;  3C1L A;  3C9I A;  1P84 E;  2GA1 A;  3A7O A;  2WPV B;  1GD2 E;  4U3F G;  1KN7 A;  4QDD A;  5APS A;  1DX7 A;  3V4W A;  1O7H A;  1M56 D;  3L73 E;  4U3F D;  4PJ0 H;  4RES B;  1JEK A;  5AEU A;  1T3J A;  5DJT B;  3AED C;  5AW6 B;  2W90 A;  3D6Z A;  1OVR A;  3MZW B;  2B9B A;  1ZME C;  2IFN A;  3H1H J;  1T3U A;  5AW3 B;  2K1A A;  2QJY C;  1NTZ D;  2K3R A;  2E74 C;  3L71 J;  1NTK J;  1AVO A;  1RF0 C;  1HVV A;  1P84 D;  1L0L G;  2RKL A;  3G4S P;  1NTM D;  3L73 G;  1RE3 C;  2I1K A;  3TK1 A;  1K9M Q;  1NAF A;  3L74 J;  1SQP E;  2RH0 A;  1NU1 J;  1OW6 A;  3HD7 D;  1FC2 C;  4ZNC A;  1A02 J;  3FXE A;  2KS1 B;  3AEC C;  5B5E H;  3TDK A;  3SWF A;  3RK2 D;  3GG2 A;  1K05 A;  3IFM A;  3HTK A;  2ZYA A;  1KIL B;  2BMO A;  2YO3 A;  2G8Y A;  2NVF A;  1LT9 C;  3B5N A;  2QPZ A;  2GBW A;  1H0T A;  3UIA A;  2IFM A;  4LLH A;  2WWW A;  1J1D B;  1NKZ B;  1SQP G;  4R4M A;  4H13 D;  5CCH C;  2ZAE B;  3KZI E;  2L5G B;  2N1T D;  1PGJ A;  4HM0 A;  4W80 A;  3H1J J;  3CXH I;  4YXD C;  1T2K D;  1IO4 A;  1FZG A;  3B71 A;  1KTM A;  4PD4 I;  4M3L A;  1PP9 J;  3CCL P;  2WT7 A;  2UWJ E;  4I7Z C;  1H8A A;  2M3E A;  1PGO A;  1L0N J;  5AW9 B;  1T6A A;  3CCM P;  3TNU B;  3N7N A;  4KJM A;  1KIL C;  4IL6 H;  3T97 B;  2E76 D;  1SQQ K;  5CBN A;  2DW3 A;  2LKM A;  1S9K E;  2WSS H;  2PAJ A;  4B86 A;  2I8D A;  2QRX A;  4C7N A;  3HD7 A;  1EDK A;  3VMG D;  3FXD A;  1VQ8 P;  3VMH D;  3TF5 A;  3Q1M A;  4HM8 A;  4D6T D;  1LTI C;  2XND H;  2AEJ A;  2P67 A;  2NVE A;  2K9J A;  1Y9B A;  2KNC B;  4RO0 A;  3P32 A;  3P8M C;  5CCG C;  1J2J B;  3TGU G;  3H1I J;  1FZC A;  1DIP A;  2V7Q J;  1IFJ A;  1X0T A;  3VTP C;  3CX5 I;  2JR8 A;  4HM6 A;  4GIF A;  1S9K D;  1NO4 A;  3D70 A;  1RE4 C;  1QL1 A;  4Y99 B;  1EZV I;  2JWD A;  5HL4 A;  2DE6 D;  4NB9 D;  4OVN F;  3F89 A;  3CCV P;  4WY4 B;  3BRT B;  4NBD D;  1SVF A;  2WSE H;  2OYI C;  2FYU K;  2WTY A;  5BU8 B;  1HGZ A;  4ZKP A;  2J5U A;  5AW5 B;  1BSH A;  2ZJS E;  5E79 E;  1X9V A;  1NTZ J;  4NPD A;  3EFF K;  1Q82 Q;  1BCC D;  5AW8 B;  1G2C B;  3M9H A;  2RN0 A;  4ZMD A;  1R8E A;  3MUD A;  1UUW A;  2NPS D;  5BU5 A;  1NTM J;  3BCC E;  2ZT9 D;  1K04 A;  1IFP A;  1GMJ A;  2A45 H;  3CCU P;  1ZRT E;  5TJH A;  1LP1 B;  4JBZ A;  1S72 P;  1OZH A;  2OTL P;  2JKV A;  1KYO E;  3GZX A;  1N7S A;  2WSC J;  1EDL A;  3LW5 H;  2BMR A;  2O3J A;  1RQV A;  2D2C B;  1RH5 B;  3P8C E;  1BE3 D;  2JEE A;  4WY4 C;  1DD4 A;  3RK3 C;  2LR2 A;  1BSN A;  5L8R J;  4QMA A;  1HJB A;  3QH9 A;  4JQ0 D;  1NYK A;  3D6Y A;  4Z1M H;  1KB9 I;  3RL0 D;  4KT0 J;  3BCC G;  3NFQ A;  2W83 C;  2FYU E;  2POH A;  2R5B A;  5CJ4 A;  2IX7 C;  1FU1 A;  1ZOY C;  2GUV A;  4L73 A;  1JY3 P;  3D89 A;  4HH2 A;  1ZRT D;  3CCJ P;  3HE4 B;  3WU2 E;  4P1C H;  1G1J A;  3H1L J;  4QCK A;  1KYO D;  1JNM A;  1AVY A;  1JM0 A;  2HYN A;  1KQF B;  3P7K A;  1LTB C;  1JCC A;  2OQQ A;  1KD1 Q;  1LTJ A;  1QVG O;  3R4Y A;  4GDO A;  1ZR2 A;  2JP3 A;  4NBE D;  2FYU D;  3MHV A;  1KOR A;  2E4Q A;  2Q3I A;  3VOP A;  4JPZ B;  1GL2 D;  1S5L X;  1FZE A;  2NPS A;  3M06 A;  3W68 A;  5KAF E;  2E74 D;  3CX5 H;  3C8V A;  3U1C A;  1L4A B;  1VQ4 P;  1M1J A;  4K3A A;  2H7H A;  2O01 H;  4I2L C;  4D6T J;  1CI6 B;  1MKM A;  1JCD A;  3L35 A;  3H32 A;  4N78 D;  3VMZ A;  1VM9 A;  3AE9 C;  3VCP A;  1RF1 B;  1P84 I;  1GTW A;  1SQB E;  2M5A B;  2YNY A;  3IF4 A;  2M0B A;  2J59 M;  2JO1 A;  2C9L Y;  1DEE G;  3L75 E;  1ULI A;  2E75 C;  1JTH A;  1N73 C;  3FWN A;  1J1E B;  1W5C E;  3G9R A;  1O7W A;  1KIL E;  1L0L K;  2OAR A;  1OXZ A;  4IOI H;  1L4A C;  5B66 H;  2KOG A;  1YQ4 C;  1JOC A;  1LWU A;  5APQ A;  2Y9Z A;  3AE5 C;  3A2A A;  4GOD A;  2HOD B;  1SQB G;  2YO2 A;  4BRY B;  3CL3 D;  3GB4 A;  3II6 A;  2BMQ A;  5KLI B;  3GMA A;  3PHL A;  2G3A A;  3L72 G;  4A7P A;  1Q7Y Q;  1LJ2 A;  1SQV E;  3NMD A;  3L75 G;  2AXT E;  1BCC J;  1RF1 C;  3N4X A;  1GL2 A;  3AE2 C;  1OVV A;  1RF0 A;  2QJY B;  2Q9I A;  2NZ2 A;  2ZXE B;  1GU5 A;  1DD3 A;  2YFJ A;  1LNQ A;  3M0A A;  2JZA A;  4JYB A;  1RE3 A;  1G1I A;  1J1E C;  1VQL P;  2C9N Y;  2YKO A;  3L70 G;  4EYY Q;  1BDD A;  1SQP K;  1SQQ J;  1FDM A;  1BE3 J;  3B5N D;  2E4P A;  2HMN A;  1SQV G;  2JWA A;  1L2P A;  2AXT H;  2IYO A;  1L0L E;  2XSO A;  1SQV D;  1ZXG A;  3H1K G;  4NPE A;  2FFD B;  5KLI C;  1SFC B;  3G3Z A;  3CD6 P;  1VF5 B;  3E1R A;  1KQG B;  2QJP C;  1UIX A;  1NHL A;  1YJN P;  1LT9 B;  4EI2 A;  1PZQ A;  1K8A Q;  5B5E E;  3EN1 A;  3L36 A;  4AIV A;  5APU A;  4P1B H;  2FYZ A;  2IBZ G;  3GHG B;  3RBZ A;  3JCU E;  1KC8 Q;  5KJ7 C;  1YI2 P;  2XKM A;  3PJS K;  2WIT A;  3EQQ A;  1MV8 A;  1L0L D;  4ASV A;  3AE6 C;  2Z5H A;  2PFX A;  4IFD K;  1M1K Q;  3L73 D;  1U57 A;  3HE5 B;  1NJI Q;  5AW0 B;  5KLV G;  3A5T A;  2FYU J;  4C46 A;  2KI7 B;  3CI9 A;  1FDO A;  2KS1 A;  3GL2 A;  2KSE A;  3IN6 A;  4I7Z B;  1SQX G;  1NOH A;  4GOE A;  1FZF A;  1NH4 A;  1VQO P;  2Q3E A;  1FQT A;  3CWB E;  3TYY A;  3MIW A;  2FFD C;  1IK7 A;  1SFC C;  1OFC X;  1XTC C;  1VL2 A;  1N2D C;  4NBF D;  1VF5 C;  1VQK P;  3TSI A;  2NUM A;  3JCU H;  2R44 A;  2IDB A;  1QX8 A;  2KLV A;  5K5G B;  1Q81 Q;  4W7Z A;  3D71 A;  2Y9Y A;  5AW2 B;  3KPE A;  2BAS A;  1LGH B;  1W2B O;  3HUS B;  4HM3 A;  3GHG C;  4IL6 E;  3NTN A;  3CLQ A;  2AXC A;  4OH8 B;  3OAK A;  3A0B H;  1IJD B;  1Q90 C;  1AQ5 A;  2NVG A;  2FKW B;  1ZW0 A;  1SQP D;  2E5T A;  4KHX A;  2KZI A;  3PTZ A;  3CWB G;  3CC2 P;  4PV1 C;  2BCC E;  2AEF A;  3MTU E;  2KZJ A;  3VCA A;  3TNU A;  3BVH A;  3VP9 A;  3BAS A;  3Q5P A;  4BXL A;  3OA7 A;  1PFI A;  1IK9 A;  3AE1 C;  3T97 A;  2XRX A;  3I56 P;  4NPF X;  3MGN A;  1EDJ A;  2GBX A;  4Y28 J;  1JY2 O;  1LTS C;  4AQR D;  3TGU E;  1YQ3 C;  2Y0D A;  2QVA A;  1N8R Q;  4TT3 H;  2OYI B;  3HUS C;  1JMM A;  2BCC G;  4DJG A;  2D2C D;  5APT A;  1SS1 A;  1N7S D;  2LXB A;  2HLO A;  5H2F E;  2KNC A;  1KYO I;  4OGQ B;  3H25 A;  2B1X A;  4I1L A;  2O1J A;  1E79 H;  5AVW B;  1NAY A;  2KLU A;  3CCR P;  3O6Q B;  2NRG A;  2C0W A;  1HWT C;  1IFN A;  5GTI H;  4U7J A;  3TGU D;  2QJK B;  2XZR A;  3E7K A;  3WUV A;  2K37 A;  3GOB A;  2DE5 D;  4U3F J;  1YTZ T;  5H2F H;  1JY3 O;  1ZLL A;  1WMK A;  1IFM A;  3RK3 B;  4I6M C;  2ZVN B;  1IFD A;  3PH0 A;  4DZO A;  2HMO A;  3IAO A;  2HMJ A;  1BGY E;  4H44 B;  1TU3 F;  1D7M A;  3EWK A;  4H13 B;  4OGQ C;  1S2E A;  2XR8 A;  1T8Z A;  4PD4 E;  1R5S A;  2N1T B;  2HG5 D;  4QDF A;  1KZU B;  1YHQ P;  2IYP A;  3Q5S A;  1L4A D;  3MP7 B;  3GL0 A;  3KXD A;  1LP1 A;  2CPB A;  1UII A;  2A45 G;  3KDP B;  2W8Z A;  4OWF A;  1VCK A;  2OYH B;  2OGU A;  2QG4 A;  3L73 J;  3VMY A;  3NXS A;  4NB8 D;  2QJK C;  2Q7C A;  1QGK B;  1PGQ A;  4HM5 A;  2KK7 A;  4YPC A;  1BGY G;  1USE A;  1E5W A;  3CCQ P;  3V2R A;  3M0D A;  1JM1 A;  4QDC A;  1IC2 A;  3VMI D;  3CXH H;  2OYO A;  1FZC C;  2ZYD A;  2KSJ A;  2XDJ A;  4PD4 H;  3H1H E;  4H44 C;  1SLQ A;  2XV5 A;  5CXM A;  1EC5 A;  1VQ5 P;  3GTE A;  3L71 E;  5KTB A;  3H6P A;  2BEZ F;  4H13 C;  2HPC B;  2PRR A;  1FDI A;  3HE4 A;  5KAI E;  2N1T C;  3BCC D;  1FOS F;  1R5L A;  1X22 A;  1U7J A;  1RHZ B;  1IZN B;  1T2K C;  3LID A;  3HRN A;  4L76 A;  5APY A;  4UB6 E;  1DEB A;  3CX5 E;  3V4Q A;  1SQP J;  4H0L B;  1S5L H;  1LT1 A;  1SQB K;  3N0Q A;  3PLN A;  3L74 E;  1GW4 A;  2OYH C;  1NU1 E;  4W7Y A;  3MD0 A;  2SPZ A;  3P8C D;  3H1H G;  1H88 A;  3AEB C;  2GUS A;  3B8E B;  2HMK A;  2JO6 A;  2A06 E;  2YVJ B;  3L71 G;  3G71 P;  1FJP A;  1NTK G;  2E76 C;  2QSI A;  4TLF A;  3L71 D;  1HBW A;  4RKU J;  4UB8 H;  2AEM A;  4XFJ A;  5KAI H;  2E75 B;  1N73 B;  4QUP A;  1L4A A;  3CC4 P;  2KUB A;  1GK4 A;  4UB6 H;  2FXP A;  2N9Y B;  3L74 G;  1URQ B;  3Q3D A;  1NU1 G;  3CMA P;  2M3B A;  1VQP P;  1RY3 A;  1EZV G;  4LGD E;  2HMM A;  1CI6 A;  3JSV C;  1SQV K;  3CC7 P;  3H1J E;  2A06 G;  4H0L C;  5B66 E;  1RF1 A;  2H88 C;  1RQU A;  3GF7 A;  1PP9 E;  2ZT9 B;  2M5A A;  3USS A;  2IPP A;  1JY2 N;  1PPJ E;  1L0N E;  3KHU A;  1KQL A;  3U59 A;  1A02 F;  4HJL A;  4HM1 A;  2WQY C;  4EIJ A;  4NBH D;  3TGU J;  4JYC A;  3L72 E;  1RFS A;  3EFG A;  1UUV A;  3V5B A;  1KB9 E;  1NDO A;  1IFI A;  1KV4 A;  3H1J G;  1USD A;  2R3C A;  3GW6 A;  3AE7 C;  1URQ C;  3RL0 B;  2HOD A;  2XNX A;  2W6A A;  1PP9 G;  5CCH D;  2YKQ A;  1KQS O;  2Q6Q A;  4BRY A;  2Q3W A;  1PPJ G;  3CCE P;  3V2N A;  1L0N G;  2WSE J;  5KLV K;  4EOT A;  4R4L A;  5AVR B;  3WMM 0;  3L70 E;  2J58 A;  4NBG D;  3GTS A;  1L0N D;  3EQ2 A;  3JC2 2;  1SQB D;  1VDF A;  1SQX K;  2HR3 A;  5AVV B;  2NPS C;  1LTA C;  1OMI A;  1M7L A;  2ZT9 C;  3H1I E;  3VYI A;  3L72 D;  2B87 B;  1JY3 N;  2QJP B;  1KB9 H;  4ZKU A;  2Z5I A;  1QEX A;  1LWU B;  3L75 D;  1CZQ A;  3SFE C;  3VMX A;  3H1K E;  1CW5 A;  2WSF J;  1EDI A;  5KJ7 A;  1AJY A;  1KIL D;  1M90 Q;  1FJK A;  1AA0 A;  1PV3 A;  2PP6 A;  3IR9 A;  1G8K B;  4DT0 A;  3LW5 J;  2ITA A;  3GF3 A;  3L70 D;  3RL0 C;  2IBZ E;  4QUR A;  1HGV A;  3QWO C;  1JMB A;  2OTK E;  3H1I G;  2E43 A;  4NBC D;  4GKG A;  2V7Q H;  2MJZ A;  2FFD A;  1WT6 A;  1X8Y A;  1SFC A;  1NTZ E;  3AE8 C;  3RGU A;  2KIK A;  4IFM A;  2BEQ D;  3F5H A;  5AW7 B;  1RIE A;  1QL2 A;  2NWF A;  3ZDM A;  3BCC J;  2M8R A;  5CCG D;  5KLV E;  3AEE C;  3H1K D;  1NTM E;  1GU4 A;  1H89 A;  1LT9 A;  2YFI A;  1VQM P;  1SQX E;  3Q5R A;  1LWU C;  1EG9 A;  3GHG A;  1VPC A;  5C39 A;  5CCH A;  5M1B A;  1YIT P;  5CJ0 A;  1SJG A;  2IBZ D;  2ZXX A;  1NTZ G;  3HE5 A;  2FXO A;  1Y8A A;  4ASW A;  2FY8 A;  1GL2 C;  2KXP B;  1YJ9 P;  2R3S A;  1KFN A;  1XTG B;  2L91 A;  4PV1 B;  1P84 H;  2DE7 D;  1O7G A;  1NTM G;  3ITK A;  3RK3 E;  3A0B E;  4OGQ D;  3RL0 g;  1O7P A;  5KLV D;  3CME P;  4O9B A;  4YXW H;  1W2E A;  3RBX A;  1SQX D;  2KB7 P;  1KIL A;  1U7M A;  2E42 A;  5TIS E;  3GCE A;  2WSC H;  3H1L E;  4IFF A;  1HF9 A;  3S1K A;  1WQL A;  4DOJ A;  1ZP0 C;  2NUK A;  4RJT A;  2I1J A;  2O01 J;  2ZYL A;  3HUS A;  3PP5 A;  4N6J A;  4WWI A;  4HM4 A;  3R2P A;  3LIE A;  4AAY B;  4C7R A;  4CPG A;  4GT1 A;  2E5Y A;  4AYC A;  4LC1 A;  4HM2 A;  4WY4 D;  3HTK B;  3RK3 D;  1AQT A;  2YIU B;  5AVS B;  1CSB A;  2A45 I;  1ULJ A;  4H44 D;  4NBA D;  1OVU A;  5CCG A;  3B5N B;  2QM7 A;  5TIS H;  1H0T B;  3H1L G;  2K88 A;  1LTT C;  3CWB D;  1GDT A;  2QEX P;  3GZY A;  3H1L D;  5KKZ B;  3L4F A;  1Y47 A;  3CCS P;  1LTG C;  1S1C X;  1RE4 A;  3GKE A;  2HFE D;  5APX A;  1MFT A;  4D6T E;  1GZL A;  1OW8 A;  2CPS A;  5DJU B;  2GM4 A;  3SWY A;  3A3Y B;  5GTI E;  2QE7 H;  2OYI A;  3SWK A;  1SQB J;  4K35 A;  1Q2N A;  2CKF A;  2WT7 B;  1YJW P;  2C0X A;  3WUT A;  2IZ0 A;  1FE6 A;  3L72 J;  4QUQ A;  3L75 J;  2BCC D;  2HML A;  3A0H E;  1S3J A;  5AVT B;  3KZI H;  2YIU C;  1HJ0 A;  3BAT A;  2KP8 A;  1M57 D;  3O6Q A;  1G8J B;  1J1D C;  3B5N C;  2RMZ A;  4D6T G;  2QM8 A;  3S9O A;  2ZFC A;  1AV1 A;  5KKZ C;  4C7N B;  3AEA C;  3HD7 B;  1BDC A;  1PIX A;  3L70 J;  1AFO A;  3AE4 C;  4IL6 X;  1S4X A;  2YKP A;  2K9J B;  2O01 N;  4H0L D;  2V4H A;  3RK2 B;  1SQV J;  4WY4 A;  1O7M A;  2JJL A;  5CMZ A;  3A0H H;  4AUW A;  1BCC E;  3PRJ A;  2OTJ P;  1JB0 J;  1FZC B;  3SSU A;  3H1K J;  1NTK K;  4L75 A;  2W27 A;  3M9Q A;  2H89 C;  1KMI Z;  2QA4 P;  1PGP A;  2P10 A;  1FAV A;  2N1T A;  1FOS E;  5CHX A;  3CXH E;  2E75 D;  1G2C A;  3I55 P;  3OW2 O;  1YTZ I;  4XE5 B;  2Q5U A;  5CBO A;  1FZB A;  1SQQ E;  4HJG H;  1NU1 K;  1YYC A;  1BE3 E;  3AEG C;  2OYH A;  1URQ D;  2FYN B;  2YXR B;  4HYT B;  3M91 A;  1L0L J;  3HD7 C;  2FBW C;  2R5D A;  1BCC G;  1JY2 P;  4EMJ B;  1QVF O;  3C0D A;  1NVO A;  4JF7 A;  1MZ9 A;  2WPR A;  1GW3 A;  5GTH E;  3RK2 C;  4QDF B;  5KLV J;  5AW1 B;  2H43 A;  2WSF H;  1S5L E;  1BGY D;  4XA4 A;  2JDI H;  1KFM A;  1X79 B;  1OWA A;  2E76 B;  1SQX J;  2MKV A;  2QIW A;  2P1J A;  1NGM B;  3CXH D;  3Q2Y A;  1SQQ G;  4EDF A;  4PD4 D;  1MUU A;  1BE3 G;  2HPC A;  1EQ7 A;  4Y99 C;  2P58 A;  1VQ6 P;  4L74 A;  3V2Q A;  2P2U A;  1SQQ D;  1N7S B;  4HB1 A;  3FGA D;  3W67 A;  1NTK E;  3B4S A;  5E79 H;  4UB8 E;  5AVQ B;  5AW4 B;  3E1I A;  2YMY A;  3S4R A;  2LXC B;  5GTH H;  3BRV B;  3FX0 A;  2YXQ B;  2FXM A;  2FYN C;  1L0N K;  1HH0 A;  2P7J A;  2VRS A;  4MN4 C;  2K9Y A;  3OJA B;  5AVX B;  2PGD A;  2Z4E A;  1OX3 A;  1GK6 A;  2XU6 A;  3AE3 C;  1EZV E;  3CWB J;  1OIP A;  2ZYG A;  1KYO H;  5AVY B;  3H1H D;  1ZR4 A;  1QLE D;  4N3Y B;  3MUD C;  1FBM A;  3M9B A;  1Q86 Q;  1N73 A;  2W6B A;  3KQG A;  2W6J H;  3CPW O;  1VQ7 P;  1NTK D;  4N78 E;  3U1A A;  2YMK A;  1URQ A;  5AVU B;  3G6E P;  2WPQ A;  2D2C C;  1VQN P;  1N7S C;  4DCK A;  3M0D C;  3VP8 A;  2FYU G;  5KJ7 D; 
#chains in the Genus database with same CATH homology
 2NVG A;  3GF3 A;  2J5U A;  2IBZ E;  4QUR A;  3AZC A;  4NBC D;  1NYH A;  4PV1 C;  3FOU A;  2BCC E;  1NTZ E;  3VCA A;  3DQY A;  3AE8 C;  2I7F A;  2BEQ D;  1RIE A;  3Q5P A;  2NWF A;  3AEF C;  1R8E A;  1UUW A;  5KLV E;  3BCC E;  3AEE C;  2ZT9 D;  1K04 A;  1NTM E;  1GMJ A;  3AE1 C;  1EXJ A;  2YFI A;  4NBB D;  1ZRT E;  2XRX A;  3SFD C;  3Q5R A;  1SQX E;  2GBX A;  1VF5 D;  4Y28 J;  2B24 A;  4YTP C;  1EG9 A;  3TGU E;  1YQ3 C;  1KYO E;  3GZX A;  2WSC J;  2BMR A;  5M1B A;  1RQV A;  2D2C B;  4TT3 H;  1SJG A;  2D2C D;  1DD4 A;  1EXI A;  5L8R J;  1Q90 D;  1NYK A;  4HKV A;  4OGQ B;  3D6Y A;  2XSH A;  3H25 A;  4Z1M H;  4PV1 B;  2DE7 D;  2B1X A;  1O7G A;  4KT0 J;  3RK3 E;  4OGQ D;  3RL0 g;  2FYU E;  1O7P A;  4PV1 D;  3ABV C;  1ZOY C;  3D89 A;  4HM7 A;  4P1C H;  3GLM A;  3GCE A;  4U7J A;  4QCK A;  3H1L E;  1HF9 A;  1WQL A;  2YFL A;  1ZP0 C;  3GOB A;  2NUK A;  2O01 J;  2ZYL A;  2DE5 D;  1KQF B;  4U3F E;  4HM4 A;  2OQQ A;  1OW7 A;  4AAY B;  1WMK A;  3R4Y A;  4GDO A;  2HMO A;  3IAO A;  2HMJ A;  5AEW A;  4H44 B;  4HM2 A;  1TU3 F;  2JP3 A;  2E74 B;  4NBE D;  1KOR A;  2E4Q A;  3EWK A;  1ULJ A;  1S5L X;  4H13 B;  4H44 D;  4OGQ C;  4NBA D;  2XR8 A;  5BOK A;  2E74 D;  4PD4 E;  1O7N A;  3C8V A;  4QDF A;  3GZY A;  1PL5 A;  3Q5S A;  1P84 E;  3GL0 A;  1S1C X;  2WPV B;  3GKE A;  4QDD A;  1VCK A;  1MKM A;  1O7H A;  4NB8 D;  2QJK C;  3L73 E;  1OW8 A;  4HM5 A;  5AEU A;  1VM9 A;  3AED C;  3AE9 C;  3VCP A;  1JM1 A;  4QDC A;  2CKF A;  1SQB E;  3VMI D;  3D6Z A;  1ZME C;  4QUQ A;  3H1H E;  2JO1 A;  2HML A;  4H44 C;  2QJY C;  3L75 E;  1ULI A;  2E75 C;  2E74 C;  5CXM A;  3GTE A;  2YIU C;  3L71 E;  2BEZ F;  3G9R A;  1HJ0 A;  4H13 C;  1O7W A;  1KIL E;  3O6Q A;  1G8J B;  1FDI A;  3S9O A;  1YQ4 C;  5KKZ C;  3AE5 C;  3AEA C;  3CX5 E;  1PIX A;  4H0L B;  3AE4 C;  1SQP E;  3N0Q A;  4IL6 X;  3L74 E;  1OW6 A;  3GB4 A;  1NU1 E;  2BMQ A;  4H0L D;  3GMA A;  2G3A A;  1O7M A;  3AEC C;  1SQV E;  3AEB C;  2HMK A;  2JO6 A;  2A06 E;  1BCC E;  3AE2 C;  2YVJ B;  1K05 A;  1JB0 J;  2E76 C;  2QSI A;  2BMO A;  2G8Y A;  2H89 C;  2NVF A;  4RKU J;  4XFJ A;  1KMI Z;  2E75 B;  2NZ2 A;  2P10 A;  2QPZ A;  2GBW A;  4QUP A;  1DD3 A;  2YFJ A;  3CXH E;  2JZA A;  2E75 D;  2FXP A;  4R4M A;  4H13 D;  1SQQ E;  3Q3D A;  2E4P A;  1BE3 E;  4HM0 A;  3AEG C;  2HMN A;  2HMM A;  4YXD C;  3H1J E;  2FBW C;  1L0L E;  2XSO A;  3B71 A;  1KTM A;  4EMJ B;  4H0L C;  3C0D A;  2H88 C;  1RQU A;  3GF7 A;  1PP9 E;  2ZT9 B;  4I7Z C;  5KLI C;  1PPJ E;  4QDF B;  1L0N E;  1VF5 B;  2E76 B;  1KQG B;  2MKV A;  2QJP C;  4HJL A;  2QIW A;  1UIX A;  4HM1 A;  2WQY C;  1NGM B;  4NBH D;  3L72 E;  3T97 B;  1RFS A;  2E76 D;  3Q2Y A;  3EN1 A;  1UUV A;  4AIV A;  4P1B H;  1KB9 E;  1NDO A;  3FGA D;  1NTK E;  3AE7 C;  3EQQ A;  3VMG D;  3AE6 C;  3VMH D;  3Q1M A;  4HM8 A;  2Q3W A;  1U57 A;  2NVE A;  2FYN C;  1Y9B A;  2WSE J;  4R4L A;  3L70 E;  2K9Y A;  4NBG D;  3GTS A;  1FDO A;  3GL2 A;  3IN6 A;  4I7Z B;  3AE3 C;  1OMI A;  1EZV E;  2ZT9 C;  1DIP A;  2V7Q J;  1FQT A;  3CWB E;  1IK7 A;  3H1I E;  1VL2 A;  4NBF D;  1VF5 C;  2NUM A;  3SFE C;  2IDB A;  4HM6 A;  3H1K E;  3D70 A;  2WSF J;  3D71 A;  1AJY A;  5HL4 A;  2DE6 D;  4NB9 D;  2YMK A;  2D2C C;  4HM3 A;  1PV3 A;  4NBD D;  1G8K B;  1Q90 C;  3LW5 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...