2D2CD

Crystal structure of cytochrome b6f complex with dbmib from m. laminosus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
168
structure length
168
Chain Sequence
DMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Intraprotein transfer of the quinone analogue inhibitor 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone in the cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 16
structure length 168
sequence length 168
chains with identical sequence Q
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2005-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2d2cD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2d2cD02
1SQPE 1PP9E 4NBGD 4HM4A 1JM1A 2GBXA 3H1JE 4NBHD 1NTME 2HMOA 2HMMA 2NVEA 5AEWA 4NBDD 4NBAD 1BCCE 1NTKE 3GTSA 2NWFA 2JO6A 2QJYC 3L72E 2E4PA 2B1XA 1FQTA 3CX5E 2ZT9C 2NUKA 4PV1D 4QDFB 2FYUE 1RIEA 4HM0A 2YIUC 2JZAA 3VCAA 3H1IE 5KKZC 2HMJA 4AAYB 2HMNA 2CKFA 4HKVA 4OGQD 1G8KB 1Q90C 3H1HE 1ULIA 1O7WA 1SQVE 2QJKC 4NB8D 4AIVA 1EG9A 1O7MA 2A06E 1UUVA 2XSHA 3L70E 5CXMA 3L74E 2YVJB 1BE3E 2XRXA 4HM8A 1SJGA 2NVGA 1O7GA 2XR8A 2BMQA 2YFLA 3GB4A 3L71E 3VMHD 1O7NA 4H44D 3GKEA 2NVFA 2BMOA 1ULJA 3L75E 1RFSA 2E74D 4QDDA 2E76D 4PV1C 4H13D 3GTEA 3VMGD 4EMJB 4P1CH 2Q3WA 3VCPA 2HMKA 2E75D 1WQLA 5BOKA 1EZVE 4OGQC 1O7HA 3TGUE 4NBCD 4QURA 4HM1A 5KLIC 3CXHE 4HM3A 4P1BH 2YFJA 4HM5A 2D2CD 1KYOE 2DE7D 4NBED 2QPZA 1NYKA 3D89A 4QUPA 4H0LD 1O7PA 1P84E 2YMKA 3AZCA 1L0LE 4H44C 4NB9D 1VCKA 3CWBE 2E74C 3GZYA 2E76C 2I7FA 4H13C 1ZRTE 2YFIA 3GOBA 4HM7A 4HM2A 1SQXE 3VMID 3GZXA 1VF5D 1G8JB 5AEUA 5HL4A 2B24A 1SQQE 1UUWA 2E75C 2FYNC 1PPJE 3GL2A 3H1KE 2NUMA 3BCCE 3EN1A 3GL0A 3N0QA 1NU1E 4NBBD 5KLVE 1NDOA 3GCEA 4PD4E 4QDFA 3FOUA 4U3FE 2XSOA 3H1LE 2E4QA 1L0NE 2BMRA 2IBZE 4HJLA 2D2CC 2HMLA 2ZT9D 1KB9E 2GBWA 4H0LC 3EQQA 4I7ZC 4HM6A 4QDCA 2BCCE 2ZYLA 4QCKA 4QUQA 3L73E 2DE5D 1NTZE 3DQYA 2DE6D 2QJPC 1SQBE 1VF5C 1VM9A 4NBFD 3C0DA
chains in the Genus database with same CATH superfamily
2HR3A 2KS1A 2FYNB 4GOEA 1SQVK 1BCCE 2WSFH 1FJKA 4LC1A 3KXDA 4ZKUA 2ZFCA 1NTMK 4HM0A 1AQTA 2JEEA 4TT3H 3HTKB 1Q2NA 3AECC 4GIFA 2A06E 3VTPC 1MFTA 1RH5B 2NPSA 1Q86Q 2GUVA 2E42A 2XR8A 3H32A 2Q6QA 2FFDC 3NXSA 3OA7A 2R3CA 3QH9A 2E76D 3VMGD 1HH0A 3MUDC 1KORA 5APYA 1M56D 1KB9H 3TGUE 3VMAA 2J59M 3TYYA 5EFWB 3B5NC 2YKPA 3WUVA 3RK2B 2WQYC 3L72J 3TF5A 2I7FA 4H13C 1SLQA 1QL2A 1SQXE 2Z5IA 1RQVA 1XTGB 1SFCA 4Y28J 3EN1A 5KLVE 1NDOA 2ZXEB 1NKZB 1SQVJ 3G6EP 5AW8B 3L70J 3W67A 1NVOA 3M9HA 1KQFB 4IL6X 5CMZA 4QCKA 4IFMA 3L75J 3CMAP 3B4SA 1X9VA 1EDJA 2IZ0A 2LXCB 3T97A 1RE3C 3VMZA 2WPQA 3H1JE 4ZKPA 3FX0A 2NUKA 5BU5A 1N7SD 4L74A 4XFJA 1KFMA 2YIUC 2L91A 4YXDC 2HMJA 2HFED 2CKFA 3D6YA 4L73A 3CX5I 1H0TB 4WVZA 2XNDH 4DJGA 1ZMEC 1CSBA 5APSA 1NU1J 3L71E 1N73B 4U3FJ 4WY4C 3U59A 2YKOA 2WSSH 5B5EH 1YYCA 3HUSA 2FYUG 4I6MC 1GL2C 1KD1Q 3H1IG 1JMBA 2KNCB 2WZ7A 1IK7A 1KILA 3AZCA 3AE4C 2Z5HA 2E74C 2HPCB 1GTWA 5CCGC 3S1KA 3SWFA 3GHGB 1RE4C 3BVHA 3CC2P 1EZVG 2OYIB 3HTKA 1KB9E 1BE3J 4H0LC 3KQGA 3H1LG 3P8CE 4EYYQ 2FXOA 3L73E 1JMMA 2A45I 2ITAA 1L0LG 1FE6A 2YXQB 1LTGC 2P2UA 2GBXA 1NTME 1DH3A 5KJ7A 5AEWA 4NBDD 1URQC 1FZCC 2Q7CA 2V7QH 1BGYG 3AE8C 1NTKK 4AAYB 1L0NG 2HMNA 2K37A 2L5GB 1W2EA 2KI7B 2P58A 5APUA 4W80A 1PGOA 1G2CA 3B5ND 1SQBG 2V7QJ 3Q5SA 1VQMP 1RFSA 4H13D 1ZOYC 2IFNA 1N2DC 5AW0B 3L72D 3AE2C 1KB9D 4RJTA 3P8CD 3TGUG 1SQVD 2YFIA 4HM2A 2ZYGA 3L70D 3G4SP 1G8JB 3PJSK 3AE9C 2W6JH 3L75D 1JUNA 1SQXG 3LW5H 1FU1A 2WPVB 2XSOA 4AYCA 1L4AB 4N78D 1QEXA 3NFQA 3C9IA 5AVWB 3PRJA 1A02J 4PD4I 1H0TA 2N1TC 2RH0A 4D6TE 3DQYA 1J1EB 2DE6D 2O1JA 1RHZB 1JY2N 3LW5J 2IFMA 1N73A 1P84D 3CWBG 5AVRB 4OGQB 1RF1C 2Q9IA 2M5AB 1S3JA 3CI9A 4WY4D 3R2PA 3H1JG 1J2JB 1ZR2A 2Q1KA 1NU1D 1Y9BA 4U3FD 1AVOA 2P7JA 5AW3B 3KHUA 4I7ZB 1YJ9P 2IBZD 1GL2D 2QE7H 1FC2C 4IFDK 3SSUA 1CI6A 3BCCJ 1NHLA 2G8YA 2HPCA 1LTSC 4UB6H 2H88C 2E74D 2QVAA 1HF9A 1IFDA 5CCGD 4P1CH 2Q3WA 3L71G 1SFCC 2BCCJ 4GOFA 1RY3A 2YFJA 1MUUA 2M3BA 1PP9J 5AW7B 4H0LD 4ASVA 2YMKA 4H44C 3OW2O 4BXLA 1LTIC 3L74G 3JC22 3RK3C 1BE3D 5HL4A 4BRYB 3H25A 1K73Q 3FXEA 1LT1A 1URQD 3E7KA 2LKMA 3M9BA 2Z4EA 2D2CC 1OVRA 1Y47A 5CJ0A 2BASA 4Y99B 5CCHA 2Y0DA 1K9MQ 4JYBA 3S9OA 1PV3A 1U7JA 1KN7A 2B88A 1EDIA 3VP8A 2E75B 3L73G 1MZ9A 3SWKA 1W5CE 5APQA 1ZRTD 1NTKE 1AQ5A 5KLIB 4QDFB 1PPJD 3G71P 1WT6A 3VCAA 1S72P 1L0LJ 3JCUH 2A45G 5AVTB 3CCSP 2POHA 1E79H 2O01N 3V2QA 4HM8A 1FDOA 1O7GA 5L8RJ 1VL2A 3GKEA 1IFNA 1KILC 1LJ2A 2PAJA 1HVVA 3A3YB 1D7MA 1L4AA 4NBCD 2ZVOB 1NO4A 3H6PA 2QJKB 2DE7D 3W68A 3OJAB 3CXHI 1X22A 2N1TD 4IL6H 2LXBA 4JPZB 1KYOI 1FDIA 3VN0A 3CPWO 4UB6E 3AEDC 2M5AA 3RK3E 3V2PA 3GL0A 1ZLLA 1IJDB 5AW9B 5KJ7C 4EI2A 3L4FA 3B8EB 1JB0J 3RL0C 1NOHA 3D6ZA 1NGMB 2YKQA 2K9YA 3KPEA 3P7KA 5KAFH 2K1AA 1SP4A 2QJPC 1QX8A 2E76B 3MIWA 3RK2C 2NVEA 1LWUA 1HJBA 3GTSA 3A0BH 4R4MA 5B66H 2YMYA 3CCMP 5DJTB 1RIEA 2WVRA 1QL1A 3BCCD 1SFCD 1IC2A 2AXTE 5CXMA 2YVJB 2H7HA 3H1KJ 1NTZG 4OH8B 2BCCD 2P1JA 1PZQA 2Y0CA 4H44D 3RBZA 2H8PD 4BRYA 1EDKA 3GTEA 1PP9D 1HTLC 5AW5B 3RK3D 5DJUB 1T6AA 2KYVA 5AVYB 1LTJB 2FYUD 2C9LY 1SQQK 1VF5B 3JCUE 2D2CD 2OYHB 1VQPP 3D89A 2BEZF 4RKUJ 1VCKA 3WUUA 1N7SB 1LGHB 2R5BA 1N73C 1X79B 2QRXA 2ZYAA 3WUTA 3SFEC 4QDFA 5KAIH 3RGUA 1SQPK 3L74J 1NU1K 3KZIH 3EQQA 1EZVD 2E43A 1LT9C 3AE5C 1G2CB 4NPEA 3CC7P 5CHXA 1GW4A 4U7JA 2M0BA 1PGJA 2CPSA 1NYHA 4HM4A 1L0LD 4IL6E 2QSIA 3H1HJ 2RKLA 1JY3N 1DIPA 3K5BA 1KILD 1OMIA 1ZP0C 1NTKG 3A5TA 3GHGC 1P84H 3EQ2A 3MGNA 2K3RA 2OYIC 1EG9A 1SQQJ 5KAFE 2YFLA 1ZW0A 1S5LX 2NZ2A 1SQBD 4QDDA 1M1JA 3A0BE 5AVXB 5B66E 2RN0A 1S1CX 3PLNA 1RF0A 5KJ7D 3M0AA 1SQPJ 3RL0D 2QPZA 4NB9D 1KQGB 2FFDB 2CK3H 2B87A 1WMKA 5AVSB 5APWA 2IZ1A 4I2LC 2OYOA 3D71A 3M91A 4NBBD 4JF7A 2IX7C 3RK2D 2R5DA 5GTHH 1E5WA 1N8RQ 1QLED 3Q5RA 1CI6B 2YXRB 2AEMA 4Z1MH 3SWYA 3M0DA 4LLHA 2BEQD 1KB9I 2R3SA 1T2KC 2ZXXA 1NAFA 1JY2P 5AW1B 4NBHD 2HMOA 4HB1A 1K05A 3L72E 2XDJA 4PD4H 1PL5A 1LTJA 3H1KD 2XV5A 2PP6A 2VRSA 3H1HE 4M3LA 3VYIA 1SQVE 1L4AC 3KZIE 2OYHA 2ZJSE 1AV1A 4KJMA 3L70E 1NKNA 3HD7B 1KMIZ 3TSIA 1VQ9P 2BMQA 1A02F 2Y9YA 3GB4A 2BMOA 3L75E 1N7SA 1FDMA 1J1EC 4A7PA 1IZNB 4EMJB 4N78E 1YITP 1BCCG 2W90A 1GD2E 4OGQC 3CX5D 3C8VA 1NTZJ 5TISH 1GW3A 1KTMA 1P84E 4TLFA 3EFGA 2A06G 3N4XA 2KB7P 1NAYA 2AEFA 4HM7A 3L74D 2IBZI 2HYNA 1W2BO 3GZXA 4WY4B 2H43A 1M90Q 4KHXA 3V6IA 1SS1A 1NU1E 3VMYA 2CPBA 1OVUA 4U3FE 2E4QA 4JYCA 3AE3C 1VQ5P 2IBZE 1OX3A 3CCVP 2QIWA 3H1HD 1XTCC 1LP1B 1R5SA 4YXWH 2K88A 5H2FH 3GW6A 1BSNA 1GMJA 3WU2H 5B5EE 1WRGA 2AEJA 1H89A 1VQNP 1SQQD 5KLVG 5GTHE 2PGDA 1OVVA 4H0LB 1AA0A 2FYUK 1GK6A 2OTKE 2WSEH 1U7MA 4Y99C 1BE3E 1SJGA 2FFDA 3A0HH 2NPSC 3N7NA 2H89C 4YTPC 1SQPD 3QWOC 2HMKA 1JM0A 2KZIA 5BOKA 2WSEJ 4KT0J 3AEEC 2KK7A 5KLIC 2GUSA 4HM3A 2W8ZA 3I55P 4QUPA 1NYKA 2SPZA 3IF4A 1N86A 1ZRTE 1LWUB 1OWAA 3CCRP 3GF3A 4MN4C 3IR9A 1L0LK 1T2KD 1FAVA 1PPJE 1J1DB 4OVNF 1YIJP 2JJLA 3EWKA 2KUBA 2UWJE 2BMRA 1YJWP 3ABVC 2QM8A 1PGQA 1DEEG 2Y9ZA 3E1RA 1L0NK 1IFJA 2FXMA 3V5BA 1FZFA 2FYUJ 1L4AD 3HD7A 3C0DA 3H1IJ 3BATA 2HMMA 1SQBK 3AEFC 2NWFA 2E4PA 1OW7A 1VDFA 2Q5UA 5AVZB 2WITA 3IN6A 1MV8A 3AE1C 4PD4D 3U1AA 4HKVA 4OGQD 2AXCA 2N1TB 2N9YB 1JNMA 4B86A 1SQVG 5H2FE 1LTTC 1NTZD 4WY4A 3H1LJ 2WT7B 4PV1C 3WU2E 1NTMG 1GU4A 2GA1A 4O9BA 3L75G 2KSEA 3M06A 3HUSC 2RMZA 4BWNA 1JOCA 3F89A 1LP1A 5BU8B 1DD3A 5CJ4A 1KFNA 1BGYJ 4HKZH 1ZN5A 1L0NJ 2XKMA 3MD0A 4W7ZA 3ITKA 5CCGA 1KV4A 3A0HE 2ZT9B 3M0DC 4ZNCA 2FYNC 3FWLA 3G9RA 1T8ZA 5KKZB 1T3JA 3BCCE 1LNQA 1UIIA 1SQBJ 1RE4A 3MHVA 4C46A 2GBWA 4U3FG 4HM6A 1Q82Q 1LTJC 2Y0EA 4DZOA 2BCCE 2IBZG 1VF5C 4NBFD 4R4LA 1M1JB 2OYHC 1PP9E 3L36A 3CCLP 3RK3B 1USDA 3ZDMA 3TGUJ 2NPSD 5E79H 3E1IA 3I5CA 3UIAA 2O01J 1S5LH 1JY3P 2FYUE 3CLQA 4IFFA 2D2CB 3V2RA 2JZAA 3CCQP 3H1IE 2KSJA 3C1LA 2JO1A 4XA4A 2ZAEB 1SQXJ 2B87B 1S9KD 1VQ7P 3P32A 2DW3A 1S2EA 3B71A 4D6TG 2R44A 2B9BA 3CCJP 5KLVJ 1OW8A 2MKVA 2WPSA 2FY8A 1ULJA 3GG2A 1FJPA 1JCDA 1BE3G 1S4XA 2LR2A 1JY2O 4HYTB 3PH0A 1EZVE 3CWBJ 3R4YA 4L75A 1IK9A 1N7LA 1FZBA 2PFXA 3Q3DA 5K5GB 1U57A 1YHQP 3Q5PA 3Q1MA 3H1JJ 4QMAA 2HG5D 3L35A 4EIJA 1L0LE 1CW5A 1M57D 2QJYB 2KP8A 1AVYA 3KYQA 1HUCA 1KILE 2W27A 2B24A 1ZV8A 3CX5H 4AUWA 2G3AA 1BGYE 5AVUB 2FBWC 3CC4P 1L0NE 3A7OA 1FZAA 3H1ID 1PPJG 2HMLA 2NRGA 1M1KQ 3MP7B 1YQ3C 2P67A 3V2NA 2N1TA 2R32A 3L71J 3CXHD 2PRRA 1EC5A 4AQRD 4RO0A 5KTBA 4L76A 1KYOD 1SQBE 4NBGD 1YQ4C 1JEKA 2WSFJ 3BRVB 2IPPA 5APVA 2WT7A 4IOIH 1RF1A 1YBKA 3BASA 2V4HA 1USEA 2B1XA 4PV1D 3TK1A 2M3EA 2C0XA 4K35A 3RL0B 3PHLA 3H1LD 2OTJP 4NB8D 3O8ZA 3FWNA 2QJPB 2E5TA 2NVGA 3F5HA 2YO2A 3VMHD 3AE6C 2NVFA 3CCUP 5AVVB 1FOSE 2OTLP 5E79E 1NH4A 1BGYD 1BCCD 1O7HA 2A45H 1L0ND 1FZGA 1S5LE 1TU3F 4HM1A 3L73J 4DT0A 4PJ0H 3AE7C 4OWFA 1NTMJ 1PGPA 3CWBE 3GZYA 1IFPA 2KXPB 3GOBA 2A06D 4GDOA 1VF5D 1JO5A 1MKMA 3HD7C 3USSA 3H1KE 3OAKA 1LTBC 2ZYDA 4WBAA 1QVFO 1OFCX 2YO3A 1PIXA 3TNUB 4GKGA 1L2PA 3BCCG 1RQUA 1IFIA 5CCHC 3TGUD 1DD4A 1T3UA 2ZYLA 1GDTA 5M1BA 1M7LA 2BCCG 2WMMA 3BRTB 3WMM0 1NTZK 3LIDA 4DOJA 1SQXD 2W83C 4WB4A 1PP9G 3CX5E 1FQTA 3AEAC 2JWAA 2QG4A 5KLVD 4NPDA 3B5NB 3GLMA 1EXIA 1G8KB 2XZRA 1Q90C 1LT9B 1OZHA 3HE5B 4H13B 1Q81Q 1CZQA 1UUVA 3L74E 3CWBD 1FS0E 3P8MC 1YJNP 1K8AQ 4UB8H 2I8DA 2JDIH 2HODB 4ZMDA 3H1JD 5KAIE 3RL0g 2W6BA 1WQLA 1HGVA 1EDLA 5GTIH 5APTA 4D6TJ 1HGZA 1FBMA 2K9JB 1FZEA 1AFOA 3CCEP 3VMXA 1JTHB 4RESB 1M8OB 1KZUB 5AW4B 2QM7A 1HWTC 1NWQA 4N3YB 1SQQE 1P84I 1ZR4A 1VQ6P 2YIUB 3L71D 3IAOA 2OARA 1QGKB 4JQ0D 2OQQA 1OIPA 3GF7A 1X0TA 5AW2B 1VQLP 1ZXGA 1GU5A 1EQ7A 4I7ZC 5C39A 4PJ0E 1YTZI 2DE5D 1X8YA 1IO4A 2JP3A 2J58A 3G3ZA 1SQPE 3CL3D 1JM1A 3RBXA 1KQSO 3O6QB 2KIKA 2Q3IA 1Y8AA 3S4RA 2KOGA 2C9NY 1LWUC 1GL2B 3A2AA 3VOPA 3EFFK 3NMDA 4HH2A 4XE5B 1J1DC 2I1KA 2W6AA 1O7WA 5CBOA 2E74B 2C0WA 3KDPB 1DEBA 1BDCA 1DX7A 3L73D 2M8RA 1GK4A 5AW6B 3VCPA 1Z56A 1NTMD 3HD7D 1R8EA 4C7NB 4DCKA 4QURA 2QA4P 3TNUA 1BDDA 1JY3O 4P1BH 1VPCA 2KLUA 2OGUA 4NBED 2B89A 3SFDC 5CCHD 2FYZA 1UIXA 1NTKJ 1URQB 3VP9A 3MUDA 3HRNA 1FZCB 4C7RA 3NTNA 5AEUA 1BSHA 2E75C 3HE4B 1VQOP 2NUMA 4UB8E 3GCEA 4PD4E 1K04A 3LIEA 3B5NA 3H1KG 5GTIE 3TDKA 1QVGO 3D70A 4CPGA 3IFMA 1LT9A 3HE5A 2WPRA 4EDFA 2FKWB 1Q90D 1IFMA 1NTZE 2KNCA 2JWDA 2P10A 1NJIQ 2HLOA 4WWIA 2JKVA 2HODA 2JO6A 2ZT9C 2IDBA 1EXJA 3CXHH 5KKZC 1AJYA 1KYOH 5TISE 3GHGA 2IYOA 1ULIA 2K9JA 2FXPA 1LTAC 3JSVC 2QJKC 5TJHA 1RE3A 2OYIA 3PP5A 2E5YA 1VQ4P 1O7MA 4GODA 2XSHA 1OXZA 1JTHA 1R5LA 2XRXA 3PTZA 1OW6A 4D6TD 1O7NA 1YTZT 2KS1B 4HJGH 2I1JA 3CMEP 1M1JC 5APXA 3M9QA 3L72G 3CD6P 5BVZA 3AEGC 1RF0C 4HM5A 1PFIA 5CBNA 3H1HG 1O7PA 4JBZA 2GM4A 1HBWA 2O3JA 2AXTH 3L70G 3AEBC 2NPSB 4ASWA 3H32B 1RF1B 2E76C 2N9BA 1FOSF 2XU6A 3O6QA 1JCCA 3GMAA 3GL2A 1GL2A 3N0QA 2KZJA 2JR8A 1SQXK 5AVQB 1H88A 1SQQG 2IYPA 5KLVK 1S9KE 1VQ8P 2QEXP 1BCCJ 4QUQA 1SVFA 4LGDE 3V4QA 3V4WA 3I56P 1G1IA 1VM9A 4I1LA 2MJZA 1YI2P 4NBAD 1SFCB 4EOTA 2QJYC 1SQPG 2WWWA 1NU1G 4C7NA 4NPFX 2O01H 1VQKP 4H44B 2XNXA 1HJ0A 3II6A 2WSCH 4AIVA 2J5UA 1URQA 3T97B 1FZCA 4N6JA 3U1CA 1N7SC 3HE4A 2YNYA 2E75D 2WSCJ 1NTKD 1GZLA 4GT1A 3CXHE 4W7YA 1H8AA 1KYOE 1G1JA 3L37A 1EZVI 3FGAD 4K3AA 1Q7YQ 2Q3EA 3Q2YA 2O1KA 1KQLA 3VMID 4PV1B 3MZWB 3MTUE 1UUWA 2KLVA 3FOUA 3H1LE 3HUSB 4HJLA 1KC8Q 2ZT9D 1MFZA 2ZVNB 2WTYA 4YPCA 4QDCA 1KILB 3FXDA
chains in the Genus database with same CATH topology
1PV3A 1GMJA 5M1BA 2E75B 1BCCE 1NTKE 1FQTA 3CX5E 3AEAC 4QDFB 4HM0A 3VCAA 4TT3H 4H0LB 3GLMA 1EXIA 1G8KB 1Q90C 3AECC 4H13B 2A06E 1UUVA 3L74E 1BE3E 4HM8A 1FDOA 1SJGA 2XR8A 1O7GA 5L8RJ 1VL2A 3GKEA 2H89C 2E76D 3VMGD 4YTPC 1KORA 3RL0g 2HMKA 1WQLA 5BOKA 2WSEJ 4KT0J 3TGUE 4NBCD 3AEEC 5KLIC 4HM3A 2DE7D 4QUPA 1NYKA 2WQYC 2I7FA 1ZRTE 4H13C 1SQXE 3GF3A 1FDIA 1RQVA 1SQQE 3AEDC 1PPJE 4Y28J 3IAOA 3EN1A 3RK3E 3GL0A 5KLVE 1NDOA 3EWKA 2OQQA 2BMRA 1JB0J 3ABVC 3GF7A 3D6ZA 1NGMB 2K9YA 1KQFB 4IL6X 4I7ZC 4QCKA 2DE5D 2QJPC 3C0DA 2E76B 2JP3A 1SQPE 1JM1A 3H1JE 2HMMA 2NVEA 3GTSA 3AEFC 2NWFA 4R4MA 2E4PA 1OW7A 2NUKA 3IN6A 4XFJA 1RIEA 2YIUC 3AE1C 4YXDC 2HMJA 2CKFA 3D6YA 4HKVA 4OGQD 1O7WA 2E74B 5CXMA 1ZMEC 2YVJB 3L71E 4H44D 4PV1C 3GTEA 3VCPA 1R8EA 4QURA 4P1BH 1VF5B 2D2CD 1IK7A 4NBED 3D89A 1DD3A 3SFDC 2BEZF 3AZCA 3AE4C 4RKUJ 1UIXA 1VCKA 2E74C 2ZT9B 5AEUA 2FYNC 2E75C 3G9RA 2NUMA 3BCCE 3GCEA 4PD4E 3SFEC 1K04A 4QDFA 1KB9E 2GBWA 4H0LC 3D70A 3EQQA 4HM6A 3AE5C 2BCCE 3L73E 1Q90D 1NTZE 4U7JA 1VF5C 4NBFD 4R4LA 1PP9E 1NYHA 2P10A 4HM4A 2GBXA 2QSIA 1NTME 5AEWA 4NBDD 1DIPA 2JO6A 2O01J 2ZT9C 1OMIA 2FYUE 2IDBA 1ZP0C 1EXJA 2D2CB 2JZAA 3AE8C 5KKZC 3H1IE 4AAYB 1AJYA 2HMNA 2JO1A 1ULIA 2FXPA 2QJKC 1EG9A 1O7MA 2XSHA 2XRXA 3B71A 2YFLA 1OW6A 1OW8A 2MKVA 2V7QJ 1O7NA 1S5LX 2NZ2A 1ULJA 3Q5SA 1RFSA 4QDDA 4H13D 1ZOYC 1S1CX 1EZVE 3R4YA 3AE2C 3AEGC 3Q3DA 4HM5A 1U57A 2QPZA 3Q5PA 3Q1MA 1O7PA 1L0LE 4NB9D 1KQGB 3AEBC 2E76C 2YFIA 4HM2A 1WMKA 1KILE 1G8JB 2B24A 3O6QA 3AE9C 3GMAA 3D71A 3GL2A 3N0QA 4NBBD 2G3AA 2FBWC 2WPVB 2XSOA 1L0NE 2HMLA 3Q5RA 1YQ3C 4QUQA 4Z1MH 2BEQD 3DQYA 2DE6D 1SQBE 1VM9A 3LW5J 4NBGD 1YQ4C 2WSFJ 4NBHD 2HMOA 4OGQB 4NBAD 1K05A 2QJYC 3L72E 2B1XA 4PV1D 1PL5A 1Y9BA 4H44B 1HJ0A 3H1HE 4I7ZB 1SQVE 4NB8D 4AIVA 3L70E 1KMIZ 2J5UA 2NVGA 2BMQA 2G8YA 3T97B 3GB4A 3VMHD 2H88C 3AE6C 2BMOA 2NVFA 3L75E 2E74D 4EMJB 1HF9A 4P1CH 2Q3WA 2E75D 2WSCJ 4OGQC 1O7HA 1TU3F 4HM1A 3C8VA 3CXHE 2YFJA 1KYOE 3AE7C 1KTMA 3FGAD 4H0LD 1P84E 2YMKA 4H44C 3Q2YA 3CWBE 3GZYA 3GOBA 4HM7A 3VMID 3GZXA 4GDOA 1VF5D 5HL4A 4PV1B 1MKMA 1UUWA 3H25A 3H1KE 1NU1E 3FOUA 4U3FE 3H1LE 2E4QA 3AE3C 2IBZE 4HJLA 1PIXA 2D2CC 2ZT9D 1RQUA 2QIWA 4QDCA 1DD4A 2ZYLA 3S9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP E;  1PP9 E;  4NBG D;  4HM4 A;  1JM1 A;  2GBX A;  3H1J E;  4NBH D;  1NTM E;  2HMO A;  2HMM A;  2NVE A;  5AEW A;  4NBD D;  4NBA D;  1BCC E;  1NTK E;  3GTS A;  2NWF A;  2JO6 A;  2QJY C;  3L72 E;  2E4P A;  2B1X A;  1FQT A;  3CX5 E;  2ZT9 C;  2NUK A;  4PV1 D;  4QDF B;  2FYU E;  1RIE A;  4HM0 A;  2YIU C;  2JZA A;  3VCA A;  3H1I E;  5KKZ C;  2HMJ A;  4AAY B;  2HMN A;  2CKF A;  4HKV A;  4OGQ D;  1G8K B;  1Q90 C;  3H1H E;  1ULI A;  1O7W A;  1SQV E;  2QJK C;  4NB8 D;  4AIV A;  1EG9 A;  1O7M A;  2A06 E;  1UUV A;  2XSH A;  3L70 E;  5CXM A;  3L74 E;  2YVJ B;  1BE3 E;  2XRX A;  4HM8 A;  1SJG A;  2NVG A;  1O7G A;  2XR8 A;  2BMQ A;  2YFL A;  3GB4 A;  3L71 E;  3VMH D;  1O7N A;  4H44 D;  3GKE A;  2NVF A;  2BMO A;  1ULJ A;  3L75 E;  1RFS A;  2E74 D;  4QDD A;  2E76 D;  4PV1 C;  4H13 D;  3GTE A;  3VMG D;  4EMJ B;  4P1C H;  2Q3W A;  3VCP A;  2HMK A;  2E75 D;  1WQL A;  5BOK A;  1EZV E;  4OGQ C;  1O7H A;  3TGU E;  4NBC D;  4QUR A;  4HM1 A;  5KLI C;  3CXH E;  4HM3 A;  4P1B H;  2YFJ A;  4HM5 A;  2D2C D;  1KYO E;  2DE7 D;  4NBE D;  2QPZ A;  1NYK A;  3D89 A;  4QUP A;  4H0L D;  1O7P A;  1P84 E;  2YMK A;  3AZC A;  1L0L E;  4H44 C;  4NB9 D;  1VCK A;  3CWB E;  2E74 C;  3GZY A;  2E76 C;  2I7F A;  4H13 C;  1ZRT E;  2YFI A;  3GOB A;  4HM7 A;  4HM2 A;  1SQX E;  3VMI D;  3GZX A;  1VF5 D;  1G8J B;  5AEU A;  5HL4 A;  2B24 A;  1SQQ E;  1UUW A;  2E75 C;  2FYN C;  1PPJ E;  3GL2 A;  3H1K E;  2NUM A;  3BCC E;  3EN1 A;  3GL0 A;  3N0Q A;  1NU1 E;  4NBB D;  5KLV E;  1NDO A;  3GCE A;  4PD4 E;  4QDF A;  3FOU A;  4U3F E;  2XSO A;  3H1L E;  2E4Q A;  1L0N E;  2BMR A;  2IBZ E;  4HJL A;  2D2C C;  2HML A;  2ZT9 D;  1KB9 E;  2GBW A;  4H0L C;  3EQQ A;  4I7Z C;  4HM6 A;  4QDC A;  2BCC E;  2ZYL A;  4QCK A;  4QUQ A;  3L73 E;  2DE5 D;  1NTZ E;  3DQY A;  2DE6 D;  2QJP C;  1SQB E;  1VF5 C;  1VM9 A;  4NBF D;  3C0D A; 
#chains in the Genus database with same CATH topology
 2HR3 A;  2KS1 A;  2FYN B;  4GOE A;  1SQV K;  1BCC E;  2WSF H;  1FJK A;  4LC1 A;  3KXD A;  4ZKU A;  2ZFC A;  1NTM K;  4HM0 A;  1AQT A;  2JEE A;  4TT3 H;  3HTK B;  1Q2N A;  3AEC C;  4GIF A;  2A06 E;  3VTP C;  1MFT A;  1RH5 B;  2NPS A;  1Q86 Q;  2GUV A;  2E42 A;  2XR8 A;  3H32 A;  2Q6Q A;  2FFD C;  3NXS A;  3OA7 A;  2R3C A;  3QH9 A;  2E76 D;  3VMG D;  1HH0 A;  3MUD C;  1KOR A;  5APY A;  1M56 D;  1KB9 H;  3TGU E;  3VMA A;  2J59 M;  3TYY A;  5EFW B;  3B5N C;  2YKP A;  3WUV A;  3RK2 B;  2WQY C;  3L72 J;  3TF5 A;  2I7F A;  4H13 C;  1SLQ A;  1QL2 A;  1SQX E;  2Z5I A;  1RQV A;  1XTG B;  1SFC A;  4Y28 J;  3EN1 A;  5KLV E;  1NDO A;  2ZXE B;  1NKZ B;  1SQV J;  3G6E P;  5AW8 B;  3L70 J;  3W67 A;  1NVO A;  3M9H A;  1KQF B;  4IL6 X;  5CMZ A;  4QCK A;  4IFM A;  3L75 J;  3CMA P;  3B4S A;  1X9V A;  1EDJ A;  2IZ0 A;  2LXC B;  3T97 A;  1RE3 C;  3VMZ A;  2WPQ A;  3H1J E;  4ZKP A;  3FX0 A;  2NUK A;  5BU5 A;  1N7S D;  4L74 A;  4XFJ A;  1KFM A;  2YIU C;  2L91 A;  4YXD C;  2HMJ A;  2HFE D;  2CKF A;  3D6Y A;  4L73 A;  3CX5 I;  1H0T B;  4WVZ A;  2XND H;  4DJG A;  1ZME C;  1CSB A;  5APS A;  1NU1 J;  3L71 E;  1N73 B;  4U3F J;  4WY4 C;  3U59 A;  2YKO A;  2WSS H;  5B5E H;  1YYC A;  3HUS A;  2FYU G;  4I6M C;  1GL2 C;  1KD1 Q;  3H1I G;  1JMB A;  2KNC B;  2WZ7 A;  1IK7 A;  1KIL A;  3AZC A;  3AE4 C;  2Z5H A;  2E74 C;  2HPC B;  1GTW A;  5CCG C;  3S1K A;  3SWF A;  3GHG B;  1RE4 C;  3BVH A;  3CC2 P;  1EZV G;  2OYI B;  3HTK A;  1KB9 E;  1BE3 J;  4H0L C;  3KQG A;  3H1L G;  3P8C E;  4EYY Q;  2FXO A;  3L73 E;  1JMM A;  2A45 I;  2ITA A;  1L0L G;  1FE6 A;  2YXQ B;  1LTG C;  2P2U A;  2GBX A;  1NTM E;  1DH3 A;  5KJ7 A;  5AEW A;  4NBD D;  1URQ C;  1FZC C;  2Q7C A;  2V7Q H;  1BGY G;  3AE8 C;  1NTK K;  4AAY B;  1L0N G;  2HMN A;  2K37 A;  2L5G B;  1W2E A;  2KI7 B;  2P58 A;  5APU A;  4W80 A;  1PGO A;  1G2C A;  3B5N D;  1SQB G;  2V7Q J;  3Q5S A;  1VQM P;  1RFS A;  4H13 D;  1ZOY C;  2IFN A;  1N2D C;  5AW0 B;  3L72 D;  3AE2 C;  1KB9 D;  4RJT A;  3P8C D;  3TGU G;  1SQV D;  2YFI A;  4HM2 A;  2ZYG A;  3L70 D;  3G4S P;  1G8J B;  3PJS K;  3AE9 C;  2W6J H;  3L75 D;  1JUN A;  1SQX G;  3LW5 H;  1FU1 A;  2WPV B;  2XSO A;  4AYC A;  1L4A B;  4N78 D;  1QEX A;  3NFQ A;  3C9I A;  5AVW B;  3PRJ A;  1A02 J;  4PD4 I;  1H0T A;  2N1T C;  2RH0 A;  4D6T E;  3DQY A;  1J1E B;  2DE6 D;  2O1J A;  1RHZ B;  1JY2 N;  3LW5 J;  2IFM A;  1N73 A;  1P84 D;  3CWB G;  5AVR B;  4OGQ B;  1RF1 C;  2Q9I A;  2M5A B;  1S3J A;  3CI9 A;  4WY4 D;  3R2P A;  3H1J G;  1J2J B;  1ZR2 A;  2Q1K A;  1NU1 D;  1Y9B A;  4U3F D;  1AVO A;  2P7J A;  5AW3 B;  3KHU A;  4I7Z B;  1YJ9 P;  2IBZ D;  1GL2 D;  2QE7 H;  1FC2 C;  4IFD K;  3SSU A;  1CI6 A;  3BCC J;  1NHL A;  2G8Y A;  2HPC A;  1LTS C;  4UB6 H;  2H88 C;  2E74 D;  2QVA A;  1HF9 A;  1IFD A;  5CCG D;  4P1C H;  2Q3W A;  3L71 G;  1SFC C;  2BCC J;  4GOF A;  1RY3 A;  2YFJ A;  1MUU A;  2M3B A;  1PP9 J;  5AW7 B;  4H0L D;  4ASV A;  2YMK A;  4H44 C;  3OW2 O;  4BXL A;  1LTI C;  3L74 G;  3JC2 2;  3RK3 C;  1BE3 D;  5HL4 A;  4BRY B;  3H25 A;  1K73 Q;  3FXE A;  1LT1 A;  1URQ D;  3E7K A;  2LKM A;  3M9B A;  2Z4E A;  2D2C C;  1OVR A;  1Y47 A;  5CJ0 A;  2BAS A;  4Y99 B;  5CCH A;  2Y0D A;  1K9M Q;  4JYB A;  3S9O A;  1PV3 A;  1U7J A;  1KN7 A;  2B88 A;  1EDI A;  3VP8 A;  2E75 B;  3L73 G;  1MZ9 A;  3SWK A;  1W5C E;  5APQ A;  1ZRT D;  1NTK E;  1AQ5 A;  5KLI B;  4QDF B;  1PPJ D;  3G71 P;  1WT6 A;  3VCA A;  1S72 P;  1L0L J;  3JCU H;  2A45 G;  5AVT B;  3CCS P;  2POH A;  1E79 H;  2O01 N;  3V2Q A;  4HM8 A;  1FDO A;  1O7G A;  5L8R J;  1VL2 A;  3GKE A;  1IFN A;  1KIL C;  1LJ2 A;  2PAJ A;  1HVV A;  3A3Y B;  1D7M A;  1L4A A;  4NBC D;  2ZVO B;  1NO4 A;  3H6P A;  2QJK B;  2DE7 D;  3W68 A;  3OJA B;  3CXH I;  1X22 A;  2N1T D;  4IL6 H;  2LXB A;  4JPZ B;  1KYO I;  1FDI A;  3VN0 A;  3CPW O;  4UB6 E;  3AED C;  2M5A A;  3RK3 E;  3V2P A;  3GL0 A;  1ZLL A;  1IJD B;  5AW9 B;  5KJ7 C;  4EI2 A;  3L4F A;  3B8E B;  1JB0 J;  3RL0 C;  1NOH A;  3D6Z A;  1NGM B;  2YKQ A;  2K9Y A;  3KPE A;  3P7K A;  5KAF H;  2K1A A;  1SP4 A;  2QJP C;  1QX8 A;  2E76 B;  3MIW A;  3RK2 C;  2NVE A;  1LWU A;  1HJB A;  3GTS A;  3A0B H;  4R4M A;  5B66 H;  2YMY A;  3CCM P;  5DJT B;  1RIE A;  2WVR A;  1QL1 A;  3BCC D;  1SFC D;  1IC2 A;  2AXT E;  5CXM A;  2YVJ B;  2H7H A;  3H1K J;  1NTZ G;  4OH8 B;  2BCC D;  2P1J A;  1PZQ A;  2Y0C A;  4H44 D;  3RBZ A;  2H8P D;  4BRY A;  1EDK A;  3GTE A;  1PP9 D;  1HTL C;  5AW5 B;  3RK3 D;  5DJU B;  1T6A A;  2KYV A;  5AVY B;  1LTJ B;  2FYU D;  2C9L Y;  1SQQ K;  1VF5 B;  3JCU E;  2D2C D;  2OYH B;  1VQP P;  3D89 A;  2BEZ F;  4RKU J;  1VCK A;  3WUU A;  1N7S B;  1LGH B;  2R5B A;  1N73 C;  1X79 B;  2QRX A;  2ZYA A;  3WUT A;  3SFE C;  4QDF A;  5KAI H;  3RGU A;  1SQP K;  3L74 J;  1NU1 K;  3KZI H;  3EQQ A;  1EZV D;  2E43 A;  1LT9 C;  3AE5 C;  1G2C B;  4NPE A;  3CC7 P;  5CHX A;  1GW4 A;  4U7J A;  2M0B A;  1PGJ A;  2CPS A;  1NYH A;  4HM4 A;  1L0L D;  4IL6 E;  2QSI A;  3H1H J;  2RKL A;  1JY3 N;  1DIP A;  3K5B A;  1KIL D;  1OMI A;  1ZP0 C;  1NTK G;  3A5T A;  3GHG C;  1P84 H;  3EQ2 A;  3MGN A;  2K3R A;  2OYI C;  1EG9 A;  1SQQ J;  5KAF E;  2YFL A;  1ZW0 A;  1S5L X;  2NZ2 A;  1SQB D;  4QDD A;  1M1J A;  3A0B E;  5AVX B;  5B66 E;  2RN0 A;  1S1C X;  3PLN A;  1RF0 A;  5KJ7 D;  3M0A A;  1SQP J;  3RL0 D;  2QPZ A;  4NB9 D;  1KQG B;  2FFD B;  2CK3 H;  2B87 A;  1WMK A;  5AVS B;  5APW A;  2IZ1 A;  4I2L C;  2OYO A;  3D71 A;  3M91 A;  4NBB D;  4JF7 A;  2IX7 C;  3RK2 D;  2R5D A;  5GTH H;  1E5W A;  1N8R Q;  1QLE D;  3Q5R A;  1CI6 B;  2YXR B;  2AEM A;  4Z1M H;  3SWY A;  3M0D A;  4LLH A;  2BEQ D;  1KB9 I;  2R3S A;  1T2K C;  2ZXX A;  1NAF A;  1JY2 P;  5AW1 B;  4NBH D;  2HMO A;  4HB1 A;  1K05 A;  3L72 E;  2XDJ A;  4PD4 H;  1PL5 A;  1LTJ A;  3H1K D;  2XV5 A;  2PP6 A;  2VRS A;  3H1H E;  4M3L A;  3VYI A;  1SQV E;  1L4A C;  3KZI E;  2OYH A;  2ZJS E;  1AV1 A;  4KJM A;  3L70 E;  1NKN A;  3HD7 B;  1KMI Z;  3TSI A;  1VQ9 P;  2BMQ A;  1A02 F;  2Y9Y A;  3GB4 A;  2BMO A;  3L75 E;  1N7S A;  1FDM A;  1J1E C;  4A7P A;  1IZN B;  4EMJ B;  4N78 E;  1YIT P;  1BCC G;  2W90 A;  1GD2 E;  4OGQ C;  3CX5 D;  3C8V A;  1NTZ J;  5TIS H;  1GW3 A;  1KTM A;  1P84 E;  4TLF A;  3EFG A;  2A06 G;  3N4X A;  2KB7 P;  1NAY A;  2AEF A;  4HM7 A;  3L74 D;  2IBZ I;  2HYN A;  1W2B O;  3GZX A;  4WY4 B;  2H43 A;  1M90 Q;  4KHX A;  3V6I A;  1SS1 A;  1NU1 E;  3VMY A;  2CPB A;  1OVU A;  4U3F E;  2E4Q A;  4JYC A;  3AE3 C;  1VQ5 P;  2IBZ E;  1OX3 A;  3CCV P;  2QIW A;  3H1H D;  1XTC C;  1LP1 B;  1R5S A;  4YXW H;  2K88 A;  5H2F H;  3GW6 A;  1BSN A;  1GMJ A;  3WU2 H;  5B5E E;  1WRG A;  2AEJ A;  1H89 A;  1VQN P;  1SQQ D;  5KLV G;  5GTH E;  2PGD A;  1OVV A;  4H0L B;  1AA0 A;  2FYU K;  1GK6 A;  2OTK E;  2WSE H;  1U7M A;  4Y99 C;  1BE3 E;  1SJG A;  2FFD A;  3A0H H;  2NPS C;  3N7N A;  2H89 C;  4YTP C;  1SQP D;  3QWO C;  2HMK A;  1JM0 A;  2KZI A;  5BOK A;  2WSE J;  4KT0 J;  3AEE C;  2KK7 A;  5KLI C;  2GUS A;  4HM3 A;  2W8Z A;  3I55 P;  4QUP A;  1NYK A;  2SPZ A;  3IF4 A;  1N86 A;  1ZRT E;  1LWU B;  1OWA A;  3CCR P;  3GF3 A;  4MN4 C;  3IR9 A;  1L0L K;  1T2K D;  1FAV A;  1PPJ E;  1J1D B;  4OVN F;  1YIJ P;  2JJL A;  3EWK A;  2KUB A;  2UWJ E;  2BMR A;  1YJW P;  3ABV C;  2QM8 A;  1PGQ A;  1DEE G;  2Y9Z A;  3E1R A;  1L0N K;  1IFJ A;  2FXM A;  3V5B A;  1FZF A;  2FYU J;  1L4A D;  3HD7 A;  3C0D A;  3H1I J;  3BAT A;  2HMM A;  1SQB K;  3AEF C;  2NWF A;  2E4P A;  1OW7 A;  1VDF A;  2Q5U A;  5AVZ B;  2WIT A;  3IN6 A;  1MV8 A;  3AE1 C;  4PD4 D;  3U1A A;  4HKV A;  4OGQ D;  2AXC A;  2N1T B;  2N9Y B;  1JNM A;  4B86 A;  1SQV G;  5H2F E;  1LTT C;  1NTZ D;  4WY4 A;  3H1L J;  2WT7 B;  4PV1 C;  3WU2 E;  1NTM G;  1GU4 A;  2GA1 A;  4O9B A;  3L75 G;  2KSE A;  3M06 A;  3HUS C;  2RMZ A;  4BWN A;  1JOC A;  3F89 A;  1LP1 A;  5BU8 B;  1DD3 A;  5CJ4 A;  1KFN A;  1BGY J;  4HKZ H;  1ZN5 A;  1L0N J;  2XKM A;  3MD0 A;  4W7Z A;  3ITK A;  5CCG A;  1KV4 A;  3A0H E;  2ZT9 B;  3M0D C;  4ZNC A;  2FYN C;  3FWL A;  3G9R A;  1T8Z A;  5KKZ B;  1T3J A;  3BCC E;  1LNQ A;  1UII A;  1SQB J;  1RE4 A;  3MHV A;  4C46 A;  2GBW A;  4U3F G;  4HM6 A;  1Q82 Q;  1LTJ C;  2Y0E A;  4DZO A;  2BCC E;  2IBZ G;  1VF5 C;  4NBF D;  4R4L A;  1M1J B;  2OYH C;  1PP9 E;  3L36 A;  3CCL P;  3RK3 B;  1USD A;  3ZDM A;  3TGU J;  2NPS D;  5E79 H;  3E1I A;  3I5C A;  3UIA A;  2O01 J;  1S5L H;  1JY3 P;  2FYU E;  3CLQ A;  4IFF A;  2D2C B;  3V2R A;  2JZA A;  3CCQ P;  3H1I E;  2KSJ A;  3C1L A;  2JO1 A;  4XA4 A;  2ZAE B;  1SQX J;  2B87 B;  1S9K D;  1VQ7 P;  3P32 A;  2DW3 A;  1S2E A;  3B71 A;  4D6T G;  2R44 A;  2B9B A;  3CCJ P;  5KLV J;  1OW8 A;  2MKV A;  2WPS A;  2FY8 A;  1ULJ A;  3GG2 A;  1FJP A;  1JCD A;  1BE3 G;  1S4X A;  2LR2 A;  1JY2 O;  4HYT B;  3PH0 A;  1EZV E;  3CWB J;  3R4Y A;  4L75 A;  1IK9 A;  1N7L A;  1FZB A;  2PFX A;  3Q3D A;  5K5G B;  1U57 A;  1YHQ P;  3Q5P A;  3Q1M A;  3H1J J;  4QMA A;  2HG5 D;  3L35 A;  4EIJ A;  1L0L E;  1CW5 A;  1M57 D;  2QJY B;  2KP8 A;  1AVY A;  3KYQ A;  1HUC A;  1KIL E;  2W27 A;  2B24 A;  1ZV8 A;  3CX5 H;  4AUW A;  2G3A A;  1BGY E;  5AVU B;  2FBW C;  3CC4 P;  1L0N E;  3A7O A;  1FZA A;  3H1I D;  1PPJ G;  2HML A;  2NRG A;  1M1K Q;  3MP7 B;  1YQ3 C;  2P67 A;  3V2N A;  2N1T A;  2R32 A;  3L71 J;  3CXH D;  2PRR A;  1EC5 A;  4AQR D;  4RO0 A;  5KTB A;  4L76 A;  1KYO D;  1SQB E;  4NBG D;  1YQ4 C;  1JEK A;  2WSF J;  3BRV B;  2IPP A;  5APV A;  2WT7 A;  4IOI H;  1RF1 A;  1YBK A;  3BAS A;  2V4H A;  1USE A;  2B1X A;  4PV1 D;  3TK1 A;  2M3E A;  2C0X A;  4K35 A;  3RL0 B;  3PHL A;  3H1L D;  2OTJ P;  4NB8 D;  3O8Z A;  3FWN A;  2QJP B;  2E5T A;  2NVG A;  3F5H A;  2YO2 A;  3VMH D;  3AE6 C;  2NVF A;  3CCU P;  5AVV B;  1FOS E;  2OTL P;  5E79 E;  1NH4 A;  1BGY D;  1BCC D;  1O7H A;  2A45 H;  1L0N D;  1FZG A;  1S5L E;  1TU3 F;  4HM1 A;  3L73 J;  4DT0 A;  4PJ0 H;  3AE7 C;  4OWF A;  1NTM J;  1PGP A;  3CWB E;  3GZY A;  1IFP A;  2KXP B;  3GOB A;  2A06 D;  4GDO A;  1VF5 D;  1JO5 A;  1MKM A;  3HD7 C;  3USS A;  3H1K E;  3OAK A;  1LTB C;  2ZYD A;  4WBA A;  1QVF O;  1OFC X;  2YO3 A;  1PIX A;  3TNU B;  4GKG A;  1L2P A;  3BCC G;  1RQU A;  1IFI A;  5CCH C;  3TGU D;  1DD4 A;  1T3U A;  2ZYL A;  1GDT A;  5M1B A;  1M7L A;  2BCC G;  2WMM A;  3BRT B;  3WMM 0;  1NTZ K;  3LID A;  4DOJ A;  1SQX D;  2W83 C;  4WB4 A;  1PP9 G;  3CX5 E;  1FQT A;  3AEA C;  2JWA A;  2QG4 A;  5KLV D;  4NPD A;  3B5N B;  3GLM A;  1EXI A;  1G8K B;  2XZR A;  1Q90 C;  1LT9 B;  1OZH A;  3HE5 B;  4H13 B;  1Q81 Q;  1CZQ A;  1UUV A;  3L74 E;  3CWB D;  1FS0 E;  3P8M C;  1YJN P;  1K8A Q;  4UB8 H;  2I8D A;  2JDI H;  2HOD B;  4ZMD A;  3H1J D;  5KAI E;  3RL0 g;  2W6B A;  1WQL A;  1HGV A;  1EDL A;  5GTI H;  5APT A;  4D6T J;  1HGZ A;  1FBM A;  2K9J B;  1FZE A;  1AFO A;  3CCE P;  3VMX A;  1JTH B;  4RES B;  1M8O B;  1KZU B;  5AW4 B;  2QM7 A;  1HWT C;  1NWQ A;  4N3Y B;  1SQQ E;  1P84 I;  1ZR4 A;  1VQ6 P;  2YIU B;  3L71 D;  3IAO A;  2OAR A;  1QGK B;  4JQ0 D;  2OQQ A;  1OIP A;  3GF7 A;  1X0T A;  5AW2 B;  1VQL P;  1ZXG A;  1GU5 A;  1EQ7 A;  4I7Z C;  5C39 A;  4PJ0 E;  1YTZ I;  2DE5 D;  1X8Y A;  1IO4 A;  2JP3 A;  2J58 A;  3G3Z A;  1SQP E;  3CL3 D;  1JM1 A;  3RBX A;  1KQS O;  3O6Q B;  2KIK A;  2Q3I A;  1Y8A A;  3S4R A;  2KOG A;  2C9N Y;  1LWU C;  1GL2 B;  3A2A A;  3VOP A;  3EFF K;  3NMD A;  4HH2 A;  4XE5 B;  1J1D C;  2I1K A;  2W6A A;  1O7W A;  5CBO A;  2E74 B;  2C0W A;  3KDP B;  1DEB A;  1BDC A;  1DX7 A;  3L73 D;  2M8R A;  1GK4 A;  5AW6 B;  3VCP A;  1Z56 A;  1NTM D;  3HD7 D;  1R8E A;  4C7N B;  4DCK A;  4QUR A;  2QA4 P;  3TNU A;  1BDD A;  1JY3 O;  4P1B H;  1VPC A;  2KLU A;  2OGU A;  4NBE D;  2B89 A;  3SFD C;  5CCH D;  2FYZ A;  1UIX A;  1NTK J;  1URQ B;  3VP9 A;  3MUD A;  3HRN A;  1FZC B;  4C7R A;  3NTN A;  5AEU A;  1BSH A;  2E75 C;  3HE4 B;  1VQO P;  2NUM A;  4UB8 E;  3GCE A;  4PD4 E;  1K04 A;  3LIE A;  3B5N A;  3H1K G;  5GTI E;  3TDK A;  1QVG O;  3D70 A;  4CPG A;  3IFM A;  1LT9 A;  3HE5 A;  2WPR A;  4EDF A;  2FKW B;  1Q90 D;  1IFM A;  1NTZ E;  2KNC A;  2JWD A;  2P10 A;  1NJI Q;  2HLO A;  4WWI A;  2JKV A;  2HOD A;  2JO6 A;  2ZT9 C;  2IDB A;  1EXJ A;  3CXH H;  5KKZ C;  1AJY A;  1KYO H;  5TIS E;  3GHG A;  2IYO A;  1ULI A;  2K9J A;  2FXP A;  1LTA C;  3JSV C;  2QJK C;  5TJH A;  1RE3 A;  2OYI A;  3PP5 A;  2E5Y A;  1VQ4 P;  1O7M A;  4GOD A;  2XSH A;  1OXZ A;  1JTH A;  1R5L A;  2XRX A;  3PTZ A;  1OW6 A;  4D6T D;  1O7N A;  1YTZ T;  2KS1 B;  4HJG H;  2I1J A;  3CME P;  1M1J C;  5APX A;  3M9Q A;  3L72 G;  3CD6 P;  5BVZ A;  3AEG C;  1RF0 C;  4HM5 A;  1PFI A;  5CBN A;  3H1H G;  1O7P A;  4JBZ A;  2GM4 A;  1HBW A;  2O3J A;  2AXT H;  3L70 G;  3AEB C;  2NPS B;  4ASW A;  3H32 B;  1RF1 B;  2E76 C;  2N9B A;  1FOS F;  2XU6 A;  3O6Q A;  1JCC A;  3GMA A;  3GL2 A;  1GL2 A;  3N0Q A;  2KZJ A;  2JR8 A;  1SQX K;  5AVQ B;  1H88 A;  1SQQ G;  2IYP A;  5KLV K;  1S9K E;  1VQ8 P;  2QEX P;  1BCC J;  4QUQ A;  1SVF A;  4LGD E;  3V4Q A;  3V4W A;  3I56 P;  1G1I A;  1VM9 A;  4I1L A;  2MJZ A;  1YI2 P;  4NBA D;  1SFC B;  4EOT A;  2QJY C;  1SQP G;  2WWW A;  1NU1 G;  4C7N A;  4NPF X;  2O01 H;  1VQK P;  4H44 B;  2XNX A;  1HJ0 A;  3II6 A;  2WSC H;  4AIV A;  2J5U A;  1URQ A;  3T97 B;  1FZC A;  4N6J A;  3U1C A;  1N7S C;  3HE4 A;  2YNY A;  2E75 D;  2WSC J;  1NTK D;  1GZL A;  4GT1 A;  3CXH E;  4W7Y A;  1H8A A;  1KYO E;  1G1J A;  3L37 A;  1EZV I;  3FGA D;  4K3A A;  1Q7Y Q;  2Q3E A;  3Q2Y A;  2O1K A;  1KQL A;  3VMI D;  4PV1 B;  3MZW B;  3MTU E;  1UUW A;  2KLV A;  3FOU A;  3H1L E;  3HUS B;  4HJL A;  1KC8 Q;  2ZT9 D;  1MFZ A;  2ZVN B;  2WTY A;  4YPC A;  4QDC A;  1KIL B;  3FXD A; 
#chains in the Genus database with same CATH homology
 1PV3 A;  1GMJ A;  5M1B A;  2E75 B;  1BCC E;  1NTK E;  1FQT A;  3CX5 E;  3AEA C;  4QDF B;  4HM0 A;  3VCA A;  4TT3 H;  4H0L B;  3GLM A;  1EXI A;  1G8K B;  1Q90 C;  3AEC C;  4H13 B;  2A06 E;  1UUV A;  3L74 E;  1BE3 E;  4HM8 A;  1FDO A;  1SJG A;  2XR8 A;  1O7G A;  5L8R J;  1VL2 A;  3GKE A;  2H89 C;  2E76 D;  3VMG D;  4YTP C;  1KOR A;  3RL0 g;  2HMK A;  1WQL A;  5BOK A;  2WSE J;  4KT0 J;  3TGU E;  4NBC D;  3AEE C;  5KLI C;  4HM3 A;  2DE7 D;  4QUP A;  1NYK A;  2WQY C;  2I7F A;  1ZRT E;  4H13 C;  1SQX E;  3GF3 A;  1FDI A;  1RQV A;  1SQQ E;  3AED C;  1PPJ E;  4Y28 J;  3IAO A;  3EN1 A;  3RK3 E;  3GL0 A;  5KLV E;  1NDO A;  3EWK A;  2OQQ A;  2BMR A;  1JB0 J;  3ABV C;  3GF7 A;  3D6Z A;  1NGM B;  2K9Y A;  1KQF B;  4IL6 X;  4I7Z C;  4QCK A;  2DE5 D;  2QJP C;  3C0D A;  2E76 B;  2JP3 A;  1SQP E;  1JM1 A;  3H1J E;  2HMM A;  2NVE A;  3GTS A;  3AEF C;  2NWF A;  4R4M A;  2E4P A;  1OW7 A;  2NUK A;  3IN6 A;  4XFJ A;  1RIE A;  2YIU C;  3AE1 C;  4YXD C;  2HMJ A;  2CKF A;  3D6Y A;  4HKV A;  4OGQ D;  1O7W A;  2E74 B;  5CXM A;  1ZME C;  2YVJ B;  3L71 E;  4H44 D;  4PV1 C;  3GTE A;  3VCP A;  1R8E A;  4QUR A;  4P1B H;  1VF5 B;  2D2C D;  1IK7 A;  4NBE D;  3D89 A;  1DD3 A;  3SFD C;  2BEZ F;  3AZC A;  3AE4 C;  4RKU J;  1UIX A;  1VCK A;  2E74 C;  2ZT9 B;  5AEU A;  2FYN C;  2E75 C;  3G9R A;  2NUM A;  3BCC E;  3GCE A;  4PD4 E;  3SFE C;  1K04 A;  4QDF A;  1KB9 E;  2GBW A;  4H0L C;  3D70 A;  3EQQ A;  4HM6 A;  3AE5 C;  2BCC E;  3L73 E;  1Q90 D;  1NTZ E;  4U7J A;  1VF5 C;  4NBF D;  4R4L A;  1PP9 E;  1NYH A;  2P10 A;  4HM4 A;  2GBX A;  2QSI A;  1NTM E;  5AEW A;  4NBD D;  1DIP A;  2JO6 A;  2O01 J;  2ZT9 C;  1OMI A;  2FYU E;  2IDB A;  1ZP0 C;  1EXJ A;  2D2C B;  2JZA A;  3AE8 C;  5KKZ C;  3H1I E;  4AAY B;  1AJY A;  2HMN A;  2JO1 A;  1ULI A;  2FXP A;  2QJK C;  1EG9 A;  1O7M A;  2XSH A;  2XRX A;  3B71 A;  2YFL A;  1OW6 A;  1OW8 A;  2MKV A;  2V7Q J;  1O7N A;  1S5L X;  2NZ2 A;  1ULJ A;  3Q5S A;  1RFS A;  4QDD A;  4H13 D;  1ZOY C;  1S1C X;  1EZV E;  3R4Y A;  3AE2 C;  3AEG C;  3Q3D A;  4HM5 A;  1U57 A;  2QPZ A;  3Q5P A;  3Q1M A;  1O7P A;  1L0L E;  4NB9 D;  1KQG B;  3AEB C;  2E76 C;  2YFI A;  4HM2 A;  1WMK A;  1KIL E;  1G8J B;  2B24 A;  3O6Q A;  3AE9 C;  3GMA A;  3D71 A;  3GL2 A;  3N0Q A;  4NBB D;  2G3A A;  2FBW C;  2WPV B;  2XSO A;  1L0N E;  2HML A;  3Q5R A;  1YQ3 C;  4QUQ A;  4Z1M H;  2BEQ D;  3DQY A;  2DE6 D;  1SQB E;  1VM9 A;  3LW5 J;  4NBG D;  1YQ4 C;  2WSF J;  4NBH D;  2HMO A;  4OGQ B;  4NBA D;  1K05 A;  2QJY C;  3L72 E;  2B1X A;  4PV1 D;  1PL5 A;  1Y9B A;  4H44 B;  1HJ0 A;  3H1H E;  4I7Z B;  1SQV E;  4NB8 D;  4AIV A;  3L70 E;  1KMI Z;  2J5U A;  2NVG A;  2BMQ A;  2G8Y A;  3T97 B;  3GB4 A;  3VMH D;  2H88 C;  3AE6 C;  2BMO A;  2NVF A;  3L75 E;  2E74 D;  4EMJ B;  1HF9 A;  4P1C H;  2Q3W A;  2E75 D;  2WSC J;  4OGQ C;  1O7H A;  1TU3 F;  4HM1 A;  3C8V A;  3CXH E;  2YFJ A;  1KYO E;  3AE7 C;  1KTM A;  3FGA D;  4H0L D;  1P84 E;  2YMK A;  4H44 C;  3Q2Y A;  3CWB E;  3GZY A;  3GOB A;  4HM7 A;  3VMI D;  3GZX A;  4GDO A;  1VF5 D;  5HL4 A;  4PV1 B;  1MKM A;  1UUW A;  3H25 A;  3H1K E;  1NU1 E;  3FOU A;  4U3F E;  3H1L E;  2E4Q A;  3AE3 C;  2IBZ E;  4HJL A;  1PIX A;  2D2C C;  2ZT9 D;  1RQU A;  2QIW A;  4QDC A;  1DD4 A;  2ZYL A;  3S9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...