1EZVE

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ezvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ezvE02
4HM4A 3C0DA 1NYKA 2HMOA 4H0LD 2QJKC 1VF5D 3H1JE 3GZXA 1FQTA 4AAYB 2JO6A 2YFLA 3GTSA 1O7GA 1VM9A 2E74D 2D2CD 1KYOE 1UUVA 1VCKA 3GZYA 1NDOA 4HM6A 4EMJB 1SJGA 2YFIA 4QUPA 1ULJA 2DE5D 4HM7A 2NVGA 2JZAA 1NU1E 1SQBE 3CXHE 3GKEA 4NBCD 2IBZE 1O7NA 1NTME 2QJYC 2XSOA 3GOBA 3EN1A 4QURA 5AEWA 1O7HA 1O7PA 4PD4E 3L73E 3GB4A 3L74E 2I7FA 1ZRTE 4HM2A 2B24A 2GBXA 2NUKA 3BCCE 3D89A 4U3FE 3VMHD 1PP9E 5KLIC 2B1XA 4HM8A 3GL2A 3TGUE 3DQYA 4QDDA 3VCAA 3H1IE 2NVFA 3H1LE 2DE6D 2BMRA 4NBED 4NBBD 2E75D 4QCKA 2XR8A 3EQQA 1O7WA 4PV1D 5AEUA 3H1HE 1G8JB 3L72E 2HMNA 1BCCE 5CXMA 3VCPA 2BCCE 2NVEA 2YVJB 2NUMA 4NBAD 3L70E 4HM0A 1P84E 4AIVA 1G8KB 3L71E 4QDFA 5HL4A 1WQLA 2QJPC 3AZCA 1KB9E 3H1KE 2YIUC 2XSHA 2XRXA 4NB9D 2HMJA 1L0NE 4QUQA 4D6TE 4NB8D 4H44D 1SQVE 4QDCA 3GTEA 1O7MA 3FOUA 4OGQD 2HMLA 4NBHD 4QDFB 4NBDD 1NTZE 1JM1A 1L0LE 4H13D 3VMGD 1SQPE 2HMKA 3VMID 1NTKE 2BMOA 2QPZA 2A06E 2NWFA 2BMQA 5KKZC 1Q90C 3N0QA 4P1CH 4HM5A 1RIEA 1UUWA 3CX5E 2YFJA 2ZYLA 1SQQE 1SQXE 2E4PA 1ULIA 1RFSA 2E76D 1EG9A 4P1BH 2CKFA 2GBWA 2FYNC 2HMMA 3GL0A 4NBFD 3L75E 2ZT9D 5KLVE 2E4QA 1PPJE 1BE3E 3CWBE 4HJLA 4NBGD 1EZVE 5BOKA 3GCEA 4HM3A 2FYUE 2DE7D 2Q3WA 1BGYE 4HKVA 4HM1A
chains in the Genus database with same CATH superfamily
2L5GB 3VTPC 3BRTB 1GTWA 2K88A 3BCCG 1JEKA 5TISE 3LIDA 2RH0A 1HH0A 1W2EA 3MUDA 4U3FJ 1OMIA 3L72D 1MFZA 3MP7B 4OVNF 3NMDA 4NPDA 1LTAC 3G4SP 5CCGC 2UWJE 2XNXA 1JY2O 1LP1B 1S1CX 1S72P 2O01H 4GDOA 3QWOC 1H8AA 1SQPD 1LP1A 1P84E 1NTZG 1VF5B 3B5ND 3L71E 4QDFA 1M7LA 1KILC 2IYOA 1SQVK 2IPPA 2DW3A 3AEEC 1EZVD 5KLVG 1L0LE 3VMGD 2PGDA 2BMQA 1ZP0C 4QMAA 1SQXK 2ZYLA 1NU1J 2OQQA 1S4XA 3HE4B 1VQ9P 3WUUA 1KYOI 3EWKA 3C0DA 2E76C 1NTMD 1BSHA 1OW7A 2P67A 3L74D 1ZRTD 5AW8B 1O7GA 3CCRP 1S2EA 1HUCA 1GL2D 2NZ2A 1CW5A 4EMJB 2YFIA 1M1JB 3CMAP 3L4FA 3VMYA 2NVGA 1AVOA 3FWLA 1FJKA 5CBOA 1CZQA 3H1IG 1YI2P 3RK2B 2KUBA 3BVHA 4QURA 1DEEG 3LW5J 3JC22 1M1JA 4I7ZC 3MUDC 2GUSA 2YO3A 5KLIC 4EOTA 1N2DC 1GU4A 3U59A 4PJ0E 1DX7A 4UB6E 4R4LA 5E79H 1XTGB 1YJNP 1J1DB 3HTKB 1OW6A 5AEUA 1A02J 1T2KD 2WSSH 1LJ2A 3HTKA 2XDJA 4HKZH 3O6QB 1U7MA 1IK9A 2H43A 2Y0DA 1SQQG 3B71A 1OW8A 2M3BA 4XE5B 1PPJD 4PV1B 3L75G 1U57A 3CX5E 4H44C 4YTPC 1WT6A 2XNDH 2WSEH 1FC2C 2GM4A 3CWBE 3GCEA 2QSIA 1W5CE 1BGYE 1W2BO 3BCCJ 2FYNB 3R4YA 1JMMA 4ZMDA 4W7ZA 2NRGA 3L73D 4BRYB 2E74D 1QX8A 2N9YB 4H13C 3H1LD 1SQBE 1U7JA 3HD7D 3Q5SA 4NBCD 2IBZE 5KAIH 4L75A 3V2QA 2NPSC 3H1HD 3AECC 2GBXA 1IFIA 1L0NK 1OXZA 2Q6QA 4K3AA 5CCHD 2D2CB 2QM7A 3L71G 4I6MC 4M3LA 1E79H 1VQNP 1IFPA 2YKQA 1MFTA 2J59M 3CWBD 4IOIH 1LT9B 1KMIZ 1EDLA 2KIKA 1RQVA 4HM0A 1EZVI 3RK3E 1L0LG 5TJHA 5HL4A 4YPCA 4IFFA 1GMJA 3AZCA 2N1TB 4NB9D 1JY3N 1KQSO 3VMXA 1SQVE 4EI2A 3PJSK 1LTBC 2HMLA 1SQBD 4NBDD 2M3EA 1NTKK 5AVRB 1ZW0A 3CLQA 1LTJC 4DT0A 3USSA 1YYCA 1SQXE 5BVZA 2FXPA 1AQTA 4IL6E 1KV4A 4HM3A 2DE7D 1BDDA 2JO1A 4H0LD 2Z5HA 3H1JE 4NPFX 1N7SB 3PLNA 2ZT9C 2QA4P 1QGKB 1N8RQ 2BEZF 4K35A 2KNCB 3W67A 2SPZA 2QVAA 2QIWA 3CXHE 2M5AA 2XSOA 2Q3IA 3A7OA 5C39A 1E5WA 1NJIQ 2GUVA 2QEXP 3TGUE 3V2PA 2Q9IA 2W6BA 3HE5B 3L72J 4D6TD 4QCKA 1RE4A 1KC8Q 2H88C 3MD0A 1SQQJ 1IJDB 1LNQA 3A3YB 1H0TB 1BCCE 3HE5A 3VCPA 1FDOA 3V5BA 3L75J 1Y8AA 2QJPC 3S1KA 4DOJA 2XSHA 2P58A 2WPSA 4KHXA 3M9HA 1S5LH 1SQPJ 1X0TA 2KLVA 3B5NC 4NBHD 2OYIC 1WMKA 1BGYG 1ZR2A 4HH2A 2AEMA 3KQGA 1ULIA 5BU8B 1JY3O 3GL0A 5AVSB 3TGUD 4NBFD 3M0DA 4JYBA 1ZXGA 1VQPP 4HJGH 4WY4D 1T3JA 2QJKC 3LW5H 1VF5D 2IBZG 1FQTA 2ZVOB 2YFLA 2R3SA 2K3RA 1VM9A 1KYOE 3BCCD 3Q2YA 1NDOA 3H1KG 4UB8H 4HYTB 1NTMJ 2QM8A 5GTIE 2W6JH 4IFMA 5GTHH 1MV8A 3M91A 3WU2E 3L74J 5KAFE 1UIIA 1OX3A 1Q86Q 2Q7CA 2HG5D 1N73B 3RBZA 1GL2C 1KFMA 4RKUJ 2E42A 3E1IA 4TT3H 3AE2C 4HM8A 3V4WA 1DH3A 3E1RA 3PP5A 1M1KQ 2RMZA 3JSVC 2MKVA 5AW1B 4NBBD 2XR8A 2WTYA 2FKWB 4ASWA 1SQVG 3A0HH 1JTHB 1NTZD 2BCCE 1N86A 3GW6A 2YIUC 5CCGA 1KORA 3AEBC 2I1JA 3RL0g 2R5BA 2H7HA 1SQXG 4EDFA 2FFDB 1KILB 1T2KC 5KLVD 2OGUA 2QG4A 2Z5IA 4EIJA 1L4AB 1NTKE 1KQFB 2HPCB 5AW2B 3N0QA 5APXA 1KILA 1PGOA 5KTBA 4WB4A 3H1JG 1USEA 1LGHB 3T97B 2ZVNB 2HPCA 2C9NY 1LT1A 1PGQA 1BE3E 2Q3WA 2WT7A 2Q1KA 3KXDA 1RF0C 3CI9A 5APYA 2YO2A 1HF9A 2E76B 4NPEA 3Q5RA 2DE5D 5APUA 3H6PA 1GU5A 3H1ID 3L73J 1MKMA 1JO5A 1JCCA 1WRGA 5AEWA 1BSNA 3CMEP 2V4HA 3GB4A 2E74C 4YXWH 4HM2A 3H1LJ 1BCCG 3HD7C 4I7ZB 3IN6A 2VRSA 3H1HJ 3V2RA 1R5LA 1O7WA 1X79B 1EDIA 4OWFA 5CCHC 1AA0A 1MZ9A 1KB9E 3CWBJ 1URQD 1ZMEC 2B87B 1LWUC 3B8EB 1SQQD 1PGJA 3ZDMA 4RO0A 5AVTB 2R32A 3L75D 2B87A 3Q5PA 3V6IA 4QDFB 2BMOA 2JDIH 1FZAA 1ZOYC 3P32A 3CCSP 1SQBJ 3CCUP 1HJBA 4DJGA 1RF1C 1NU1K 4C7NA 2KSEA 1Z56A 2FYUE 1KTMA 2E75B 2KI7B 3RBXA 1ZV8A 1GD2E 1PL5A 2N1TD 3AE8C 3GLMA 3Q1MA 1JY2P 1LTIC 4HM6A 3VYIA 4QUPA 2P1JA 2KOGA 1L0NG 4H0LC 5CJ4A 5DJUB 3C9IA 5B66E 3EN1A 3KHUA 4H13B 3AE9C 2YKPA 4JBZA 2GA1A 5APWA 1P84D 2BCCG 3L71D 1PP9E 1JCDA 2NVFA 2K9YA 2NPSA 1N7SD 3RL0D 1L0LD 1VQ4P 1PV3A 4D6TJ 5TISH 2L91A 1FJPA 4A7PA 1WQLA 1NTKG 3OA7A 4R4MA 1FS0E 3U1AA 1EDJA 1IFNA 2IDBA 4JQ0D 1BE3G 2FYZA 2JR8A 1QVGO 2QPZA 2A06E 1M56D 1EXJA 1NKZB 1LTSC 2AXCA 1GK6A 1LTJB 2HMMA 2R5DA 1HVVA 2OTLP 1AFOA 2WVRA 4HJLA 2HFED 3FX0A 2ZYDA 1P84H 1YBKA 1LTJA 1J1EB 3TGUJ 3EFGA 2E5TA 3CC4P 3GTSA 3L70G 2ZXXA 5EFWB 1YQ3C 2RN0A 5CJ0A 1VCKA 4WY4C 2Y0CA 5H2FE 1FZCC 3GKEA 1SFCD 1X22A 4PD4E 1CSBA 1VDFA 3HUSC 2R3CA 1HJ0A 4U3FE 2KZJA 4JYCA 2JP3A 3D71A 3H25A 1AV1A 3DQYA 3H32B 4OH8B 3CCLP 1KQLA 1JOCA 1EDKA 4NBED 3EQQA 1T6AA 3W68A 3KDPB 1QVFO 3H32A 1DD3A 3AE5C 3VMAA 3TF5A 2YVJB 2FXMA 1YTZI 3H1KE 3CX5D 1Q90D 1KILE 3KPEA 1NTZJ 1KQGB 3Q3DA 2QJPB 4GOFA 3MGNA 3AE1C 3B4SA 3M9BA 1YITP 1Q81Q 1BGYD 2FYUG 3AEAC 1KD1Q 4P1CH 4UB6H 2OYIB 1AJYA 5KLVJ 1JUNA 2E4PA 1RFSA 3AE6C 4AUWA 5AW0B 5AVZB 3B5NA 2OYIA 5B5EH 1LTGC 1JMBA 2PFXA 3SWKA 2V7QJ 2IBZD 3M0AA 4AAYB 1J1DC 3H1KD 2QJKB 4YXDC 2LR2A 1P84I 3SWYA 1ULJA 2PP6A 1PP9G 3D6YA 5CBNA 1L4AD 2QJYC 2WITA 1O7HA 5APVA 5KJ7D 2XU6A 2G8YA 3AEFC 2JWAA 3I55P 3VOPA 1OIPA 3H1IJ 2AEFA 1GZLA 1QLED 3RK3D 2M5AB 1GL2B 4XA4A 2WMMA 1D7MA 2IFNA 3CPWO 3MHVA 1HTLC 1SQVD 2XV5A 1PPJG 4O9BA 1GL2A 1NYHA 2N9BA 4IL6X 1G1IA 2G3AA 1SQQK 3JCUE 1FZBA 2WSFJ 5AW7B 2YNYA 2A06G 1SQXD 3F5HA 4NB8D 3P8MC 1S9KE 3SSUA 2IZ1A 4GT1A 2POHA 1SQPK 2LXCB 1JM1A 1IFJA 1URQC 2OTJP 1GK4A 2NWFA 5KKZC 4Y99C 1H88A 3H1JD 3A0HE 2A45H 2W27A 4L73A 4P1BH 1TU3F 5AW6B 2LXBA 4AQRD 1Q7YQ 3O8ZA 3ITKA 1Y47A 3CXHD 1HGZA 1NVOA 4HM4A 5APQA 1YHQP 1OVRA 2JO6A 3IR9A 2PAJA 3A0BE 1LT9C 3GHGA 1FU1A 2P10A 4U3FG 2CPBA 3D6ZA 1FZEA 1NTMK 3UIAA 2N1TC 3I5CA 4OGQB 1IZNB 1O7PA 1JNMA 1RF0A 1BCCD 2CK3H 3KZIE 1RY3A 2C9LY 2IZ0A 2E74B 1RE3C 2KXPB 2DE6D 2E75D 2PRRA 3M9QA 3L71J 3P8CE 2B89A 2AXTE 3R2PA 4AIVA 3HD7A 4Z1MH 1JY3P 4N78E 2FYUJ 1L0NE 4KJMA 1L0LJ 2HODA 3IF4A 4TLFA 2HLOA 3FOUA 1N7SC 2JEEA 3RL0C 5CCHA 2K9JA 4H13D 1NU1G 2HR3A 3TSIA 5AW4B 3FGAD 2B9BA 1LWUA 2R44A 2IBZI 1Q82Q 1NH4A 2GBWA 4I1LA 1KYOD 3AEDC 1FDMA 5BOKA 3RK2D 4HKVA 3AE7C 2WZ7A 1HGVA 1LTTC 1RH5B 1FZGA 3SFDC 3GZXA 2A45I 2E5YA 1RF1A 2WT7B 2KS1A 4N78D 1FE6A 2OTKE 2ITAA 3GHGC 1XTCC 3S4RA 2QE7H 4H0LB 3CCVP 2JWDA 3MTUE 1G2CA 2BCCD 4BXLA 3S9OA 1NO4A 1SFCC 3GMAA 1OFCX 1IFDA 4PV1D 3C8VA 4IFDK 4DZOA 1X9VA 3L72E 2M0BA 2P7JA 2HMNA 2BEQD 3L70E 1NTKD 1VQLP 5GTIH 2ZAEB 2E43A 1KZUB 2WPVB 3V4QA 3WU2H 1OVVA 5KAFH 1K73Q 3BATA 1VL2A 1FDIA 5KLIB 1BE3D 2ZYAA 3VMID 1SQPE 2V7QH 3CL3D 1Q90C 4KT0J 3CXHI 3L36A 3CC2P 2W8ZA 2WPRA 3FWNA 1VPCA 1EG9A 2W83C 3P7KA 1NKNA 1BGYJ 1NAFA 3BRVB 3WUTA 4GKGA 1SQBK 2O1KA 1N73C 4L74A 1EZVE 1IFMA 3AE3C 4ZNCA 3CCMP 5E79E 2IYPA 3NTNA 4C7NB 3L70D 5AVXB 2KP8A 2D2CD 1QEXA 3I56P 1R5SA 4H44B 3MZWB 2I1KA 1VQOP 1NTME 3H1KJ 4C7RA 4WY4B 3TNUB 1VQ5P 3L74E 3QH9A 1FZCB 2FFDC 1ZRTE 2B24A 2WWWA 4JF7A 2WSFH 1EXIA 2B1XA 4WY4A 3LIEA 1KB9D 3TNUA 1M90Q 1L4AC 3HUSB 1FZCA 1Y9BA 1SLQA 1PIXA 5BU5A 5KJ7C 1OZHA 2WSCJ 3HUSA 3RK3C 5CXMA 5CMZA 1NHLA 1GDTA 2NUMA 2OYHC 3NFQA 2FY8A 4ZKUA 1SQVJ 1L2PA 2B88A 4LLHA 4B86A 2NPSB 4C46A 1FOSE 2MJZA 1MUUA 3TYYA 5AVYB 1YTZT 1OWAA 3HE4A 2FYUD 1ZN5A 1SQXJ 1UUWA 5KAIE 2YXRB 3N4XA 3AEGC 3V2NA 1USDA 2W6AA 1PPJE 2ZFCA 3H1JJ 4W80A 3N7NA 1UIXA 1KB9H 1NYKA 1IC2A 1GW3A 4GOEA 1T8ZA 3TDKA 2KSJA 3PH0A 3A5TA 1NAYA 3G6EP 1PP9D 1CI6B 2JZAA 3M06A 3EFFK 1BDCA 3PTZA 1Q2NA 3MIWA 3SWFA 2JJLA 2KLUA 2KZIA 5B5EE 3L73E 1CI6A 3IFMA 2QJYB 3L72G 2O01N 4W7YA 3VMHD 5AVWB 3GL2A 4GIFA 4QDDA 3H1LE 3OAKA 2OYOA 2ZT9B 1BCCJ 3C1LA 3O6QA 1VF5C 1R8EA 3H1HE 2O1JA 2Y9ZA 2KK7A 1YQ4C 5APSA 1G1JA 3CCJP 3PHLA 4NBAD 2A06D 1SQPG 3U1CA 1YJ9P 2E75C 1HWTC 2YXQB 2H8PD 3AE4C 2HYNA 5B66H 3II6A 2Z4EA 4QDCA 1FAVA 5AVVB 1NTZK 2IFMA 4OGQD 4GODA 1EZVG 4BWNA 1EQ7A 3SFEC 5DJTB 2W90A 1URQB 5KKZB 2CKFA 5KLVK 4Y99B 4BRYA 5AVQB 5K5GB 1URQA 2ZXEB 2XZRA 1NTMG 4PD4D 4PJ0H 1M1JC 3B5NB 3L74G 1QL1A 4U3FD 3RK2C 1SJGA 1VQ6P 2YMYA 1NU1E 1KB9I 1H89A 5CCGD 1O7NA 3G3ZA 1S5LE 2WPQA 1L0NJ 4JPZB 1LT9A 3F89A 3CD6P 3FXDA 3VCAA 2BASA 3GF3A 3E7KA 1KILD 2BMRA 2N1TA 1GW4A 3CC7P 2BCCJ 2O3JA 4ASVA 2QRXA 3CX5H 1JB0J 4N6JA 2NVEA 2ZJSE 5H2FH 1RE3A 3OJAB 1S5LX 4PV1C 1ZLLA 4D6TE 4I2LC 1J1EC 2YKOA 1NTKJ 4PD4H 1IK7A 1NU1D 1DIPA 4UB8E 2O01J 5GTHE 4ZKPA 1FOSF 3RL0B 2K37A 2XKMA 2I8DA 1BE3J 2E76D 1X8YA 1K8AQ 2FYNC 1N7SA 1VQKP 2E4QA 2YIUB 4HM1A 5AW3B 2KNCA 4RESB 1M8OB 5AW5B 3EQ2A 3L73G 1UUVA 5L8RJ 1PFIA 3GF7A 1M57D 4HM7A 5AW9B 2KB7P 2J58A 3L70J 2WSCH 3H1LG 1VQMP 3GOBA 1NOHA 1N7LA 1SVFA 1K05A 2JKVA 1NWQA 2D2CC 3GHGB 3CCQP 2I7FA 1FZFA 3H1HG 2RKLA 3FXEA 4RJTA 3BCCE 3D89A 1H0TA 4EYYQ 1RQUA 1S9KD 3L37A 3VP8A 3CWBG 1VQ7P 1SFCB 2FXOA 1G8JB 2P2UA 4Y28J 3CCEP 2AEJA 3IAOA 2K1AA 4IL6H 3HRNA 4WBAA 4CPGA 1SFCA 2XRXA 1AVYA 2OARA 2HMJA 4QUQA 2J5UA 1FBMA 1K04A 3TK1A 4H44D 1KN7A 2FYUK 3CX5I 1L0LK 3HD7B 1NTZE 2HMKA 1SQBG 1J2JB 1VQ8P 3G9RA 1RIEA 5APTA 2Y0EA 2HODB 3VP9A 4PD4I 1QL2A 2ZYGA 2K9JB 3CXHH 2WQYC 5KLVE 4NBGD 1PGPA 1LWUB 3A2AA 4HB1A 3JCUH 3GG2A 1HBWA 2CPSA 2A45G 5CHXA 2HMOA 2Q5UA 2Q3EA 3VN0A 2Y9YA 1YJWP 4WVZA 2C0XA 2WSEJ 2NPSD 2M8RA 1N73A 3GZYA 1JY2N 2FBWC 2IX7C 4XFJA 3VMZA 2LKMA 3BASA 4N3YB 1RF1B 1RE4C 3P8CD 1SP4A 1PP9J 2KS1B 2NUKA 3PRJA 1EC5A 1JTHA 1K9MQ 3H1IE 1L0ND 5AVUB 3KYQA 3NXSA 4WWIA 2H89C 4L76A 1G2CB 4U7JA 4D6TG 1OVUA 3OW2O 2FFDA 3K5BA 3WMM0 3A0BH 1DD4A 1G8KB 1S3JA 1L4AA 3RK3B 3L35A 4LC1A 2OYHB 4DCKA 5KJ7A 1SS1A 3WUVA 1PZQA 4AYCA 3GTEA 1O7MA 1YIJP 1KFNA 3M0DC 3T97A 3RGUA 3D70A 1DEBA 2KYVA 1IO4A 2OYHA 3KZIH 1AQ5A 1NGMB 1KYOH 4HM5A 2C0WA 2YFJA 1SQQE 2YMKA 4MN4C 1ZR4A 4OGQC 3L75E 2ZT9D 2AXTH 1JM0A 3ABVC 3TGUG 1A02F 1RHZB 4LGDE 3G71P 1T3UA 5M1BA
chains in the Genus database with same CATH topology
4HM4A 3C0DA 1NYKA 2HMOA 4H0LD 2QJKC 1VF5D 3H1JE 3GZXA 1FQTA 4AAYB 2JO6A 2YFLA 3GTSA 1O7GA 1VM9A 2E74D 2D2CD 1KYOE 1UUVA 1VCKA 3GZYA 1NDOA 4HM6A 4EMJB 1SJGA 2YFIA 4QUPA 1ULJA 2DE5D 4HM7A 2NVGA 2JZAA 1NU1E 1SQBE 3CXHE 3GKEA 4NBCD 2IBZE 1O7NA 1NTME 2QJYC 2XSOA 3GOBA 3EN1A 4QURA 5AEWA 1O7HA 1O7PA 4PD4E 3L73E 3GB4A 3L74E 2I7FA 1ZRTE 4HM2A 2B24A 2GBXA 2NUKA 3BCCE 3D89A 4U3FE 3VMHD 1PP9E 5KLIC 2B1XA 4HM8A 3GL2A 3TGUE 3DQYA 4QDDA 3VCAA 3H1IE 2NVFA 3H1LE 2DE6D 2BMRA 4NBED 4NBBD 2E75D 4QCKA 2XR8A 3EQQA 1O7WA 4PV1D 5AEUA 3H1HE 1G8JB 3L72E 2HMNA 1BCCE 5CXMA 3VCPA 2BCCE 2NVEA 2YVJB 2NUMA 4NBAD 3L70E 4HM0A 1P84E 4AIVA 1G8KB 3L71E 4QDFA 5HL4A 1WQLA 2QJPC 3AZCA 1KB9E 3H1KE 2YIUC 2XSHA 2XRXA 4NB9D 2HMJA 1L0NE 4QUQA 4D6TE 4NB8D 4H44D 1SQVE 4QDCA 3GTEA 1O7MA 3FOUA 4OGQD 2HMLA 4NBHD 4QDFB 4NBDD 1NTZE 1JM1A 1L0LE 4H13D 3VMGD 1SQPE 2HMKA 3VMID 1NTKE 2BMOA 2QPZA 2A06E 2NWFA 2BMQA 5KKZC 1Q90C 3N0QA 4P1CH 4HM5A 1RIEA 1UUWA 3CX5E 2YFJA 2ZYLA 1SQQE 1SQXE 2E4PA 1ULIA 1RFSA 2E76D 1EG9A 4P1BH 2CKFA 2GBWA 2FYNC 2HMMA 3GL0A 4NBFD 3L75E 2ZT9D 5KLVE 2E4QA 1PPJE 1BE3E 3CWBE 4HJLA 4NBGD 1EZVE 5BOKA 3GCEA 4HM3A 2FYUE 2DE7D 2Q3WA 1BGYE 4HKVA 4HM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM4 A;  3C0D A;  1NYK A;  2HMO A;  4H0L D;  2QJK C;  1VF5 D;  3H1J E;  3GZX A;  1FQT A;  4AAY B;  2JO6 A;  2YFL A;  3GTS A;  1O7G A;  1VM9 A;  2E74 D;  2D2C D;  1KYO E;  1UUV A;  1VCK A;  3GZY A;  1NDO A;  4HM6 A;  4EMJ B;  1SJG A;  2YFI A;  4QUP A;  1ULJ A;  2DE5 D;  4HM7 A;  2NVG A;  2JZA A;  1NU1 E;  1SQB E;  3CXH E;  3GKE A;  4NBC D;  2IBZ E;  1O7N A;  1NTM E;  2QJY C;  2XSO A;  3GOB A;  3EN1 A;  4QUR A;  5AEW A;  1O7H A;  1O7P A;  4PD4 E;  3L73 E;  3GB4 A;  3L74 E;  2I7F A;  1ZRT E;  4HM2 A;  2B24 A;  2GBX A;  2NUK A;  3BCC E;  3D89 A;  4U3F E;  3VMH D;  1PP9 E;  5KLI C;  2B1X A;  4HM8 A;  3GL2 A;  3TGU E;  3DQY A;  4QDD A;  3VCA A;  3H1I E;  2NVF A;  3H1L E;  2DE6 D;  2BMR A;  4NBE D;  4NBB D;  2E75 D;  4QCK A;  2XR8 A;  3EQQ A;  1O7W A;  4PV1 D;  5AEU A;  3H1H E;  1G8J B;  3L72 E;  2HMN A;  1BCC E;  5CXM A;  3VCP A;  2BCC E;  2NVE A;  2YVJ B;  2NUM A;  4NBA D;  3L70 E;  4HM0 A;  1P84 E;  4AIV A;  1G8K B;  3L71 E;  4QDF A;  5HL4 A;  1WQL A;  2QJP C;  3AZC A;  1KB9 E;  3H1K E;  2YIU C;  2XSH A;  2XRX A;  4NB9 D;  2HMJ A;  1L0N E;  4QUQ A;  4D6T E;  4NB8 D;  4H44 D;  1SQV E;  4QDC A;  3GTE A;  1O7M A;  3FOU A;  4OGQ D;  2HML A;  4NBH D;  4QDF B;  4NBD D;  1NTZ E;  1JM1 A;  1L0L E;  4H13 D;  3VMG D;  1SQP E;  2HMK A;  3VMI D;  1NTK E;  2BMO A;  2QPZ A;  2A06 E;  2NWF A;  2BMQ A;  5KKZ C;  1Q90 C;  3N0Q A;  4P1C H;  4HM5 A;  1RIE A;  1UUW A;  3CX5 E;  2YFJ A;  2ZYL A;  1SQQ E;  1SQX E;  2E4P A;  1ULI A;  1RFS A;  2E76 D;  1EG9 A;  4P1B H;  2CKF A;  2GBW A;  2FYN C;  2HMM A;  3GL0 A;  4NBF D;  3L75 E;  2ZT9 D;  5KLV E;  2E4Q A;  1PPJ E;  1BE3 E;  3CWB E;  4HJL A;  4NBG D;  1EZV E;  5BOK A;  3GCE A;  4HM3 A;  2FYU E;  2DE7 D;  2Q3W A;  1BGY E;  4HKV A;  4HM1 A; 
#chains in the Genus database with same CATH topology
 2L5G B;  3VTP C;  3BRT B;  1GTW A;  2K88 A;  3BCC G;  1JEK A;  5TIS E;  3LID A;  2RH0 A;  1HH0 A;  1W2E A;  3MUD A;  4U3F J;  1OMI A;  3L72 D;  1MFZ A;  3MP7 B;  4OVN F;  3NMD A;  4NPD A;  1LTA C;  3G4S P;  5CCG C;  2UWJ E;  2XNX A;  1JY2 O;  1LP1 B;  1S1C X;  1S72 P;  2O01 H;  4GDO A;  3QWO C;  1H8A A;  1SQP D;  1LP1 A;  1P84 E;  1NTZ G;  1VF5 B;  3B5N D;  3L71 E;  4QDF A;  1M7L A;  1KIL C;  2IYO A;  1SQV K;  2IPP A;  2DW3 A;  3AEE C;  1EZV D;  5KLV G;  1L0L E;  3VMG D;  2PGD A;  2BMQ A;  1ZP0 C;  4QMA A;  1SQX K;  2ZYL A;  1NU1 J;  2OQQ A;  1S4X A;  3HE4 B;  1VQ9 P;  3WUU A;  1KYO I;  3EWK A;  3C0D A;  2E76 C;  1NTM D;  1BSH A;  1OW7 A;  2P67 A;  3L74 D;  1ZRT D;  5AW8 B;  1O7G A;  3CCR P;  1S2E A;  1HUC A;  1GL2 D;  2NZ2 A;  1CW5 A;  4EMJ B;  2YFI A;  1M1J B;  3CMA P;  3L4F A;  3VMY A;  2NVG A;  1AVO A;  3FWL A;  1FJK A;  5CBO A;  1CZQ A;  3H1I G;  1YI2 P;  3RK2 B;  2KUB A;  3BVH A;  4QUR A;  1DEE G;  3LW5 J;  3JC2 2;  1M1J A;  4I7Z C;  3MUD C;  2GUS A;  2YO3 A;  5KLI C;  4EOT A;  1N2D C;  1GU4 A;  3U59 A;  4PJ0 E;  1DX7 A;  4UB6 E;  4R4L A;  5E79 H;  1XTG B;  1YJN P;  1J1D B;  3HTK B;  1OW6 A;  5AEU A;  1A02 J;  1T2K D;  2WSS H;  1LJ2 A;  3HTK A;  2XDJ A;  4HKZ H;  3O6Q B;  1U7M A;  1IK9 A;  2H43 A;  2Y0D A;  1SQQ G;  3B71 A;  1OW8 A;  2M3B A;  4XE5 B;  1PPJ D;  4PV1 B;  3L75 G;  1U57 A;  3CX5 E;  4H44 C;  4YTP C;  1WT6 A;  2XND H;  2WSE H;  1FC2 C;  2GM4 A;  3CWB E;  3GCE A;  2QSI A;  1W5C E;  1BGY E;  1W2B O;  3BCC J;  2FYN B;  3R4Y A;  1JMM A;  4ZMD A;  4W7Z A;  2NRG A;  3L73 D;  4BRY B;  2E74 D;  1QX8 A;  2N9Y B;  4H13 C;  3H1L D;  1SQB E;  1U7J A;  3HD7 D;  3Q5S A;  4NBC D;  2IBZ E;  5KAI H;  4L75 A;  3V2Q A;  2NPS C;  3H1H D;  3AEC C;  2GBX A;  1IFI A;  1L0N K;  1OXZ A;  2Q6Q A;  4K3A A;  5CCH D;  2D2C B;  2QM7 A;  3L71 G;  4I6M C;  4M3L A;  1E79 H;  1VQN P;  1IFP A;  2YKQ A;  1MFT A;  2J59 M;  3CWB D;  4IOI H;  1LT9 B;  1KMI Z;  1EDL A;  2KIK A;  1RQV A;  4HM0 A;  1EZV I;  3RK3 E;  1L0L G;  5TJH A;  5HL4 A;  4YPC A;  4IFF A;  1GMJ A;  3AZC A;  2N1T B;  4NB9 D;  1JY3 N;  1KQS O;  3VMX A;  1SQV E;  4EI2 A;  3PJS K;  1LTB C;  2HML A;  1SQB D;  4NBD D;  2M3E A;  1NTK K;  5AVR B;  1ZW0 A;  3CLQ A;  1LTJ C;  4DT0 A;  3USS A;  1YYC A;  1SQX E;  5BVZ A;  2FXP A;  1AQT A;  4IL6 E;  1KV4 A;  4HM3 A;  2DE7 D;  1BDD A;  2JO1 A;  4H0L D;  2Z5H A;  3H1J E;  4NPF X;  1N7S B;  3PLN A;  2ZT9 C;  2QA4 P;  1QGK B;  1N8R Q;  2BEZ F;  4K35 A;  2KNC B;  3W67 A;  2SPZ A;  2QVA A;  2QIW A;  3CXH E;  2M5A A;  2XSO A;  2Q3I A;  3A7O A;  5C39 A;  1E5W A;  1NJI Q;  2GUV A;  2QEX P;  3TGU E;  3V2P A;  2Q9I A;  2W6B A;  3HE5 B;  3L72 J;  4D6T D;  4QCK A;  1RE4 A;  1KC8 Q;  2H88 C;  3MD0 A;  1SQQ J;  1IJD B;  1LNQ A;  3A3Y B;  1H0T B;  1BCC E;  3HE5 A;  3VCP A;  1FDO A;  3V5B A;  3L75 J;  1Y8A A;  2QJP C;  3S1K A;  4DOJ A;  2XSH A;  2P58 A;  2WPS A;  4KHX A;  3M9H A;  1S5L H;  1SQP J;  1X0T A;  2KLV A;  3B5N C;  4NBH D;  2OYI C;  1WMK A;  1BGY G;  1ZR2 A;  4HH2 A;  2AEM A;  3KQG A;  1ULI A;  5BU8 B;  1JY3 O;  3GL0 A;  5AVS B;  3TGU D;  4NBF D;  3M0D A;  4JYB A;  1ZXG A;  1VQP P;  4HJG H;  4WY4 D;  1T3J A;  2QJK C;  3LW5 H;  1VF5 D;  2IBZ G;  1FQT A;  2ZVO B;  2YFL A;  2R3S A;  2K3R A;  1VM9 A;  1KYO E;  3BCC D;  3Q2Y A;  1NDO A;  3H1K G;  4UB8 H;  4HYT B;  1NTM J;  2QM8 A;  5GTI E;  2W6J H;  4IFM A;  5GTH H;  1MV8 A;  3M91 A;  3WU2 E;  3L74 J;  5KAF E;  1UII A;  1OX3 A;  1Q86 Q;  2Q7C A;  2HG5 D;  1N73 B;  3RBZ A;  1GL2 C;  1KFM A;  4RKU J;  2E42 A;  3E1I A;  4TT3 H;  3AE2 C;  4HM8 A;  3V4W A;  1DH3 A;  3E1R A;  3PP5 A;  1M1K Q;  2RMZ A;  3JSV C;  2MKV A;  5AW1 B;  4NBB D;  2XR8 A;  2WTY A;  2FKW B;  4ASW A;  1SQV G;  3A0H H;  1JTH B;  1NTZ D;  2BCC E;  1N86 A;  3GW6 A;  2YIU C;  5CCG A;  1KOR A;  3AEB C;  2I1J A;  3RL0 g;  2R5B A;  2H7H A;  1SQX G;  4EDF A;  2FFD B;  1KIL B;  1T2K C;  5KLV D;  2OGU A;  2QG4 A;  2Z5I A;  4EIJ A;  1L4A B;  1NTK E;  1KQF B;  2HPC B;  5AW2 B;  3N0Q A;  5APX A;  1KIL A;  1PGO A;  5KTB A;  4WB4 A;  3H1J G;  1USE A;  1LGH B;  3T97 B;  2ZVN B;  2HPC A;  2C9N Y;  1LT1 A;  1PGQ A;  1BE3 E;  2Q3W A;  2WT7 A;  2Q1K A;  3KXD A;  1RF0 C;  3CI9 A;  5APY A;  2YO2 A;  1HF9 A;  2E76 B;  4NPE A;  3Q5R A;  2DE5 D;  5APU A;  3H6P A;  1GU5 A;  3H1I D;  3L73 J;  1MKM A;  1JO5 A;  1JCC A;  1WRG A;  5AEW A;  1BSN A;  3CME P;  2V4H A;  3GB4 A;  2E74 C;  4YXW H;  4HM2 A;  3H1L J;  1BCC G;  3HD7 C;  4I7Z B;  3IN6 A;  2VRS A;  3H1H J;  3V2R A;  1R5L A;  1O7W A;  1X79 B;  1EDI A;  4OWF A;  5CCH C;  1AA0 A;  1MZ9 A;  1KB9 E;  3CWB J;  1URQ D;  1ZME C;  2B87 B;  1LWU C;  3B8E B;  1SQQ D;  1PGJ A;  3ZDM A;  4RO0 A;  5AVT B;  2R32 A;  3L75 D;  2B87 A;  3Q5P A;  3V6I A;  4QDF B;  2BMO A;  2JDI H;  1FZA A;  1ZOY C;  3P32 A;  3CCS P;  1SQB J;  3CCU P;  1HJB A;  4DJG A;  1RF1 C;  1NU1 K;  4C7N A;  2KSE A;  1Z56 A;  2FYU E;  1KTM A;  2E75 B;  2KI7 B;  3RBX A;  1ZV8 A;  1GD2 E;  1PL5 A;  2N1T D;  3AE8 C;  3GLM A;  3Q1M A;  1JY2 P;  1LTI C;  4HM6 A;  3VYI A;  4QUP A;  2P1J A;  2KOG A;  1L0N G;  4H0L C;  5CJ4 A;  5DJU B;  3C9I A;  5B66 E;  3EN1 A;  3KHU A;  4H13 B;  3AE9 C;  2YKP A;  4JBZ A;  2GA1 A;  5APW A;  1P84 D;  2BCC G;  3L71 D;  1PP9 E;  1JCD A;  2NVF A;  2K9Y A;  2NPS A;  1N7S D;  3RL0 D;  1L0L D;  1VQ4 P;  1PV3 A;  4D6T J;  5TIS H;  2L91 A;  1FJP A;  4A7P A;  1WQL A;  1NTK G;  3OA7 A;  4R4M A;  1FS0 E;  3U1A A;  1EDJ A;  1IFN A;  2IDB A;  4JQ0 D;  1BE3 G;  2FYZ A;  2JR8 A;  1QVG O;  2QPZ A;  2A06 E;  1M56 D;  1EXJ A;  1NKZ B;  1LTS C;  2AXC A;  1GK6 A;  1LTJ B;  2HMM A;  2R5D A;  1HVV A;  2OTL P;  1AFO A;  2WVR A;  4HJL A;  2HFE D;  3FX0 A;  2ZYD A;  1P84 H;  1YBK A;  1LTJ A;  1J1E B;  3TGU J;  3EFG A;  2E5T A;  3CC4 P;  3GTS A;  3L70 G;  2ZXX A;  5EFW B;  1YQ3 C;  2RN0 A;  5CJ0 A;  1VCK A;  4WY4 C;  2Y0C A;  5H2F E;  1FZC C;  3GKE A;  1SFC D;  1X22 A;  4PD4 E;  1CSB A;  1VDF A;  3HUS C;  2R3C A;  1HJ0 A;  4U3F E;  2KZJ A;  4JYC A;  2JP3 A;  3D71 A;  3H25 A;  1AV1 A;  3DQY A;  3H32 B;  4OH8 B;  3CCL P;  1KQL A;  1JOC A;  1EDK A;  4NBE D;  3EQQ A;  1T6A A;  3W68 A;  3KDP B;  1QVF O;  3H32 A;  1DD3 A;  3AE5 C;  3VMA A;  3TF5 A;  2YVJ B;  2FXM A;  1YTZ I;  3H1K E;  3CX5 D;  1Q90 D;  1KIL E;  3KPE A;  1NTZ J;  1KQG B;  3Q3D A;  2QJP B;  4GOF A;  3MGN A;  3AE1 C;  3B4S A;  3M9B A;  1YIT P;  1Q81 Q;  1BGY D;  2FYU G;  3AEA C;  1KD1 Q;  4P1C H;  4UB6 H;  2OYI B;  1AJY A;  5KLV J;  1JUN A;  2E4P A;  1RFS A;  3AE6 C;  4AUW A;  5AW0 B;  5AVZ B;  3B5N A;  2OYI A;  5B5E H;  1LTG C;  1JMB A;  2PFX A;  3SWK A;  2V7Q J;  2IBZ D;  3M0A A;  4AAY B;  1J1D C;  3H1K D;  2QJK B;  4YXD C;  2LR2 A;  1P84 I;  3SWY A;  1ULJ A;  2PP6 A;  1PP9 G;  3D6Y A;  5CBN A;  1L4A D;  2QJY C;  2WIT A;  1O7H A;  5APV A;  5KJ7 D;  2XU6 A;  2G8Y A;  3AEF C;  2JWA A;  3I55 P;  3VOP A;  1OIP A;  3H1I J;  2AEF A;  1GZL A;  1QLE D;  3RK3 D;  2M5A B;  1GL2 B;  4XA4 A;  2WMM A;  1D7M A;  2IFN A;  3CPW O;  3MHV A;  1HTL C;  1SQV D;  2XV5 A;  1PPJ G;  4O9B A;  1GL2 A;  1NYH A;  2N9B A;  4IL6 X;  1G1I A;  2G3A A;  1SQQ K;  3JCU E;  1FZB A;  2WSF J;  5AW7 B;  2YNY A;  2A06 G;  1SQX D;  3F5H A;  4NB8 D;  3P8M C;  1S9K E;  3SSU A;  2IZ1 A;  4GT1 A;  2POH A;  1SQP K;  2LXC B;  1JM1 A;  1IFJ A;  1URQ C;  2OTJ P;  1GK4 A;  2NWF A;  5KKZ C;  4Y99 C;  1H88 A;  3H1J D;  3A0H E;  2A45 H;  2W27 A;  4L73 A;  4P1B H;  1TU3 F;  5AW6 B;  2LXB A;  4AQR D;  1Q7Y Q;  3O8Z A;  3ITK A;  1Y47 A;  3CXH D;  1HGZ A;  1NVO A;  4HM4 A;  5APQ A;  1YHQ P;  1OVR A;  2JO6 A;  3IR9 A;  2PAJ A;  3A0B E;  1LT9 C;  3GHG A;  1FU1 A;  2P10 A;  4U3F G;  2CPB A;  3D6Z A;  1FZE A;  1NTM K;  3UIA A;  2N1T C;  3I5C A;  4OGQ B;  1IZN B;  1O7P A;  1JNM A;  1RF0 A;  1BCC D;  2CK3 H;  3KZI E;  1RY3 A;  2C9L Y;  2IZ0 A;  2E74 B;  1RE3 C;  2KXP B;  2DE6 D;  2E75 D;  2PRR A;  3M9Q A;  3L71 J;  3P8C E;  2B89 A;  2AXT E;  3R2P A;  4AIV A;  3HD7 A;  4Z1M H;  1JY3 P;  4N78 E;  2FYU J;  1L0N E;  4KJM A;  1L0L J;  2HOD A;  3IF4 A;  4TLF A;  2HLO A;  3FOU A;  1N7S C;  2JEE A;  3RL0 C;  5CCH A;  2K9J A;  4H13 D;  1NU1 G;  2HR3 A;  3TSI A;  5AW4 B;  3FGA D;  2B9B A;  1LWU A;  2R44 A;  2IBZ I;  1Q82 Q;  1NH4 A;  2GBW A;  4I1L A;  1KYO D;  3AED C;  1FDM A;  5BOK A;  3RK2 D;  4HKV A;  3AE7 C;  2WZ7 A;  1HGV A;  1LTT C;  1RH5 B;  1FZG A;  3SFD C;  3GZX A;  2A45 I;  2E5Y A;  1RF1 A;  2WT7 B;  2KS1 A;  4N78 D;  1FE6 A;  2OTK E;  2ITA A;  3GHG C;  1XTC C;  3S4R A;  2QE7 H;  4H0L B;  3CCV P;  2JWD A;  3MTU E;  1G2C A;  2BCC D;  4BXL A;  3S9O A;  1NO4 A;  1SFC C;  3GMA A;  1OFC X;  1IFD A;  4PV1 D;  3C8V A;  4IFD K;  4DZO A;  1X9V A;  3L72 E;  2M0B A;  2P7J A;  2HMN A;  2BEQ D;  3L70 E;  1NTK D;  1VQL P;  5GTI H;  2ZAE B;  2E43 A;  1KZU B;  2WPV B;  3V4Q A;  3WU2 H;  1OVV A;  5KAF H;  1K73 Q;  3BAT A;  1VL2 A;  1FDI A;  5KLI B;  1BE3 D;  2ZYA A;  3VMI D;  1SQP E;  2V7Q H;  3CL3 D;  1Q90 C;  4KT0 J;  3CXH I;  3L36 A;  3CC2 P;  2W8Z A;  2WPR A;  3FWN A;  1VPC A;  1EG9 A;  2W83 C;  3P7K A;  1NKN A;  1BGY J;  1NAF A;  3BRV B;  3WUT A;  4GKG A;  1SQB K;  2O1K A;  1N73 C;  4L74 A;  1EZV E;  1IFM A;  3AE3 C;  4ZNC A;  3CCM P;  5E79 E;  2IYP A;  3NTN A;  4C7N B;  3L70 D;  5AVX B;  2KP8 A;  2D2C D;  1QEX A;  3I56 P;  1R5S A;  4H44 B;  3MZW B;  2I1K A;  1VQO P;  1NTM E;  3H1K J;  4C7R A;  4WY4 B;  3TNU B;  1VQ5 P;  3L74 E;  3QH9 A;  1FZC B;  2FFD C;  1ZRT E;  2B24 A;  2WWW A;  4JF7 A;  2WSF H;  1EXI A;  2B1X A;  4WY4 A;  3LIE A;  1KB9 D;  3TNU A;  1M90 Q;  1L4A C;  3HUS B;  1FZC A;  1Y9B A;  1SLQ A;  1PIX A;  5BU5 A;  5KJ7 C;  1OZH A;  2WSC J;  3HUS A;  3RK3 C;  5CXM A;  5CMZ A;  1NHL A;  1GDT A;  2NUM A;  2OYH C;  3NFQ A;  2FY8 A;  4ZKU A;  1SQV J;  1L2P A;  2B88 A;  4LLH A;  4B86 A;  2NPS B;  4C46 A;  1FOS E;  2MJZ A;  1MUU A;  3TYY A;  5AVY B;  1YTZ T;  1OWA A;  3HE4 A;  2FYU D;  1ZN5 A;  1SQX J;  1UUW A;  5KAI E;  2YXR B;  3N4X A;  3AEG C;  3V2N A;  1USD A;  2W6A A;  1PPJ E;  2ZFC A;  3H1J J;  4W80 A;  3N7N A;  1UIX A;  1KB9 H;  1NYK A;  1IC2 A;  1GW3 A;  4GOE A;  1T8Z A;  3TDK A;  2KSJ A;  3PH0 A;  3A5T A;  1NAY A;  3G6E P;  1PP9 D;  1CI6 B;  2JZA A;  3M06 A;  3EFF K;  1BDC A;  3PTZ A;  1Q2N A;  3MIW A;  3SWF A;  2JJL A;  2KLU A;  2KZI A;  5B5E E;  3L73 E;  1CI6 A;  3IFM A;  2QJY B;  3L72 G;  2O01 N;  4W7Y A;  3VMH D;  5AVW B;  3GL2 A;  4GIF A;  4QDD A;  3H1L E;  3OAK A;  2OYO A;  2ZT9 B;  1BCC J;  3C1L A;  3O6Q A;  1VF5 C;  1R8E A;  3H1H E;  2O1J A;  2Y9Z A;  2KK7 A;  1YQ4 C;  5APS A;  1G1J A;  3CCJ P;  3PHL A;  4NBA D;  2A06 D;  1SQP G;  3U1C A;  1YJ9 P;  2E75 C;  1HWT C;  2YXQ B;  2H8P D;  3AE4 C;  2HYN A;  5B66 H;  3II6 A;  2Z4E A;  4QDC A;  1FAV A;  5AVV B;  1NTZ K;  2IFM A;  4OGQ D;  4GOD A;  1EZV G;  4BWN A;  1EQ7 A;  3SFE C;  5DJT B;  2W90 A;  1URQ B;  5KKZ B;  2CKF A;  5KLV K;  4Y99 B;  4BRY A;  5AVQ B;  5K5G B;  1URQ A;  2ZXE B;  2XZR A;  1NTM G;  4PD4 D;  4PJ0 H;  1M1J C;  3B5N B;  3L74 G;  1QL1 A;  4U3F D;  3RK2 C;  1SJG A;  1VQ6 P;  2YMY A;  1NU1 E;  1KB9 I;  1H89 A;  5CCG D;  1O7N A;  3G3Z A;  1S5L E;  2WPQ A;  1L0N J;  4JPZ B;  1LT9 A;  3F89 A;  3CD6 P;  3FXD A;  3VCA A;  2BAS A;  3GF3 A;  3E7K A;  1KIL D;  2BMR A;  2N1T A;  1GW4 A;  3CC7 P;  2BCC J;  2O3J A;  4ASV A;  2QRX A;  3CX5 H;  1JB0 J;  4N6J A;  2NVE A;  2ZJS E;  5H2F H;  1RE3 A;  3OJA B;  1S5L X;  4PV1 C;  1ZLL A;  4D6T E;  4I2L C;  1J1E C;  2YKO A;  1NTK J;  4PD4 H;  1IK7 A;  1NU1 D;  1DIP A;  4UB8 E;  2O01 J;  5GTH E;  4ZKP A;  1FOS F;  3RL0 B;  2K37 A;  2XKM A;  2I8D A;  1BE3 J;  2E76 D;  1X8Y A;  1K8A Q;  2FYN C;  1N7S A;  1VQK P;  2E4Q A;  2YIU B;  4HM1 A;  5AW3 B;  2KNC A;  4RES B;  1M8O B;  5AW5 B;  3EQ2 A;  3L73 G;  1UUV A;  5L8R J;  1PFI A;  3GF7 A;  1M57 D;  4HM7 A;  5AW9 B;  2KB7 P;  2J58 A;  3L70 J;  2WSC H;  3H1L G;  1VQM P;  3GOB A;  1NOH A;  1N7L A;  1SVF A;  1K05 A;  2JKV A;  1NWQ A;  2D2C C;  3GHG B;  3CCQ P;  2I7F A;  1FZF A;  3H1H G;  2RKL A;  3FXE A;  4RJT A;  3BCC E;  3D89 A;  1H0T A;  4EYY Q;  1RQU A;  1S9K D;  3L37 A;  3VP8 A;  3CWB G;  1VQ7 P;  1SFC B;  2FXO A;  1G8J B;  2P2U A;  4Y28 J;  3CCE P;  2AEJ A;  3IAO A;  2K1A A;  4IL6 H;  3HRN A;  4WBA A;  4CPG A;  1SFC A;  2XRX A;  1AVY A;  2OAR A;  2HMJ A;  4QUQ A;  2J5U A;  1FBM A;  1K04 A;  3TK1 A;  4H44 D;  1KN7 A;  2FYU K;  3CX5 I;  1L0L K;  3HD7 B;  1NTZ E;  2HMK A;  1SQB G;  1J2J B;  1VQ8 P;  3G9R A;  1RIE A;  5APT A;  2Y0E A;  2HOD B;  3VP9 A;  4PD4 I;  1QL2 A;  2ZYG A;  2K9J B;  3CXH H;  2WQY C;  5KLV E;  4NBG D;  1PGP A;  1LWU B;  3A2A A;  4HB1 A;  3JCU H;  3GG2 A;  1HBW A;  2CPS A;  2A45 G;  5CHX A;  2HMO A;  2Q5U A;  2Q3E A;  3VN0 A;  2Y9Y A;  1YJW P;  4WVZ A;  2C0X A;  2WSE J;  2NPS D;  2M8R A;  1N73 A;  3GZY A;  1JY2 N;  2FBW C;  2IX7 C;  4XFJ A;  3VMZ A;  2LKM A;  3BAS A;  4N3Y B;  1RF1 B;  1RE4 C;  3P8C D;  1SP4 A;  1PP9 J;  2KS1 B;  2NUK A;  3PRJ A;  1EC5 A;  1JTH A;  1K9M Q;  3H1I E;  1L0N D;  5AVU B;  3KYQ A;  3NXS A;  4WWI A;  2H89 C;  4L76 A;  1G2C B;  4U7J A;  4D6T G;  1OVU A;  3OW2 O;  2FFD A;  3K5B A;  3WMM 0;  3A0B H;  1DD4 A;  1G8K B;  1S3J A;  1L4A A;  3RK3 B;  3L35 A;  4LC1 A;  2OYH B;  4DCK A;  5KJ7 A;  1SS1 A;  3WUV A;  1PZQ A;  4AYC A;  3GTE A;  1O7M A;  1YIJ P;  1KFN A;  3M0D C;  3T97 A;  3RGU A;  3D70 A;  1DEB A;  2KYV A;  1IO4 A;  2OYH A;  3KZI H;  1AQ5 A;  1NGM B;  1KYO H;  4HM5 A;  2C0W A;  2YFJ A;  1SQQ E;  2YMK A;  4MN4 C;  1ZR4 A;  4OGQ C;  3L75 E;  2ZT9 D;  2AXT H;  1JM0 A;  3ABV C;  3TGU G;  1A02 F;  1RHZ B;  4LGD E;  3G71 P;  1T3U A;  5M1B A; 
#chains in the Genus database with same CATH homology
 4HM4 A;  3C0D A;  1NYK A;  2HMO A;  4H0L D;  2QJK C;  1VF5 D;  3H1J E;  3GZX A;  1FQT A;  4AAY B;  2JO6 A;  2YFL A;  3GTS A;  1O7G A;  1VM9 A;  2E74 D;  2D2C D;  1KYO E;  1UUV A;  1VCK A;  3GZY A;  1NDO A;  4HM6 A;  4EMJ B;  1SJG A;  2YFI A;  4QUP A;  1ULJ A;  2DE5 D;  4HM7 A;  2NVG A;  2JZA A;  1NU1 E;  1SQB E;  3CXH E;  3GKE A;  4NBC D;  2IBZ E;  1O7N A;  1NTM E;  2QJY C;  2XSO A;  3GOB A;  3EN1 A;  4QUR A;  5AEW A;  1O7H A;  1O7P A;  4PD4 E;  3L73 E;  3GB4 A;  3L74 E;  2I7F A;  1ZRT E;  4HM2 A;  2B24 A;  2GBX A;  2NUK A;  3BCC E;  3D89 A;  4U3F E;  3VMH D;  1PP9 E;  5KLI C;  2B1X A;  4HM8 A;  3GL2 A;  3TGU E;  3DQY A;  4QDD A;  3VCA A;  3H1I E;  2NVF A;  3H1L E;  2DE6 D;  2BMR A;  4NBE D;  4NBB D;  2E75 D;  4QCK A;  2XR8 A;  3EQQ A;  1O7W A;  4PV1 D;  5AEU A;  3H1H E;  1G8J B;  3L72 E;  2HMN A;  1BCC E;  5CXM A;  3VCP A;  2BCC E;  2NVE A;  2YVJ B;  2NUM A;  4NBA D;  3L70 E;  4HM0 A;  1P84 E;  4AIV A;  1G8K B;  3L71 E;  4QDF A;  5HL4 A;  1WQL A;  2QJP C;  3AZC A;  1KB9 E;  3H1K E;  2YIU C;  2XSH A;  2XRX A;  4NB9 D;  2HMJ A;  1L0N E;  4QUQ A;  4D6T E;  4NB8 D;  4H44 D;  1SQV E;  4QDC A;  3GTE A;  1O7M A;  3FOU A;  4OGQ D;  2HML A;  4NBH D;  4QDF B;  4NBD D;  1NTZ E;  1JM1 A;  1L0L E;  4H13 D;  3VMG D;  1SQP E;  2HMK A;  3VMI D;  1NTK E;  2BMO A;  2QPZ A;  2A06 E;  2NWF A;  2BMQ A;  5KKZ C;  1Q90 C;  3N0Q A;  4P1C H;  4HM5 A;  1RIE A;  1UUW A;  3CX5 E;  2YFJ A;  2ZYL A;  1SQQ E;  1SQX E;  2E4P A;  1ULI A;  1RFS A;  2E76 D;  1EG9 A;  4P1B H;  2CKF A;  2GBW A;  2FYN C;  2HMM A;  3GL0 A;  4NBF D;  3L75 E;  2ZT9 D;  5KLV E;  2E4Q A;  1PPJ E;  1BE3 E;  3CWB E;  4HJL A;  4NBG D;  1EZV E;  5BOK A;  3GCE A;  4HM3 A;  2FYU E;  2DE7 D;  2Q3W A;  1BGY E;  4HKV A;  4HM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...