1EZVE

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ezvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ezvE02
4QUQA 4NBBD 4AIVA 4NB9D 2IBZE 2HMLA 2ZT9D 3L71E 3EQQA 4NB8D 1SQBE 1NTME 3H1JE 3C0DA 1G8KB 3VMGD 4PV1D 3H1LE 2YIUC 4H0LD 1ULIA 2GBXA 5KKZC 5CXMA 1O7GA 2E4PA 2DE5D 4QDFA 1P84E 3H1IE 2XRXA 4HM8A 1SJGA 3VCPA 3L73E 1Q90C 2NVEA 2FYUE 2DE7D 3D89A 2YVJB 4QDDA 1RFSA 2Q3WA 4NBCD 1O7NA 2E4QA 2DE6D 3GZXA 4HM0A 1VF5D 3TGUE 1O7PA 2CKFA 4PD4E 3FOUA 1KYOE 2XR8A 4HM7A 4NBFD 1FQTA 3L75E 4U3FE 2HMOA 4OGQD 4EMJB 2JZAA 2YFLA 1VCKA 2BMRA 4P1BH 5HL4A 1JM1A 2ZYLA 4HJLA 1O7HA 3CX5E 4HKVA 1KB9E 1O7WA 3GTEA 4HM6A 3BCCE 1NDOA 3L70E 4HM5A 2BCCE 2E74D 2NVFA 1SQPE 1BGYE 3L74E 2JO6A 3GZYA 3GCEA 2B24A 3VMHD 2HMKA 2HMMA 2QJYC 5KLVE 4NBHD 3DQYA 3VCAA 3VMID 4H44D 2A06E 3H1HE 1PP9E 5AEWA 1UUVA 2NUMA 3H1KE 2B1XA 3CXHE 1VM9A 2HMNA 3EN1A 4HM2A 1RIEA 1G8JB 2NVGA 1ULJA 2I7FA 3GB4A 4P1CH 2YFJA 2BMQA 2D2CD 4NBAD 1SQVE 3L72E 2NWFA 1BCCE 1WQLA 4HM1A 1BE3E 2GBWA 1EG9A 4QDFB 3CWBE 2NUKA 4HM4A 1SQQE 1EZVE 1L0LE 1NTKE 1NTZE 1UUWA 3GKEA 4AAYB 1NYKA 2E75D 1O7MA 4NBGD 4QDCA 4QURA 2YFIA 1NU1E 2XSOA 1ZRTE 2QJPC 4HM3A 4D6TE 5KLIC 4QUPA 3GL0A 3AZCA 4QCKA 2HMJA 3N0QA 1SQXE 3GOBA 5BOKA 2FYNC 3GTSA 2XSHA 5AEUA 1L0NE 3GL2A 1PPJE 4NBED 2E76D 4NBDD 2BMOA 2QJKC 2QPZA 4H13D
chains in the Genus database with same CATH superfamily
4AIVA 5CCGA 4Y28J 3SWYA 1VQOP 3VTPC 3JSVC 1FU1A 2WT7A 2GBXA 3CXHI 1JY2O 1VQ8P 3P8MC 1CW5A 1UIXA 2MJZA 3UIAA 1YJ9P 1JCCA 5BU5A 4XFJA 2K1AA 3K5BA 4MN4C 1ZW0A 1KB9D 3V4WA 1JEKA 1U57A 1IO4A 2JJLA 2M5AA 3TGUG 1VQLP 3T97B 1G2CA 1GK6A 4H13B 1JY2P 1SQBK 3CC2P 1KB9E 2BCCE 3IAOA 3WU2H 5AW8B 1K05A 3G9RA 4PV1B 2HPCB 1LTTC 3AE8C 5KJ7D 3EN1A 5B66H 2O01J 2BEZF 2NVGA 1AFOA 2ZXEB 2WZ7A 1J2JB 2IZ1A 2V7QJ 4HM1A 1LT9A 3FXDA 3GKEA 5AW2B 4NBGD 1HJBA 4OGQB 4IL6H 4H0LB 1A02F 1NTZD 2YMKA 3BASA 3T97A 5CCGD 1GK4A 3AE3C 2XNXA 3FWNA 1JTHB 1VQ7P 3CCRP 1OVRA 2E74B 1SQXG 1FOSF 4NBED 2R3CA 1P84D 3H1ID 2HPCA 5E79H 1SQBE 1PGPA 2Z4EA 2Z5IA 3ABVC 3Q3DA 1P84E 3H1IE 1ZXGA 3NFQA 2QJKB 1HBWA 5GTIH 1LWUA 2NVEA 1BSNA 2Y0CA 1URQB 3M0DA 3VMYA 2M8RA 3VYIA 3G4SP 2B87B 3RBZA 1VF5D 1JTHA 2ZAEB 2E76B 4U3FG 1R8EA 1NAYA 3D6YA 1RQUA 2OYIB 5APXA 3GHGA 3VMHD 5AVQB 2FXPA 1M1JB 3VCAA 1SQPG 1UUVA 3PTZA 1J1EC 1JMBA 1VQ9P 1OW8A 3VP8A 2BMQA 4WWIA 2WITA 1EG9A 1AVYA 4H44C 5CBOA 1URQA 1YTZI 1IFPA 2B87A 2OTLP 1O7MA 1X22A 4I7ZB 1M57D 4HM3A 2M3EA 1NTKD 1KFMA 2IDBA 1T2KD 1L4AC 2W83C 2P1JA 2OYIA 2M3BA 1Q2NA 3GL2A 3B5NB 2E75C 3G6EP 2BCCJ 1GZLA 3ITKA 2FYUD 1S5LE 3OA7A 5CJ4A 2W90A 4H0LD 1NTMD 1KYOD 1FBMA 3AEFC 3V5BA 2IYOA 1SJGA 3VCPA 1OWAA 1AVOA 2FYUE 1FZCB 2Q3EA 1RFSA 2XU6A 4OH8B 1Q86Q 2K9JB 3HTKA 1YITP 4K3AA 2CKFA 1KYOE 4NBFD 1HGVA 5KAFE 1S4XA 1DX7A 3B5NA 1QEXA 4HM6A 2XNDH 3RK2B 4HM5A 3L72D 2BCCG 3CWBD 1SQBJ 5AW5B 3L70D 1NWQA 2IBZI 4I6MC 2HMNA 4L75A 2Y9ZA 4P1CH 3H1IJ 3H1KD 3F89A 1IFDA 2YXRB 3L72E 2NWFA 3CWBE 1FZCA 5KTBA 1KILB 4BRYB 1RH5B 2K9JA 1EXIA 3TDKA 5KLIC 1Y8AA 1QGKB 3L71D 3CCJP 2QRXA 5B5EE 5H2FH 3LW5H 2QPZA 3RK3D 4NBBD 1QX8A 3CMEP 3A7OA 3L71E 3E1IA 4NB8D 5KAIE 1DH3A 1L0NK 1FE6A 1FDMA 3C0DA 1SQBG 1QL2A 3HE5B 1K8AQ 4PD4D 1O7GA 2ZFCA 2E4PA 3ZDMA 3H1IG 1KILA 4BRYA 5APTA 2YVJB 4NBCD 1JY2N 2E43A 3IFMA 3U1CA 3PJSK 4B86A 1BGYD 3KYQA 4PD4E 2AXCA 4W7YA 1HF9A 1IC2A 3TGUD 2ZYLA 2R44A 2OGUA 4L76A 2W6AA 1BGYE 3I55P 2JO1A 2XDJA 3BRVB 2KOGA 3SWFA 3HE5A 1FZGA 5KKZB 3HD7C 2FKWB 3V2PA 3MGNA 3TK1A 3AE7C 2QJPC 3WMM0 2HFED 4R4LA 1OVVA 2Z5HA 4IFDK 2D2CC 3AEEC 4IFFA 1W2EA 1VDFA 3RL0B 2FYNC 3H1LD 3AE6C 3CXHH 1MUUA 2KS1B 1KILD 3VMAA 1G8KB 1GL2A 2K9YA 3H1LE 3W68A 3NXSA 4TLFA 2IFMA 4UB6H 1N73B 3N7NA 3CWBJ 3R2PA 2AEMA 5B66E 1KILE 1LT1A 3GF3A 4ASWA 1H0TA 2C0WA 3GZXA 2QG4A 2XR8A 1JOCA 1KQSO 2OYHC 3AE9C 1J1DB 2O1KA 2BMRA 1OZHA 1G1IA 1OVUA 2YKQA 1LP1B 2WSSH 2KNCB 5AW4B 2KS1A 4HB1A 2IFNA 1YI2P 5AW9B 2I7FA 1Q81Q 2CK3H 1LTGC 2P67A 1N73A 1K9MQ 3GG2A 4JYBA 3HUSC 1NKZB 3L72G 3CWBG 3M0AA 2ZXXA 3W67A 1KN7A 3II6A 4QDCA 2WQYC 3G71P 2KB7P 4KT0J 1J1EB 4ZKUA 1SQQK 1NVOA 5GTIE 1SS1A 5CCHC 2ITAA 1M56D 3MP7B 4LGDE 1GL2D 2KP8A 3AEGC 3CCSP 4HYTB 4NPEA 5AEUA 2Q5UA 2KNCA 1NHLA 4H44B 2M0BA 4UB8H 2R5BA 1CI6B 4KJMA 3L71G 4EI2A 1K73Q 1E79H 1L4AB 1RE4A 1HH0A 4OWFA 5CXMA 4RKUJ 1L0NJ 3CLQA 2Q6QA 2E75B 2ZT9C 1IFMA 3RL0D 4GT1A 1Q90C 3CX5D 3VMXA 1ZN5A 1EZVI 2WSEJ 1SFCB 1O7PA 2FFDB 2W27A 3FOUA 2QIWA 1S1CX 3CX5E 1YJNP 3MIWA 3B71A 2NPSA 1N8RQ 2LXBA 3AE4C 2N9BA 1BGYG 4I1LA 4WY4A 5AEWA 2BCCD 3MZWB 2DW3A 1RF1A 5AVWB 2C9NY 3H1LJ 1X8YA 3QWOC 4XE5B 5APVA 5KLVK 2KZJA 3NTNA 1BCCE 4YXDC 5AW6B 1YQ4C 2KK7A 4HM4A 2JWAA 3GF7A 3SSUA 5GTHE 1N86A 1NYKA 1CZQA 1JUNA 1SFCA 2KSEA 2FFDA 2C9LY 2QM7A 4GKGA 4WBAA 3SFEC 1N7SC 4ZNCA 2L5GB 1WT6A 5DJUB 2QJYB 2GUVA 5KLIB 1S5LX 2W6JH 4RO0A 2K3RA 2PGDA 3VMGD 3JCUE 3VMZA 1SQBD 1ULIA 3H1LG 1NH4A 1KQLA 3CCMP 1RE3C 3CCVP 1M90Q 3AE1C 2ZVNB 2Q3WA 2YKOA 2NPSD 2V7QH 5TISE 1FC2C 2WSFH 4HM0A 2JR8A 1FZEA 1ZLLA 2KZIA 2HMOA 4WY4D 1XTGB 4HKVA 1NDOA 2I1KA 1DEBA 4PJ0E 3FXEA 2NUMA 1OX3A 4GOFA 1RQVA 1SFCD 4EYYQ 2XKMA 1DD3A 2H7HA 1JY3O 4QDFB 3LIEA 1GW3A 4AAYB 3H1HJ 1UIIA 5KJ7C 3Q5SA 3D70A 4QURA 2POHA 3C8VA 1IFIA 2N1TB 3MUDA 3CCLP 2WVRA 5BOKA 3HD7B 3CI9A 1RF0A 2GM4A 1SQQJ 4CPGA 1PIXA 4H13D 5L8RJ 2Y0DA 3RGUA 1M7LA 3CCQP 2QM8A 3KZIH 3CC7P 4DZOA 5CCGC 1KMIZ 3P8CE 4JYCA 3RL0g 5APSA 4PV1D 2D2CB 2HLOA 2GA1A 2FYNB 1A02J 1NU1K 4QDFA 1BCCJ 2XRXA 3H25A 2PFXA 1ZR4A 1ZP0C 1YBKA 2NZ2A 1M1JA 1OIPA 1O7NA 3F5HA 3H1HG 1T3JA 2N1TA 3L75E 4OGQD 3A0BH 3OAKA 3HD7A 4JPZB 3L73J 4YXWH 1IK7A 2WTYA 1FJKA 2E74D 3B8EB 2NVFA 2JO6A 1VF5C 3GCEA 2ZJSE 1VQ5P 1KB9H 1U7MA 1WMKA 3CXHE 2OYHB 2OQQA 3IR9A 2KLVA 3QH9A 1EDLA 1CSBA 2YFJA 3M9QA 4NBAD 3GLMA 3KPEA 1BCCG 2H8PD 1LT9C 5KLVJ 3E7KA 1NU1E 4BXLA 3PRJA 1URQD 5AVXB 2KUBA 1HUCA 2V4HA 1S72P 2RN0A 5APQA 1BE3J 3H32B 3HUSB 3BVHA 2E76D 2R32A 3L73G 3Q5PA 4HKZH 1T2KC 3LW5J 1SQVK 2AXTE 1H89A 2WPSA 1BDCA 4O9BA 1KTMA 1FS0E 3A0HE 2N1TD 1LTBC 3U1AA 2RKLA 4N3YB 1MFTA 2VRSA 2GUSA 2AEFA 4GDOA 1LWUC 1VQ4P 3V4QA 1OW6A 1P84H 1FZBA 3M0DC 4H0LC 5KLVG 3CD6P 5AVRB 1EDIA 1FQTA 2A06D 4XA4A 1MV8A 2JZAA 2JP3A 1GTWA 2A45H 2OARA 1KQGB 3OW2O 4IL6X 2ZT9B 4DT0A 2JKVA 3GHGC 2YXQB 3B5ND 2A06E 1JNMA 1JCDA 3GW6A 4ASVA 2IZ0A 2HR3A 5AW0B 1LTJC 1Y9BA 2WSCH 4D6TD 3KXDA 1AQ5A 5CHXA 1SQVE 1FZFA 1RY3A 1WQLA 2GBWA 4KHXA 1SP4A 1HJ0A 3MD0A 2XZRA 1L0ND 1PGJA 2YFIA 4D6TE 3L75J 2LKMA 3PLNA 1PFIA 1IZNB 1GD2E 2OYIC 2OTJP 3KHUA 1L0NE 1W5CE 1U7JA 1XTCC 1KB9I 1SQXK 2WPRA 3RK2D 2KSJA 1NGMB 1AV1A 1KQFB 5BU8B 1OMIA 2FY8A 1EXJA 1X9VA 1GMJA 1L0LK 1N7SB 3P7KA 3RK3C 1RHZB 2DE7D 1E5WA 4K35A 2K37A 1NU1J 4I7ZC 4AYCA 2O1JA 2DE6D 5APWA 2JEEA 1USDA 4C7RA 1L2PA 3L75G 1VCKA 3WU2E 1KYOH 1PV3A 1ZR2A 1IK9A 2YO2A 5KAFH 1EZVG 2Y9YA 2HMKA 1FJPA 4NBHD 1YHQP 5AVVB 2BASA 4YPCA 1L0LD 1NJIQ 2WPVB 1SQPK 1Z56A 5AVZB 3U59A 5AW7B 2W6BA 2MKVA 1YQ3C 4IL6E 1KD1Q 1FDOA 1HTLC 4WB4A 1P84I 1FZCC 1L0LE 5C39A 1PP9J 1MZ9A 3R4YA 1NU1G 1SLQA 1OFCX 2A45I 3GL0A 4NPFX 1H88A 1KV4A 2FXMA 1M1KQ 5E79E 3A5TA 1IJDB 3IF4A 5AW3B 1S3JA 4QMAA 5B5EH 3L4FA 1LTSC 4NB9D 2E5YA 2IBZE 2HMLA 3AECC 3EQQA 3BATA 2RH0A 3H1JE 1GW4A 4IOIH 3S1KA 4EOTA 3Q1MA 1SQVJ 1EQ7A 1LP1A 2E42A 1KILC 4QDDA 1PGOA 3D71A 1Q7YQ 2E4QA 4D6TJ 2R3SA 4N78E 1GU5A 4DOJA 4WVZA 3H1HD 4C46A 2YFLA 4ZKPA 2IYPA 1JM1A 4HJLA 4PD4H 3GTEA 2KIKA 3USSA 5APUA 2B24A 4GODA 2QE7H 3H1HE 1SQQD 4EDFA 3EQ2A 3S4RA 2A06G 2L91A 2M5AB 3A3YB 1G2CB 2WPQA 3O8ZA 3N4XA 2AEJA 2G3AA 1SQVG 2KYVA 1SQQE 1R5LA 5M1BA 1VF5B 3WUTA 1BCCD 2QVAA 4Y99C 1CI6A 1LJ2A 1ZRTE 1L4AA 1YIJP 3FX0A 2HYNA 3CMAP 2XV5A 4N6JA 4D6TG 3L35A 1KYOI 3L37A 2UWJE 2WSEH 1PZQA 1QVGO 1VQNP 1USEA 1LT9B 1L0NG 3S9OA 3A0BE 1S9KD 2BEQD 1G1JA 2HG5D 3L73D 1FOSE 1GL2C 1SQXJ 1K04A 1NTZK 1NOHA 5KKZC 1AQTA 1S9KE 3L73E 2W8ZA 4LLHA 4L73A 1L0LJ 1YYCA 2JDIH 2I1JA 4NPDA 5KLVD 1IFNA 4A7PA 3RL0C 2WSFJ 3SFDC 2O01H 1LWUB 1OW7A 1BE3D 5KLVE 5K5GB 4H44D 3H1JJ 4I2LC 4BWNA 4U3FJ 3SWKA 4HM2A 1RIEA 2IX7C 5CBNA 1L4AD 1VPCA 2YO3A 5EFWB 1N73C 2P58A 1BE3E 2N9YB 3HE4B 1SQPJ 2R5DA 2J5UA 2B88A 1NTZE 3GHGB 3PP5A 2E75D 1L0LG 5H2FE 3CC4P 2QA4P 3D6ZA 1LTJB 1SVFA 4PD4I 3E1RA 1J1DC 3AEBC 2SPZA 2CPSA 3AEDC 1VQKP 2IBZG 3AE5C 1ZMEC 1QL1A 3EFFK 3AE2C 3H1JG 2YIUC 1RE4C 2YMYA 1NTKK 2QSIA 3TSIA 3P8CD 3TNUB 3P32A 1DEEG 1JY3P 3HE4A 2WWWA 3D89A 3VP9A 5AVUB 3VN0A 3BCCD 3CPWO 1T6AA 2QJPB 3L74D 1LTJA 1N7LA 5APYA 2FYUK 4HM7A 1KC8Q 5AVYB 3RK3B 3MHVA 2P10A 4M3LA 4HJGH 2RMZA 1NTMK 3L75D 1QVFO 3BCCE 3V2QA 3CCUP 2NPSC 2ZVOB 3L74E 3V2NA 3CX5H 1GDTA 1EZVD 1T8ZA 5BVZA 4WY4C 1RF1C 1NO4A 3HTKB 2B1XA 1VM9A 4JQ0D 2ZYDA 3NMDA 3TNUA 3B4SA 3C1LA 3CXHD 5AVSB 3TYYA 2NUKA 1PPJG 1EZVE 1PL5A 1NTKE 1UUWA 2C0XA 1SQQG 2YKPA 1SFCC 1M8OB 2PRRA 2FFDC 4JF7A 3JC22 2FYZA 5GTHH 1X0TA 1NU1D 1FDIA 2K88A 4QCKA 2HMJA 4EIJA 4RJTA 4W80A 1BSHA 4DCKA 2P7JA 4QUQA 3I56P 2Q1KA 1AA0A 4ZMDA 5AW1B 1NTME 3WUVA 3BRTB 4UB6E 4DJGA 3G3ZA 3I5CA 4H13C 3MTUE 4RESB 4AQRD 4HM8A 3JCUH 1NTZJ 1ZOYC 2IPPA 4PV1C 1YJWP 4AUWA 2OYOA 2WMMA 2OYHA 3C9IA 1GU4A 3A2AA 1PP9D 3HRNA 5HL4A 2PP6A 2Q3IA 5TISH 1PGQA 3KDPB 3L70E 3M06A 4TT3H 3HD7D 2QEXP 3GZYA 3L36A 2QJYC 2HMMA 2H89C 1VQMP 3VMID 2B89A 4OGQC 1PP9E 1KORA 3H1KE 3Q2YA 1G8JB 1MFZA 3GB4A 1TU3F 1W2BO 4PJ0H 3H32A 2E74C 2D2CD 1N2DC 1Q82Q 3HUSA 2YNYA 2Q9IA 1BE3G 3CCEP 2WSCJ 2O3JA 3KQGA 1SQVD 4JBZA 4GOEA 1T3UA 2H43A 1NTZG 2NRGA 2ZYGA 5CCHA 5AVTB 4LC1A 2I8DA 3MUDC 4UB8E 4OVNF 3GOBA 3RK3E 3BCCJ 1RF0C 3GMAA 4L74A 1H8AA 2BMOA 2QJKC 3CX5I 4EMJB 3L74J 1D7MA 1HVVA 2J59M 4Y99B 1URQC 4C7NB 2A45G 4W7ZA 2PAJA 2HODB 3M9BA 3M91A 3LIDA 1QLED 2E76C 1JO5A 2KLUA 1LTIC 5CJ0A 1NTKJ 1NKNA 3IN6A 1M1JC 1R5SA 3TGUE 3V2RA 1GL2B 2N1TC 4YTPC 4P1BH 3EFGA 1S5LH 1O7WA 2FYUJ 2KXPB 3BCCG 4C7NA 3EWKA 1H0TB 3DQYA 3L74G 1NTMJ 1HGZA 2Q7CA 2HODA 1WRGA 3WUUA 1ULJA 1MKMA 5CCHD 1VQ6P 3B5NC 1SQXD 1YTZT 3O6QB 1NTKG 1KFNA 2XSOA 5DJTB 1JMMA 3AEAC 1S2EA 1N7SA 1KZUB 4U7JA 1SQXE 2E5TA 3L72J 4HH2A 1DD4A 3L70J 1ZV8A 1VL2A 2B9BA 2FYUG 2OTKE 4Z1MH 1LGHB 2ZT9D 2FXOA 1Q90D 1JY3N 3H1KJ 1FZAA 1LTAC 2IBZD 1NTMG 1OXZA 1BDDA 3Q5RA 3PH0A 4GIFA 3H1JD 1EDJA 2LR2A 2DE5D 2AXTH 4U3FD 1RE3A 1JM0A 3RBXA 2O01N 3RK2C 2Y0EA 2P2UA 3L71J 3A0HH 3O6QA 1FAVA 2J58A 3V6IA 1VQPP 1SQPD 2YIUB 4U3FE 3PHLA 3VOPA 3OJAB 1LNQA 4N78D 2JWDA 3CL3D 5KAIH 1O7HA 1X79B 1NAFA 1SQPE 2ZYAA 3L70G 1NYHA 1EC5A 1PP9G 1Y47A 3H1KG 1HWTC 2WT7B 1IFJA 2G8YA 1AJYA 1N7SD 1BGYJ 2NPSB 2KI7B 3FGAD 5CMZA 5KJ7A 1PPJD 4R4MA 4WY4B 3TGUJ 5TJHA 3FWLA 4IFMA 1RF1B 4QUPA 3M9HA 2H88C 3AZCA 2LXCB 1EDKA 2CPBA 3H6PA 1ZRTD 3N0QA 3TF5A 2FBWC 1DIPA 3KZIE 1JB0J 3GTSA 2XSHA 1PPJE 4NBDD
chains in the Genus database with same CATH topology
4QUQA 4NBBD 4AIVA 4NB9D 2IBZE 2HMLA 2ZT9D 3L71E 3EQQA 4NB8D 1SQBE 1NTME 3H1JE 3C0DA 1G8KB 3VMGD 4PV1D 3H1LE 2YIUC 4H0LD 1ULIA 2GBXA 5KKZC 5CXMA 1O7GA 2E4PA 2DE5D 4QDFA 1P84E 3H1IE 2XRXA 4HM8A 1SJGA 3VCPA 3L73E 1Q90C 2NVEA 2FYUE 2DE7D 3D89A 2YVJB 4QDDA 1RFSA 2Q3WA 4NBCD 1O7NA 2E4QA 2DE6D 3GZXA 4HM0A 1VF5D 3TGUE 1O7PA 2CKFA 4PD4E 3FOUA 1KYOE 2XR8A 4HM7A 4NBFD 1FQTA 3L75E 4U3FE 2HMOA 4OGQD 4EMJB 2JZAA 2YFLA 1VCKA 2BMRA 4P1BH 5HL4A 1JM1A 2ZYLA 4HJLA 1O7HA 3CX5E 4HKVA 1KB9E 1O7WA 3GTEA 4HM6A 3BCCE 1NDOA 3L70E 4HM5A 2BCCE 2E74D 2NVFA 1SQPE 1BGYE 3L74E 2JO6A 3GZYA 3GCEA 2B24A 3VMHD 2HMKA 2HMMA 2QJYC 5KLVE 4NBHD 3DQYA 3VCAA 3VMID 4H44D 2A06E 3H1HE 1PP9E 5AEWA 1UUVA 2NUMA 3H1KE 2B1XA 3CXHE 1VM9A 2HMNA 3EN1A 4HM2A 1RIEA 1G8JB 2NVGA 1ULJA 2I7FA 3GB4A 4P1CH 2YFJA 2BMQA 2D2CD 4NBAD 1SQVE 3L72E 2NWFA 1BCCE 1WQLA 4HM1A 1BE3E 2GBWA 1EG9A 4QDFB 3CWBE 2NUKA 4HM4A 1SQQE 1EZVE 1L0LE 1NTKE 1NTZE 1UUWA 3GKEA 4AAYB 1NYKA 2E75D 1O7MA 4NBGD 4QDCA 4QURA 2YFIA 1NU1E 2XSOA 1ZRTE 2QJPC 4HM3A 4D6TE 5KLIC 4QUPA 3GL0A 3AZCA 4QCKA 2HMJA 3N0QA 1SQXE 3GOBA 5BOKA 2FYNC 3GTSA 2XSHA 5AEUA 1L0NE 3GL2A 1PPJE 4NBED 2E76D 4NBDD 2BMOA 2QJKC 2QPZA 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUQ A;  4NBB D;  4AIV A;  4NB9 D;  2IBZ E;  2HML A;  2ZT9 D;  3L71 E;  3EQQ A;  4NB8 D;  1SQB E;  1NTM E;  3H1J E;  3C0D A;  1G8K B;  3VMG D;  4PV1 D;  3H1L E;  2YIU C;  4H0L D;  1ULI A;  2GBX A;  5KKZ C;  5CXM A;  1O7G A;  2E4P A;  2DE5 D;  4QDF A;  1P84 E;  3H1I E;  2XRX A;  4HM8 A;  1SJG A;  3VCP A;  3L73 E;  1Q90 C;  2NVE A;  2FYU E;  2DE7 D;  3D89 A;  2YVJ B;  4QDD A;  1RFS A;  2Q3W A;  4NBC D;  1O7N A;  2E4Q A;  2DE6 D;  3GZX A;  4HM0 A;  1VF5 D;  3TGU E;  1O7P A;  2CKF A;  4PD4 E;  3FOU A;  1KYO E;  2XR8 A;  4HM7 A;  4NBF D;  1FQT A;  3L75 E;  4U3F E;  2HMO A;  4OGQ D;  4EMJ B;  2JZA A;  2YFL A;  1VCK A;  2BMR A;  4P1B H;  5HL4 A;  1JM1 A;  2ZYL A;  4HJL A;  1O7H A;  3CX5 E;  4HKV A;  1KB9 E;  1O7W A;  3GTE A;  4HM6 A;  3BCC E;  1NDO A;  3L70 E;  4HM5 A;  2BCC E;  2E74 D;  2NVF A;  1SQP E;  1BGY E;  3L74 E;  2JO6 A;  3GZY A;  3GCE A;  2B24 A;  3VMH D;  2HMK A;  2HMM A;  2QJY C;  5KLV E;  4NBH D;  3DQY A;  3VCA A;  3VMI D;  4H44 D;  2A06 E;  3H1H E;  1PP9 E;  5AEW A;  1UUV A;  2NUM A;  3H1K E;  2B1X A;  3CXH E;  1VM9 A;  2HMN A;  3EN1 A;  4HM2 A;  1RIE A;  1G8J B;  2NVG A;  1ULJ A;  2I7F A;  3GB4 A;  4P1C H;  2YFJ A;  2BMQ A;  2D2C D;  4NBA D;  1SQV E;  3L72 E;  2NWF A;  1BCC E;  1WQL A;  4HM1 A;  1BE3 E;  2GBW A;  1EG9 A;  4QDF B;  3CWB E;  2NUK A;  4HM4 A;  1SQQ E;  1EZV E;  1L0L E;  1NTK E;  1NTZ E;  1UUW A;  3GKE A;  4AAY B;  1NYK A;  2E75 D;  1O7M A;  4NBG D;  4QDC A;  4QUR A;  2YFI A;  1NU1 E;  2XSO A;  1ZRT E;  2QJP C;  4HM3 A;  4D6T E;  5KLI C;  4QUP A;  3GL0 A;  3AZC A;  4QCK A;  2HMJ A;  3N0Q A;  1SQX E;  3GOB A;  5BOK A;  2FYN C;  3GTS A;  2XSH A;  5AEU A;  1L0N E;  3GL2 A;  1PPJ E;  4NBE D;  2E76 D;  4NBD D;  2BMO A;  2QJK C;  2QPZ A;  4H13 D; 
#chains in the Genus database with same CATH topology
 4AIV A;  5CCG A;  4Y28 J;  3SWY A;  1VQO P;  3VTP C;  3JSV C;  1FU1 A;  2WT7 A;  2GBX A;  3CXH I;  1JY2 O;  1VQ8 P;  3P8M C;  1CW5 A;  1UIX A;  2MJZ A;  3UIA A;  1YJ9 P;  1JCC A;  5BU5 A;  4XFJ A;  2K1A A;  3K5B A;  4MN4 C;  1ZW0 A;  1KB9 D;  3V4W A;  1JEK A;  1U57 A;  1IO4 A;  2JJL A;  2M5A A;  3TGU G;  1VQL P;  3T97 B;  1G2C A;  1GK6 A;  4H13 B;  1JY2 P;  1SQB K;  3CC2 P;  1KB9 E;  2BCC E;  3IAO A;  3WU2 H;  5AW8 B;  1K05 A;  3G9R A;  4PV1 B;  2HPC B;  1LTT C;  3AE8 C;  5KJ7 D;  3EN1 A;  5B66 H;  2O01 J;  2BEZ F;  2NVG A;  1AFO A;  2ZXE B;  2WZ7 A;  1J2J B;  2IZ1 A;  2V7Q J;  4HM1 A;  1LT9 A;  3FXD A;  3GKE A;  5AW2 B;  4NBG D;  1HJB A;  4OGQ B;  4IL6 H;  4H0L B;  1A02 F;  1NTZ D;  2YMK A;  3BAS A;  3T97 A;  5CCG D;  1GK4 A;  3AE3 C;  2XNX A;  3FWN A;  1JTH B;  1VQ7 P;  3CCR P;  1OVR A;  2E74 B;  1SQX G;  1FOS F;  4NBE D;  2R3C A;  1P84 D;  3H1I D;  2HPC A;  5E79 H;  1SQB E;  1PGP A;  2Z4E A;  2Z5I A;  3ABV C;  3Q3D A;  1P84 E;  3H1I E;  1ZXG A;  3NFQ A;  2QJK B;  1HBW A;  5GTI H;  1LWU A;  2NVE A;  1BSN A;  2Y0C A;  1URQ B;  3M0D A;  3VMY A;  2M8R A;  3VYI A;  3G4S P;  2B87 B;  3RBZ A;  1VF5 D;  1JTH A;  2ZAE B;  2E76 B;  4U3F G;  1R8E A;  1NAY A;  3D6Y A;  1RQU A;  2OYI B;  5APX A;  3GHG A;  3VMH D;  5AVQ B;  2FXP A;  1M1J B;  3VCA A;  1SQP G;  1UUV A;  3PTZ A;  1J1E C;  1JMB A;  1VQ9 P;  1OW8 A;  3VP8 A;  2BMQ A;  4WWI A;  2WIT A;  1EG9 A;  1AVY A;  4H44 C;  5CBO A;  1URQ A;  1YTZ I;  1IFP A;  2B87 A;  2OTL P;  1O7M A;  1X22 A;  4I7Z B;  1M57 D;  4HM3 A;  2M3E A;  1NTK D;  1KFM A;  2IDB A;  1T2K D;  1L4A C;  2W83 C;  2P1J A;  2OYI A;  2M3B A;  1Q2N A;  3GL2 A;  3B5N B;  2E75 C;  3G6E P;  2BCC J;  1GZL A;  3ITK A;  2FYU D;  1S5L E;  3OA7 A;  5CJ4 A;  2W90 A;  4H0L D;  1NTM D;  1KYO D;  1FBM A;  3AEF C;  3V5B A;  2IYO A;  1SJG A;  3VCP A;  1OWA A;  1AVO A;  2FYU E;  1FZC B;  2Q3E A;  1RFS A;  2XU6 A;  4OH8 B;  1Q86 Q;  2K9J B;  3HTK A;  1YIT P;  4K3A A;  2CKF A;  1KYO E;  4NBF D;  1HGV A;  5KAF E;  1S4X A;  1DX7 A;  3B5N A;  1QEX A;  4HM6 A;  2XND H;  3RK2 B;  4HM5 A;  3L72 D;  2BCC G;  3CWB D;  1SQB J;  5AW5 B;  3L70 D;  1NWQ A;  2IBZ I;  4I6M C;  2HMN A;  4L75 A;  2Y9Z A;  4P1C H;  3H1I J;  3H1K D;  3F89 A;  1IFD A;  2YXR B;  3L72 E;  2NWF A;  3CWB E;  1FZC A;  5KTB A;  1KIL B;  4BRY B;  1RH5 B;  2K9J A;  1EXI A;  3TDK A;  5KLI C;  1Y8A A;  1QGK B;  3L71 D;  3CCJ P;  2QRX A;  5B5E E;  5H2F H;  3LW5 H;  2QPZ A;  3RK3 D;  4NBB D;  1QX8 A;  3CME P;  3A7O A;  3L71 E;  3E1I A;  4NB8 D;  5KAI E;  1DH3 A;  1L0N K;  1FE6 A;  1FDM A;  3C0D A;  1SQB G;  1QL2 A;  3HE5 B;  1K8A Q;  4PD4 D;  1O7G A;  2ZFC A;  2E4P A;  3ZDM A;  3H1I G;  1KIL A;  4BRY A;  5APT A;  2YVJ B;  4NBC D;  1JY2 N;  2E43 A;  3IFM A;  3U1C A;  3PJS K;  4B86 A;  1BGY D;  3KYQ A;  4PD4 E;  2AXC A;  4W7Y A;  1HF9 A;  1IC2 A;  3TGU D;  2ZYL A;  2R44 A;  2OGU A;  4L76 A;  2W6A A;  1BGY E;  3I55 P;  2JO1 A;  2XDJ A;  3BRV B;  2KOG A;  3SWF A;  3HE5 A;  1FZG A;  5KKZ B;  3HD7 C;  2FKW B;  3V2P A;  3MGN A;  3TK1 A;  3AE7 C;  2QJP C;  3WMM 0;  2HFE D;  4R4L A;  1OVV A;  2Z5H A;  4IFD K;  2D2C C;  3AEE C;  4IFF A;  1W2E A;  1VDF A;  3RL0 B;  2FYN C;  3H1L D;  3AE6 C;  3CXH H;  1MUU A;  2KS1 B;  1KIL D;  3VMA A;  1G8K B;  1GL2 A;  2K9Y A;  3H1L E;  3W68 A;  3NXS A;  4TLF A;  2IFM A;  4UB6 H;  1N73 B;  3N7N A;  3CWB J;  3R2P A;  2AEM A;  5B66 E;  1KIL E;  1LT1 A;  3GF3 A;  4ASW A;  1H0T A;  2C0W A;  3GZX A;  2QG4 A;  2XR8 A;  1JOC A;  1KQS O;  2OYH C;  3AE9 C;  1J1D B;  2O1K A;  2BMR A;  1OZH A;  1G1I A;  1OVU A;  2YKQ A;  1LP1 B;  2WSS H;  2KNC B;  5AW4 B;  2KS1 A;  4HB1 A;  2IFN A;  1YI2 P;  5AW9 B;  2I7F A;  1Q81 Q;  2CK3 H;  1LTG C;  2P67 A;  1N73 A;  1K9M Q;  3GG2 A;  4JYB A;  3HUS C;  1NKZ B;  3L72 G;  3CWB G;  3M0A A;  2ZXX A;  3W67 A;  1KN7 A;  3II6 A;  4QDC A;  2WQY C;  3G71 P;  2KB7 P;  4KT0 J;  1J1E B;  4ZKU A;  1SQQ K;  1NVO A;  5GTI E;  1SS1 A;  5CCH C;  2ITA A;  1M56 D;  3MP7 B;  4LGD E;  1GL2 D;  2KP8 A;  3AEG C;  3CCS P;  4HYT B;  4NPE A;  5AEU A;  2Q5U A;  2KNC A;  1NHL A;  4H44 B;  2M0B A;  4UB8 H;  2R5B A;  1CI6 B;  4KJM A;  3L71 G;  4EI2 A;  1K73 Q;  1E79 H;  1L4A B;  1RE4 A;  1HH0 A;  4OWF A;  5CXM A;  4RKU J;  1L0N J;  3CLQ A;  2Q6Q A;  2E75 B;  2ZT9 C;  1IFM A;  3RL0 D;  4GT1 A;  1Q90 C;  3CX5 D;  3VMX A;  1ZN5 A;  1EZV I;  2WSE J;  1SFC B;  1O7P A;  2FFD B;  2W27 A;  3FOU A;  2QIW A;  1S1C X;  3CX5 E;  1YJN P;  3MIW A;  3B71 A;  2NPS A;  1N8R Q;  2LXB A;  3AE4 C;  2N9B A;  1BGY G;  4I1L A;  4WY4 A;  5AEW A;  2BCC D;  3MZW B;  2DW3 A;  1RF1 A;  5AVW B;  2C9N Y;  3H1L J;  1X8Y A;  3QWO C;  4XE5 B;  5APV A;  5KLV K;  2KZJ A;  3NTN A;  1BCC E;  4YXD C;  5AW6 B;  1YQ4 C;  2KK7 A;  4HM4 A;  2JWA A;  3GF7 A;  3SSU A;  5GTH E;  1N86 A;  1NYK A;  1CZQ A;  1JUN A;  1SFC A;  2KSE A;  2FFD A;  2C9L Y;  2QM7 A;  4GKG A;  4WBA A;  3SFE C;  1N7S C;  4ZNC A;  2L5G B;  1WT6 A;  5DJU B;  2QJY B;  2GUV A;  5KLI B;  1S5L X;  2W6J H;  4RO0 A;  2K3R A;  2PGD A;  3VMG D;  3JCU E;  3VMZ A;  1SQB D;  1ULI A;  3H1L G;  1NH4 A;  1KQL A;  3CCM P;  1RE3 C;  3CCV P;  1M90 Q;  3AE1 C;  2ZVN B;  2Q3W A;  2YKO A;  2NPS D;  2V7Q H;  5TIS E;  1FC2 C;  2WSF H;  4HM0 A;  2JR8 A;  1FZE A;  1ZLL A;  2KZI A;  2HMO A;  4WY4 D;  1XTG B;  4HKV A;  1NDO A;  2I1K A;  1DEB A;  4PJ0 E;  3FXE A;  2NUM A;  1OX3 A;  4GOF A;  1RQV A;  1SFC D;  4EYY Q;  2XKM A;  1DD3 A;  2H7H A;  1JY3 O;  4QDF B;  3LIE A;  1GW3 A;  4AAY B;  3H1H J;  1UII A;  5KJ7 C;  3Q5S A;  3D70 A;  4QUR A;  2POH A;  3C8V A;  1IFI A;  2N1T B;  3MUD A;  3CCL P;  2WVR A;  5BOK A;  3HD7 B;  3CI9 A;  1RF0 A;  2GM4 A;  1SQQ J;  4CPG A;  1PIX A;  4H13 D;  5L8R J;  2Y0D A;  3RGU A;  1M7L A;  3CCQ P;  2QM8 A;  3KZI H;  3CC7 P;  4DZO A;  5CCG C;  1KMI Z;  3P8C E;  4JYC A;  3RL0 g;  5APS A;  4PV1 D;  2D2C B;  2HLO A;  2GA1 A;  2FYN B;  1A02 J;  1NU1 K;  4QDF A;  1BCC J;  2XRX A;  3H25 A;  2PFX A;  1ZR4 A;  1ZP0 C;  1YBK A;  2NZ2 A;  1M1J A;  1OIP A;  1O7N A;  3F5H A;  3H1H G;  1T3J A;  2N1T A;  3L75 E;  4OGQ D;  3A0B H;  3OAK A;  3HD7 A;  4JPZ B;  3L73 J;  4YXW H;  1IK7 A;  2WTY A;  1FJK A;  2E74 D;  3B8E B;  2NVF A;  2JO6 A;  1VF5 C;  3GCE A;  2ZJS E;  1VQ5 P;  1KB9 H;  1U7M A;  1WMK A;  3CXH E;  2OYH B;  2OQQ A;  3IR9 A;  2KLV A;  3QH9 A;  1EDL A;  1CSB A;  2YFJ A;  3M9Q A;  4NBA D;  3GLM A;  3KPE A;  1BCC G;  2H8P D;  1LT9 C;  5KLV J;  3E7K A;  1NU1 E;  4BXL A;  3PRJ A;  1URQ D;  5AVX B;  2KUB A;  1HUC A;  2V4H A;  1S72 P;  2RN0 A;  5APQ A;  1BE3 J;  3H32 B;  3HUS B;  3BVH A;  2E76 D;  2R32 A;  3L73 G;  3Q5P A;  4HKZ H;  1T2K C;  3LW5 J;  1SQV K;  2AXT E;  1H89 A;  2WPS A;  1BDC A;  4O9B A;  1KTM A;  1FS0 E;  3A0H E;  2N1T D;  1LTB C;  3U1A A;  2RKL A;  4N3Y B;  1MFT A;  2VRS A;  2GUS A;  2AEF A;  4GDO A;  1LWU C;  1VQ4 P;  3V4Q A;  1OW6 A;  1P84 H;  1FZB A;  3M0D C;  4H0L C;  5KLV G;  3CD6 P;  5AVR B;  1EDI A;  1FQT A;  2A06 D;  4XA4 A;  1MV8 A;  2JZA A;  2JP3 A;  1GTW A;  2A45 H;  2OAR A;  1KQG B;  3OW2 O;  4IL6 X;  2ZT9 B;  4DT0 A;  2JKV A;  3GHG C;  2YXQ B;  3B5N D;  2A06 E;  1JNM A;  1JCD A;  3GW6 A;  4ASV A;  2IZ0 A;  2HR3 A;  5AW0 B;  1LTJ C;  1Y9B A;  2WSC H;  4D6T D;  3KXD A;  1AQ5 A;  5CHX A;  1SQV E;  1FZF A;  1RY3 A;  1WQL A;  2GBW A;  4KHX A;  1SP4 A;  1HJ0 A;  3MD0 A;  2XZR A;  1L0N D;  1PGJ A;  2YFI A;  4D6T E;  3L75 J;  2LKM A;  3PLN A;  1PFI A;  1IZN B;  1GD2 E;  2OYI C;  2OTJ P;  3KHU A;  1L0N E;  1W5C E;  1U7J A;  1XTC C;  1KB9 I;  1SQX K;  2WPR A;  3RK2 D;  2KSJ A;  1NGM B;  1AV1 A;  1KQF B;  5BU8 B;  1OMI A;  2FY8 A;  1EXJ A;  1X9V A;  1GMJ A;  1L0L K;  1N7S B;  3P7K A;  3RK3 C;  1RHZ B;  2DE7 D;  1E5W A;  4K35 A;  2K37 A;  1NU1 J;  4I7Z C;  4AYC A;  2O1J A;  2DE6 D;  5APW A;  2JEE A;  1USD A;  4C7R A;  1L2P A;  3L75 G;  1VCK A;  3WU2 E;  1KYO H;  1PV3 A;  1ZR2 A;  1IK9 A;  2YO2 A;  5KAF H;  1EZV G;  2Y9Y A;  2HMK A;  1FJP A;  4NBH D;  1YHQ P;  5AVV B;  2BAS A;  4YPC A;  1L0L D;  1NJI Q;  2WPV B;  1SQP K;  1Z56 A;  5AVZ B;  3U59 A;  5AW7 B;  2W6B A;  2MKV A;  1YQ3 C;  4IL6 E;  1KD1 Q;  1FDO A;  1HTL C;  4WB4 A;  1P84 I;  1FZC C;  1L0L E;  5C39 A;  1PP9 J;  1MZ9 A;  3R4Y A;  1NU1 G;  1SLQ A;  1OFC X;  2A45 I;  3GL0 A;  4NPF X;  1H88 A;  1KV4 A;  2FXM A;  1M1K Q;  5E79 E;  3A5T A;  1IJD B;  3IF4 A;  5AW3 B;  1S3J A;  4QMA A;  5B5E H;  3L4F A;  1LTS C;  4NB9 D;  2E5Y A;  2IBZ E;  2HML A;  3AEC C;  3EQQ A;  3BAT A;  2RH0 A;  3H1J E;  1GW4 A;  4IOI H;  3S1K A;  4EOT A;  3Q1M A;  1SQV J;  1EQ7 A;  1LP1 A;  2E42 A;  1KIL C;  4QDD A;  1PGO A;  3D71 A;  1Q7Y Q;  2E4Q A;  4D6T J;  2R3S A;  4N78 E;  1GU5 A;  4DOJ A;  4WVZ A;  3H1H D;  4C46 A;  2YFL A;  4ZKP A;  2IYP A;  1JM1 A;  4HJL A;  4PD4 H;  3GTE A;  2KIK A;  3USS A;  5APU A;  2B24 A;  4GOD A;  2QE7 H;  3H1H E;  1SQQ D;  4EDF A;  3EQ2 A;  3S4R A;  2A06 G;  2L91 A;  2M5A B;  3A3Y B;  1G2C B;  2WPQ A;  3O8Z A;  3N4X A;  2AEJ A;  2G3A A;  1SQV G;  2KYV A;  1SQQ E;  1R5L A;  5M1B A;  1VF5 B;  3WUT A;  1BCC D;  2QVA A;  4Y99 C;  1CI6 A;  1LJ2 A;  1ZRT E;  1L4A A;  1YIJ P;  3FX0 A;  2HYN A;  3CMA P;  2XV5 A;  4N6J A;  4D6T G;  3L35 A;  1KYO I;  3L37 A;  2UWJ E;  2WSE H;  1PZQ A;  1QVG O;  1VQN P;  1USE A;  1LT9 B;  1L0N G;  3S9O A;  3A0B E;  1S9K D;  2BEQ D;  1G1J A;  2HG5 D;  3L73 D;  1FOS E;  1GL2 C;  1SQX J;  1K04 A;  1NTZ K;  1NOH A;  5KKZ C;  1AQT A;  1S9K E;  3L73 E;  2W8Z A;  4LLH A;  4L73 A;  1L0L J;  1YYC A;  2JDI H;  2I1J A;  4NPD A;  5KLV D;  1IFN A;  4A7P A;  3RL0 C;  2WSF J;  3SFD C;  2O01 H;  1LWU B;  1OW7 A;  1BE3 D;  5KLV E;  5K5G B;  4H44 D;  3H1J J;  4I2L C;  4BWN A;  4U3F J;  3SWK A;  4HM2 A;  1RIE A;  2IX7 C;  5CBN A;  1L4A D;  1VPC A;  2YO3 A;  5EFW B;  1N73 C;  2P58 A;  1BE3 E;  2N9Y B;  3HE4 B;  1SQP J;  2R5D A;  2J5U A;  2B88 A;  1NTZ E;  3GHG B;  3PP5 A;  2E75 D;  1L0L G;  5H2F E;  3CC4 P;  2QA4 P;  3D6Z A;  1LTJ B;  1SVF A;  4PD4 I;  3E1R A;  1J1D C;  3AEB C;  2SPZ A;  2CPS A;  3AED C;  1VQK P;  2IBZ G;  3AE5 C;  1ZME C;  1QL1 A;  3EFF K;  3AE2 C;  3H1J G;  2YIU C;  1RE4 C;  2YMY A;  1NTK K;  2QSI A;  3TSI A;  3P8C D;  3TNU B;  3P32 A;  1DEE G;  1JY3 P;  3HE4 A;  2WWW A;  3D89 A;  3VP9 A;  5AVU B;  3VN0 A;  3BCC D;  3CPW O;  1T6A A;  2QJP B;  3L74 D;  1LTJ A;  1N7L A;  5APY A;  2FYU K;  4HM7 A;  1KC8 Q;  5AVY B;  3RK3 B;  3MHV A;  2P10 A;  4M3L A;  4HJG H;  2RMZ A;  1NTM K;  3L75 D;  1QVF O;  3BCC E;  3V2Q A;  3CCU P;  2NPS C;  2ZVO B;  3L74 E;  3V2N A;  3CX5 H;  1GDT A;  1EZV D;  1T8Z A;  5BVZ A;  4WY4 C;  1RF1 C;  1NO4 A;  3HTK B;  2B1X A;  1VM9 A;  4JQ0 D;  2ZYD A;  3NMD A;  3TNU A;  3B4S A;  3C1L A;  3CXH D;  5AVS B;  3TYY A;  2NUK A;  1PPJ G;  1EZV E;  1PL5 A;  1NTK E;  1UUW A;  2C0X A;  1SQQ G;  2YKP A;  1SFC C;  1M8O B;  2PRR A;  2FFD C;  4JF7 A;  3JC2 2;  2FYZ A;  5GTH H;  1X0T A;  1NU1 D;  1FDI A;  2K88 A;  4QCK A;  2HMJ A;  4EIJ A;  4RJT A;  4W80 A;  1BSH A;  4DCK A;  2P7J A;  4QUQ A;  3I56 P;  2Q1K A;  1AA0 A;  4ZMD A;  5AW1 B;  1NTM E;  3WUV A;  3BRT B;  4UB6 E;  4DJG A;  3G3Z A;  3I5C A;  4H13 C;  3MTU E;  4RES B;  4AQR D;  4HM8 A;  3JCU H;  1NTZ J;  1ZOY C;  2IPP A;  4PV1 C;  1YJW P;  4AUW A;  2OYO A;  2WMM A;  2OYH A;  3C9I A;  1GU4 A;  3A2A A;  1PP9 D;  3HRN A;  5HL4 A;  2PP6 A;  2Q3I A;  5TIS H;  1PGQ A;  3KDP B;  3L70 E;  3M06 A;  4TT3 H;  3HD7 D;  2QEX P;  3GZY A;  3L36 A;  2QJY C;  2HMM A;  2H89 C;  1VQM P;  3VMI D;  2B89 A;  4OGQ C;  1PP9 E;  1KOR A;  3H1K E;  3Q2Y A;  1G8J B;  1MFZ A;  3GB4 A;  1TU3 F;  1W2B O;  4PJ0 H;  3H32 A;  2E74 C;  2D2C D;  1N2D C;  1Q82 Q;  3HUS A;  2YNY A;  2Q9I A;  1BE3 G;  3CCE P;  2WSC J;  2O3J A;  3KQG A;  1SQV D;  4JBZ A;  4GOE A;  1T3U A;  2H43 A;  1NTZ G;  2NRG A;  2ZYG A;  5CCH A;  5AVT B;  4LC1 A;  2I8D A;  3MUD C;  4UB8 E;  4OVN F;  3GOB A;  3RK3 E;  3BCC J;  1RF0 C;  3GMA A;  4L74 A;  1H8A A;  2BMO A;  2QJK C;  3CX5 I;  4EMJ B;  3L74 J;  1D7M A;  1HVV A;  2J59 M;  4Y99 B;  1URQ C;  4C7N B;  2A45 G;  4W7Z A;  2PAJ A;  2HOD B;  3M9B A;  3M91 A;  3LID A;  1QLE D;  2E76 C;  1JO5 A;  2KLU A;  1LTI C;  5CJ0 A;  1NTK J;  1NKN A;  3IN6 A;  1M1J C;  1R5S A;  3TGU E;  3V2R A;  1GL2 B;  2N1T C;  4YTP C;  4P1B H;  3EFG A;  1S5L H;  1O7W A;  2FYU J;  2KXP B;  3BCC G;  4C7N A;  3EWK A;  1H0T B;  3DQY A;  3L74 G;  1NTM J;  1HGZ A;  2Q7C A;  2HOD A;  1WRG A;  3WUU A;  1ULJ A;  1MKM A;  5CCH D;  1VQ6 P;  3B5N C;  1SQX D;  1YTZ T;  3O6Q B;  1NTK G;  1KFN A;  2XSO A;  5DJT B;  1JMM A;  3AEA C;  1S2E A;  1N7S A;  1KZU B;  4U7J A;  1SQX E;  2E5T A;  3L72 J;  4HH2 A;  1DD4 A;  3L70 J;  1ZV8 A;  1VL2 A;  2B9B A;  2FYU G;  2OTK E;  4Z1M H;  1LGH B;  2ZT9 D;  2FXO A;  1Q90 D;  1JY3 N;  3H1K J;  1FZA A;  1LTA C;  2IBZ D;  1NTM G;  1OXZ A;  1BDD A;  3Q5R A;  3PH0 A;  4GIF A;  3H1J D;  1EDJ A;  2LR2 A;  2DE5 D;  2AXT H;  4U3F D;  1RE3 A;  1JM0 A;  3RBX A;  2O01 N;  3RK2 C;  2Y0E A;  2P2U A;  3L71 J;  3A0H H;  3O6Q A;  1FAV A;  2J58 A;  3V6I A;  1VQP P;  1SQP D;  2YIU B;  4U3F E;  3PHL A;  3VOP A;  3OJA B;  1LNQ A;  4N78 D;  2JWD A;  3CL3 D;  5KAI H;  1O7H A;  1X79 B;  1NAF A;  1SQP E;  2ZYA A;  3L70 G;  1NYH A;  1EC5 A;  1PP9 G;  1Y47 A;  3H1K G;  1HWT C;  2WT7 B;  1IFJ A;  2G8Y A;  1AJY A;  1N7S D;  1BGY J;  2NPS B;  2KI7 B;  3FGA D;  5CMZ A;  5KJ7 A;  1PPJ D;  4R4M A;  4WY4 B;  3TGU J;  5TJH A;  3FWL A;  4IFM A;  1RF1 B;  4QUP A;  3M9H A;  2H88 C;  3AZC A;  2LXC B;  1EDK A;  2CPB A;  3H6P A;  1ZRT D;  3N0Q A;  3TF5 A;  2FBW C;  1DIP A;  3KZI E;  1JB0 J;  3GTS A;  2XSH A;  1PPJ E;  4NBD D; 
#chains in the Genus database with same CATH homology
 4QUQ A;  4NBB D;  4AIV A;  4NB9 D;  2IBZ E;  2HML A;  2ZT9 D;  3L71 E;  3EQQ A;  4NB8 D;  1SQB E;  1NTM E;  3H1J E;  3C0D A;  1G8K B;  3VMG D;  4PV1 D;  3H1L E;  2YIU C;  4H0L D;  1ULI A;  2GBX A;  5KKZ C;  5CXM A;  1O7G A;  2E4P A;  2DE5 D;  4QDF A;  1P84 E;  3H1I E;  2XRX A;  4HM8 A;  1SJG A;  3VCP A;  3L73 E;  1Q90 C;  2NVE A;  2FYU E;  2DE7 D;  3D89 A;  2YVJ B;  4QDD A;  1RFS A;  2Q3W A;  4NBC D;  1O7N A;  2E4Q A;  2DE6 D;  3GZX A;  4HM0 A;  1VF5 D;  3TGU E;  1O7P A;  2CKF A;  4PD4 E;  3FOU A;  1KYO E;  2XR8 A;  4HM7 A;  4NBF D;  1FQT A;  3L75 E;  4U3F E;  2HMO A;  4OGQ D;  4EMJ B;  2JZA A;  2YFL A;  1VCK A;  2BMR A;  4P1B H;  5HL4 A;  1JM1 A;  2ZYL A;  4HJL A;  1O7H A;  3CX5 E;  4HKV A;  1KB9 E;  1O7W A;  3GTE A;  4HM6 A;  3BCC E;  1NDO A;  3L70 E;  4HM5 A;  2BCC E;  2E74 D;  2NVF A;  1SQP E;  1BGY E;  3L74 E;  2JO6 A;  3GZY A;  3GCE A;  2B24 A;  3VMH D;  2HMK A;  2HMM A;  2QJY C;  5KLV E;  4NBH D;  3DQY A;  3VCA A;  3VMI D;  4H44 D;  2A06 E;  3H1H E;  1PP9 E;  5AEW A;  1UUV A;  2NUM A;  3H1K E;  2B1X A;  3CXH E;  1VM9 A;  2HMN A;  3EN1 A;  4HM2 A;  1RIE A;  1G8J B;  2NVG A;  1ULJ A;  2I7F A;  3GB4 A;  4P1C H;  2YFJ A;  2BMQ A;  2D2C D;  4NBA D;  1SQV E;  3L72 E;  2NWF A;  1BCC E;  1WQL A;  4HM1 A;  1BE3 E;  2GBW A;  1EG9 A;  4QDF B;  3CWB E;  2NUK A;  4HM4 A;  1SQQ E;  1EZV E;  1L0L E;  1NTK E;  1NTZ E;  1UUW A;  3GKE A;  4AAY B;  1NYK A;  2E75 D;  1O7M A;  4NBG D;  4QDC A;  4QUR A;  2YFI A;  1NU1 E;  2XSO A;  1ZRT E;  2QJP C;  4HM3 A;  4D6T E;  5KLI C;  4QUP A;  3GL0 A;  3AZC A;  4QCK A;  2HMJ A;  3N0Q A;  1SQX E;  3GOB A;  5BOK A;  2FYN C;  3GTS A;  2XSH A;  5AEU A;  1L0N E;  3GL2 A;  1PPJ E;  4NBE D;  2E76 D;  4NBD D;  2BMO A;  2QJK C;  2QPZ A;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...