1EZVE

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 46
structure length 185
sequence length 185
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ezvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ezvE02
3L74E 3GCEA 1PPJE 2YFLA 2ZT9D 3TGUE 1NTKE 3L70E 3C0DA 4H13D 1P84E 3VMID 3VCPA 1ULJA 2XSHA 2QJKC 3EQQA 4U3FE 2QJYC 2FYUE 3GOBA 2GBWA 2BCCE 4H0LD 2HMLA 5KLVE 1G8JB 2A06E 1O7HA 2E4PA 2NVFA 2DE7D 3DQYA 3EN1A 4HM6A 2HMJA 2YVJB 5KKZC 1PP9E 4HM1A 4D6TE 1SQQE 2DE5D 3GTSA 4NBBD 4NBDD 1O7MA 1EZVE 1RFSA 4P1BH 2B24A 4QURA 1NU1E 5BOKA 1L0LE 1O7WA 3GKEA 4NBCD 2NVEA 2HMMA 1UUVA 1KB9E 4NB8D 4PV1D 2FYNC 1L0NE 5HL4A 4H44D 4HKVA 2ZYLA 1EG9A 3VMHD 1BE3E 3D89A 4HJLA 4HM3A 2GBXA 5AEWA 3GZYA 2E4QA 3GZXA 1SQXE 4AIVA 2E75D 2YFJA 4AAYB 4HM0A 3GL0A 1O7PA 2BMOA 1NTZE 4HM5A 2B1XA 2HMKA 4QDFB 2Q3WA 3GL2A 3VMGD 2IBZE 4EMJB 3CXHE 1RIEA 1SJGA 3GB4A 3CWBE 1VM9A 4NBAD 3BCCE 1NYKA 3H1IE 2NUKA 2DE6D 4NBFD 1O7NA 1FQTA 1ULIA 4QCKA 2D2CD 2NUMA 3L72E 5CXMA 2E74D 3L75E 2NWFA 1BGYE 4NBED 3AZCA 4PD4E 3GTEA 4HM7A 2XRXA 1SQVE 2XSOA 4QDCA 3H1LE 4NBGD 1NDOA 2HMOA 2YFIA 3L71E 1JM1A 4HM2A 5KLIC 1VCKA 3L73E 4P1CH 4QDDA 4NB9D 1KYOE 3H1KE 2XR8A 4QUQA 1O7GA 1ZRTE 2BMRA 2BMQA 3H1JE 2JZAA 2HMNA 3CX5E 3FOUA 1SQPE 2QJPC 2QPZA 2YIUC 3H1HE 1Q90C 5AEUA 4HM8A 1VF5D 3N0QA 1G8KB 3VCAA 1NTME 1SQBE 1BCCE 2NVGA 1WQLA 4OGQD 4NBHD 2JO6A 1UUWA 2CKFA 4HM4A 4QUPA 4QDFA 2I7FA 2E76D
chains in the Genus database with same CATH superfamily
2IBZG 1FZGA 1PPJE 4H13D 1HJBA 1FJPA 2FYUE 3AEGC 2PGDA 2E4PA 2DE7D 3CX5H 5KKZC 3L71J 1RF0A 2A45G 4BXLA 3GKEA 1PGJA 1KFNA 1VQOP 1LTJC 2GUSA 2KUBA 3VP9A 4I7ZB 2KYVA 2YFJA 1SQQK 1PL5A 5AVVB 5KJ7C 2BEZF 2BCCJ 3KXDA 1PV3A 1GL2A 1YHQP 2XNDH 1NYKA 3L4FA 1L0LJ 1SQXG 1KYOD 2D2CD 2Z5IA 1VF5C 2D2CC 3VYIA 2E42A 1BE3J 1NTZK 1JTHA 1HBWA 2FYZA 3SSUA 1KYOE 2KIKA 2P1JA 5AVXB 3USSA 4TT3H 3JC22 3L36A 1OIPA 2ZJSE 4WWIA 4DZOA 2KZJA 3TK1A 2YNYA 5GTIH 1N8RQ 4DOJA 1JO5A 2W8ZA 1PP9D 3GCEA 1U7JA 3AE3C 2Y9YA 1H0TA 5K5GB 1JY2P 5B66H 3GOBA 2C9LY 3HTKB 3MHVA 1IFPA 1BDDA 1L2PA 1OMIA 3LW5J 1PP9E 2QRXA 3EFGA 5CCGA 3L73J 1O7MA 4P1BH 4C46A 1YIJP 1RHZB 1T3UA 2N1TD 1GL2C 5HL4A 2IX7C 1NU1D 3TDKA 3SWFA 1GL2B 1ZMEC 2Y0DA 5E79E 1BCCJ 3Q3DA 2FYUK 3CXHD 2M0BA 5KAIE 4L73A 3V2NA 1URQB 2WPSA 1W2EA 3CXHE 3M0AA 2Q7CA 1SQQJ 1QVFO 2WSSH 1CZQA 2E43A 5KAFE 1YBKA 3L35A 4IFDK 2J58A 4HKZH 5AW7B 1HGVA 1SQVE 5AW8B 1NDOA 2YFIA 3RL0B 1VQ7P 5KLIC 3G9RA 3ABVC 5AW4B 1JMBA 2KK7A 1OX3A 2KS1A 3AE5C 1H0TB 1VQ5P 1JY3N 4IL6E 3AE9C 1KQLA 2Z5HA 2OYHC 1NTZJ 4JPZB 5CCGC 5H2FE 4H0LC 1RH5B 1EDLA 1NGMB 2CKFA 2CK3H 3BCCJ 2E75B 4D6TD 3OW2O 3VCPA 1NTKK 3RGUA 2QJKC 3L75J 4NPEA 4UB8H 2HMJA 5AVYB 3FX0A 2Q3EA 4D6TE 1Q82Q 2RN0A 3D71A 3MGNA 4RKUJ 1RF1A 3SFEC 2YO3A 2AXTE 5APQA 1SLQA 1L0NE 2HPCA 4H44D 2Y0CA 3CPWO 2O3JA 4JQ0D 3D89A 1LTBC 2IBZD 3N4XA 3JSVC 1KILC 4WVZA 4LC1A 3WUTA 3CL3D 3EQ2A 4JYCA 2FYUJ 2QM7A 3AE8C 3RBZA 2IBZE 1JEKA 3PTZA 1HJ0A 3PLNA 2WSCH 4Y99B 1NO4A 2YIUB 2ZYDA 1EZVG 3F89A 1SQPD 3OA7A 1FOSE 2XSOA 3SWKA 4CPGA 4OVNF 4HM2A 2B87A 1NOHA 2OYIB 3C9IA 4IL6X 2HMNA 2JZAA 1SQPE 1S72P 4DT0A 2ZYAA 2ZT9B 3GW6A 3VMXA 3HUSC 3VMAA 4OGQD 4HM4A 3A0HH 3BRTB 1SQVK 2IYPA 1ZW0A 2W6BA 1RF1B 3HD7C 5DJTB 2HPCB 1NAFA 1GK4A 1KB9D 3KDPB 1S5LH 1BGYG 1RE4A 2V4HA 2AEFA 1MV8A 1KB9E 2O01J 5AVUB 1L0LD 1RY3A 2BASA 3EWKA 4KHXA 3CC7P 2WPQA 5CMZA 2AEMA 5BVZA 5AEWA 3GZYA 3GZXA 4AIVA 3OAKA 3RK3D 1HH0A 2RKLA 1GW3A 3L70G 4UB6H 2B87B 1ZOYC 1DD3A 1AQTA 1L0NK 1PP9J 3KHUA 2A06G 4ZMDA 2QJPB 1PGPA 1Q81Q 2FXMA 3RK3E 1VQNP 2O1KA 3W67A 1ULIA 2NUMA 4WY4D 3D70A 1G1IA 4NBED 3LIEA 3Q5SA 1LT9B 4RESB 1YJ9P 1LP1A 2Q6QA 1RE3A 4IFFA 3O6QA 1N7SC 1O7GA 2BMQA 5KTBA 2OTKE 2H43A 1FJKA 4K35A 3CI9A 5AEUA 3CLQA 1DIPA 5TJHA 2NZ2A 4OH8B 3H25A 1SFCD 3E7KA 2JO6A 4QUPA 3IFMA 4AQRD 3RK2D 3CCSP 3B5NC 4PV1C 3EQQA 2WT7A 3AE4C 2HYNA 2M8RA 2WSEH 4GOEA 1LTGC 1SQVJ 3RK2C 2FKWB 1LTSC 2P7JA 1JY2N 3W68A 4NBBD 2N9YB 3P32A 1HF9A 2WVRA 1FC2C 2W83C 1OFCX 5BU5A 3G6EP 1IFJA 1EG9A 3AECC 1GD2E 3CMEP 2YMKA 3TYYA 2IYOA 2HG5D 1SQXK 2RMZA 3WU2E 1PZQA 1U57A 1AVOA 2HMKA 3Q2YA 1EDIA 2ITAA 3GL2A 2WSFH 1H89A 1S9KD 1LP1B 3O6QB 1SVFA 3GB4A 2E76B 4D6TJ 5KLVG 1LJ2A 1DEBA 2BEQD 1BSNA 1X9VA 4HJGH 3CX5D 1IK9A 1ZP0C 1KV4A 4YTPC 3RBXA 3OJAB 3P8MC 3G71P 2Z4EA 1S9KE 2UWJE 1L0NJ 4OWFA 1NVOA 4HB1A 2FXPA 2NPSD 3O8ZA 3H1IG 3CX5E 3V6IA 2PFXA 2WT7B 4LLHA 1FS0E 4HM8A 1P84D 3AE7C 4JF7A 2FBWC 4C7NA 1EZVD 2YFLA 3AEBC 3H1JG 3B4SA 4O9BA 1P84E 3CWBG 5CCHA 1UIXA 5APXA 2NVFA 1O7HA 3CCEP 2K9JA 1DEEG 1EZVE 2WPRA 1SQPJ 1YJWP 4YPCA 4IOIH 2E74B 4NB8D 3QWOC 4GODA 4PJ0E 1Q7YQ 2WZ7A 1S1CX 1FZCB 1S2EA 2QE7H 2XNXA 4EYYQ 1ZR2A 1JB0J 3AE6C 2B1XA 4QDFB 2JWAA 2RH0A 1BGYD 2WITA 3V5BA 4U3FG 3IN6A 3HTKA 4I7ZC 1FZFA 5GTIE 4H13B 3A0BH 5KJ7D 1J1DB 2K37A 1BGYE 1EQ7A 2SPZA 3V2QA 5B66E 2R32A 4C7NB 5CCHC 3TNUA 4A7PA 3U59A 3H6PA 2QJYB 3S4RA 1NTKD 1YQ4C 3L70D 1VF5D 3N0QA 2B9BA 2K9JB 2WTYA 3GHGA 2KLVA 2A06D 5CHXA 1URQA 3FGAD 4L76A 2I7FA 5AW3B 3JCUH 1NTKE 3L70E 5APWA 2LXCB 1Q86Q 4EOTA 2A06E 1LTAC 2ZXXA 4JYBA 1RF0C 2E5TA 2GUVA 2PAJA 1VQ4P 3L74G 2DW3A 3H1KG 3WUUA 1T2KC 2LR2A 2K1AA 5L8RJ 1X79B 1KORA 2GBXA 2B88A 4B86A 2AEJA 3GF7A 1DD4A 2NRGA 1GK6A 1FZEA 1GL2D 2HR3A 4GT1A 3R4YA 1XTCC 3PRJA 1XTGB 3TNUB 4RO0A 1JCDA 3AEEC 4ASWA 1EC5A 1NKZB 4N3YB 5CXMA 1RQVA 3AEAC 3GHGB 4QMAA 1URQC 2XRXA 3VOPA 1KYOI 4XFJA 1JY3O 2M3EA 1R8EA 1M90Q 3V2PA 1LGHB 3MUDA 4QDDA 1FZAA 4UB8E 4W7ZA 1SQVD 2BMRA 1KYOH 3P8CD 1R5LA 1U7MA 2N1TB 1LWUB 1Q90C 1PGOA 3FXEA 4GKGA 2V7QH 5KLVD 3E1IA 3RL0C 3M9QA 1OW8A 3P8CE 3PJSK 3CCUP 3FWLA 2W6JH 5TISE 3C0DA 3GLMA 4GOFA 3A7OA 5CCGD 4H0LD 5KLVE 3IF4A 2Q9IA 1CI6B 3MD0A 1BCCG 1YITP 1FU1A 3L37A 3CMAP 3C1LA 4WB4A 1RFSA 2B24A 2O01N 5APYA 2NVEA 2E75C 1YQ3C 2FY8A 2HMMA 2OYIA 2ZYLA 1ZR4A 4L75A 2POHA 1L0ND 1NTMG 1SQBG 5KAIH 4HM0A 2L5GB 4HM5A 2Q3IA 3CXHI 3ITKA 3TGUG 2WMMA 1ZXGA 3CWBE 3SWYA 2YKQA 1KILD 2IFNA 3CXHH 2PRRA 1GTWA 1LTTC 1Q2NA 4HM7A 4N78D 1N7LA 1KILE 3M0DA 4JBZA 3BCCG 3R2PA 4Y99C 1Y47A 1S5LE 2YIUC 4N78E 3BVHA 4IL6H 3L75G 4W7YA 4H44B 3VCAA 3V2RA 1GU5A 5H2FH 5AVQB 3V4WA 2YO2A 4ZNCA 3MP7B 2OYIC 2ZT9D 2R3SA 4U3FE 1BGYJ 3CCJP 1FBMA 1N73A 3DQYA 2ZT9C 1IFMA 3HE5A 2H89C 1OZHA 1LT9A 1AA0A 2YXRB 2KNCA 4UB6E 3HD7D 2LXBA 1SQXD 1WRGA 3TSIA 1RF1C 1FOSF 1NWQA 3II6A 5CBNA 5AW9B 2KOGA 2AXTH 2XU6A 1GW4A 1LTIC 4ZKUA 1NHLA 5KLVK 1SQXE 3PP5A 3GL0A 1NTKJ 2IBZI 3L70J 1HVVA 5AW0B 4I1LA 1M1JA 1OWAA 1E5WA 2HLOA 2Q3WA 4OGQB 1OXZA 3MIWA 3CCLP 2WPVB 4NBAD 2QM8A 2NUKA 4Y28J 3H1KD 3A5TA 1FQTA 3KQGA 3VN0A 1Z56A 4QDCA 4NBGD 1GZLA 1EXJA 1SFCA 2HODA 3H1KE 3PH0A 5B5EE 4GIFA 1T3JA 2QJPC 3V4QA 2FXOA 1N73B 2JO1A 1JOCA 3HE5B 5APSA 2KI7B 1LT9C 1FZBA 1N7SD 2KNCB 5AVZB 1PFIA 4W80A 1EDJA 2IZ1A 3RK3B 1ULJA 1IFIA 1VQLP 1QVGO 3F5HA 3L72G 1QLED 2YVJB 1RE4C 4NBDD 1KB9I 1OW7A 3Q5RA 5AW1B 2XV5A 4WY4B 1VQ8P 1M1JB 3B5ND 4PV1D 2YXQB 1KB9H 2JJLA 1L4AA 1YTZI 2R5BA 3IAOA 2I1KA 1Y9BA 1KN7A 3HE4A 1AVYA 2I1JA 1VQPP 5KLVJ 1SFCB 2HODB 2CPSA 3MTUE 1GMJA 5AW6B 1KQSO 1VQMP 4HYTB 1NU1G 3C8VA 2WSCJ 4MN4C 4BRYB 4N6JA 1SQBD 2H8PD 1VCKA 1AFOA 3GG2A 4NB9D 1RE3C 2E76C 1FZCA 4TLFA 2QPZA 5GTHE 3TGUD 3NMDA 1NTME 1SQBE 2ZVNB 4QDFA 3CWBJ 5CBOA 1MZ9A 3LW5H 3TGUE 2FYNB 2O1JA 3FWNA 2ZAEB 2XKMA 1L4AB 1QL1A 2Q1KA 2WQYC 1J1EB 1USEA 4EDFA 3H1LG 3HE4B 3GF3A 2OYOA 3I56P 2JKVA 1BSHA 3D6YA 2QSIA 3P7KA 1LTJA 3G3ZA 2GA1A 4DCKA 3H1HG 4WBAA 3A0BE 3M06A 3ZDMA 2NPSB 3NTNA 4D6TG 2GM4A 2AXCA 2BMOA 5KJ7A 4KJMA 2E74C 2ZYGA 2Y9ZA 4U3FJ 5DJUB 1H88A 3A2AA 4EMJB 1FZCC 1M57D 2N9BA 2KSEA 4QCKA 1ZRTD 4L74A 3GTEA 3CX5I 2FFDB 1FDIA 3CCMP 5APTA 1AV1A 2IDBA 1ZRTE 2YMYA 1SQXJ 3KZIH 3FOUA 1N86A 2JP3A 1E79H 3B8EB 4H13C 1R5SA 4PD4I 1M8OB 3KYQA 1J1DC 1X8YA 1T6AA 2WWWA 5KKZB 4BWNA 1P84I 1WMKA 1Y8AA 5CCHD 4PD4H 2R44A 1SQPG 1YJNP 2W6AA 4EI2A 2J5UA 1LTJB 1OVRA 4LGDE 2QJYC 1P84H 2QA4P 2LKMA 4Z1MH 1EZVI 4GDOA 1VDFA 1G8JB 4HM6A 2Q5UA 2KXPB 3L74J 3S9OA 5BOKA 3H1KJ 2R5DA 1NTMK 1SQBK 2WSEJ 3L71G 5C39A 5AW5B 2K9YA 5BU8B 1HTLC 3I5CA 5AVRB 1ZV8A 1FDOA 3VMHD 4PJ0H 2N1TA 4HJLA 1LWUA 1QGKB 2OARA 4AUWA 2E4QA 2K3RA 1S3JA 4EIJA 1KTMA 4NPFX 1T2KD 1VF5B 1IZNB 1MFZA 2D2CB 3L72D 2MKVA 4AYCA 4KT0J 2BCCG 3U1AA 1VM9A 2HFED 3MZWB 2WSFJ 1CI6A 1O7NA 2CPBA 1ZN5A 2KLUA 3L72E 1L0LG 2NWFA 3M91A 2IPPA 2P2UA 3Q1MA 1KMIZ 1JM1A 1IFDA 3CCVP 1BE3G 3U1CA 3AE1C 4XE5B 3I55P 4NPDA 2OYHA 1URQD 2H88C 3GHGC 3FXDA 1ZLLA 1FAVA 2L91A 1FDMA 1K04A 1Q90D 2XSHA 2YKOA 2N1TC 1LWUC 3KPEA 1K73Q 3CD6P 1NYHA 1NH4A 1YTZT 3RL0D 2O01H 2KB7P 2XDJA 1M1KQ 4HM1A 1UIIA 1MKMA 1NU1E 2P10A 5CJ4A 4NBCD 3L73G 1JTHB 2QIWA 2P67A 1A02J 4XA4A 5AVSB 3H32A 1NTMJ 1SQBJ 2P58A 4HM3A 4IFMA 1FE6A 1KILA 2E75D 4ASVA 1EXIA 3E1RA 3TGUJ 2PP6A 3H1ID 1D7MA 2QEXP 3CCQP 3QH9A 5KLIB 4HH2A 1G2CA 3H1LD 1JMMA 1KQFB 2JR8A 3H1IE 2DE6D 4NBFD 5E79H 3A3YB 2OYHB 1SQQG 3H1JD 1CSBA 3CWBD 4H0LB 1OVVA 3H1HD 3H1LE 1M56D 3MUDC 3TF5A 4QUQA 3VMYA 1OW6A 3H1JE 1MUUA 3AEDC 3GMAA 2QJKB 3H1HE 1EDKA 3HRNA 1G8KB 3HUSA 1T8ZA 1NTZG 5KAFH 3A0HE 1IO4A 1G1JA 1VQ6P 1QEXA 3HD7A 1OVUA 2JDIH 2ZVOB 5AVTB 5TISH 2GBWA 3H32B 4H44C 1QX8A 1DX7A 2C0XA 2DE5D 2KZIA 3GTSA 1KILB 5CJ0A 4U3FD 4QURA 2OTLP 1GU4A 2I8DA 1UUVA 1LNQA 2Y0EA 2IZ0A 1G2CB 2KS1B 1RQUA 3VP8A 1GDTA 2KP8A 3CC4P 3BRVB 4RJTA 3RL0g 3T97A 4DJGA 3BATA 1M7LA 1NU1K 1PPJG 2R3CA 2VRSA 1JNMA 1VQ9P 4U7JA 2FYUG 1RIEA 2E5YA 4C7RA 1JCCA 3L71D 3VMZA 1JUNA 1NAYA 3HUSB 5APUA 4ZKPA 2HMOA 4WY4A 1HWTC 3L71E 3M0DC 4OGQC 4P1CH 3M9BA 1IFNA 1N7SA 1PIXA 1SS1A 3HD7B 3L74D 3K5BA 2QVAA 1H8AA 1WT6A 3M9HA 2A45I 5M1BA 1K05A 1BDCA 2BCCD 1WQLA 2C9NY 4R4MA 1NKNA 3IR9A 2OGUA 1X22A 3L74E 2A45H 1YYCA 2JEEA 2V7QJ 2OQQA 1KC8Q 3L72J 3B5NA 1S5LX 2BCCE 1LT1A 1N73C 1DH3A 1SP4A 4I6MC 1BE3D 4I2LC 1K9MQ 1AQ5A 3T97B 1L0LE 4YXWH 1O7WA 4BRYA 1NTKG 1X0TA 1VL2A 1HUCA 3Q5PA 3RK3C 1J2JB 4K3AA 2G3AA 1PGQA 1BE3E 1JY2O 3NXSA 1VQKP 1IK7A 3S1KA 2QG4A 1N2DC 1S4XA 1O7PA 2IFMA 4WY4C 1M1JC 1VPCA 3CCRP 1MFTA 1AJYA 3AEFC 2MJZA 1N7SB 2ZFCA 1SJGA 4YXDC 1NU1J 3L73D 1PP9G 2YKPA 1IJDB 3AZCA 1KD1Q 1JM0A 1JY3P 1YI2P 3EFFK 1BCCD 1SFCC 3L73E 2M5AA 1USDA 3B5NB 3N7NA 4PV1B 5B5EH 3SFDC 1SQPK 2NPSA 1IC2A 1TU3F 3RK2B 1KFMA 2M3BA 1BCCE 1QL2A 3D6ZA 1W5CE 5AW2B 1HGZA 2E76D 1SQQD 3WUVA 2ZXEB 5AVWB 1NTMD 3H1IJ 3WMM0 3AE2C 3VMID 2W90A 2HMLA 3EN1A 3H1LJ 2J59M 2XZRA 1SQQE 1SQVG 3UIAA 1NJIQ 3NFQA 1L4AD 3H1JJ 1KZUB 2FFDA 2FYNC 3H1HJ 3LIDA 1L4AC 1NTZD 3CC2P 4HKVA 3BASA 3VTPC 1CW5A 1J1EC 2JWDA 3B71A 2OTJP 2W27A 4R4LA 3BCCD 4AAYB 2K88A 1A02F 1NTZE 1L0LK 3L75D 3VMGD 3KZIE 4PD4D 1K8AQ 2M5AB 3BCCE 2NPSC 3G4SP 2C0WA 5EFWB 2E74D 3L75E 4PD4E 4M3LA 3WU2H 1L0NG 2XR8A 1W2BO 1PPJD 1KQGB 2KSJA 5GTHH 2B89A 2H7HA 2FYUD 5APVA 2G8YA 2NVGA 4NBHD 3PHLA 1UUWA 2FFDC 3JCUE
chains in the Genus database with same CATH topology
3L74E 3GCEA 1PPJE 2YFLA 2ZT9D 3TGUE 1NTKE 3L70E 3C0DA 4H13D 1P84E 3VMID 3VCPA 1ULJA 2XSHA 2QJKC 3EQQA 4U3FE 2QJYC 2FYUE 3GOBA 2GBWA 2BCCE 4H0LD 2HMLA 5KLVE 1G8JB 2A06E 1O7HA 2E4PA 2NVFA 2DE7D 3DQYA 3EN1A 4HM6A 2HMJA 2YVJB 5KKZC 1PP9E 4HM1A 4D6TE 1SQQE 2DE5D 3GTSA 4NBBD 4NBDD 1O7MA 1EZVE 1RFSA 4P1BH 2B24A 4QURA 1NU1E 5BOKA 1L0LE 1O7WA 3GKEA 4NBCD 2NVEA 2HMMA 1UUVA 1KB9E 4NB8D 4PV1D 2FYNC 1L0NE 5HL4A 4H44D 4HKVA 2ZYLA 1EG9A 3VMHD 1BE3E 3D89A 4HJLA 4HM3A 2GBXA 5AEWA 3GZYA 2E4QA 3GZXA 1SQXE 4AIVA 2E75D 2YFJA 4AAYB 4HM0A 3GL0A 1O7PA 2BMOA 1NTZE 4HM5A 2B1XA 2HMKA 4QDFB 2Q3WA 3GL2A 3VMGD 2IBZE 4EMJB 3CXHE 1RIEA 1SJGA 3GB4A 3CWBE 1VM9A 4NBAD 3BCCE 1NYKA 3H1IE 2NUKA 2DE6D 4NBFD 1O7NA 1FQTA 1ULIA 4QCKA 2D2CD 2NUMA 3L72E 5CXMA 2E74D 3L75E 2NWFA 1BGYE 4NBED 3AZCA 4PD4E 3GTEA 4HM7A 2XRXA 1SQVE 2XSOA 4QDCA 3H1LE 4NBGD 1NDOA 2HMOA 2YFIA 3L71E 1JM1A 4HM2A 5KLIC 1VCKA 3L73E 4P1CH 4QDDA 4NB9D 1KYOE 3H1KE 2XR8A 4QUQA 1O7GA 1ZRTE 2BMRA 2BMQA 3H1JE 2JZAA 2HMNA 3CX5E 3FOUA 1SQPE 2QJPC 2QPZA 2YIUC 3H1HE 1Q90C 5AEUA 4HM8A 1VF5D 3N0QA 1G8KB 3VCAA 1NTME 1SQBE 1BCCE 2NVGA 1WQLA 4OGQD 4NBHD 2JO6A 1UUWA 2CKFA 4HM4A 4QUPA 4QDFA 2I7FA 2E76D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 E;  3GCE A;  1PPJ E;  2YFL A;  2ZT9 D;  3TGU E;  1NTK E;  3L70 E;  3C0D A;  4H13 D;  1P84 E;  3VMI D;  3VCP A;  1ULJ A;  2XSH A;  2QJK C;  3EQQ A;  4U3F E;  2QJY C;  2FYU E;  3GOB A;  2GBW A;  2BCC E;  4H0L D;  2HML A;  5KLV E;  1G8J B;  2A06 E;  1O7H A;  2E4P A;  2NVF A;  2DE7 D;  3DQY A;  3EN1 A;  4HM6 A;  2HMJ A;  2YVJ B;  5KKZ C;  1PP9 E;  4HM1 A;  4D6T E;  1SQQ E;  2DE5 D;  3GTS A;  4NBB D;  4NBD D;  1O7M A;  1EZV E;  1RFS A;  4P1B H;  2B24 A;  4QUR A;  1NU1 E;  5BOK A;  1L0L E;  1O7W A;  3GKE A;  4NBC D;  2NVE A;  2HMM A;  1UUV A;  1KB9 E;  4NB8 D;  4PV1 D;  2FYN C;  1L0N E;  5HL4 A;  4H44 D;  4HKV A;  2ZYL A;  1EG9 A;  3VMH D;  1BE3 E;  3D89 A;  4HJL A;  4HM3 A;  2GBX A;  5AEW A;  3GZY A;  2E4Q A;  3GZX A;  1SQX E;  4AIV A;  2E75 D;  2YFJ A;  4AAY B;  4HM0 A;  3GL0 A;  1O7P A;  2BMO A;  1NTZ E;  4HM5 A;  2B1X A;  2HMK A;  4QDF B;  2Q3W A;  3GL2 A;  3VMG D;  2IBZ E;  4EMJ B;  3CXH E;  1RIE A;  1SJG A;  3GB4 A;  3CWB E;  1VM9 A;  4NBA D;  3BCC E;  1NYK A;  3H1I E;  2NUK A;  2DE6 D;  4NBF D;  1O7N A;  1FQT A;  1ULI A;  4QCK A;  2D2C D;  2NUM A;  3L72 E;  5CXM A;  2E74 D;  3L75 E;  2NWF A;  1BGY E;  4NBE D;  3AZC A;  4PD4 E;  3GTE A;  4HM7 A;  2XRX A;  1SQV E;  2XSO A;  4QDC A;  3H1L E;  4NBG D;  1NDO A;  2HMO A;  2YFI A;  3L71 E;  1JM1 A;  4HM2 A;  5KLI C;  1VCK A;  3L73 E;  4P1C H;  4QDD A;  4NB9 D;  1KYO E;  3H1K E;  2XR8 A;  4QUQ A;  1O7G A;  1ZRT E;  2BMR A;  2BMQ A;  3H1J E;  2JZA A;  2HMN A;  3CX5 E;  3FOU A;  1SQP E;  2QJP C;  2QPZ A;  2YIU C;  3H1H E;  1Q90 C;  5AEU A;  4HM8 A;  1VF5 D;  3N0Q A;  1G8K B;  3VCA A;  1NTM E;  1SQB E;  1BCC E;  2NVG A;  1WQL A;  4OGQ D;  4NBH D;  2JO6 A;  1UUW A;  2CKF A;  4HM4 A;  4QUP A;  4QDF A;  2I7F A;  2E76 D; 
#chains in the Genus database with same CATH topology
 2IBZ G;  1FZG A;  1PPJ E;  4H13 D;  1HJB A;  1FJP A;  2FYU E;  3AEG C;  2PGD A;  2E4P A;  2DE7 D;  3CX5 H;  5KKZ C;  3L71 J;  1RF0 A;  2A45 G;  4BXL A;  3GKE A;  1PGJ A;  1KFN A;  1VQO P;  1LTJ C;  2GUS A;  2KUB A;  3VP9 A;  4I7Z B;  2KYV A;  2YFJ A;  1SQQ K;  1PL5 A;  5AVV B;  5KJ7 C;  2BEZ F;  2BCC J;  3KXD A;  1PV3 A;  1GL2 A;  1YHQ P;  2XND H;  1NYK A;  3L4F A;  1L0L J;  1SQX G;  1KYO D;  2D2C D;  2Z5I A;  1VF5 C;  2D2C C;  3VYI A;  2E42 A;  1BE3 J;  1NTZ K;  1JTH A;  1HBW A;  2FYZ A;  3SSU A;  1KYO E;  2KIK A;  2P1J A;  5AVX B;  3USS A;  4TT3 H;  3JC2 2;  3L36 A;  1OIP A;  2ZJS E;  4WWI A;  4DZO A;  2KZJ A;  3TK1 A;  2YNY A;  5GTI H;  1N8R Q;  4DOJ A;  1JO5 A;  2W8Z A;  1PP9 D;  3GCE A;  1U7J A;  3AE3 C;  2Y9Y A;  1H0T A;  5K5G B;  1JY2 P;  5B66 H;  3GOB A;  2C9L Y;  3HTK B;  3MHV A;  1IFP A;  1BDD A;  1L2P A;  1OMI A;  3LW5 J;  1PP9 E;  2QRX A;  3EFG A;  5CCG A;  3L73 J;  1O7M A;  4P1B H;  4C46 A;  1YIJ P;  1RHZ B;  1T3U A;  2N1T D;  1GL2 C;  5HL4 A;  2IX7 C;  1NU1 D;  3TDK A;  3SWF A;  1GL2 B;  1ZME C;  2Y0D A;  5E79 E;  1BCC J;  3Q3D A;  2FYU K;  3CXH D;  2M0B A;  5KAI E;  4L73 A;  3V2N A;  1URQ B;  2WPS A;  1W2E A;  3CXH E;  3M0A A;  2Q7C A;  1SQQ J;  1QVF O;  2WSS H;  1CZQ A;  2E43 A;  5KAF E;  1YBK A;  3L35 A;  4IFD K;  2J58 A;  4HKZ H;  5AW7 B;  1HGV A;  1SQV E;  5AW8 B;  1NDO A;  2YFI A;  3RL0 B;  1VQ7 P;  5KLI C;  3G9R A;  3ABV C;  5AW4 B;  1JMB A;  2KK7 A;  1OX3 A;  2KS1 A;  3AE5 C;  1H0T B;  1VQ5 P;  1JY3 N;  4IL6 E;  3AE9 C;  1KQL A;  2Z5H A;  2OYH C;  1NTZ J;  4JPZ B;  5CCG C;  5H2F E;  4H0L C;  1RH5 B;  1EDL A;  1NGM B;  2CKF A;  2CK3 H;  3BCC J;  2E75 B;  4D6T D;  3OW2 O;  3VCP A;  1NTK K;  3RGU A;  2QJK C;  3L75 J;  4NPE A;  4UB8 H;  2HMJ A;  5AVY B;  3FX0 A;  2Q3E A;  4D6T E;  1Q82 Q;  2RN0 A;  3D71 A;  3MGN A;  4RKU J;  1RF1 A;  3SFE C;  2YO3 A;  2AXT E;  5APQ A;  1SLQ A;  1L0N E;  2HPC A;  4H44 D;  2Y0C A;  3CPW O;  2O3J A;  4JQ0 D;  3D89 A;  1LTB C;  2IBZ D;  3N4X A;  3JSV C;  1KIL C;  4WVZ A;  4LC1 A;  3WUT A;  3CL3 D;  3EQ2 A;  4JYC A;  2FYU J;  2QM7 A;  3AE8 C;  3RBZ A;  2IBZ E;  1JEK A;  3PTZ A;  1HJ0 A;  3PLN A;  2WSC H;  4Y99 B;  1NO4 A;  2YIU B;  2ZYD A;  1EZV G;  3F89 A;  1SQP D;  3OA7 A;  1FOS E;  2XSO A;  3SWK A;  4CPG A;  4OVN F;  4HM2 A;  2B87 A;  1NOH A;  2OYI B;  3C9I A;  4IL6 X;  2HMN A;  2JZA A;  1SQP E;  1S72 P;  4DT0 A;  2ZYA A;  2ZT9 B;  3GW6 A;  3VMX A;  3HUS C;  3VMA A;  4OGQ D;  4HM4 A;  3A0H H;  3BRT B;  1SQV K;  2IYP A;  1ZW0 A;  2W6B A;  1RF1 B;  3HD7 C;  5DJT B;  2HPC B;  1NAF A;  1GK4 A;  1KB9 D;  3KDP B;  1S5L H;  1BGY G;  1RE4 A;  2V4H A;  2AEF A;  1MV8 A;  1KB9 E;  2O01 J;  5AVU B;  1L0L D;  1RY3 A;  2BAS A;  3EWK A;  4KHX A;  3CC7 P;  2WPQ A;  5CMZ A;  2AEM A;  5BVZ A;  5AEW A;  3GZY A;  3GZX A;  4AIV A;  3OAK A;  3RK3 D;  1HH0 A;  2RKL A;  1GW3 A;  3L70 G;  4UB6 H;  2B87 B;  1ZOY C;  1DD3 A;  1AQT A;  1L0N K;  1PP9 J;  3KHU A;  2A06 G;  4ZMD A;  2QJP B;  1PGP A;  1Q81 Q;  2FXM A;  3RK3 E;  1VQN P;  2O1K A;  3W67 A;  1ULI A;  2NUM A;  4WY4 D;  3D70 A;  1G1I A;  4NBE D;  3LIE A;  3Q5S A;  1LT9 B;  4RES B;  1YJ9 P;  1LP1 A;  2Q6Q A;  1RE3 A;  4IFF A;  3O6Q A;  1N7S C;  1O7G A;  2BMQ A;  5KTB A;  2OTK E;  2H43 A;  1FJK A;  4K35 A;  3CI9 A;  5AEU A;  3CLQ A;  1DIP A;  5TJH A;  2NZ2 A;  4OH8 B;  3H25 A;  1SFC D;  3E7K A;  2JO6 A;  4QUP A;  3IFM A;  4AQR D;  3RK2 D;  3CCS P;  3B5N C;  4PV1 C;  3EQQ A;  2WT7 A;  3AE4 C;  2HYN A;  2M8R A;  2WSE H;  4GOE A;  1LTG C;  1SQV J;  3RK2 C;  2FKW B;  1LTS C;  2P7J A;  1JY2 N;  3W68 A;  4NBB D;  2N9Y B;  3P32 A;  1HF9 A;  2WVR A;  1FC2 C;  2W83 C;  1OFC X;  5BU5 A;  3G6E P;  1IFJ A;  1EG9 A;  3AEC C;  1GD2 E;  3CME P;  2YMK A;  3TYY A;  2IYO A;  2HG5 D;  1SQX K;  2RMZ A;  3WU2 E;  1PZQ A;  1U57 A;  1AVO A;  2HMK A;  3Q2Y A;  1EDI A;  2ITA A;  3GL2 A;  2WSF H;  1H89 A;  1S9K D;  1LP1 B;  3O6Q B;  1SVF A;  3GB4 A;  2E76 B;  4D6T J;  5KLV G;  1LJ2 A;  1DEB A;  2BEQ D;  1BSN A;  1X9V A;  4HJG H;  3CX5 D;  1IK9 A;  1ZP0 C;  1KV4 A;  4YTP C;  3RBX A;  3OJA B;  3P8M C;  3G71 P;  2Z4E A;  1S9K E;  2UWJ E;  1L0N J;  4OWF A;  1NVO A;  4HB1 A;  2FXP A;  2NPS D;  3O8Z A;  3H1I G;  3CX5 E;  3V6I A;  2PFX A;  2WT7 B;  4LLH A;  1FS0 E;  4HM8 A;  1P84 D;  3AE7 C;  4JF7 A;  2FBW C;  4C7N A;  1EZV D;  2YFL A;  3AEB C;  3H1J G;  3B4S A;  4O9B A;  1P84 E;  3CWB G;  5CCH A;  1UIX A;  5APX A;  2NVF A;  1O7H A;  3CCE P;  2K9J A;  1DEE G;  1EZV E;  2WPR A;  1SQP J;  1YJW P;  4YPC A;  4IOI H;  2E74 B;  4NB8 D;  3QWO C;  4GOD A;  4PJ0 E;  1Q7Y Q;  2WZ7 A;  1S1C X;  1FZC B;  1S2E A;  2QE7 H;  2XNX A;  4EYY Q;  1ZR2 A;  1JB0 J;  3AE6 C;  2B1X A;  4QDF B;  2JWA A;  2RH0 A;  1BGY D;  2WIT A;  3V5B A;  4U3F G;  3IN6 A;  3HTK A;  4I7Z C;  1FZF A;  5GTI E;  4H13 B;  3A0B H;  5KJ7 D;  1J1D B;  2K37 A;  1BGY E;  1EQ7 A;  2SPZ A;  3V2Q A;  5B66 E;  2R32 A;  4C7N B;  5CCH C;  3TNU A;  4A7P A;  3U59 A;  3H6P A;  2QJY B;  3S4R A;  1NTK D;  1YQ4 C;  3L70 D;  1VF5 D;  3N0Q A;  2B9B A;  2K9J B;  2WTY A;  3GHG A;  2KLV A;  2A06 D;  5CHX A;  1URQ A;  3FGA D;  4L76 A;  2I7F A;  5AW3 B;  3JCU H;  1NTK E;  3L70 E;  5APW A;  2LXC B;  1Q86 Q;  4EOT A;  2A06 E;  1LTA C;  2ZXX A;  4JYB A;  1RF0 C;  2E5T A;  2GUV A;  2PAJ A;  1VQ4 P;  3L74 G;  2DW3 A;  3H1K G;  3WUU A;  1T2K C;  2LR2 A;  2K1A A;  5L8R J;  1X79 B;  1KOR A;  2GBX A;  2B88 A;  4B86 A;  2AEJ A;  3GF7 A;  1DD4 A;  2NRG A;  1GK6 A;  1FZE A;  1GL2 D;  2HR3 A;  4GT1 A;  3R4Y A;  1XTC C;  3PRJ A;  1XTG B;  3TNU B;  4RO0 A;  1JCD A;  3AEE C;  4ASW A;  1EC5 A;  1NKZ B;  4N3Y B;  5CXM A;  1RQV A;  3AEA C;  3GHG B;  4QMA A;  1URQ C;  2XRX A;  3VOP A;  1KYO I;  4XFJ A;  1JY3 O;  2M3E A;  1R8E A;  1M90 Q;  3V2P A;  1LGH B;  3MUD A;  4QDD A;  1FZA A;  4UB8 E;  4W7Z A;  1SQV D;  2BMR A;  1KYO H;  3P8C D;  1R5L A;  1U7M A;  2N1T B;  1LWU B;  1Q90 C;  1PGO A;  3FXE A;  4GKG A;  2V7Q H;  5KLV D;  3E1I A;  3RL0 C;  3M9Q A;  1OW8 A;  3P8C E;  3PJS K;  3CCU P;  3FWL A;  2W6J H;  5TIS E;  3C0D A;  3GLM A;  4GOF A;  3A7O A;  5CCG D;  4H0L D;  5KLV E;  3IF4 A;  2Q9I A;  1CI6 B;  3MD0 A;  1BCC G;  1YIT P;  1FU1 A;  3L37 A;  3CMA P;  3C1L A;  4WB4 A;  1RFS A;  2B24 A;  2O01 N;  5APY A;  2NVE A;  2E75 C;  1YQ3 C;  2FY8 A;  2HMM A;  2OYI A;  2ZYL A;  1ZR4 A;  4L75 A;  2POH A;  1L0N D;  1NTM G;  1SQB G;  5KAI H;  4HM0 A;  2L5G B;  4HM5 A;  2Q3I A;  3CXH I;  3ITK A;  3TGU G;  2WMM A;  1ZXG A;  3CWB E;  3SWY A;  2YKQ A;  1KIL D;  2IFN A;  3CXH H;  2PRR A;  1GTW A;  1LTT C;  1Q2N A;  4HM7 A;  4N78 D;  1N7L A;  1KIL E;  3M0D A;  4JBZ A;  3BCC G;  3R2P A;  4Y99 C;  1Y47 A;  1S5L E;  2YIU C;  4N78 E;  3BVH A;  4IL6 H;  3L75 G;  4W7Y A;  4H44 B;  3VCA A;  3V2R A;  1GU5 A;  5H2F H;  5AVQ B;  3V4W A;  2YO2 A;  4ZNC A;  3MP7 B;  2OYI C;  2ZT9 D;  2R3S A;  4U3F E;  1BGY J;  3CCJ P;  1FBM A;  1N73 A;  3DQY A;  2ZT9 C;  1IFM A;  3HE5 A;  2H89 C;  1OZH A;  1LT9 A;  1AA0 A;  2YXR B;  2KNC A;  4UB6 E;  3HD7 D;  2LXB A;  1SQX D;  1WRG A;  3TSI A;  1RF1 C;  1FOS F;  1NWQ A;  3II6 A;  5CBN A;  5AW9 B;  2KOG A;  2AXT H;  2XU6 A;  1GW4 A;  1LTI C;  4ZKU A;  1NHL A;  5KLV K;  1SQX E;  3PP5 A;  3GL0 A;  1NTK J;  2IBZ I;  3L70 J;  1HVV A;  5AW0 B;  4I1L A;  1M1J A;  1OWA A;  1E5W A;  2HLO A;  2Q3W A;  4OGQ B;  1OXZ A;  3MIW A;  3CCL P;  2WPV B;  4NBA D;  2QM8 A;  2NUK A;  4Y28 J;  3H1K D;  3A5T A;  1FQT A;  3KQG A;  3VN0 A;  1Z56 A;  4QDC A;  4NBG D;  1GZL A;  1EXJ A;  1SFC A;  2HOD A;  3H1K E;  3PH0 A;  5B5E E;  4GIF A;  1T3J A;  2QJP C;  3V4Q A;  2FXO A;  1N73 B;  2JO1 A;  1JOC A;  3HE5 B;  5APS A;  2KI7 B;  1LT9 C;  1FZB A;  1N7S D;  2KNC B;  5AVZ B;  1PFI A;  4W80 A;  1EDJ A;  2IZ1 A;  3RK3 B;  1ULJ A;  1IFI A;  1VQL P;  1QVG O;  3F5H A;  3L72 G;  1QLE D;  2YVJ B;  1RE4 C;  4NBD D;  1KB9 I;  1OW7 A;  3Q5R A;  5AW1 B;  2XV5 A;  4WY4 B;  1VQ8 P;  1M1J B;  3B5N D;  4PV1 D;  2YXQ B;  1KB9 H;  2JJL A;  1L4A A;  1YTZ I;  2R5B A;  3IAO A;  2I1K A;  1Y9B A;  1KN7 A;  3HE4 A;  1AVY A;  2I1J A;  1VQP P;  5KLV J;  1SFC B;  2HOD B;  2CPS A;  3MTU E;  1GMJ A;  5AW6 B;  1KQS O;  1VQM P;  4HYT B;  1NU1 G;  3C8V A;  2WSC J;  4MN4 C;  4BRY B;  4N6J A;  1SQB D;  2H8P D;  1VCK A;  1AFO A;  3GG2 A;  4NB9 D;  1RE3 C;  2E76 C;  1FZC A;  4TLF A;  2QPZ A;  5GTH E;  3TGU D;  3NMD A;  1NTM E;  1SQB E;  2ZVN B;  4QDF A;  3CWB J;  5CBO A;  1MZ9 A;  3LW5 H;  3TGU E;  2FYN B;  2O1J A;  3FWN A;  2ZAE B;  2XKM A;  1L4A B;  1QL1 A;  2Q1K A;  2WQY C;  1J1E B;  1USE A;  4EDF A;  3H1L G;  3HE4 B;  3GF3 A;  2OYO A;  3I56 P;  2JKV A;  1BSH A;  3D6Y A;  2QSI A;  3P7K A;  1LTJ A;  3G3Z A;  2GA1 A;  4DCK A;  3H1H G;  4WBA A;  3A0B E;  3M06 A;  3ZDM A;  2NPS B;  3NTN A;  4D6T G;  2GM4 A;  2AXC A;  2BMO A;  5KJ7 A;  4KJM A;  2E74 C;  2ZYG A;  2Y9Z A;  4U3F J;  5DJU B;  1H88 A;  3A2A A;  4EMJ B;  1FZC C;  1M57 D;  2N9B A;  2KSE A;  4QCK A;  1ZRT D;  4L74 A;  3GTE A;  3CX5 I;  2FFD B;  1FDI A;  3CCM P;  5APT A;  1AV1 A;  2IDB A;  1ZRT E;  2YMY A;  1SQX J;  3KZI H;  3FOU A;  1N86 A;  2JP3 A;  1E79 H;  3B8E B;  4H13 C;  1R5S A;  4PD4 I;  1M8O B;  3KYQ A;  1J1D C;  1X8Y A;  1T6A A;  2WWW A;  5KKZ B;  4BWN A;  1P84 I;  1WMK A;  1Y8A A;  5CCH D;  4PD4 H;  2R44 A;  1SQP G;  1YJN P;  2W6A A;  4EI2 A;  2J5U A;  1LTJ B;  1OVR A;  4LGD E;  2QJY C;  1P84 H;  2QA4 P;  2LKM A;  4Z1M H;  1EZV I;  4GDO A;  1VDF A;  1G8J B;  4HM6 A;  2Q5U A;  2KXP B;  3L74 J;  3S9O A;  5BOK A;  3H1K J;  2R5D A;  1NTM K;  1SQB K;  2WSE J;  3L71 G;  5C39 A;  5AW5 B;  2K9Y A;  5BU8 B;  1HTL C;  3I5C A;  5AVR B;  1ZV8 A;  1FDO A;  3VMH D;  4PJ0 H;  2N1T A;  4HJL A;  1LWU A;  1QGK B;  2OAR A;  4AUW A;  2E4Q A;  2K3R A;  1S3J A;  4EIJ A;  1KTM A;  4NPF X;  1T2K D;  1VF5 B;  1IZN B;  1MFZ A;  2D2C B;  3L72 D;  2MKV A;  4AYC A;  4KT0 J;  2BCC G;  3U1A A;  1VM9 A;  2HFE D;  3MZW B;  2WSF J;  1CI6 A;  1O7N A;  2CPB A;  1ZN5 A;  2KLU A;  3L72 E;  1L0L G;  2NWF A;  3M91 A;  2IPP A;  2P2U A;  3Q1M A;  1KMI Z;  1JM1 A;  1IFD A;  3CCV P;  1BE3 G;  3U1C A;  3AE1 C;  4XE5 B;  3I55 P;  4NPD A;  2OYH A;  1URQ D;  2H88 C;  3GHG C;  3FXD A;  1ZLL A;  1FAV A;  2L91 A;  1FDM A;  1K04 A;  1Q90 D;  2XSH A;  2YKO A;  2N1T C;  1LWU C;  3KPE A;  1K73 Q;  3CD6 P;  1NYH A;  1NH4 A;  1YTZ T;  3RL0 D;  2O01 H;  2KB7 P;  2XDJ A;  1M1K Q;  4HM1 A;  1UII A;  1MKM A;  1NU1 E;  2P10 A;  5CJ4 A;  4NBC D;  3L73 G;  1JTH B;  2QIW A;  2P67 A;  1A02 J;  4XA4 A;  5AVS B;  3H32 A;  1NTM J;  1SQB J;  2P58 A;  4HM3 A;  4IFM A;  1FE6 A;  1KIL A;  2E75 D;  4ASV A;  1EXI A;  3E1R A;  3TGU J;  2PP6 A;  3H1I D;  1D7M A;  2QEX P;  3CCQ P;  3QH9 A;  5KLI B;  4HH2 A;  1G2C A;  3H1L D;  1JMM A;  1KQF B;  2JR8 A;  3H1I E;  2DE6 D;  4NBF D;  5E79 H;  3A3Y B;  2OYH B;  1SQQ G;  3H1J D;  1CSB A;  3CWB D;  4H0L B;  1OVV A;  3H1H D;  3H1L E;  1M56 D;  3MUD C;  3TF5 A;  4QUQ A;  3VMY A;  1OW6 A;  3H1J E;  1MUU A;  3AED C;  3GMA A;  2QJK B;  3H1H E;  1EDK A;  3HRN A;  1G8K B;  3HUS A;  1T8Z A;  1NTZ G;  5KAF H;  3A0H E;  1IO4 A;  1G1J A;  1VQ6 P;  1QEX A;  3HD7 A;  1OVU A;  2JDI H;  2ZVO B;  5AVT B;  5TIS H;  2GBW A;  3H32 B;  4H44 C;  1QX8 A;  1DX7 A;  2C0X A;  2DE5 D;  2KZI A;  3GTS A;  1KIL B;  5CJ0 A;  4U3F D;  4QUR A;  2OTL P;  1GU4 A;  2I8D A;  1UUV A;  1LNQ A;  2Y0E A;  2IZ0 A;  1G2C B;  2KS1 B;  1RQU A;  3VP8 A;  1GDT A;  2KP8 A;  3CC4 P;  3BRV B;  4RJT A;  3RL0 g;  3T97 A;  4DJG A;  3BAT A;  1M7L A;  1NU1 K;  1PPJ G;  2R3C A;  2VRS A;  1JNM A;  1VQ9 P;  4U7J A;  2FYU G;  1RIE A;  2E5Y A;  4C7R A;  1JCC A;  3L71 D;  3VMZ A;  1JUN A;  1NAY A;  3HUS B;  5APU A;  4ZKP A;  2HMO A;  4WY4 A;  1HWT C;  3L71 E;  3M0D C;  4OGQ C;  4P1C H;  3M9B A;  1IFN A;  1N7S A;  1PIX A;  1SS1 A;  3HD7 B;  3L74 D;  3K5B A;  2QVA A;  1H8A A;  1WT6 A;  3M9H A;  2A45 I;  5M1B A;  1K05 A;  1BDC A;  2BCC D;  1WQL A;  2C9N Y;  4R4M A;  1NKN A;  3IR9 A;  2OGU A;  1X22 A;  3L74 E;  2A45 H;  1YYC A;  2JEE A;  2V7Q J;  2OQQ A;  1KC8 Q;  3L72 J;  3B5N A;  1S5L X;  2BCC E;  1LT1 A;  1N73 C;  1DH3 A;  1SP4 A;  4I6M C;  1BE3 D;  4I2L C;  1K9M Q;  1AQ5 A;  3T97 B;  1L0L E;  4YXW H;  1O7W A;  4BRY A;  1NTK G;  1X0T A;  1VL2 A;  1HUC A;  3Q5P A;  3RK3 C;  1J2J B;  4K3A A;  2G3A A;  1PGQ A;  1BE3 E;  1JY2 O;  3NXS A;  1VQK P;  1IK7 A;  3S1K A;  2QG4 A;  1N2D C;  1S4X A;  1O7P A;  2IFM A;  4WY4 C;  1M1J C;  1VPC A;  3CCR P;  1MFT A;  1AJY A;  3AEF C;  2MJZ A;  1N7S B;  2ZFC A;  1SJG A;  4YXD C;  1NU1 J;  3L73 D;  1PP9 G;  2YKP A;  1IJD B;  3AZC A;  1KD1 Q;  1JM0 A;  1JY3 P;  1YI2 P;  3EFF K;  1BCC D;  1SFC C;  3L73 E;  2M5A A;  1USD A;  3B5N B;  3N7N A;  4PV1 B;  5B5E H;  3SFD C;  1SQP K;  2NPS A;  1IC2 A;  1TU3 F;  3RK2 B;  1KFM A;  2M3B A;  1BCC E;  1QL2 A;  3D6Z A;  1W5C E;  5AW2 B;  1HGZ A;  2E76 D;  1SQQ D;  3WUV A;  2ZXE B;  5AVW B;  1NTM D;  3H1I J;  3WMM 0;  3AE2 C;  3VMI D;  2W90 A;  2HML A;  3EN1 A;  3H1L J;  2J59 M;  2XZR A;  1SQQ E;  1SQV G;  3UIA A;  1NJI Q;  3NFQ A;  1L4A D;  3H1J J;  1KZU B;  2FFD A;  2FYN C;  3H1H J;  3LID A;  1L4A C;  1NTZ D;  3CC2 P;  4HKV A;  3BAS A;  3VTP C;  1CW5 A;  1J1E C;  2JWD A;  3B71 A;  2OTJ P;  2W27 A;  4R4L A;  3BCC D;  4AAY B;  2K88 A;  1A02 F;  1NTZ E;  1L0L K;  3L75 D;  3VMG D;  3KZI E;  4PD4 D;  1K8A Q;  2M5A B;  3BCC E;  2NPS C;  3G4S P;  2C0W A;  5EFW B;  2E74 D;  3L75 E;  4PD4 E;  4M3L A;  3WU2 H;  1L0N G;  2XR8 A;  1W2B O;  1PPJ D;  1KQG B;  2KSJ A;  5GTH H;  2B89 A;  2H7H A;  2FYU D;  5APV A;  2G8Y A;  2NVG A;  4NBH D;  3PHL A;  1UUW A;  2FFD C;  3JCU E; 
#chains in the Genus database with same CATH homology
 3L74 E;  3GCE A;  1PPJ E;  2YFL A;  2ZT9 D;  3TGU E;  1NTK E;  3L70 E;  3C0D A;  4H13 D;  1P84 E;  3VMI D;  3VCP A;  1ULJ A;  2XSH A;  2QJK C;  3EQQ A;  4U3F E;  2QJY C;  2FYU E;  3GOB A;  2GBW A;  2BCC E;  4H0L D;  2HML A;  5KLV E;  1G8J B;  2A06 E;  1O7H A;  2E4P A;  2NVF A;  2DE7 D;  3DQY A;  3EN1 A;  4HM6 A;  2HMJ A;  2YVJ B;  5KKZ C;  1PP9 E;  4HM1 A;  4D6T E;  1SQQ E;  2DE5 D;  3GTS A;  4NBB D;  4NBD D;  1O7M A;  1EZV E;  1RFS A;  4P1B H;  2B24 A;  4QUR A;  1NU1 E;  5BOK A;  1L0L E;  1O7W A;  3GKE A;  4NBC D;  2NVE A;  2HMM A;  1UUV A;  1KB9 E;  4NB8 D;  4PV1 D;  2FYN C;  1L0N E;  5HL4 A;  4H44 D;  4HKV A;  2ZYL A;  1EG9 A;  3VMH D;  1BE3 E;  3D89 A;  4HJL A;  4HM3 A;  2GBX A;  5AEW A;  3GZY A;  2E4Q A;  3GZX A;  1SQX E;  4AIV A;  2E75 D;  2YFJ A;  4AAY B;  4HM0 A;  3GL0 A;  1O7P A;  2BMO A;  1NTZ E;  4HM5 A;  2B1X A;  2HMK A;  4QDF B;  2Q3W A;  3GL2 A;  3VMG D;  2IBZ E;  4EMJ B;  3CXH E;  1RIE A;  1SJG A;  3GB4 A;  3CWB E;  1VM9 A;  4NBA D;  3BCC E;  1NYK A;  3H1I E;  2NUK A;  2DE6 D;  4NBF D;  1O7N A;  1FQT A;  1ULI A;  4QCK A;  2D2C D;  2NUM A;  3L72 E;  5CXM A;  2E74 D;  3L75 E;  2NWF A;  1BGY E;  4NBE D;  3AZC A;  4PD4 E;  3GTE A;  4HM7 A;  2XRX A;  1SQV E;  2XSO A;  4QDC A;  3H1L E;  4NBG D;  1NDO A;  2HMO A;  2YFI A;  3L71 E;  1JM1 A;  4HM2 A;  5KLI C;  1VCK A;  3L73 E;  4P1C H;  4QDD A;  4NB9 D;  1KYO E;  3H1K E;  2XR8 A;  4QUQ A;  1O7G A;  1ZRT E;  2BMR A;  2BMQ A;  3H1J E;  2JZA A;  2HMN A;  3CX5 E;  3FOU A;  1SQP E;  2QJP C;  2QPZ A;  2YIU C;  3H1H E;  1Q90 C;  5AEU A;  4HM8 A;  1VF5 D;  3N0Q A;  1G8K B;  3VCA A;  1NTM E;  1SQB E;  1BCC E;  2NVG A;  1WQL A;  4OGQ D;  4NBH D;  2JO6 A;  1UUW A;  2CKF A;  4HM4 A;  4QUP A;  4QDF A;  2I7F A;  2E76 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...