2I7FA

Sphingomonas yanoikuyae b1 ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NKLRLCQVASVKDGEPVAVYQEKMPALAVYNVDGEVFVTDNLCTHGNAMLTDGYQDGTIIECPFHGGSFDIATGAAKAFPCQIPIKTYPVTIEDGWVCIDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin component of dioxygenase
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2i7fA00
2HMLA 1RIEA 4OGQD 3D89A 2JO6A 4H44D 4NBBD 3BCCE 4HM3A 1L0LE 1VM9A 3FOUA 3GL0A 4NBAD 5AEWA 4NBDD 1EZVE 1NU1E 1JM1A 4NBCD 1SQQE 2ZT9D 1BE3E 2Q3WA 1O7PA 4NBHD 3VMID 4QDDA 4HM8A 5CXMA 2YFIA 3H1KE 1NDOA 2NWFA 1ULIA 1G8KB 3VMHD 2E74D 1L0NE 2IBZE 3VMGD 3H1JE 2BMRA 2NVGA 3L75E 2B24A 2NUKA 3N0QA 3CX5E 4QDCA 4H0LD 4QCKA 3CXHE 1NTZE 2I7FA 1SQPE 2B1XA 1VF5D 2HMMA 1O7HA 2XR8A 2BCCE 1G8JB 1KYOE 3H1LE 2FYUE 2NVFA 1O7NA 4HKVA 1PP9E 4EMJB 3EN1A 1BCCE 4HM1A 2DE6D 2BMOA 2GBWA 2QJYC 4HM2A 5KLIC 2QJKC 4P1CH 2XSOA 4HM7A 1EG9A 3H1IE 2QPZA 4AAYB 3L72E 2D2CD 3GZYA 4HM5A 4PD4E 3DQYA 3TGUE 2E4QA 2HMKA 2DE5D 4H13D 4AIVA 2YIUC 1O7GA 3GB4A 4P1BH 4QUPA 4HM4A 5BOKA 2GBXA 2YFJA 2E4PA 3GTSA 2FYNC 3L71E 4NBED 1NYKA 2JZAA 1P84E 4HM6A 1VCKA 2E76D 2E75D 1NTKE 1SQXE 2QJPC 2ZYLA 2A06E 2YFLA 2CKFA 3GTEA 4QURA 3VCAA 3EQQA 2BMQA 5KLVE 1WQLA 3GCEA 1KB9E 3AZCA 1ULJA 4HM0A 2YVJB 1PPJE 1O7MA 1FQTA 2NUMA 2NVEA 4NBFD 4QDFB 1RFSA 5HL4A 2HMJA 3GL2A 3GZXA 4U3FE 1SQVE 1O7WA 4NBGD 3L74E 1UUWA 4HJLA 3H1HE 4QUQA 1SQBE 3VCPA 5AEUA 2HMNA 5KKZC 2XSHA 1ZRTE 3GOBA 4NB9D 1NTME 4QDFA 1SJGA 1UUVA 3L73E 1Q90C 3CWBE 3GKEA 4PV1D 3C0DA 2DE7D 3L70E 2HMOA 4NB8D 2XRXA
chains in the Genus database with same CATH superfamily
2HMLA 1RIEA 4OGQD 3D89A 2JO6A 4H44D 4NBBD 3BCCE 4HM3A 1L0LE 1VM9A 3FOUA 3GL0A 4NBAD 5AEWA 4NBDD 1EZVE 1NU1E 1JM1A 4NBCD 1SQQE 2ZT9D 1BE3E 2Q3WA 1O7PA 4NBHD 3VMID 4QDDA 4HM8A 5CXMA 2YFIA 3H1KE 1NDOA 2NWFA 1ULIA 1G8KB 3VMHD 2E74D 1L0NE 2IBZE 3VMGD 3H1JE 2BMRA 2NVGA 3L75E 2B24A 2NUKA 3N0QA 3CX5E 4QDCA 4H0LD 4QCKA 3CXHE 1NTZE 2I7FA 1SQPE 2B1XA 1VF5D 2HMMA 1O7HA 2XR8A 2BCCE 1G8JB 1KYOE 3H1LE 2FYUE 2NVFA 1O7NA 4HKVA 1PP9E 4EMJB 3EN1A 1BCCE 4HM1A 2DE6D 2BMOA 2GBWA 2QJYC 4HM2A 5KLIC 2QJKC 4P1CH 2XSOA 4HM7A 1EG9A 3H1IE 2QPZA 4AAYB 3L72E 2D2CD 3GZYA 4HM5A 4PD4E 3DQYA 3TGUE 2E4QA 2HMKA 2DE5D 4H13D 4AIVA 2YIUC 1O7GA 3GB4A 4P1BH 4QUPA 4HM4A 5BOKA 2GBXA 2YFJA 2E4PA 3GTSA 2FYNC 3L71E 4NBED 1NYKA 2JZAA 1P84E 4HM6A 1VCKA 2E76D 2E75D 1NTKE 1SQXE 2QJPC 2ZYLA 2A06E 2YFLA 2CKFA 3GTEA 4QURA 3VCAA 3EQQA 2BMQA 5KLVE 1WQLA 3GCEA 1KB9E 3AZCA 1ULJA 4HM0A 2YVJB 1PPJE 1O7MA 1FQTA 2NUMA 2NVEA 4NBFD 4QDFB 1RFSA 5HL4A 2HMJA 3GL2A 3GZXA 4U3FE 1SQVE 1O7WA 4NBGD 3L74E 1UUWA 4HJLA 3H1HE 4QUQA 1SQBE 3VCPA 5AEUA 2HMNA 5KKZC 2XSHA 1ZRTE 3GOBA 4NB9D 1NTME 4QDFA 1SJGA 1UUVA 3L73E 1Q90C 3CWBE 3GKEA 4PV1D 3C0DA 2DE7D 3L70E 2HMOA 4NB8D 2XRXA
chains in the Genus database with same CATH topology
2HMLA 1RIEA 4OGQD 3D89A 2JO6A 4H44D 4NBBD 3BCCE 4HM3A 1L0LE 1VM9A 3FOUA 3GL0A 4NBAD 5AEWA 4NBDD 1EZVE 1NU1E 1JM1A 4NBCD 1SQQE 2ZT9D 1BE3E 2Q3WA 1O7PA 4NBHD 3VMID 4QDDA 4HM8A 5CXMA 2YFIA 3H1KE 1NDOA 2NWFA 1ULIA 1G8KB 3VMHD 2E74D 1L0NE 2IBZE 3VMGD 3H1JE 2BMRA 2NVGA 3L75E 2B24A 2NUKA 3N0QA 3CX5E 4QDCA 4H0LD 4QCKA 3CXHE 1NTZE 2I7FA 1SQPE 2B1XA 1VF5D 2HMMA 1O7HA 2XR8A 2BCCE 1G8JB 1KYOE 3H1LE 2FYUE 2NVFA 1O7NA 4HKVA 1PP9E 4EMJB 3EN1A 1BCCE 4HM1A 2DE6D 2BMOA 2GBWA 2QJYC 4HM2A 5KLIC 2QJKC 4P1CH 2XSOA 4HM7A 1EG9A 3H1IE 2QPZA 4AAYB 3L72E 2D2CD 3GZYA 4HM5A 4PD4E 3DQYA 3TGUE 2E4QA 2HMKA 2DE5D 4H13D 4AIVA 2YIUC 1O7GA 3GB4A 4P1BH 4QUPA 4HM4A 5BOKA 2GBXA 2YFJA 2E4PA 3GTSA 2FYNC 3L71E 4NBED 1NYKA 2JZAA 1P84E 4HM6A 1VCKA 2E76D 2E75D 1NTKE 1SQXE 2QJPC 2ZYLA 2A06E 2YFLA 2CKFA 3GTEA 4QURA 3VCAA 3EQQA 2BMQA 5KLVE 1WQLA 3GCEA 1KB9E 3AZCA 1ULJA 4HM0A 2YVJB 1PPJE 1O7MA 1FQTA 2NUMA 2NVEA 4NBFD 4QDFB 1RFSA 5HL4A 2HMJA 3GL2A 3GZXA 4U3FE 1SQVE 1O7WA 4NBGD 3L74E 1UUWA 4HJLA 3H1HE 4QUQA 1SQBE 3VCPA 5AEUA 2HMNA 5KKZC 2XSHA 1ZRTE 3GOBA 4NB9D 1NTME 4QDFA 1SJGA 1UUVA 3L73E 1Q90C 3CWBE 3GKEA 4PV1D 3C0DA 2DE7D 3L70E 2HMOA 4NB8D 2XRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HML A;  1RIE A;  4OGQ D;  3D89 A;  2JO6 A;  4H44 D;  4NBB D;  3BCC E;  4HM3 A;  1L0L E;  1VM9 A;  3FOU A;  3GL0 A;  4NBA D;  5AEW A;  4NBD D;  1EZV E;  1NU1 E;  1JM1 A;  4NBC D;  1SQQ E;  2ZT9 D;  1BE3 E;  2Q3W A;  1O7P A;  4NBH D;  3VMI D;  4QDD A;  4HM8 A;  5CXM A;  2YFI A;  3H1K E;  1NDO A;  2NWF A;  1ULI A;  1G8K B;  3VMH D;  2E74 D;  1L0N E;  2IBZ E;  3VMG D;  3H1J E;  2BMR A;  2NVG A;  3L75 E;  2B24 A;  2NUK A;  3N0Q A;  3CX5 E;  4QDC A;  4H0L D;  4QCK A;  3CXH E;  1NTZ E;  2I7F A;  1SQP E;  2B1X A;  1VF5 D;  2HMM A;  1O7H A;  2XR8 A;  2BCC E;  1G8J B;  1KYO E;  3H1L E;  2FYU E;  2NVF A;  1O7N A;  4HKV A;  1PP9 E;  4EMJ B;  3EN1 A;  1BCC E;  4HM1 A;  2DE6 D;  2BMO A;  2GBW A;  2QJY C;  4HM2 A;  5KLI C;  2QJK C;  4P1C H;  2XSO A;  4HM7 A;  1EG9 A;  3H1I E;  2QPZ A;  4AAY B;  3L72 E;  2D2C D;  3GZY A;  4HM5 A;  4PD4 E;  3DQY A;  3TGU E;  2E4Q A;  2HMK A;  2DE5 D;  4H13 D;  4AIV A;  2YIU C;  1O7G A;  3GB4 A;  4P1B H;  4QUP A;  4HM4 A;  5BOK A;  2GBX A;  2YFJ A;  2E4P A;  3GTS A;  2FYN C;  3L71 E;  4NBE D;  1NYK A;  2JZA A;  1P84 E;  4HM6 A;  1VCK A;  2E76 D;  2E75 D;  1NTK E;  1SQX E;  2QJP C;  2ZYL A;  2A06 E;  2YFL A;  2CKF A;  3GTE A;  4QUR A;  3VCA A;  3EQQ A;  2BMQ A;  5KLV E;  1WQL A;  3GCE A;  1KB9 E;  3AZC A;  1ULJ A;  4HM0 A;  2YVJ B;  1PPJ E;  1O7M A;  1FQT A;  2NUM A;  2NVE A;  4NBF D;  4QDF B;  1RFS A;  5HL4 A;  2HMJ A;  3GL2 A;  3GZX A;  4U3F E;  1SQV E;  1O7W A;  4NBG D;  3L74 E;  1UUW A;  4HJL A;  3H1H E;  4QUQ A;  1SQB E;  3VCP A;  5AEU A;  2HMN A;  5KKZ C;  2XSH A;  1ZRT E;  3GOB A;  4NB9 D;  1NTM E;  4QDF A;  1SJG A;  1UUV A;  3L73 E;  1Q90 C;  3CWB E;  3GKE A;  4PV1 D;  3C0D A;  2DE7 D;  3L70 E;  2HMO A;  4NB8 D;  2XRX A; 
#chains in the Genus database with same CATH topology
 2HML A;  1RIE A;  4OGQ D;  3D89 A;  2JO6 A;  4H44 D;  4NBB D;  3BCC E;  4HM3 A;  1L0L E;  1VM9 A;  3FOU A;  3GL0 A;  4NBA D;  5AEW A;  4NBD D;  1EZV E;  1NU1 E;  1JM1 A;  4NBC D;  1SQQ E;  2ZT9 D;  1BE3 E;  2Q3W A;  1O7P A;  4NBH D;  3VMI D;  4QDD A;  4HM8 A;  5CXM A;  2YFI A;  3H1K E;  1NDO A;  2NWF A;  1ULI A;  1G8K B;  3VMH D;  2E74 D;  1L0N E;  2IBZ E;  3VMG D;  3H1J E;  2BMR A;  2NVG A;  3L75 E;  2B24 A;  2NUK A;  3N0Q A;  3CX5 E;  4QDC A;  4H0L D;  4QCK A;  3CXH E;  1NTZ E;  2I7F A;  1SQP E;  2B1X A;  1VF5 D;  2HMM A;  1O7H A;  2XR8 A;  2BCC E;  1G8J B;  1KYO E;  3H1L E;  2FYU E;  2NVF A;  1O7N A;  4HKV A;  1PP9 E;  4EMJ B;  3EN1 A;  1BCC E;  4HM1 A;  2DE6 D;  2BMO A;  2GBW A;  2QJY C;  4HM2 A;  5KLI C;  2QJK C;  4P1C H;  2XSO A;  4HM7 A;  1EG9 A;  3H1I E;  2QPZ A;  4AAY B;  3L72 E;  2D2C D;  3GZY A;  4HM5 A;  4PD4 E;  3DQY A;  3TGU E;  2E4Q A;  2HMK A;  2DE5 D;  4H13 D;  4AIV A;  2YIU C;  1O7G A;  3GB4 A;  4P1B H;  4QUP A;  4HM4 A;  5BOK A;  2GBX A;  2YFJ A;  2E4P A;  3GTS A;  2FYN C;  3L71 E;  4NBE D;  1NYK A;  2JZA A;  1P84 E;  4HM6 A;  1VCK A;  2E76 D;  2E75 D;  1NTK E;  1SQX E;  2QJP C;  2ZYL A;  2A06 E;  2YFL A;  2CKF A;  3GTE A;  4QUR A;  3VCA A;  3EQQ A;  2BMQ A;  5KLV E;  1WQL A;  3GCE A;  1KB9 E;  3AZC A;  1ULJ A;  4HM0 A;  2YVJ B;  1PPJ E;  1O7M A;  1FQT A;  2NUM A;  2NVE A;  4NBF D;  4QDF B;  1RFS A;  5HL4 A;  2HMJ A;  3GL2 A;  3GZX A;  4U3F E;  1SQV E;  1O7W A;  4NBG D;  3L74 E;  1UUW A;  4HJL A;  3H1H E;  4QUQ A;  1SQB E;  3VCP A;  5AEU A;  2HMN A;  5KKZ C;  2XSH A;  1ZRT E;  3GOB A;  4NB9 D;  1NTM E;  4QDF A;  1SJG A;  1UUV A;  3L73 E;  1Q90 C;  3CWB E;  3GKE A;  4PV1 D;  3C0D A;  2DE7 D;  3L70 E;  2HMO A;  4NB8 D;  2XRX A; 
#chains in the Genus database with same CATH homology
 2HML A;  1RIE A;  4OGQ D;  3D89 A;  2JO6 A;  4H44 D;  4NBB D;  3BCC E;  4HM3 A;  1L0L E;  1VM9 A;  3FOU A;  3GL0 A;  4NBA D;  5AEW A;  4NBD D;  1EZV E;  1NU1 E;  1JM1 A;  4NBC D;  1SQQ E;  2ZT9 D;  1BE3 E;  2Q3W A;  1O7P A;  4NBH D;  3VMI D;  4QDD A;  4HM8 A;  5CXM A;  2YFI A;  3H1K E;  1NDO A;  2NWF A;  1ULI A;  1G8K B;  3VMH D;  2E74 D;  1L0N E;  2IBZ E;  3VMG D;  3H1J E;  2BMR A;  2NVG A;  3L75 E;  2B24 A;  2NUK A;  3N0Q A;  3CX5 E;  4QDC A;  4H0L D;  4QCK A;  3CXH E;  1NTZ E;  2I7F A;  1SQP E;  2B1X A;  1VF5 D;  2HMM A;  1O7H A;  2XR8 A;  2BCC E;  1G8J B;  1KYO E;  3H1L E;  2FYU E;  2NVF A;  1O7N A;  4HKV A;  1PP9 E;  4EMJ B;  3EN1 A;  1BCC E;  4HM1 A;  2DE6 D;  2BMO A;  2GBW A;  2QJY C;  4HM2 A;  5KLI C;  2QJK C;  4P1C H;  2XSO A;  4HM7 A;  1EG9 A;  3H1I E;  2QPZ A;  4AAY B;  3L72 E;  2D2C D;  3GZY A;  4HM5 A;  4PD4 E;  3DQY A;  3TGU E;  2E4Q A;  2HMK A;  2DE5 D;  4H13 D;  4AIV A;  2YIU C;  1O7G A;  3GB4 A;  4P1B H;  4QUP A;  4HM4 A;  5BOK A;  2GBX A;  2YFJ A;  2E4P A;  3GTS A;  2FYN C;  3L71 E;  4NBE D;  1NYK A;  2JZA A;  1P84 E;  4HM6 A;  1VCK A;  2E76 D;  2E75 D;  1NTK E;  1SQX E;  2QJP C;  2ZYL A;  2A06 E;  2YFL A;  2CKF A;  3GTE A;  4QUR A;  3VCA A;  3EQQ A;  2BMQ A;  5KLV E;  1WQL A;  3GCE A;  1KB9 E;  3AZC A;  1ULJ A;  4HM0 A;  2YVJ B;  1PPJ E;  1O7M A;  1FQT A;  2NUM A;  2NVE A;  4NBF D;  4QDF B;  1RFS A;  5HL4 A;  2HMJ A;  3GL2 A;  3GZX A;  4U3F E;  1SQV E;  1O7W A;  4NBG D;  3L74 E;  1UUW A;  4HJL A;  3H1H E;  4QUQ A;  1SQB E;  3VCP A;  5AEU A;  2HMN A;  5KKZ C;  2XSH A;  1ZRT E;  3GOB A;  4NB9 D;  1NTM E;  4QDF A;  1SJG A;  1UUV A;  3L73 E;  1Q90 C;  3CWB E;  3GKE A;  4PV1 D;  3C0D A;  2DE7 D;  3L70 E;  2HMO A;  4NB8 D;  2XRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...