2I7FA

Sphingomonas yanoikuyae b1 ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
b'NKLRLCQVASVKDGEPVAVYQEKMPALAVYNVDGEVFVTDNLCTHGNAMLTDGYQDGTIIECPFHGGSFDIATGAAKAFPCQIPIKTYPVTIEDGWVCIDQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin component of dioxygenase
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2i7fA00
3BCCE 2DE6D 2GBWA 3VMID 2YFIA 2BMOA 1NDOA 4HM8A 3EQQA 2QJYC 2XR8A 1EZVE 1ZRTE 4NBHD 2QPZA 4HM3A 1Q90C 1G8JB 4HM6A 2YFLA 2CKFA 4P1CH 1NTKE 1SQPE 4H0LD 5AEUA 1O7WA 1SJGA 3GTEA 3AZCA 5AEWA 2GBXA 2QJPC 2HMOA 3CWBE 1O7GA 2E4QA 4QDDA 2NVFA 1NYKA 1ULJA 1P84E 2NVGA 3EN1A 4HM5A 2E76D 4NBFD 4HM1A 2HMLA 2JZAA 3VCPA 1FQTA 3VMHD 3H1LE 2FYUE 2YVJB 3GZXA 1BCCE 2QJKC 3H1IE 4NBCD 3VCAA 1UUWA 1O7HA 3DQYA 2Q3WA 4P1BH 4QDCA 3N0QA 1O7PA 3GL2A 3H1KE 2HMKA 4NB9D 4NB8D 1L0LE 5KLIC 3VMGD 4HKVA 3GKEA 2NUMA 3CXHE 2DE7D 4HM7A 4HM4A 4AAYB 1WQLA 2XSOA 2XSHA 2ZT9D 1PP9E 5CXMA 2I7FA 2A06E 5HL4A 2FYNC 5KKZC 4NBBD 1ULIA 4HM2A 1NTME 1KB9E 1NU1E 4PD4E 3TGUE 3D89A 4QCKA 3GL0A 2HMMA 2YIUC 2NVEA 3FOUA 3L70E 5KLVE 2JO6A 4HJLA 4HM0A 2HMNA 4H13D 1KYOE 1VF5D 1VM9A 3GCEA 1BE3E 3L74E 1RIEA 2YFJA 5BOKA 4NBGD 4NBDD 4H44D 1VCKA 1SQXE 4NBED 1NTZE 3GZYA 3GB4A 4EMJB 3GOBA 3H1JE 2E74D 3CX5E 4QURA 1O7NA 2BCCE 2B24A 3L73E 4QDFA 4QUQA 1EG9A 4NBAD 1PPJE 4AIVA 2NWFA 2E75D 1JM1A 1SQQE 2BMQA 2DE5D 1G8KB 1SQVE 2B1XA 2NUKA 4U3FE 2ZYLA 4PV1D 1UUVA 2XRXA 2IBZE 4QUPA 4QDFB 1L0NE 3L72E 1SQBE 3L75E 3GTSA 2D2CD 2E4PA 3C0DA 1RFSA 3H1HE 4OGQD 2BMRA 3L71E 2HMJA 1O7MA
chains in the Genus database with same CATH superfamily
3BCCE 2DE6D 2GBWA 3VMID 2YFIA 2BMOA 1NDOA 4HM8A 3EQQA 2QJYC 2XR8A 1EZVE 1ZRTE 4NBHD 2QPZA 4HM3A 1Q90C 1G8JB 4HM6A 2YFLA 2CKFA 4P1CH 1NTKE 1SQPE 4H0LD 5AEUA 1O7WA 1SJGA 3GTEA 3AZCA 5AEWA 2GBXA 2QJPC 2HMOA 3CWBE 1O7GA 2E4QA 4QDDA 2NVFA 1NYKA 1ULJA 1P84E 2NVGA 3EN1A 4HM5A 2E76D 4NBFD 4HM1A 2HMLA 2JZAA 3VCPA 1FQTA 3VMHD 3H1LE 2FYUE 2YVJB 3GZXA 1BCCE 2QJKC 3H1IE 4NBCD 3VCAA 1UUWA 1O7HA 3DQYA 2Q3WA 4P1BH 4QDCA 3N0QA 1O7PA 3GL2A 3H1KE 2HMKA 4NB9D 4NB8D 1L0LE 5KLIC 3VMGD 4HKVA 3GKEA 2NUMA 3CXHE 2DE7D 4HM7A 4HM4A 4AAYB 1WQLA 2XSOA 2XSHA 2ZT9D 1PP9E 5CXMA 2I7FA 2A06E 5HL4A 2FYNC 5KKZC 4NBBD 1ULIA 4HM2A 1NTME 1KB9E 1NU1E 4PD4E 3TGUE 3D89A 4QCKA 3GL0A 2HMMA 2YIUC 2NVEA 3FOUA 3L70E 5KLVE 2JO6A 4HJLA 4HM0A 2HMNA 4H13D 1KYOE 1VF5D 1VM9A 3GCEA 1BE3E 3L74E 1RIEA 2YFJA 5BOKA 4NBGD 4NBDD 4H44D 1VCKA 1SQXE 4NBED 1NTZE 3GZYA 3GB4A 4EMJB 3GOBA 3H1JE 2E74D 3CX5E 4QURA 1O7NA 2BCCE 2B24A 3L73E 4QDFA 4QUQA 1EG9A 4NBAD 1PPJE 4AIVA 2NWFA 2E75D 1JM1A 1SQQE 2BMQA 2DE5D 1G8KB 1SQVE 2B1XA 2NUKA 4U3FE 2ZYLA 4PV1D 1UUVA 2XRXA 2IBZE 4QUPA 4QDFB 1L0NE 3L72E 1SQBE 3L75E 3GTSA 2D2CD 2E4PA 3C0DA 1RFSA 3H1HE 4OGQD 2BMRA 3L71E 2HMJA 1O7MA
chains in the Genus database with same CATH topology
3BCCE 2DE6D 2GBWA 3VMID 2YFIA 2BMOA 1NDOA 4HM8A 3EQQA 2QJYC 2XR8A 1EZVE 1ZRTE 4NBHD 2QPZA 4HM3A 1Q90C 1G8JB 4HM6A 2YFLA 2CKFA 4P1CH 1NTKE 1SQPE 4H0LD 5AEUA 1O7WA 1SJGA 3GTEA 3AZCA 5AEWA 2GBXA 2QJPC 2HMOA 3CWBE 1O7GA 2E4QA 4QDDA 2NVFA 1NYKA 1ULJA 1P84E 2NVGA 3EN1A 4HM5A 2E76D 4NBFD 4HM1A 2HMLA 2JZAA 3VCPA 1FQTA 3VMHD 3H1LE 2FYUE 2YVJB 3GZXA 1BCCE 2QJKC 3H1IE 4NBCD 3VCAA 1UUWA 1O7HA 3DQYA 2Q3WA 4P1BH 4QDCA 3N0QA 1O7PA 3GL2A 3H1KE 2HMKA 4NB9D 4NB8D 1L0LE 5KLIC 3VMGD 4HKVA 3GKEA 2NUMA 3CXHE 2DE7D 4HM7A 4HM4A 4AAYB 1WQLA 2XSOA 2XSHA 2ZT9D 1PP9E 5CXMA 2I7FA 2A06E 5HL4A 2FYNC 5KKZC 4NBBD 1ULIA 4HM2A 1NTME 1KB9E 1NU1E 4PD4E 3TGUE 3D89A 4QCKA 3GL0A 2HMMA 2YIUC 2NVEA 3FOUA 3L70E 5KLVE 2JO6A 4HJLA 4HM0A 2HMNA 4H13D 1KYOE 1VF5D 1VM9A 3GCEA 1BE3E 3L74E 1RIEA 2YFJA 5BOKA 4NBGD 4NBDD 4H44D 1VCKA 1SQXE 4NBED 1NTZE 3GZYA 3GB4A 4EMJB 3GOBA 3H1JE 2E74D 3CX5E 4QURA 1O7NA 2BCCE 2B24A 3L73E 4QDFA 4QUQA 1EG9A 4NBAD 1PPJE 4AIVA 2NWFA 2E75D 1JM1A 1SQQE 2BMQA 2DE5D 1G8KB 1SQVE 2B1XA 2NUKA 4U3FE 2ZYLA 4PV1D 1UUVA 2XRXA 2IBZE 4QUPA 4QDFB 1L0NE 3L72E 1SQBE 3L75E 3GTSA 2D2CD 2E4PA 3C0DA 1RFSA 3H1HE 4OGQD 2BMRA 3L71E 2HMJA 1O7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCC E;  2DE6 D;  2GBW A;  3VMI D;  2YFI A;  2BMO A;  1NDO A;  4HM8 A;  3EQQ A;  2QJY C;  2XR8 A;  1EZV E;  1ZRT E;  4NBH D;  2QPZ A;  4HM3 A;  1Q90 C;  1G8J B;  4HM6 A;  2YFL A;  2CKF A;  4P1C H;  1NTK E;  1SQP E;  4H0L D;  5AEU A;  1O7W A;  1SJG A;  3GTE A;  3AZC A;  5AEW A;  2GBX A;  2QJP C;  2HMO A;  3CWB E;  1O7G A;  2E4Q A;  4QDD A;  2NVF A;  1NYK A;  1ULJ A;  1P84 E;  2NVG A;  3EN1 A;  4HM5 A;  2E76 D;  4NBF D;  4HM1 A;  2HML A;  2JZA A;  3VCP A;  1FQT A;  3VMH D;  3H1L E;  2FYU E;  2YVJ B;  3GZX A;  1BCC E;  2QJK C;  3H1I E;  4NBC D;  3VCA A;  1UUW A;  1O7H A;  3DQY A;  2Q3W A;  4P1B H;  4QDC A;  3N0Q A;  1O7P A;  3GL2 A;  3H1K E;  2HMK A;  4NB9 D;  4NB8 D;  1L0L E;  5KLI C;  3VMG D;  4HKV A;  3GKE A;  2NUM A;  3CXH E;  2DE7 D;  4HM7 A;  4HM4 A;  4AAY B;  1WQL A;  2XSO A;  2XSH A;  2ZT9 D;  1PP9 E;  5CXM A;  2I7F A;  2A06 E;  5HL4 A;  2FYN C;  5KKZ C;  4NBB D;  1ULI A;  4HM2 A;  1NTM E;  1KB9 E;  1NU1 E;  4PD4 E;  3TGU E;  3D89 A;  4QCK A;  3GL0 A;  2HMM A;  2YIU C;  2NVE A;  3FOU A;  3L70 E;  5KLV E;  2JO6 A;  4HJL A;  4HM0 A;  2HMN A;  4H13 D;  1KYO E;  1VF5 D;  1VM9 A;  3GCE A;  1BE3 E;  3L74 E;  1RIE A;  2YFJ A;  5BOK A;  4NBG D;  4NBD D;  4H44 D;  1VCK A;  1SQX E;  4NBE D;  1NTZ E;  3GZY A;  3GB4 A;  4EMJ B;  3GOB A;  3H1J E;  2E74 D;  3CX5 E;  4QUR A;  1O7N A;  2BCC E;  2B24 A;  3L73 E;  4QDF A;  4QUQ A;  1EG9 A;  4NBA D;  1PPJ E;  4AIV A;  2NWF A;  2E75 D;  1JM1 A;  1SQQ E;  2BMQ A;  2DE5 D;  1G8K B;  1SQV E;  2B1X A;  2NUK A;  4U3F E;  2ZYL A;  4PV1 D;  1UUV A;  2XRX A;  2IBZ E;  4QUP A;  4QDF B;  1L0N E;  3L72 E;  1SQB E;  3L75 E;  3GTS A;  2D2C D;  2E4P A;  3C0D A;  1RFS A;  3H1H E;  4OGQ D;  2BMR A;  3L71 E;  2HMJ A;  1O7M A; 
#chains in the Genus database with same CATH topology
 3BCC E;  2DE6 D;  2GBW A;  3VMI D;  2YFI A;  2BMO A;  1NDO A;  4HM8 A;  3EQQ A;  2QJY C;  2XR8 A;  1EZV E;  1ZRT E;  4NBH D;  2QPZ A;  4HM3 A;  1Q90 C;  1G8J B;  4HM6 A;  2YFL A;  2CKF A;  4P1C H;  1NTK E;  1SQP E;  4H0L D;  5AEU A;  1O7W A;  1SJG A;  3GTE A;  3AZC A;  5AEW A;  2GBX A;  2QJP C;  2HMO A;  3CWB E;  1O7G A;  2E4Q A;  4QDD A;  2NVF A;  1NYK A;  1ULJ A;  1P84 E;  2NVG A;  3EN1 A;  4HM5 A;  2E76 D;  4NBF D;  4HM1 A;  2HML A;  2JZA A;  3VCP A;  1FQT A;  3VMH D;  3H1L E;  2FYU E;  2YVJ B;  3GZX A;  1BCC E;  2QJK C;  3H1I E;  4NBC D;  3VCA A;  1UUW A;  1O7H A;  3DQY A;  2Q3W A;  4P1B H;  4QDC A;  3N0Q A;  1O7P A;  3GL2 A;  3H1K E;  2HMK A;  4NB9 D;  4NB8 D;  1L0L E;  5KLI C;  3VMG D;  4HKV A;  3GKE A;  2NUM A;  3CXH E;  2DE7 D;  4HM7 A;  4HM4 A;  4AAY B;  1WQL A;  2XSO A;  2XSH A;  2ZT9 D;  1PP9 E;  5CXM A;  2I7F A;  2A06 E;  5HL4 A;  2FYN C;  5KKZ C;  4NBB D;  1ULI A;  4HM2 A;  1NTM E;  1KB9 E;  1NU1 E;  4PD4 E;  3TGU E;  3D89 A;  4QCK A;  3GL0 A;  2HMM A;  2YIU C;  2NVE A;  3FOU A;  3L70 E;  5KLV E;  2JO6 A;  4HJL A;  4HM0 A;  2HMN A;  4H13 D;  1KYO E;  1VF5 D;  1VM9 A;  3GCE A;  1BE3 E;  3L74 E;  1RIE A;  2YFJ A;  5BOK A;  4NBG D;  4NBD D;  4H44 D;  1VCK A;  1SQX E;  4NBE D;  1NTZ E;  3GZY A;  3GB4 A;  4EMJ B;  3GOB A;  3H1J E;  2E74 D;  3CX5 E;  4QUR A;  1O7N A;  2BCC E;  2B24 A;  3L73 E;  4QDF A;  4QUQ A;  1EG9 A;  4NBA D;  1PPJ E;  4AIV A;  2NWF A;  2E75 D;  1JM1 A;  1SQQ E;  2BMQ A;  2DE5 D;  1G8K B;  1SQV E;  2B1X A;  2NUK A;  4U3F E;  2ZYL A;  4PV1 D;  1UUV A;  2XRX A;  2IBZ E;  4QUP A;  4QDF B;  1L0N E;  3L72 E;  1SQB E;  3L75 E;  3GTS A;  2D2C D;  2E4P A;  3C0D A;  1RFS A;  3H1H E;  4OGQ D;  2BMR A;  3L71 E;  2HMJ A;  1O7M A; 
#chains in the Genus database with same CATH homology
 3BCC E;  2DE6 D;  2GBW A;  3VMI D;  2YFI A;  2BMO A;  1NDO A;  4HM8 A;  3EQQ A;  2QJY C;  2XR8 A;  1EZV E;  1ZRT E;  4NBH D;  2QPZ A;  4HM3 A;  1Q90 C;  1G8J B;  4HM6 A;  2YFL A;  2CKF A;  4P1C H;  1NTK E;  1SQP E;  4H0L D;  5AEU A;  1O7W A;  1SJG A;  3GTE A;  3AZC A;  5AEW A;  2GBX A;  2QJP C;  2HMO A;  3CWB E;  1O7G A;  2E4Q A;  4QDD A;  2NVF A;  1NYK A;  1ULJ A;  1P84 E;  2NVG A;  3EN1 A;  4HM5 A;  2E76 D;  4NBF D;  4HM1 A;  2HML A;  2JZA A;  3VCP A;  1FQT A;  3VMH D;  3H1L E;  2FYU E;  2YVJ B;  3GZX A;  1BCC E;  2QJK C;  3H1I E;  4NBC D;  3VCA A;  1UUW A;  1O7H A;  3DQY A;  2Q3W A;  4P1B H;  4QDC A;  3N0Q A;  1O7P A;  3GL2 A;  3H1K E;  2HMK A;  4NB9 D;  4NB8 D;  1L0L E;  5KLI C;  3VMG D;  4HKV A;  3GKE A;  2NUM A;  3CXH E;  2DE7 D;  4HM7 A;  4HM4 A;  4AAY B;  1WQL A;  2XSO A;  2XSH A;  2ZT9 D;  1PP9 E;  5CXM A;  2I7F A;  2A06 E;  5HL4 A;  2FYN C;  5KKZ C;  4NBB D;  1ULI A;  4HM2 A;  1NTM E;  1KB9 E;  1NU1 E;  4PD4 E;  3TGU E;  3D89 A;  4QCK A;  3GL0 A;  2HMM A;  2YIU C;  2NVE A;  3FOU A;  3L70 E;  5KLV E;  2JO6 A;  4HJL A;  4HM0 A;  2HMN A;  4H13 D;  1KYO E;  1VF5 D;  1VM9 A;  3GCE A;  1BE3 E;  3L74 E;  1RIE A;  2YFJ A;  5BOK A;  4NBG D;  4NBD D;  4H44 D;  1VCK A;  1SQX E;  4NBE D;  1NTZ E;  3GZY A;  3GB4 A;  4EMJ B;  3GOB A;  3H1J E;  2E74 D;  3CX5 E;  4QUR A;  1O7N A;  2BCC E;  2B24 A;  3L73 E;  4QDF A;  4QUQ A;  1EG9 A;  4NBA D;  1PPJ E;  4AIV A;  2NWF A;  2E75 D;  1JM1 A;  1SQQ E;  2BMQ A;  2DE5 D;  1G8K B;  1SQV E;  2B1X A;  2NUK A;  4U3F E;  2ZYL A;  4PV1 D;  1UUV A;  2XRX A;  2IBZ E;  4QUP A;  4QDF B;  1L0N E;  3L72 E;  1SQB E;  3L75 E;  3GTS A;  2D2C D;  2E4P A;  3C0D A;  1RFS A;  3H1H E;  4OGQ D;  2BMR A;  3L71 E;  2HMJ A;  1O7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...