2I7FA

Sphingomonas yanoikuyae b1 ferredoxin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
NKLRLCQVASVKDGEPVAVYQEKMPALAVYNVDGEVFVTDNLCTHGNAMLTDGYQDGTIIECPFHGGSFDIATGAAKAFPCQIPIKTYPVTIEDGWVCIDQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigations of the ferredoxin and terminal oxygenase components of the biphenyl 2,3-dioxygenase from Sphingobium yanoikuyae B1.
pubmed doi rcsb
source organism Sphingobium yanoikuyae
molecule tags Oxidoreductase
molecule keywords Ferredoxin component of dioxygenase
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2i7fA00
3GZXA 4HM7A 2Q3WA 4PD4E 1SQQE 4EMJB 1SQBE 3CX5E 3GKEA 1NTKE 3VMGD 2YFJA 1PP9E 1WQLA 4NBAD 1NTME 2BCCE 4H44D 2DE6D 2DE7D 2CKFA 3L74E 2YFIA 1O7HA 3C0DA 4QCKA 1RIEA 4HM3A 4AIVA 4U3FE 4HJLA 1VCKA 2B24A 1SJGA 3L73E 1O7PA 1G8JB 2XRXA 2E75D 1PPJE 2QJPC 4NBFD 1NDOA 3TGUE 5HL4A 3DQYA 1SQPE 2E74D 3L75E 1KB9E 4P1BH 1KYOE 4QDFB 1VF5D 3L71E 5BOKA 1RFSA 2QJYC 2IBZE 1P84E 5KLVE 3H1IE 1G8KB 2XSOA 4PV1D 2GBXA 3VMHD 4H0LD 3GTEA 1NTZE 2I7FA 1O7NA 2ZT9D 1O7MA 4QUPA 5KKZC 2HMMA 4NBDD 2E4PA 3L70E 3GL0A 4HM5A 2NWFA 2NUKA 3EN1A 4HM4A 2NUMA 2B1XA 2BMOA 2D2CD 2HMKA 3H1HE 5KLIC 3GCEA 3BCCE 4HM0A 1L0NE 4HM2A 4NB8D 4QUQA 5CXMA 2NVFA 2YFLA 3VCAA 1BE3E 2HMJA 1EZVE 3FOUA 2A06E 2QJKC 4QDFA 2GBWA 3L72E 2BMRA 4HM1A 2HMOA 2NVGA 4QURA 1VM9A 2NVEA 1NYKA 3D89A 1ZRTE 4NB9D 2E76D 1ULIA 2E4QA 2BMQA 4NBCD 3CXHE 3GOBA 3GTSA 4NBHD 2XR8A 2QPZA 4NBGD 4H13D 2HMLA 2YIUC 4NBED 3VCPA 5AEUA 2HMNA 2JO6A 2FYUE 3CWBE 1L0LE 1SQVE 3H1JE 4HKVA 3AZCA 3EQQA 4AAYB 1UUWA 3GL2A 2DE5D 3GZYA 3GB4A 4HM8A 3N0QA 1SQXE 1JM1A 1EG9A 2XSHA 2YVJB 1BCCE 4NBBD 1O7WA 1NU1E 1UUVA 2ZYLA 5AEWA 1ULJA 2FYNC 4OGQD 4HM6A 3H1KE 4P1CH 4QDCA 1FQTA 1Q90C 3H1LE 2JZAA 1O7GA 4QDDA 3VMID
chains in the Genus database with same CATH superfamily
3GZXA 4HM7A 2Q3WA 4PD4E 1SQQE 4EMJB 1SQBE 3CX5E 3GKEA 1NTKE 3VMGD 2YFJA 1PP9E 1WQLA 4NBAD 1NTME 2BCCE 4H44D 2DE6D 2DE7D 2CKFA 3L74E 2YFIA 1O7HA 3C0DA 4QCKA 1RIEA 4HM3A 4AIVA 4U3FE 4HJLA 1VCKA 2B24A 1SJGA 3L73E 1O7PA 1G8JB 2XRXA 2E75D 1PPJE 2QJPC 4NBFD 1NDOA 3TGUE 5HL4A 3DQYA 1SQPE 2E74D 3L75E 1KB9E 4P1BH 1KYOE 4QDFB 1VF5D 3L71E 5BOKA 1RFSA 2QJYC 2IBZE 1P84E 5KLVE 3H1IE 1G8KB 2XSOA 4PV1D 2GBXA 3VMHD 4H0LD 3GTEA 1NTZE 2I7FA 1O7NA 2ZT9D 1O7MA 4QUPA 5KKZC 2HMMA 4NBDD 2E4PA 3L70E 3GL0A 4HM5A 2NWFA 2NUKA 3EN1A 4HM4A 2NUMA 2B1XA 2BMOA 2D2CD 2HMKA 3H1HE 5KLIC 3GCEA 3BCCE 4HM0A 1L0NE 4HM2A 4NB8D 4QUQA 5CXMA 2NVFA 2YFLA 3VCAA 1BE3E 2HMJA 1EZVE 3FOUA 2A06E 2QJKC 4QDFA 2GBWA 3L72E 2BMRA 4HM1A 2HMOA 2NVGA 4QURA 1VM9A 2NVEA 1NYKA 3D89A 1ZRTE 4NB9D 2E76D 1ULIA 2E4QA 2BMQA 4NBCD 3CXHE 3GOBA 3GTSA 4NBHD 2XR8A 2QPZA 4NBGD 4H13D 2HMLA 2YIUC 4NBED 3VCPA 5AEUA 2HMNA 2JO6A 2FYUE 3CWBE 1L0LE 1SQVE 3H1JE 4HKVA 3AZCA 3EQQA 4AAYB 1UUWA 3GL2A 2DE5D 3GZYA 3GB4A 4HM8A 3N0QA 1SQXE 1JM1A 1EG9A 2XSHA 2YVJB 1BCCE 4NBBD 1O7WA 1NU1E 1UUVA 2ZYLA 5AEWA 1ULJA 2FYNC 4OGQD 4HM6A 3H1KE 4P1CH 4QDCA 1FQTA 1Q90C 3H1LE 2JZAA 1O7GA 4QDDA 3VMID
chains in the Genus database with same CATH topology
3GZXA 4HM7A 2Q3WA 4PD4E 1SQQE 4EMJB 1SQBE 3CX5E 3GKEA 1NTKE 3VMGD 2YFJA 1PP9E 1WQLA 4NBAD 1NTME 2BCCE 4H44D 2DE6D 2DE7D 2CKFA 3L74E 2YFIA 1O7HA 3C0DA 4QCKA 1RIEA 4HM3A 4AIVA 4U3FE 4HJLA 1VCKA 2B24A 1SJGA 3L73E 1O7PA 1G8JB 2XRXA 2E75D 1PPJE 2QJPC 4NBFD 1NDOA 3TGUE 5HL4A 3DQYA 1SQPE 2E74D 3L75E 1KB9E 4P1BH 1KYOE 4QDFB 1VF5D 3L71E 5BOKA 1RFSA 2QJYC 2IBZE 1P84E 5KLVE 3H1IE 1G8KB 2XSOA 4PV1D 2GBXA 3VMHD 4H0LD 3GTEA 1NTZE 2I7FA 1O7NA 2ZT9D 1O7MA 4QUPA 5KKZC 2HMMA 4NBDD 2E4PA 3L70E 3GL0A 4HM5A 2NWFA 2NUKA 3EN1A 4HM4A 2NUMA 2B1XA 2BMOA 2D2CD 2HMKA 3H1HE 5KLIC 3GCEA 3BCCE 4HM0A 1L0NE 4HM2A 4NB8D 4QUQA 5CXMA 2NVFA 2YFLA 3VCAA 1BE3E 2HMJA 1EZVE 3FOUA 2A06E 2QJKC 4QDFA 2GBWA 3L72E 2BMRA 4HM1A 2HMOA 2NVGA 4QURA 1VM9A 2NVEA 1NYKA 3D89A 1ZRTE 4NB9D 2E76D 1ULIA 2E4QA 2BMQA 4NBCD 3CXHE 3GOBA 3GTSA 4NBHD 2XR8A 2QPZA 4NBGD 4H13D 2HMLA 2YIUC 4NBED 3VCPA 5AEUA 2HMNA 2JO6A 2FYUE 3CWBE 1L0LE 1SQVE 3H1JE 4HKVA 3AZCA 3EQQA 4AAYB 1UUWA 3GL2A 2DE5D 3GZYA 3GB4A 4HM8A 3N0QA 1SQXE 1JM1A 1EG9A 2XSHA 2YVJB 1BCCE 4NBBD 1O7WA 1NU1E 1UUVA 2ZYLA 5AEWA 1ULJA 2FYNC 4OGQD 4HM6A 3H1KE 4P1CH 4QDCA 1FQTA 1Q90C 3H1LE 2JZAA 1O7GA 4QDDA 3VMID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZX A;  4HM7 A;  2Q3W A;  4PD4 E;  1SQQ E;  4EMJ B;  1SQB E;  3CX5 E;  3GKE A;  1NTK E;  3VMG D;  2YFJ A;  1PP9 E;  1WQL A;  4NBA D;  1NTM E;  2BCC E;  4H44 D;  2DE6 D;  2DE7 D;  2CKF A;  3L74 E;  2YFI A;  1O7H A;  3C0D A;  4QCK A;  1RIE A;  4HM3 A;  4AIV A;  4U3F E;  4HJL A;  1VCK A;  2B24 A;  1SJG A;  3L73 E;  1O7P A;  1G8J B;  2XRX A;  2E75 D;  1PPJ E;  2QJP C;  4NBF D;  1NDO A;  3TGU E;  5HL4 A;  3DQY A;  1SQP E;  2E74 D;  3L75 E;  1KB9 E;  4P1B H;  1KYO E;  4QDF B;  1VF5 D;  3L71 E;  5BOK A;  1RFS A;  2QJY C;  2IBZ E;  1P84 E;  5KLV E;  3H1I E;  1G8K B;  2XSO A;  4PV1 D;  2GBX A;  3VMH D;  4H0L D;  3GTE A;  1NTZ E;  2I7F A;  1O7N A;  2ZT9 D;  1O7M A;  4QUP A;  5KKZ C;  2HMM A;  4NBD D;  2E4P A;  3L70 E;  3GL0 A;  4HM5 A;  2NWF A;  2NUK A;  3EN1 A;  4HM4 A;  2NUM A;  2B1X A;  2BMO A;  2D2C D;  2HMK A;  3H1H E;  5KLI C;  3GCE A;  3BCC E;  4HM0 A;  1L0N E;  4HM2 A;  4NB8 D;  4QUQ A;  5CXM A;  2NVF A;  2YFL A;  3VCA A;  1BE3 E;  2HMJ A;  1EZV E;  3FOU A;  2A06 E;  2QJK C;  4QDF A;  2GBW A;  3L72 E;  2BMR A;  4HM1 A;  2HMO A;  2NVG A;  4QUR A;  1VM9 A;  2NVE A;  1NYK A;  3D89 A;  1ZRT E;  4NB9 D;  2E76 D;  1ULI A;  2E4Q A;  2BMQ A;  4NBC D;  3CXH E;  3GOB A;  3GTS A;  4NBH D;  2XR8 A;  2QPZ A;  4NBG D;  4H13 D;  2HML A;  2YIU C;  4NBE D;  3VCP A;  5AEU A;  2HMN A;  2JO6 A;  2FYU E;  3CWB E;  1L0L E;  1SQV E;  3H1J E;  4HKV A;  3AZC A;  3EQQ A;  4AAY B;  1UUW A;  3GL2 A;  2DE5 D;  3GZY A;  3GB4 A;  4HM8 A;  3N0Q A;  1SQX E;  1JM1 A;  1EG9 A;  2XSH A;  2YVJ B;  1BCC E;  4NBB D;  1O7W A;  1NU1 E;  1UUV A;  2ZYL A;  5AEW A;  1ULJ A;  2FYN C;  4OGQ D;  4HM6 A;  3H1K E;  4P1C H;  4QDC A;  1FQT A;  1Q90 C;  3H1L E;  2JZA A;  1O7G A;  4QDD A;  3VMI D; 
#chains in the Genus database with same CATH topology
 3GZX A;  4HM7 A;  2Q3W A;  4PD4 E;  1SQQ E;  4EMJ B;  1SQB E;  3CX5 E;  3GKE A;  1NTK E;  3VMG D;  2YFJ A;  1PP9 E;  1WQL A;  4NBA D;  1NTM E;  2BCC E;  4H44 D;  2DE6 D;  2DE7 D;  2CKF A;  3L74 E;  2YFI A;  1O7H A;  3C0D A;  4QCK A;  1RIE A;  4HM3 A;  4AIV A;  4U3F E;  4HJL A;  1VCK A;  2B24 A;  1SJG A;  3L73 E;  1O7P A;  1G8J B;  2XRX A;  2E75 D;  1PPJ E;  2QJP C;  4NBF D;  1NDO A;  3TGU E;  5HL4 A;  3DQY A;  1SQP E;  2E74 D;  3L75 E;  1KB9 E;  4P1B H;  1KYO E;  4QDF B;  1VF5 D;  3L71 E;  5BOK A;  1RFS A;  2QJY C;  2IBZ E;  1P84 E;  5KLV E;  3H1I E;  1G8K B;  2XSO A;  4PV1 D;  2GBX A;  3VMH D;  4H0L D;  3GTE A;  1NTZ E;  2I7F A;  1O7N A;  2ZT9 D;  1O7M A;  4QUP A;  5KKZ C;  2HMM A;  4NBD D;  2E4P A;  3L70 E;  3GL0 A;  4HM5 A;  2NWF A;  2NUK A;  3EN1 A;  4HM4 A;  2NUM A;  2B1X A;  2BMO A;  2D2C D;  2HMK A;  3H1H E;  5KLI C;  3GCE A;  3BCC E;  4HM0 A;  1L0N E;  4HM2 A;  4NB8 D;  4QUQ A;  5CXM A;  2NVF A;  2YFL A;  3VCA A;  1BE3 E;  2HMJ A;  1EZV E;  3FOU A;  2A06 E;  2QJK C;  4QDF A;  2GBW A;  3L72 E;  2BMR A;  4HM1 A;  2HMO A;  2NVG A;  4QUR A;  1VM9 A;  2NVE A;  1NYK A;  3D89 A;  1ZRT E;  4NB9 D;  2E76 D;  1ULI A;  2E4Q A;  2BMQ A;  4NBC D;  3CXH E;  3GOB A;  3GTS A;  4NBH D;  2XR8 A;  2QPZ A;  4NBG D;  4H13 D;  2HML A;  2YIU C;  4NBE D;  3VCP A;  5AEU A;  2HMN A;  2JO6 A;  2FYU E;  3CWB E;  1L0L E;  1SQV E;  3H1J E;  4HKV A;  3AZC A;  3EQQ A;  4AAY B;  1UUW A;  3GL2 A;  2DE5 D;  3GZY A;  3GB4 A;  4HM8 A;  3N0Q A;  1SQX E;  1JM1 A;  1EG9 A;  2XSH A;  2YVJ B;  1BCC E;  4NBB D;  1O7W A;  1NU1 E;  1UUV A;  2ZYL A;  5AEW A;  1ULJ A;  2FYN C;  4OGQ D;  4HM6 A;  3H1K E;  4P1C H;  4QDC A;  1FQT A;  1Q90 C;  3H1L E;  2JZA A;  1O7G A;  4QDD A;  3VMI D; 
#chains in the Genus database with same CATH homology
 3GZX A;  4HM7 A;  2Q3W A;  4PD4 E;  1SQQ E;  4EMJ B;  1SQB E;  3CX5 E;  3GKE A;  1NTK E;  3VMG D;  2YFJ A;  1PP9 E;  1WQL A;  4NBA D;  1NTM E;  2BCC E;  4H44 D;  2DE6 D;  2DE7 D;  2CKF A;  3L74 E;  2YFI A;  1O7H A;  3C0D A;  4QCK A;  1RIE A;  4HM3 A;  4AIV A;  4U3F E;  4HJL A;  1VCK A;  2B24 A;  1SJG A;  3L73 E;  1O7P A;  1G8J B;  2XRX A;  2E75 D;  1PPJ E;  2QJP C;  4NBF D;  1NDO A;  3TGU E;  5HL4 A;  3DQY A;  1SQP E;  2E74 D;  3L75 E;  1KB9 E;  4P1B H;  1KYO E;  4QDF B;  1VF5 D;  3L71 E;  5BOK A;  1RFS A;  2QJY C;  2IBZ E;  1P84 E;  5KLV E;  3H1I E;  1G8K B;  2XSO A;  4PV1 D;  2GBX A;  3VMH D;  4H0L D;  3GTE A;  1NTZ E;  2I7F A;  1O7N A;  2ZT9 D;  1O7M A;  4QUP A;  5KKZ C;  2HMM A;  4NBD D;  2E4P A;  3L70 E;  3GL0 A;  4HM5 A;  2NWF A;  2NUK A;  3EN1 A;  4HM4 A;  2NUM A;  2B1X A;  2BMO A;  2D2C D;  2HMK A;  3H1H E;  5KLI C;  3GCE A;  3BCC E;  4HM0 A;  1L0N E;  4HM2 A;  4NB8 D;  4QUQ A;  5CXM A;  2NVF A;  2YFL A;  3VCA A;  1BE3 E;  2HMJ A;  1EZV E;  3FOU A;  2A06 E;  2QJK C;  4QDF A;  2GBW A;  3L72 E;  2BMR A;  4HM1 A;  2HMO A;  2NVG A;  4QUR A;  1VM9 A;  2NVE A;  1NYK A;  3D89 A;  1ZRT E;  4NB9 D;  2E76 D;  1ULI A;  2E4Q A;  2BMQ A;  4NBC D;  3CXH E;  3GOB A;  3GTS A;  4NBH D;  2XR8 A;  2QPZ A;  4NBG D;  4H13 D;  2HML A;  2YIU C;  4NBE D;  3VCP A;  5AEU A;  2HMN A;  2JO6 A;  2FYU E;  3CWB E;  1L0L E;  1SQV E;  3H1J E;  4HKV A;  3AZC A;  3EQQ A;  4AAY B;  1UUW A;  3GL2 A;  2DE5 D;  3GZY A;  3GB4 A;  4HM8 A;  3N0Q A;  1SQX E;  1JM1 A;  1EG9 A;  2XSH A;  2YVJ B;  1BCC E;  4NBB D;  1O7W A;  1NU1 E;  1UUV A;  2ZYL A;  5AEW A;  1ULJ A;  2FYN C;  4OGQ D;  4HM6 A;  3H1K E;  4P1C H;  4QDC A;  1FQT A;  1Q90 C;  3H1L E;  2JZA A;  1O7G A;  4QDD A;  3VMI D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...