2YIUC

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
DFLYYATAGAGTVAAGAAAWTLVNQMNPSADVQALASIQVDVSGVETGTQLTVKWLGKPVFIRRRTEDEIQAGREVDLGQLIDRSAQNSNKPDAPATDENRTMDEAGEWLVMIGVCTHLGCVPIGDGAGDFGGWFCPCHGSHYDTSGRIRRGPAPQNLHIPVAEFLDDTTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 174
sequence length 174
chains with identical sequence F
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2yiuC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yiuC02
4PV1B 1NU1E 5KKZC 4I7ZB 5KLVE 3H1HE 3BCCE 3GB4A 1FQTA 1Q90D 2QSIA 2HMMA 1UUVA 3CX5E 1WQLA 2HMNA 1G8KB 2E74B 1SJGA 2DE6D 2E74D 3L75E 4HM4A 4QDDA 1UUWA 2YVJB 3CWBE 3L74E 4H0LD 4QDFB 1NTZE 4Y28J 2XSHA 4KT0J 4HM5A 1O7NA 4NBFD 3VCAA 2NWFA 4QDCA 1SQQE 2B1XA 2E75B 2GBWA 3VMID 4IL6X 3GL0A 4OGQD 2NVEA 1VM9A 4H13B 5L8RJ 1ZRTE 1O7MA 3H1IE 1RIEA 3H1JE 4H13D 2K9YA 2FYUE 3C0DA 4HM2A 3VMGD 1ULJA 3H1KE 1NTKE 2QJKC 3GZXA 4NBCD 4NBBD 4QUPA 4NB8D 5BOKA 2I7FA 2CKFA 1PP9E 1PPJE 3AZCA 2WSCJ 2QJYC 1O7HA 1P84E 2GBXA 4AIVA 4HJLA 4HM1A 2D2CB 2D2CD 4HM6A 2BMQA 4H0LB 4H44B 2XSOA 4H44D 4AAYB 4HM3A 2DE7D 4QUQA 4HM0A 4NB9D 3GTSA 3VCPA 4EMJB 1SQVE 4OGQB 2BCCE 5HL4A 2JO6A 3GZYA 5AEUA 5CXMA 3GOBA 1JB0J 2A06E 3GTEA 2IBZE 3FOUA 2ZYLA 2ZT9D 4NBAD 4HKVA 3CXHE 3D89A 1SQXE 3DQYA 2WSFJ 1SQPE 1KYOE 2NUMA 3GCEA 4QCKA 4QURA 1SQBE 2B24A 4NBHD 5AEWA 2YFJA 4NBGD 1VF5B 3C8VA 1VF5D 1KB9E 2NVFA 4QDFA 2E76B 2E76D 4P1CH 2QPZA 1JM1A 1NDOA 2YFLA 4PD4E 1NYKA 1O7GA 1Q90C 1L0NE 2E4PA 1L0LE 4P1BH 1NTME 2HMJA 2O01J 2YIUC 3L70E 2DE5D 3N0QA 1S5LX 2WPVB 3LW5J 4PV1D 1BCCE 2ZT9B 1EG9A 2NUKA 2BMOA 2WSEJ 2BMRA 3L71E 3GKEA 4NBED 5KLIC 3EQQA 1O7PA 1VCKA 4HM8A 2JZAA 2E4QA 3H1LE 1BE3E 2Q3WA 3L72E 2HMLA 4RKUJ 4NBDD 3GL2A 2E75D 4U3FE 4HM7A 1G8JB 3VMHD 2FYNC 3L73E 2HMOA 1ULIA 3EN1A 2QIWA 2QJPC 1O7WA 2XRXA 1EZVE 2HMKA 2XR8A 2YFIA 2NVGA 1RFSA 3TGUE
chains in the Genus database with same CATH superfamily
2Q3IA 1NU1E 1NU1J 1YIJP 1Q90D 4HYTB 1OFCX 1SFCA 5AVSB 3BATA 3V2PA 1NH4A 1RF0C 2Q1KA 4Y28J 2B89A 1YQ3C 3CC2P 2HODB 1M1JB 4QDCA 2N9BA 4IL6X 2Y0DA 1VM9A 2KP8A 5L8RJ 5KAFH 5TJHA 1VF5C 3GW6A 5BOKA 2J58A 2FXPA 1PPJE 1VQLP 2W6AA 3A7OA 2QJPB 1KMIZ 5AVXB 4EMJB 4KHXA 1FZFA 4O9BA 2Z5HA 2ZVOB 4HKVA 1PGJA 2YNYA 1KILA 2ZJSE 2NUMA 5TISE 3V4WA 3CD6P 1KQSO 1S1CX 1FZCB 3PP5A 2WQYC 1YHQP 1G1IA 2K37A 2WT7B 5AVUB 3RK3E 1N7SB 2BCCD 1ZRTD 5CCHA 4HM8A 2FYUD 3NXSA 2NPSB 3TNUB 4MN4C 1R5LA 3LW5H 1JY3O 1AJYA 1EZVE 1G2CB 4N78D 3B5ND 3CCEP 4HB1A 4LC1A 1X79B 1L4AC 1JO5A 4OGQC 1G8KB 2OQQA 1LTJA 4H0LD 3L70D 1HF9A 1GW4A 2I8DA 4QDFB 1SQQE 1SQQJ 1JMMA 5AW1B 4DCKA 1JM0A 4DOJA 2WSCH 4WY4C 4GKGA 5AVTB 2P58A 5GTHE 1EDIA 3RL0g 4BRYB 1SQXK 4I1LA 4IFFA 4HJLA 3EQ2A 4ASWA 2W27A 4L75A 5KJ7D 5EFWB 1GD2E 1KILE 3M0DA 1IJDB 1FJPA 3BVHA 2BCCE 1GK6A 2BCCJ 2FYUJ 2IBZE 4M3LA 3L74D 1MKMA 1DD4A 1KB9I 2E5TA 1KYOE 3SWYA 2Z4EA 1LTIC 1AQ5A 2UWJE 5APQA 1K05A 1JM1A 3L70E 3L70J 2OTJP 1QL1A 1EG9A 3M06A 3HD7B 1VL2A 2A06D 2E5YA 2P10A 4RKUJ 1BGYD 3JCUE 1URQC 3AE2C 2WWWA 1G8JB 1SQXD 3M9HA 1ULIA 1ZN5A 2YXQB 3CCLP 4K35A 2IYOA 3RK2C 2P1JA 4QDDA 3Q5SA 2AEFA 3L74E 3L74J 1IFDA 3AEBC 3H1HG 3D71A 3Q5PA 4AQRD 1O7MA 1MUUA 2KXPB 3H1JE 3H1JJ 5KLIB 4LGDE 2NRGA 3M9BA 1OW7A 1P84I 1LGHB 4NB8D 1LTGC 5DJUB 2BEZF 3WUTA 2CKFA 4OVNF 1PP9E 2WSCJ 3C9IA 1YJWP 4IOIH 1LTAC 1GZLA 1W2EA 2A06E 4NPEA 1KB9H 1SQXE 1SQXJ 1USEA 3A0HE 3I5CA 3V2QA 4NBHD 5APSA 1J1EB 2E76B 4AUWA 4RJTA 2OYHC 4JF7A 3CC4P 2H43A 1GMJA 1SQBG 4GDOA 4PV1D 1H89A 2MKVA 1NO4A 1IK9A 1LWUA 2P7JA 4H13C 1MFZA 5AW9B 1U7JA 3CCMP 2K3RA 4DT0A 2XNDH 3M91A 2FYNC 2RMZA 3EN1A 2HYNA 3PJSK 3CWBG 1RFSA 1KB9D 1ZV8A 2BEQD 2DE6D 1JY2N 4N3YB 4C7NB 3HTKB 5CJ4A 3VCAA 5CCGC 2N1TB 3GL0A 2QA4P 1W2BO 2K9YA 1OVUA 3MIWA 1LP1B 1N73C 2W6JH 4QMAA 5BU5A 3AEAC 3VOPA 3VCPA 1KQFB 4U7JA 1S72P 5CXMA 3SFEC 2FFDB 1T2KC 1URQA 2WPSA 1NAFA 1L0NG 3DQYA 3P32A 3G3ZA 3AE8C 2YFJA 2O3JA 3MZWB 1KB9E 2E76D 2FXMA 3BRTB 3PH0A 2W8ZA 1JCDA 1Q90C 3V5BA 1S5LH 2DW3A 3GHGA 2IDBA 2E75C 3MHVA 2GUVA 3U1CA 4PD4H 2Q3WA 2FY8A 2QM8A 2K88A 1L2PA 3RBXA 3TDKA 3Q3DA 2YKQA 1MFTA 2HG5D 1N86A 4HM4A 4Y99C 2YVJB 2A45G 3FX0A 3P8CD 1FOSF 1RY3A 2N1TD 1EZVI 1LT9C 5AVZB 3RL0B 2IFNA 3U59A 1ULJA 4UB6H 2QJKC 3G71P 1Q7YQ 3D70A 2QJYC 1P84E 3SFDC 4LLHA 1SQBK 5APVA 1NTMD 1M1KQ 3I56P 4AAYB 2ZT9C 3VP9A 5E79E 1QL2A 2L91A 3RK3B 4NBAD 3D6YA 3V4QA 2OTLP 1Q2NA 1DEBA 3RGUA 1SFCB 3B5NC 1R8EA 1A02J 1YYCA 1NU1D 3EFGA 1HWTC 3P8CE 1S5LX 1M1JC 1YI2P 2H89C 2QVAA 5AVYB 5TISH 1Y8AA 1QEXA 3AECC 4CPGA 2YMKA 1BDDA 3PTZA 2A45I 1N73A 1PPJD 5APTA 2Y9YA 2JKVA 1HBWA 2QJPC 1SQBD 3L4FA 1M57D 3CX5I 2M3EA 5KJ7C 3H1HE 3H1HJ 1HUCA 1GU4A 2QSIA 1KILB 2WTYA 1HVVA 1FZBA 5CHXA 2XSHA 2XV5A 4KT0J 3L36A 1JUNA 2NWFA 2NVEA 3L75G 3R2PA 1AA0A 2W83C 3GZXA 4NBCD 4QUPA 1NTZG 3T97A 1SS1A 4UB6E 3AZCA 3JSVC 1FZCC 2W6BA 5KLVK 4H0LB 4XA4A 1NGMB 3RK3D 1N7SC 1T8ZA 2KOGA 2O1KA 5AW0B 5GTHH 3GLMA 2NPSC 4L73A 1FZEA 2R5DA 1JY2P 4QURA 1SQBE 1RE4A 1SQBJ 4DZOA 1SFCD 2NVFA 1EZVD 4EIJA 3JC22 4JQ0D 2KSJA 2YFLA 4IL6E 4N6JA 1FDIA 1SQPG 2K1AA 1OX3A 2Y9ZA 5BVZA 2PFXA 3P7KA 3VTPC 3B8EB 1M90Q 3VP8A 1KYOH 3MUDA 2LKMA 3PLNA 2OYIA 4RO0A 1SQQD 1H8AA 4EI2A 3GKEA 4ZNCA 1M7LA 5APUA 1Q86Q 5KLVD 1NKZB 2C0WA 2R44A 1LTSC 1KILD 1KFNA 2HLOA 3JCUH 1NTKG 2IBZD 1AV1A 1E79H 1KC8Q 3L35A 2C9LY 2J59M 3TYYA 1SQVK 2WMMA 1KYOD 3QH9A 2O1JA 3OJAB 1S3JA 1NJIQ 1IFJA 2JDIH 3L73D 4HM6A 4YXWH 2CPBA 5CCHD 1JCCA 4H44B 3N4XA 3AE9C 1J1DB 3HD7C 3CX5D 3PRJA 4XFJA 2GUSA 2FYZA 5KLVE 5KLVJ 1PIXA 2G8YA 2RN0A 2Q9IA 3A5TA 1IFIA 1NYKA 2XNXA 1GL2A 3HRNA 4ZMDA 1PL5A 2H8PD 1JTHA 4D6TG 5GTIH 3A0HH 2BMOA 4C46A 1JY3N 1SQVD 5KLIC 4EYYQ 3H1JD 2NZ2A 4TLFA 2P2UA 1BCCG 2FXOA 2GA1A 1HH0A 1PP9D 1IC2A 3L73E 4GOEA 3L73J 2HMKA 2YFIA 1RF0A 3OW2O 2ZYAA 3KYQA 1OMIA 4PV1B 1Q81Q 1X0TA 4I7ZB 1FDMA 3W68A 1VQPP 5H2FE 4BXLA 3CX5E 1WQLA 2HMNA 2YIUB 2NPSA 1CI6A 3TGUG 3M9QA 3NFQA 1VQ7P 3MTUE 5APXA 1PGQA 2IFMA 2J5UA 5CJ0A 1KZUB 1LTTC 1J1EC 2E76C 1S2EA 1LWUB 3KZIE 3H1IG 1SQPK 1Z56A 1YITP 4BWNA 3RBZA 4H44D 3A0BE 5KKZB 1HJ0A 1Q82Q 1G1JA 3ITKA 1SQVE 1SQVJ 1IK7A 3L75D 2WSFH 1FZGA 4BRYA 3HUSB 2WPRA 3CCVP 1PP9J 1RH5B 3GCEA 4QCKA 5AVRB 4JBZA 3HE4A 5AW3B 1IFNA 2W90A 5AW5B 4EDFA 2Q5UA 1PFIA 2XDJA 2O01J 1YQ4C 1NAYA 1OWAA 1QGKB 3L37A 2N1TC 2HPCA 4R4LA 1T3UA 5GTIE 2BMRA 4GOFA 1KQLA 1NVOA 1L4AA 2KUBA 4HM7A 1DEEG 2HMOA 1JY2O 1ZMEC 2WVRA 3L72G 3AEEC 1GW3A 2YO3A 2C9NY 3HD7A 3WU2H 4U3FG 3G9RA 3GB4A 3R4YA 1YJ9P 3L75E 3L75J 4NPFX 4WY4A 1KQGB 2FFDC 3O6QA 1NWQA 1NTZE 4NBFD 1O7NA 3WUVA 1NYHA 3BCCG 4OGQD 4A7PA 1RIEA 3M0AA 1W5CE 2AEMA 3GHGB 2I7FA 1EDJA 2ZYDA 1Y47A 2KLUA 1X8YA 2KIKA 3H1KG 4UB8E 1HGZA 2AXTE 4NB9D 1JB0J 1R5SA 2K9JA 1WT6A 3KPEA 1NOHA 1P84H 3D89A 2PAJA 2WSFJ 1SQPE 1SQPJ 5E79H 1FZAA 4P1CH 3HE5B 2OTKE 4WBAA 2WITA 1O7GA 3W67A 2E4PA 2R5BA 4TT3H 2DE5D 1K9MQ 5AW2B 2KNCA 4L74A 4OH8B 3RL0C 1RE3C 1VQNP 3H32A 2KZIA 1FAVA 4AYCA 3PHLA 1QVGO 5AW4B 4NBDD 5AW7B 1RF1B 2JP3A 1ZP0C 3GMAA 5APWA 1P84D 5CMZA 2B9BA 1VQKP 1URQD 1DX7A 2CK3H 1UUVA 3RK3C 2E74B 3WU2E 5B66E 1FDOA 2JO1A 1ZW0A 1TU3F 4NPDA 3V6IA 2B1XA 2MJZA 5BU8B 1CZQA 3G4SP 4WB4A 1PGPA 3BRVB 1UIIA 3F89A 4DJGA 1DD3A 1SFCC 3TK1A 1CW5A 4PJ0E 3EWKA 3CL3D 2D2CB 2FYUG 1X22A 3SWKA 1VQ8P 2OYOA 2DE7D 1SLQA 2M0BA 3IN6A 5HL4A 3GTEA 3CPWO 2ZYLA 2V7QJ 2XU6A 2OYHA 2HFED 3G6EP 1ZLLA 5KTBA 4EOTA 1U7MA 3FGAD 1ZXGA 3IFMA 5B5EE 4GIFA 1KILC 3H1HD 1BSHA 2IPPA 3FWNA 2KYVA 1BCCE 2ZYGA 1BCCJ 1WMKA 3VN0A 3VYIA 3T97B 2WSEJ 1OXZA 1VCKA 1H0TA 1E5WA 4IL6H 2HMLA 3NTNA 4JPZB 4C7RA 4YPCA 1GU5A 1OW8A 4ASVA 4H0LC 5CCGA 1BE3G 5CCHC 3TGUE 1GK4A 2E43A 1A02F 2B87A 2E74D 5AVVB 4YTPC 1U57A 1JOCA 3QWOC 1VQOP 2O01N 4KJMA 2H7HA 3H1IE 4HM2A 3H1IJ 1OW6A 3C0DA 2Y0CA 4HJGH 3L72D 1KFMA 2Z5IA 4U3FD 4HH2A 4GODA 4ZKUA 2OYIB 2D2CD 1VPCA 2I1JA 1BGYG 2AEJA 3VMAA 1SQXG 3BCCD 1L0NK 1YJNP 2L5GB 3CWBD 2V4HA 2ZFCA 3SSUA 3CXHE 4IFMA 3M0DC 3TSIA 4K3AA 3AEGC 3E1IA 1FS0E 1T2KD 2KB7P 1AFOA 3CLQA 2HMJA 5KAIE 3VMYA 1Y9BA 1RHZB 2GM4A 3EFFK 2NUKA 3B4SA 3AEFC 1O7PA 2JZAA 1X9VA 1ZR2A 1LTJB 3L72E 2KS1A 3L72J 1GTWA 2E75D 4U3FE 4U3FJ 3C1LA 2M5AA 3VMHD 1IFMA 3L71G 2IZ0A 2FYUK 4H44C 1J1DC 1LT9A 3BCCE 3BCCJ 2Q7CA 2HMMA 1L0ND 1GDTA 3CWBE 3CWBJ 3H1LG 1PZQA 2A45H 1GL2B 2IYPA 3H1KE 3VMGD 3H1KJ 1JTHB 5H2FH 3MD0A 2B88A 3CX5H 3GF3A 2KK7A 4AIVA 2POHA 2IZ1A 2YKOA 2C0XA 3F5HA 1JNMA 3KXDA 2LXBA 1IZNB 2BASA 1FC2C 2YMYA 3B5NA 4Z1MH 2KLVA 2ZT9D 2PP6A 4YXDC 3KZIH 5K5GB 3P8MC 3GF7A 3A0BH 2B24A 1AQTA 5AEWA 3AE7C 1VF5B 1CI6B 5AW8B 2HODA 1M1JA 1EDKA 4PV1C 4I7ZC 1AVOA 1L0NE 1L0NJ 5AW6B 2Y0EA 2YIUC 3U1AA 1RQUA 2IX7C 3IR9A 1WRGA 2HR3A 3Q2YA 2G3AA 1L0LG 1YTZI 1FJKA 2Q3EA 5KJ7A 2YXRB 3GL2A 2O01H 1YBKA 1T6AA 1LWUC 2QIWA 4R4MA 3I55P 5KAFE 1KV4A 5M1BA 3O8ZA 1H88A 5KKZC 2QM7A 2OGUA 1EXIA 1UUWA 2WSSH 1LTBC 3HE4B 2R32A 3HUSC 1NTZK 1FZCA 3FXEA 1ZRTE 1GL2D 2FYUE 4I2LC 4WWIA 2WT7A 1BE3D 2HPCB 1N7SA 1O7HA 2GBXA 1IFPA 2CPSA 4N78E 1FE6A 4JYCA 2YKPA 1FBMA 3TNUA 3D6ZA 3SWFA 2H88C 2ZVNB 3GTSA 2RKLA 1JEKA 1YTZT 1L4AB 4OGQB 1G2CA 3GZYA 3FOUA 2I1KA 1EC5A 1VQ5P 2WZ7A 2LR2A 4WVZA 4W7YA 4UB8H 3KHUA 1N7SD 1MV8A 4HKZH 2AXTH 1VF5D 4QDFA 3Q1MA 2NPSD 3AE6C 4WY4B 3NMDA 3O6QB 5AVWB 1M56D 2XKMA 3N7NA 1XTGB 3WUUA 3II6A 4ZKPA 1D7MA 2WPVB 3K5BA 1K73Q 3LW5J 4W7ZA 1NTZD 1MZ9A 1NTMG 2RH0A 2E4QA 1BE3E 1BE3J 2QE7H 3GHGC 2QEXP 2AXCA 3AE3C 3LIEA 2K9JB 1NTKK 2P67A 3CI9A 1LNQA 4L76A 2M8RA 2N9YB 4HM5A 1EDLA 1NU1G 3S1KA 5CBOA 2GBWA 3UIAA 1S4XA 1SQPD 3L71D 1LT1A 3A3YB 1BGYE 4RESB 1BGYJ 1OVRA 3OA7A 2KNCB 3LIDA 1URQB 4I6MC 4HM1A 5B66H 5C39A 3H32B 2BMQA 2KI7B 2XSOA 3H1LD 4QUQA 1NTZJ 1PPJG 1LJ2A 3RK2B 1L4AD 3E1RA 4PJ0H 4IFDK 1L0LK 3GOBA 4W80A 1RF1C 3B71A 3KDPB 3HD7D 1VDFA 4PD4I 3C8VA 3AE1C 4WY4D 1NTKD 1HTLC 1IO4A 2V7QH 1HJBA 4P1BH 2E74C 1KORA 3CXHI 3H25A 3OAKA 1ZOYC 3HUSA 4XE5B 3CCQP 1CSBA 3V2NA 5APYA 3L71E 3L71J 3S4RA 1OVVA 5B5EH 1KTMA 1PV3A 4GT1A 1S9KD 3TF5A 2FKWB 2D2CC 3CCSP 2XRXA 1VQ6P 2JJLA 2Q6QA 5AVQB 2NVGA 3H1LE 3USSA 3H1LJ 2WSEH 2KSEA 3AEDC 3KQGA 2OYHB 2WPQA 3ABVC 1FQTA 1L0LD 1SJGA 1EZVG 2LXCB 3CMEP 2ITAA 1BSNA 4H13B 1VQ9P 1HGVA 2M3BA 2ZAEB 1USDA 1NTKE 1NTKJ 4JYBA 4NBBD 3FXDA 4D6TD 3VMXA 1VQ4P 1SQQG 2FYNB 1KD1Q 3ZDMA 3E7KA 3CCJP 1QVFO 1H0TB 2PGDA 4HM3A 4HM0A 3RK2D 1BCCD 3A2AA 1N8RQ 5KLVG 2JO6A 3MGNA 3CMAP 1EQ7A 1NTMK 3Q5RA 1JY3P 1S9KE 1K8AQ 2QG4A 1AVYA 2BCCG 4C7NA 3HTKA 4NBGD 2ZXEB 2B87B 2IBZG 3GG2A 4B86A 2PRRA 2N1TA 3V2RA 3TGUD 1NDOA 2JWDA 1J2JB 1N7LA 1L0LE 1L0LJ 5CBNA 1N73B 1FOSE 3WMM0 3CXHH 3N0QA 1RE4C 1NU1K 1LP1A 3L73G 3MP7B 3AE5C 2JR8A 3H1ID 3L70G 3AE4C 3HE5A 1DIPA 4D6TE 4D6TJ 2OARA 5KAIH 1OIPA 3MUDC 3IF4A 2OYIC 2FFDA 2KZJA 1UIXA 1QX8A 4PD4D 2FBWC 1RQVA 1RF1A 2QRXA 3VMID 2E75B 3CXHD 2XZRA 4H13D 1T3JA 3IAOA 2SPZA 1M8OB 3CC7P 3L74G 2R3SA 1SVFA 3TGUJ 1SQVG 1ZR4A 3H1JG 3FWLA 1N2DC 1K04A 2KS1B 1NHLA 2IBZI 1PP9G 2VRSA 2M5AB 5DJTB 5AEUA 4Y99B 1KYOI 1LTJC 2YO2A 1S5LE 5CCGD 1LT9B 2JEEA 2A06G 1NKNA 2QJKB 1QLED 3CCUP 2QPZA 1RE3A 4PD4E 2E42A 1KN7A 2JWAA 1PGOA 2QJYB 1FU1A 1EXJA 1NTME 3CCRP 1NTMJ 3S9OA 2R3CA 1JMBA 2ZT9B 2ZXXA 3VMZA 1GL2C 4NBED 3EQQA 3H6PA 1XTCC 4OWFA 1VQMP 1OZHA 3H1KD 1BDCA 3RL0D 1SQQK 3BASA 1O7WA 2XR8A 3B5NB 1SP4A 1DH3A
chains in the Genus database with same CATH topology
3AEEC 5M1BA 1NU1E 5KKZC 3Q3DA 3G9RA 3GB4A 3R4YA 1Q90D 3L75E 1EXIA 4HM4A 1UUWA 2YVJB 1KQGB 3O6QA 1NTZE 4Y28J 4NBFD 1YQ3C 1O7NA 4QDCA 4IL6X 1NYHA 4OGQD 1VM9A 5L8RJ 1ZRTE 1RIEA 2FYUE 1ULJA 1VF5C 2QJKC 5BOKA 2I7FA 2FXPA 1PPJE 3D70A 2QJYC 1O7HA 1P84E 2GBXA 3SFDC 3D6ZA 4AAYB 1KMIZ 2H88C 2ZT9C 4NB9D 3GTSA 4EMJB 4OGQB 3GZYA 1JB0J 3FOUA 4NBAD 3D6YA 4HKVA 3D89A 2WSFJ 1SQPE 2NUMA 1VF5D 4QDFA 3Q1MA 3AE6C 4P1CH 1R8EA 1S1CX 1O7GA 2E4PA 4TT3H 2WQYC 2DE5D 1S5LX 2WPVB 3LW5J 3RK3E 2H89C 4HM8A 2E4QA 3AECC 1BE3E 4NBDD 2YMKA 2JP3A 1ZP0C 3GMAA 1AJYA 2QJPC 3AE3C 1EZVE 3H1HE 2QSIA 1UUVA 4OGQC 1G8KB 2E74B 2OQQA 4H0LD 1HF9A 4QDFB 2XSHA 1FDOA 2JO1A 4KT0J 1TU3F 4HM5A 2NWFA 1SQQE 2B1XA 2GBWA 2NVEA 1DD3A 3GZXA 4NBCD 4QUPA 3RL0g 3AZCA 3EWKA 4HJLA 4HM1A 2D2CB 2BMQA 4H0LB 2XSOA 2DE7D 4QUQA 1KILE 1NGMB 3IN6A 5HL4A 2BCCE 3GOBA 3GTEA 2IBZE 3GLMA 2ZYLA 2V7QJ 1MKMA 3B71A 1DD4A 1KYOE 4QURA 1SQBE 3C8VA 2NVFA 3AE1C 1K05A 3FGAD 1JM1A 2YFLA 1FDIA 4P1BH 2E74C 1KORA 3H25A 3L70E 1ZOYC 1BCCE 1WMKA 1EG9A 3T97B 2WSEJ 3L71E 3GKEA 1VCKA 1VL2A 2P10A 2HMLA 4RKUJ 1KTMA 1PV3A 3AE2C 1G8JB 1ULIA 2D2CC 2XRXA 1OW8A 2NVGA 3H1LE 4H0LC 3TGUE 3AEDC 3ABVC 1FQTA 2E74D 1SJGA 4QDDA 4YTPC 3Q5SA 1U57A 3L74E 3AEBC 3D71A 3Q5PA 4H13B 1O7MA 3H1IE 4HM2A 3H1JE 1OW6A 3C0DA 1OW7A 1NTKE 4NBBD 4NB8D 2BEZF 2CKFA 1PP9E 2WSCJ 2D2CD 4HM6A 4H44B 4HM3A 3AE9C 4HM0A 2JO6A 2A06E 4XFJA 3Q5RA 3CXHE 1SQXE 5KLVE 3AEGC 4NBHD 1PIXA 4NBGD 2G8YA 2E76B 1NDOA 1NYKA 1L0LE 1PL5A 2HMJA 1GMJA 3N0QA 4GDOA 4PV1D 2MKVA 1Y9BA 2NUKA 2BMOA 4H13C 3AE5C 3AEFC 5KLIC 1O7PA 2JZAA 3AE4C 1DIPA 2NZ2A 3L72E 2E75D 4U3FE 3VMHD 2FYNC 3L73E 3EN1A 2HMKA 2YFIA 1RFSA 4H44C 1OMIA 4PV1B 4I7ZB 3BCCE 2BEQD 1UIXA 2HMMA 3CX5E 2FBWC 1WQLA 1RQVA 2HMNA 2DE6D 3CWBE 3VCAA 3VMID 2E75B 3GL0A 4H13D 3IAOA 2K9YA 2J5UA 3VMGD 3H1KE 2E76C 3GF3A 4AIVA 3AEAC 4H44D 1K04A 1HJ0A 3VCPA 1KQFB 4U7JA 1SQVE 1IK7A 5AEUA 5CXMA 3SFEC 4Z1MH 2ZT9D 4YXDC 3DQYA 3GF7A 3GCEA 4QCKA 2B24A 3AE8C 2YFJA 5AEWA 3AE7C 1VF5B 1KB9E 2E76D 2QPZA 4PV1C 4I7ZC 4PD4E 1Q90C 1L0NE 1EXJA 1NTME 2O01J 2YIUC 3S9OA 1YQ4C 1RQUA 2IDBA 2ZT9B 2E75C 4R4LA 3Q2YA 2G3AA 2BMRA 4NBED 3EQQA 2Q3WA 3GL2A 4HM7A 2HMOA 2QIWA 4R4MA 1O7WA 2XR8A 1ZMEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV1 B;  1NU1 E;  5KKZ C;  4I7Z B;  5KLV E;  3H1H E;  3BCC E;  3GB4 A;  1FQT A;  1Q90 D;  2QSI A;  2HMM A;  1UUV A;  3CX5 E;  1WQL A;  2HMN A;  1G8K B;  2E74 B;  1SJG A;  2DE6 D;  2E74 D;  3L75 E;  4HM4 A;  4QDD A;  1UUW A;  2YVJ B;  3CWB E;  3L74 E;  4H0L D;  4QDF B;  1NTZ E;  4Y28 J;  2XSH A;  4KT0 J;  4HM5 A;  1O7N A;  4NBF D;  3VCA A;  2NWF A;  4QDC A;  1SQQ E;  2B1X A;  2E75 B;  2GBW A;  3VMI D;  4IL6 X;  3GL0 A;  4OGQ D;  2NVE A;  1VM9 A;  4H13 B;  5L8R J;  1ZRT E;  1O7M A;  3H1I E;  1RIE A;  3H1J E;  4H13 D;  2K9Y A;  2FYU E;  3C0D A;  4HM2 A;  3VMG D;  1ULJ A;  3H1K E;  1NTK E;  2QJK C;  3GZX A;  4NBC D;  4NBB D;  4QUP A;  4NB8 D;  5BOK A;  2I7F A;  2CKF A;  1PP9 E;  1PPJ E;  3AZC A;  2WSC J;  2QJY C;  1O7H A;  1P84 E;  2GBX A;  4AIV A;  4HJL A;  4HM1 A;  2D2C B;  2D2C D;  4HM6 A;  2BMQ A;  4H0L B;  4H44 B;  2XSO A;  4H44 D;  4AAY B;  4HM3 A;  2DE7 D;  4QUQ A;  4HM0 A;  4NB9 D;  3GTS A;  3VCP A;  4EMJ B;  1SQV E;  4OGQ B;  2BCC E;  5HL4 A;  2JO6 A;  3GZY A;  5AEU A;  5CXM A;  3GOB A;  1JB0 J;  2A06 E;  3GTE A;  2IBZ E;  3FOU A;  2ZYL A;  2ZT9 D;  4NBA D;  4HKV A;  3CXH E;  3D89 A;  1SQX E;  3DQY A;  2WSF J;  1SQP E;  1KYO E;  2NUM A;  3GCE A;  4QCK A;  4QUR A;  1SQB E;  2B24 A;  4NBH D;  5AEW A;  2YFJ A;  4NBG D;  1VF5 B;  3C8V A;  1VF5 D;  1KB9 E;  2NVF A;  4QDF A;  2E76 B;  2E76 D;  4P1C H;  2QPZ A;  1JM1 A;  1NDO A;  2YFL A;  4PD4 E;  1NYK A;  1O7G A;  1Q90 C;  1L0N E;  2E4P A;  1L0L E;  4P1B H;  1NTM E;  2HMJ A;  2O01 J;  2YIU C;  3L70 E;  2DE5 D;  3N0Q A;  1S5L X;  2WPV B;  3LW5 J;  4PV1 D;  1BCC E;  2ZT9 B;  1EG9 A;  2NUK A;  2BMO A;  2WSE J;  2BMR A;  3L71 E;  3GKE A;  4NBE D;  5KLI C;  3EQQ A;  1O7P A;  1VCK A;  4HM8 A;  2JZA A;  2E4Q A;  3H1L E;  1BE3 E;  2Q3W A;  3L72 E;  2HML A;  4RKU J;  4NBD D;  3GL2 A;  2E75 D;  4U3F E;  4HM7 A;  1G8J B;  3VMH D;  2FYN C;  3L73 E;  2HMO A;  1ULI A;  3EN1 A;  2QIW A;  2QJP C;  1O7W A;  2XRX A;  1EZV E;  2HMK A;  2XR8 A;  2YFI A;  2NVG A;  1RFS A;  3TGU E; 
#chains in the Genus database with same CATH topology
 2Q3I A;  1NU1 E;  1NU1 J;  1YIJ P;  1Q90 D;  4HYT B;  1OFC X;  1SFC A;  5AVS B;  3BAT A;  3V2P A;  1NH4 A;  1RF0 C;  2Q1K A;  4Y28 J;  2B89 A;  1YQ3 C;  3CC2 P;  2HOD B;  1M1J B;  4QDC A;  2N9B A;  4IL6 X;  2Y0D A;  1VM9 A;  2KP8 A;  5L8R J;  5KAF H;  5TJH A;  1VF5 C;  3GW6 A;  5BOK A;  2J58 A;  2FXP A;  1PPJ E;  1VQL P;  2W6A A;  3A7O A;  2QJP B;  1KMI Z;  5AVX B;  4EMJ B;  4KHX A;  1FZF A;  4O9B A;  2Z5H A;  2ZVO B;  4HKV A;  1PGJ A;  2YNY A;  1KIL A;  2ZJS E;  2NUM A;  5TIS E;  3V4W A;  3CD6 P;  1KQS O;  1S1C X;  1FZC B;  3PP5 A;  2WQY C;  1YHQ P;  1G1I A;  2K37 A;  2WT7 B;  5AVU B;  3RK3 E;  1N7S B;  2BCC D;  1ZRT D;  5CCH A;  4HM8 A;  2FYU D;  3NXS A;  2NPS B;  3TNU B;  4MN4 C;  1R5L A;  3LW5 H;  1JY3 O;  1AJY A;  1EZV E;  1G2C B;  4N78 D;  3B5N D;  3CCE P;  4HB1 A;  4LC1 A;  1X79 B;  1L4A C;  1JO5 A;  4OGQ C;  1G8K B;  2OQQ A;  1LTJ A;  4H0L D;  3L70 D;  1HF9 A;  1GW4 A;  2I8D A;  4QDF B;  1SQQ E;  1SQQ J;  1JMM A;  5AW1 B;  4DCK A;  1JM0 A;  4DOJ A;  2WSC H;  4WY4 C;  4GKG A;  5AVT B;  2P58 A;  5GTH E;  1EDI A;  3RL0 g;  4BRY B;  1SQX K;  4I1L A;  4IFF A;  4HJL A;  3EQ2 A;  4ASW A;  2W27 A;  4L75 A;  5KJ7 D;  5EFW B;  1GD2 E;  1KIL E;  3M0D A;  1IJD B;  1FJP A;  3BVH A;  2BCC E;  1GK6 A;  2BCC J;  2FYU J;  2IBZ E;  4M3L A;  3L74 D;  1MKM A;  1DD4 A;  1KB9 I;  2E5T A;  1KYO E;  3SWY A;  2Z4E A;  1LTI C;  1AQ5 A;  2UWJ E;  5APQ A;  1K05 A;  1JM1 A;  3L70 E;  3L70 J;  2OTJ P;  1QL1 A;  1EG9 A;  3M06 A;  3HD7 B;  1VL2 A;  2A06 D;  2E5Y A;  2P10 A;  4RKU J;  1BGY D;  3JCU E;  1URQ C;  3AE2 C;  2WWW A;  1G8J B;  1SQX D;  3M9H A;  1ULI A;  1ZN5 A;  2YXQ B;  3CCL P;  4K35 A;  2IYO A;  3RK2 C;  2P1J A;  4QDD A;  3Q5S A;  2AEF A;  3L74 E;  3L74 J;  1IFD A;  3AEB C;  3H1H G;  3D71 A;  3Q5P A;  4AQR D;  1O7M A;  1MUU A;  2KXP B;  3H1J E;  3H1J J;  5KLI B;  4LGD E;  2NRG A;  3M9B A;  1OW7 A;  1P84 I;  1LGH B;  4NB8 D;  1LTG C;  5DJU B;  2BEZ F;  3WUT A;  2CKF A;  4OVN F;  1PP9 E;  2WSC J;  3C9I A;  1YJW P;  4IOI H;  1LTA C;  1GZL A;  1W2E A;  2A06 E;  4NPE A;  1KB9 H;  1SQX E;  1SQX J;  1USE A;  3A0H E;  3I5C A;  3V2Q A;  4NBH D;  5APS A;  1J1E B;  2E76 B;  4AUW A;  4RJT A;  2OYH C;  4JF7 A;  3CC4 P;  2H43 A;  1GMJ A;  1SQB G;  4GDO A;  4PV1 D;  1H89 A;  2MKV A;  1NO4 A;  1IK9 A;  1LWU A;  2P7J A;  4H13 C;  1MFZ A;  5AW9 B;  1U7J A;  3CCM P;  2K3R A;  4DT0 A;  2XND H;  3M91 A;  2FYN C;  2RMZ A;  3EN1 A;  2HYN A;  3PJS K;  3CWB G;  1RFS A;  1KB9 D;  1ZV8 A;  2BEQ D;  2DE6 D;  1JY2 N;  4N3Y B;  4C7N B;  3HTK B;  5CJ4 A;  3VCA A;  5CCG C;  2N1T B;  3GL0 A;  2QA4 P;  1W2B O;  2K9Y A;  1OVU A;  3MIW A;  1LP1 B;  1N73 C;  2W6J H;  4QMA A;  5BU5 A;  3AEA C;  3VOP A;  3VCP A;  1KQF B;  4U7J A;  1S72 P;  5CXM A;  3SFE C;  2FFD B;  1T2K C;  1URQ A;  2WPS A;  1NAF A;  1L0N G;  3DQY A;  3P32 A;  3G3Z A;  3AE8 C;  2YFJ A;  2O3J A;  3MZW B;  1KB9 E;  2E76 D;  2FXM A;  3BRT B;  3PH0 A;  2W8Z A;  1JCD A;  1Q90 C;  3V5B A;  1S5L H;  2DW3 A;  3GHG A;  2IDB A;  2E75 C;  3MHV A;  2GUV A;  3U1C A;  4PD4 H;  2Q3W A;  2FY8 A;  2QM8 A;  2K88 A;  1L2P A;  3RBX A;  3TDK A;  3Q3D A;  2YKQ A;  1MFT A;  2HG5 D;  1N86 A;  4HM4 A;  4Y99 C;  2YVJ B;  2A45 G;  3FX0 A;  3P8C D;  1FOS F;  1RY3 A;  2N1T D;  1EZV I;  1LT9 C;  5AVZ B;  3RL0 B;  2IFN A;  3U59 A;  1ULJ A;  4UB6 H;  2QJK C;  3G71 P;  1Q7Y Q;  3D70 A;  2QJY C;  1P84 E;  3SFD C;  4LLH A;  1SQB K;  5APV A;  1NTM D;  1M1K Q;  3I56 P;  4AAY B;  2ZT9 C;  3VP9 A;  5E79 E;  1QL2 A;  2L91 A;  3RK3 B;  4NBA D;  3D6Y A;  3V4Q A;  2OTL P;  1Q2N A;  1DEB A;  3RGU A;  1SFC B;  3B5N C;  1R8E A;  1A02 J;  1YYC A;  1NU1 D;  3EFG A;  1HWT C;  3P8C E;  1S5L X;  1M1J C;  1YI2 P;  2H89 C;  2QVA A;  5AVY B;  5TIS H;  1Y8A A;  1QEX A;  3AEC C;  4CPG A;  2YMK A;  1BDD A;  3PTZ A;  2A45 I;  1N73 A;  1PPJ D;  5APT A;  2Y9Y A;  2JKV A;  1HBW A;  2QJP C;  1SQB D;  3L4F A;  1M57 D;  3CX5 I;  2M3E A;  5KJ7 C;  3H1H E;  3H1H J;  1HUC A;  1GU4 A;  2QSI A;  1KIL B;  2WTY A;  1HVV A;  1FZB A;  5CHX A;  2XSH A;  2XV5 A;  4KT0 J;  3L36 A;  1JUN A;  2NWF A;  2NVE A;  3L75 G;  3R2P A;  1AA0 A;  2W83 C;  3GZX A;  4NBC D;  4QUP A;  1NTZ G;  3T97 A;  1SS1 A;  4UB6 E;  3AZC A;  3JSV C;  1FZC C;  2W6B A;  5KLV K;  4H0L B;  4XA4 A;  1NGM B;  3RK3 D;  1N7S C;  1T8Z A;  2KOG A;  2O1K A;  5AW0 B;  5GTH H;  3GLM A;  2NPS C;  4L73 A;  1FZE A;  2R5D A;  1JY2 P;  4QUR A;  1SQB E;  1RE4 A;  1SQB J;  4DZO A;  1SFC D;  2NVF A;  1EZV D;  4EIJ A;  3JC2 2;  4JQ0 D;  2KSJ A;  2YFL A;  4IL6 E;  4N6J A;  1FDI A;  1SQP G;  2K1A A;  1OX3 A;  2Y9Z A;  5BVZ A;  2PFX A;  3P7K A;  3VTP C;  3B8E B;  1M90 Q;  3VP8 A;  1KYO H;  3MUD A;  2LKM A;  3PLN A;  2OYI A;  4RO0 A;  1SQQ D;  1H8A A;  4EI2 A;  3GKE A;  4ZNC A;  1M7L A;  5APU A;  1Q86 Q;  5KLV D;  1NKZ B;  2C0W A;  2R44 A;  1LTS C;  1KIL D;  1KFN A;  2HLO A;  3JCU H;  1NTK G;  2IBZ D;  1AV1 A;  1E79 H;  1KC8 Q;  3L35 A;  2C9L Y;  2J59 M;  3TYY A;  1SQV K;  2WMM A;  1KYO D;  3QH9 A;  2O1J A;  3OJA B;  1S3J A;  1NJI Q;  1IFJ A;  2JDI H;  3L73 D;  4HM6 A;  4YXW H;  2CPB A;  5CCH D;  1JCC A;  4H44 B;  3N4X A;  3AE9 C;  1J1D B;  3HD7 C;  3CX5 D;  3PRJ A;  4XFJ A;  2GUS A;  2FYZ A;  5KLV E;  5KLV J;  1PIX A;  2G8Y A;  2RN0 A;  2Q9I A;  3A5T A;  1IFI A;  1NYK A;  2XNX A;  1GL2 A;  3HRN A;  4ZMD A;  1PL5 A;  2H8P D;  1JTH A;  4D6T G;  5GTI H;  3A0H H;  2BMO A;  4C46 A;  1JY3 N;  1SQV D;  5KLI C;  4EYY Q;  3H1J D;  2NZ2 A;  4TLF A;  2P2U A;  1BCC G;  2FXO A;  2GA1 A;  1HH0 A;  1PP9 D;  1IC2 A;  3L73 E;  4GOE A;  3L73 J;  2HMK A;  2YFI A;  1RF0 A;  3OW2 O;  2ZYA A;  3KYQ A;  1OMI A;  4PV1 B;  1Q81 Q;  1X0T A;  4I7Z B;  1FDM A;  3W68 A;  1VQP P;  5H2F E;  4BXL A;  3CX5 E;  1WQL A;  2HMN A;  2YIU B;  2NPS A;  1CI6 A;  3TGU G;  3M9Q A;  3NFQ A;  1VQ7 P;  3MTU E;  5APX A;  1PGQ A;  2IFM A;  2J5U A;  5CJ0 A;  1KZU B;  1LTT C;  1J1E C;  2E76 C;  1S2E A;  1LWU B;  3KZI E;  3H1I G;  1SQP K;  1Z56 A;  1YIT P;  4BWN A;  3RBZ A;  4H44 D;  3A0B E;  5KKZ B;  1HJ0 A;  1Q82 Q;  1G1J A;  3ITK A;  1SQV E;  1SQV J;  1IK7 A;  3L75 D;  2WSF H;  1FZG A;  4BRY A;  3HUS B;  2WPR A;  3CCV P;  1PP9 J;  1RH5 B;  3GCE A;  4QCK A;  5AVR B;  4JBZ A;  3HE4 A;  5AW3 B;  1IFN A;  2W90 A;  5AW5 B;  4EDF A;  2Q5U A;  1PFI A;  2XDJ A;  2O01 J;  1YQ4 C;  1NAY A;  1OWA A;  1QGK B;  3L37 A;  2N1T C;  2HPC A;  4R4L A;  1T3U A;  5GTI E;  2BMR A;  4GOF A;  1KQL A;  1NVO A;  1L4A A;  2KUB A;  4HM7 A;  1DEE G;  2HMO A;  1JY2 O;  1ZME C;  2WVR A;  3L72 G;  3AEE C;  1GW3 A;  2YO3 A;  2C9N Y;  3HD7 A;  3WU2 H;  4U3F G;  3G9R A;  3GB4 A;  3R4Y A;  1YJ9 P;  3L75 E;  3L75 J;  4NPF X;  4WY4 A;  1KQG B;  2FFD C;  3O6Q A;  1NWQ A;  1NTZ E;  4NBF D;  1O7N A;  3WUV A;  1NYH A;  3BCC G;  4OGQ D;  4A7P A;  1RIE A;  3M0A A;  1W5C E;  2AEM A;  3GHG B;  2I7F A;  1EDJ A;  2ZYD A;  1Y47 A;  2KLU A;  1X8Y A;  2KIK A;  3H1K G;  4UB8 E;  1HGZ A;  2AXT E;  4NB9 D;  1JB0 J;  1R5S A;  2K9J A;  1WT6 A;  3KPE A;  1NOH A;  1P84 H;  3D89 A;  2PAJ A;  2WSF J;  1SQP E;  1SQP J;  5E79 H;  1FZA A;  4P1C H;  3HE5 B;  2OTK E;  4WBA A;  2WIT A;  1O7G A;  3W67 A;  2E4P A;  2R5B A;  4TT3 H;  2DE5 D;  1K9M Q;  5AW2 B;  2KNC A;  4L74 A;  4OH8 B;  3RL0 C;  1RE3 C;  1VQN P;  3H32 A;  2KZI A;  1FAV A;  4AYC A;  3PHL A;  1QVG O;  5AW4 B;  4NBD D;  5AW7 B;  1RF1 B;  2JP3 A;  1ZP0 C;  3GMA A;  5APW A;  1P84 D;  5CMZ A;  2B9B A;  1VQK P;  1URQ D;  1DX7 A;  2CK3 H;  1UUV A;  3RK3 C;  2E74 B;  3WU2 E;  5B66 E;  1FDO A;  2JO1 A;  1ZW0 A;  1TU3 F;  4NPD A;  3V6I A;  2B1X A;  2MJZ A;  5BU8 B;  1CZQ A;  3G4S P;  4WB4 A;  1PGP A;  3BRV B;  1UII A;  3F89 A;  4DJG A;  1DD3 A;  1SFC C;  3TK1 A;  1CW5 A;  4PJ0 E;  3EWK A;  3CL3 D;  2D2C B;  2FYU G;  1X22 A;  3SWK A;  1VQ8 P;  2OYO A;  2DE7 D;  1SLQ A;  2M0B A;  3IN6 A;  5HL4 A;  3GTE A;  3CPW O;  2ZYL A;  2V7Q J;  2XU6 A;  2OYH A;  2HFE D;  3G6E P;  1ZLL A;  5KTB A;  4EOT A;  1U7M A;  3FGA D;  1ZXG A;  3IFM A;  5B5E E;  4GIF A;  1KIL C;  3H1H D;  1BSH A;  2IPP A;  3FWN A;  2KYV A;  1BCC E;  2ZYG A;  1BCC J;  1WMK A;  3VN0 A;  3VYI A;  3T97 B;  2WSE J;  1OXZ A;  1VCK A;  1H0T A;  1E5W A;  4IL6 H;  2HML A;  3NTN A;  4JPZ B;  4C7R A;  4YPC A;  1GU5 A;  1OW8 A;  4ASV A;  4H0L C;  5CCG A;  1BE3 G;  5CCH C;  3TGU E;  1GK4 A;  2E43 A;  1A02 F;  2B87 A;  2E74 D;  5AVV B;  4YTP C;  1U57 A;  1JOC A;  3QWO C;  1VQO P;  2O01 N;  4KJM A;  2H7H A;  3H1I E;  4HM2 A;  3H1I J;  1OW6 A;  3C0D A;  2Y0C A;  4HJG H;  3L72 D;  1KFM A;  2Z5I A;  4U3F D;  4HH2 A;  4GOD A;  4ZKU A;  2OYI B;  2D2C D;  1VPC A;  2I1J A;  1BGY G;  2AEJ A;  3VMA A;  1SQX G;  3BCC D;  1L0N K;  1YJN P;  2L5G B;  3CWB D;  2V4H A;  2ZFC A;  3SSU A;  3CXH E;  4IFM A;  3M0D C;  3TSI A;  4K3A A;  3AEG C;  3E1I A;  1FS0 E;  1T2K D;  2KB7 P;  1AFO A;  3CLQ A;  2HMJ A;  5KAI E;  3VMY A;  1Y9B A;  1RHZ B;  2GM4 A;  3EFF K;  2NUK A;  3B4S A;  3AEF C;  1O7P A;  2JZA A;  1X9V A;  1ZR2 A;  1LTJ B;  3L72 E;  2KS1 A;  3L72 J;  1GTW A;  2E75 D;  4U3F E;  4U3F J;  3C1L A;  2M5A A;  3VMH D;  1IFM A;  3L71 G;  2IZ0 A;  2FYU K;  4H44 C;  1J1D C;  1LT9 A;  3BCC E;  3BCC J;  2Q7C A;  2HMM A;  1L0N D;  1GDT A;  3CWB E;  3CWB J;  3H1L G;  1PZQ A;  2A45 H;  1GL2 B;  2IYP A;  3H1K E;  3VMG D;  3H1K J;  1JTH B;  5H2F H;  3MD0 A;  2B88 A;  3CX5 H;  3GF3 A;  2KK7 A;  4AIV A;  2POH A;  2IZ1 A;  2YKO A;  2C0X A;  3F5H A;  1JNM A;  3KXD A;  2LXB A;  1IZN B;  2BAS A;  1FC2 C;  2YMY A;  3B5N A;  4Z1M H;  2KLV A;  2ZT9 D;  2PP6 A;  4YXD C;  3KZI H;  5K5G B;  3P8M C;  3GF7 A;  3A0B H;  2B24 A;  1AQT A;  5AEW A;  3AE7 C;  1VF5 B;  1CI6 B;  5AW8 B;  2HOD A;  1M1J A;  1EDK A;  4PV1 C;  4I7Z C;  1AVO A;  1L0N E;  1L0N J;  5AW6 B;  2Y0E A;  2YIU C;  3U1A A;  1RQU A;  2IX7 C;  3IR9 A;  1WRG A;  2HR3 A;  3Q2Y A;  2G3A A;  1L0L G;  1YTZ I;  1FJK A;  2Q3E A;  5KJ7 A;  2YXR B;  3GL2 A;  2O01 H;  1YBK A;  1T6A A;  1LWU C;  2QIW A;  4R4M A;  3I55 P;  5KAF E;  1KV4 A;  5M1B A;  3O8Z A;  1H88 A;  5KKZ C;  2QM7 A;  2OGU A;  1EXI A;  1UUW A;  2WSS H;  1LTB C;  3HE4 B;  2R32 A;  3HUS C;  1NTZ K;  1FZC A;  3FXE A;  1ZRT E;  1GL2 D;  2FYU E;  4I2L C;  4WWI A;  2WT7 A;  1BE3 D;  2HPC B;  1N7S A;  1O7H A;  2GBX A;  1IFP A;  2CPS A;  4N78 E;  1FE6 A;  4JYC A;  2YKP A;  1FBM A;  3TNU A;  3D6Z A;  3SWF A;  2H88 C;  2ZVN B;  3GTS A;  2RKL A;  1JEK A;  1YTZ T;  1L4A B;  4OGQ B;  1G2C A;  3GZY A;  3FOU A;  2I1K A;  1EC5 A;  1VQ5 P;  2WZ7 A;  2LR2 A;  4WVZ A;  4W7Y A;  4UB8 H;  3KHU A;  1N7S D;  1MV8 A;  4HKZ H;  2AXT H;  1VF5 D;  4QDF A;  3Q1M A;  2NPS D;  3AE6 C;  4WY4 B;  3NMD A;  3O6Q B;  5AVW B;  1M56 D;  2XKM A;  3N7N A;  1XTG B;  3WUU A;  3II6 A;  4ZKP A;  1D7M A;  2WPV B;  3K5B A;  1K73 Q;  3LW5 J;  4W7Z A;  1NTZ D;  1MZ9 A;  1NTM G;  2RH0 A;  2E4Q A;  1BE3 E;  1BE3 J;  2QE7 H;  3GHG C;  2QEX P;  2AXC A;  3AE3 C;  3LIE A;  2K9J B;  1NTK K;  2P67 A;  3CI9 A;  1LNQ A;  4L76 A;  2M8R A;  2N9Y B;  4HM5 A;  1EDL A;  1NU1 G;  3S1K A;  5CBO A;  2GBW A;  3UIA A;  1S4X A;  1SQP D;  3L71 D;  1LT1 A;  3A3Y B;  1BGY E;  4RES B;  1BGY J;  1OVR A;  3OA7 A;  2KNC B;  3LID A;  1URQ B;  4I6M C;  4HM1 A;  5B66 H;  5C39 A;  3H32 B;  2BMQ A;  2KI7 B;  2XSO A;  3H1L D;  4QUQ A;  1NTZ J;  1PPJ G;  1LJ2 A;  3RK2 B;  1L4A D;  3E1R A;  4PJ0 H;  4IFD K;  1L0L K;  3GOB A;  4W80 A;  1RF1 C;  3B71 A;  3KDP B;  3HD7 D;  1VDF A;  4PD4 I;  3C8V A;  3AE1 C;  4WY4 D;  1NTK D;  1HTL C;  1IO4 A;  2V7Q H;  1HJB A;  4P1B H;  2E74 C;  1KOR A;  3CXH I;  3H25 A;  3OAK A;  1ZOY C;  3HUS A;  4XE5 B;  3CCQ P;  1CSB A;  3V2N A;  5APY A;  3L71 E;  3L71 J;  3S4R A;  1OVV A;  5B5E H;  1KTM A;  1PV3 A;  4GT1 A;  1S9K D;  3TF5 A;  2FKW B;  2D2C C;  3CCS P;  2XRX A;  1VQ6 P;  2JJL A;  2Q6Q A;  5AVQ B;  2NVG A;  3H1L E;  3USS A;  3H1L J;  2WSE H;  2KSE A;  3AED C;  3KQG A;  2OYH B;  2WPQ A;  3ABV C;  1FQT A;  1L0L D;  1SJG A;  1EZV G;  2LXC B;  3CME P;  2ITA A;  1BSN A;  4H13 B;  1VQ9 P;  1HGV A;  2M3B A;  2ZAE B;  1USD A;  1NTK E;  1NTK J;  4JYB A;  4NBB D;  3FXD A;  4D6T D;  3VMX A;  1VQ4 P;  1SQQ G;  2FYN B;  1KD1 Q;  3ZDM A;  3E7K A;  3CCJ P;  1QVF O;  1H0T B;  2PGD A;  4HM3 A;  4HM0 A;  3RK2 D;  1BCC D;  3A2A A;  1N8R Q;  5KLV G;  2JO6 A;  3MGN A;  3CMA P;  1EQ7 A;  1NTM K;  3Q5R A;  1JY3 P;  1S9K E;  1K8A Q;  2QG4 A;  1AVY A;  2BCC G;  4C7N A;  3HTK A;  4NBG D;  2ZXE B;  2B87 B;  2IBZ G;  3GG2 A;  4B86 A;  2PRR A;  2N1T A;  3V2R A;  3TGU D;  1NDO A;  2JWD A;  1J2J B;  1N7L A;  1L0L E;  1L0L J;  5CBN A;  1N73 B;  1FOS E;  3WMM 0;  3CXH H;  3N0Q A;  1RE4 C;  1NU1 K;  1LP1 A;  3L73 G;  3MP7 B;  3AE5 C;  2JR8 A;  3H1I D;  3L70 G;  3AE4 C;  3HE5 A;  1DIP A;  4D6T E;  4D6T J;  2OAR A;  5KAI H;  1OIP A;  3MUD C;  3IF4 A;  2OYI C;  2FFD A;  2KZJ A;  1UIX A;  1QX8 A;  4PD4 D;  2FBW C;  1RQV A;  1RF1 A;  2QRX A;  3VMI D;  2E75 B;  3CXH D;  2XZR A;  4H13 D;  1T3J A;  3IAO A;  2SPZ A;  1M8O B;  3CC7 P;  3L74 G;  2R3S A;  1SVF A;  3TGU J;  1SQV G;  1ZR4 A;  3H1J G;  3FWL A;  1N2D C;  1K04 A;  2KS1 B;  1NHL A;  2IBZ I;  1PP9 G;  2VRS A;  2M5A B;  5DJT B;  5AEU A;  4Y99 B;  1KYO I;  1LTJ C;  2YO2 A;  1S5L E;  5CCG D;  1LT9 B;  2JEE A;  2A06 G;  1NKN A;  2QJK B;  1QLE D;  3CCU P;  2QPZ A;  1RE3 A;  4PD4 E;  2E42 A;  1KN7 A;  2JWA A;  1PGO A;  2QJY B;  1FU1 A;  1EXJ A;  1NTM E;  3CCR P;  1NTM J;  3S9O A;  2R3C A;  1JMB A;  2ZT9 B;  2ZXX A;  3VMZ A;  1GL2 C;  4NBE D;  3EQQ A;  3H6P A;  1XTC C;  4OWF A;  1VQM P;  1OZH A;  3H1K D;  1BDC A;  3RL0 D;  1SQQ K;  3BAS A;  1O7W A;  2XR8 A;  3B5N B;  1SP4 A;  1DH3 A; 
#chains in the Genus database with same CATH homology
 3AEE C;  5M1B A;  1NU1 E;  5KKZ C;  3Q3D A;  3G9R A;  3GB4 A;  3R4Y A;  1Q90 D;  3L75 E;  1EXI A;  4HM4 A;  1UUW A;  2YVJ B;  1KQG B;  3O6Q A;  1NTZ E;  4Y28 J;  4NBF D;  1YQ3 C;  1O7N A;  4QDC A;  4IL6 X;  1NYH A;  4OGQ D;  1VM9 A;  5L8R J;  1ZRT E;  1RIE A;  2FYU E;  1ULJ A;  1VF5 C;  2QJK C;  5BOK A;  2I7F A;  2FXP A;  1PPJ E;  3D70 A;  2QJY C;  1O7H A;  1P84 E;  2GBX A;  3SFD C;  3D6Z A;  4AAY B;  1KMI Z;  2H88 C;  2ZT9 C;  4NB9 D;  3GTS A;  4EMJ B;  4OGQ B;  3GZY A;  1JB0 J;  3FOU A;  4NBA D;  3D6Y A;  4HKV A;  3D89 A;  2WSF J;  1SQP E;  2NUM A;  1VF5 D;  4QDF A;  3Q1M A;  3AE6 C;  4P1C H;  1R8E A;  1S1C X;  1O7G A;  2E4P A;  4TT3 H;  2WQY C;  2DE5 D;  1S5L X;  2WPV B;  3LW5 J;  3RK3 E;  2H89 C;  4HM8 A;  2E4Q A;  3AEC C;  1BE3 E;  4NBD D;  2YMK A;  2JP3 A;  1ZP0 C;  3GMA A;  1AJY A;  2QJP C;  3AE3 C;  1EZV E;  3H1H E;  2QSI A;  1UUV A;  4OGQ C;  1G8K B;  2E74 B;  2OQQ A;  4H0L D;  1HF9 A;  4QDF B;  2XSH A;  1FDO A;  2JO1 A;  4KT0 J;  1TU3 F;  4HM5 A;  2NWF A;  1SQQ E;  2B1X A;  2GBW A;  2NVE A;  1DD3 A;  3GZX A;  4NBC D;  4QUP A;  3RL0 g;  3AZC A;  3EWK A;  4HJL A;  4HM1 A;  2D2C B;  2BMQ A;  4H0L B;  2XSO A;  2DE7 D;  4QUQ A;  1KIL E;  1NGM B;  3IN6 A;  5HL4 A;  2BCC E;  3GOB A;  3GTE A;  2IBZ E;  3GLM A;  2ZYL A;  2V7Q J;  1MKM A;  3B71 A;  1DD4 A;  1KYO E;  4QUR A;  1SQB E;  3C8V A;  2NVF A;  3AE1 C;  1K05 A;  3FGA D;  1JM1 A;  2YFL A;  1FDI A;  4P1B H;  2E74 C;  1KOR A;  3H25 A;  3L70 E;  1ZOY C;  1BCC E;  1WMK A;  1EG9 A;  3T97 B;  2WSE J;  3L71 E;  3GKE A;  1VCK A;  1VL2 A;  2P10 A;  2HML A;  4RKU J;  1KTM A;  1PV3 A;  3AE2 C;  1G8J B;  1ULI A;  2D2C C;  2XRX A;  1OW8 A;  2NVG A;  3H1L E;  4H0L C;  3TGU E;  3AED C;  3ABV C;  1FQT A;  2E74 D;  1SJG A;  4QDD A;  4YTP C;  3Q5S A;  1U57 A;  3L74 E;  3AEB C;  3D71 A;  3Q5P A;  4H13 B;  1O7M A;  3H1I E;  4HM2 A;  3H1J E;  1OW6 A;  3C0D A;  1OW7 A;  1NTK E;  4NBB D;  4NB8 D;  2BEZ F;  2CKF A;  1PP9 E;  2WSC J;  2D2C D;  4HM6 A;  4H44 B;  4HM3 A;  3AE9 C;  4HM0 A;  2JO6 A;  2A06 E;  4XFJ A;  3Q5R A;  3CXH E;  1SQX E;  5KLV E;  3AEG C;  4NBH D;  1PIX A;  4NBG D;  2G8Y A;  2E76 B;  1NDO A;  1NYK A;  1L0L E;  1PL5 A;  2HMJ A;  1GMJ A;  3N0Q A;  4GDO A;  4PV1 D;  2MKV A;  1Y9B A;  2NUK A;  2BMO A;  4H13 C;  3AE5 C;  3AEF C;  5KLI C;  1O7P A;  2JZA A;  3AE4 C;  1DIP A;  2NZ2 A;  3L72 E;  2E75 D;  4U3F E;  3VMH D;  2FYN C;  3L73 E;  3EN1 A;  2HMK A;  2YFI A;  1RFS A;  4H44 C;  1OMI A;  4PV1 B;  4I7Z B;  3BCC E;  2BEQ D;  1UIX A;  2HMM A;  3CX5 E;  2FBW C;  1WQL A;  1RQV A;  2HMN A;  2DE6 D;  3CWB E;  3VCA A;  3VMI D;  2E75 B;  3GL0 A;  4H13 D;  3IAO A;  2K9Y A;  2J5U A;  3VMG D;  3H1K E;  2E76 C;  3GF3 A;  4AIV A;  3AEA C;  4H44 D;  1K04 A;  1HJ0 A;  3VCP A;  1KQF B;  4U7J A;  1SQV E;  1IK7 A;  5AEU A;  5CXM A;  3SFE C;  4Z1M H;  2ZT9 D;  4YXD C;  3DQY A;  3GF7 A;  3GCE A;  4QCK A;  2B24 A;  3AE8 C;  2YFJ A;  5AEW A;  3AE7 C;  1VF5 B;  1KB9 E;  2E76 D;  2QPZ A;  4PV1 C;  4I7Z C;  4PD4 E;  1Q90 C;  1L0N E;  1EXJ A;  1NTM E;  2O01 J;  2YIU C;  3S9O A;  1YQ4 C;  1RQU A;  2IDB A;  2ZT9 B;  2E75 C;  4R4L A;  3Q2Y A;  2G3A A;  2BMR A;  4NBE D;  3EQQ A;  2Q3W A;  3GL2 A;  4HM7 A;  2HMO A;  2QIW A;  4R4M A;  1O7W A;  2XR8 A;  1ZME C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...