2YIUC

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
b'DFLYYATAGAGTVAAGAAAWTLVNQMNPSADVQALASIQVDVSGVETGTQLTVKWLGKPVFIRRRTEDEIQAGREVDLGQLIDRSAQNSNKPDAPATDENRTMDEAGEWLVMIGVCTHLGCVPIGDGAGDFGGWFCPCHGSHYDTSGRIRRGPAPQNLHIPVAEFLDDTTIKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 48
structure length 174
sequence length 174
chains with identical sequence F
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2yiuC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yiuC02
2E74D 3VMHD 1KYOE 2I7FA 3GZYA 3DQYA 4P1CH 1O7PA 4HM5A 2D2CB 1ULJA 2YIUC 2NVGA 1VM9A 3TGUE 1FQTA 2GBXA 1NTME 2JO6A 2YFLA 3N0QA 2ZT9D 2XRXA 1VCKA 2E76B 2E75D 4H13D 4H13B 3L75E 2HMLA 1SQQE 2B24A 4HJLA 1EG9A 1O7MA 1ZRTE 4AIVA 2BMRA 1UUVA 2BCCE 3C0DA 4IL6X 1NTKE 3VCAA 2WSFJ 1BE3E 2QSIA 4HM8A 2XSOA 4KT0J 4AAYB 4HM0A 3VMGD 1JB0J 2QJKC 5KLIC 3GKEA 1O7NA 3H1KE 1SJGA 2D2CD 2O01J 4NB8D 4QDFA 2BMOA 2NUKA 5AEUA 2DE7D 3AZCA 1SQBE 3L70E 2HMMA 4H0LB 4QURA 3EQQA 3GTSA 2FYNC 3GL0A 2NWFA 1RIEA 2HMOA 2E76D 2YFJA 3H1IE 4NB9D 1SQPE 1KB9E 1SQVE 3CWBE 3L74E 3EN1A 4I7ZB 2B1XA 3CX5E 3L72E 1L0NE 2HMJA 2NVFA 4RKUJ 3D89A 3FOUA 1RFSA 4HM6A 4PV1B 5CXMA 3VMID 5KLVE 1JM1A 4NBFD 2ZYLA 1O7GA 4QDFB 4H44D 3GOBA 2Q3WA 4NBCD 4H44B 3H1JE 2NVEA 1UUWA 1NTZE 2K9YA 4HM1A 4HM3A 2XSHA 3H1HE 2CKFA 1VF5D 1WQLA 1NU1E 2IBZE 4QDDA 1Q90D 1VF5B 1P84E 2XR8A 4H0LD 2WSCJ 5L8RJ 1O7HA 1PP9E 2HMKA 5KKZC 3GB4A 4Y28J 4NBBD 4QUPA 4HM4A 4QCKA 1EZVE 3L73E 2FYUE 3H1LE 4PV1D 3LW5J 2DE5D 4HKVA 2NUMA 2QJYC 1NYKA 4NBAD 4U3FE 2QIWA 3CXHE 2YFIA 1BCCE 2E4QA 4OGQD 3GZXA 3C8VA 2WPVB 3GL2A 4OGQB 2E74B 5HL4A 1Q90C 5AEWA 4PD4E 2HMNA 2JZAA 2DE6D 4NBDD 4QDCA 4HM2A 1L0LE 4NBHD 2BMQA 1NDOA 4EMJB 1S5LX 2YVJB 3VCPA 2GBWA 3GCEA 4P1BH 2ZT9B 2QJPC 4NBED 2E4PA 2QPZA 2E75B 1SQXE 3L71E 1O7WA 4NBGD 1G8JB 1G8KB 1PPJE 2A06E 5BOKA 4QUQA 3BCCE 2WSEJ 4HM7A 1ULIA 3GTEA
chains in the Genus database with same CATH superfamily
1LT9A 5KJ7A 1ZR4A 2NVGA 2P1JA 2QM8A 5KLVG 1FS0E 1UIXA 3RL0C 5KJ7D 1KORA 3JCUE 3VYIA 2BEZF 3TGUJ 2W90A 2LR2A 5E79H 3U59A 3L74D 1ZOYC 4RJTA 3EFGA 1ZP0C 3EQQA 1FJPA 1EDJA 2YFJA 3GL0A 3CWBE 5TJHA 1OIPA 4HJGH 5M1BA 3GOBA 2FBWC 3PTZA 4KJMA 1SQVJ 3HE4B 2OTLP 2YXQB 4DCKA 2CKFA 3Q3DA 1MFTA 5L8RJ 4C7NB 1RE4A 1YBKA 2CK3H 2WSSH 5AVQB 3C9IA 2QA4P 1NYKA 1NU1J 3CXHE 3GHGB 1BCCE 3GF7A 1U7MA 2WPVB 3GL2A 1E5WA 4U3FJ 5AVXB 3BCCD 4GOEA 1N73B 3TK1A 3IAOA 3A0HH 4XA4A 3SWKA 4NBED 1VL2A 1AQ5A 2WWWA 1PPJE 5BOKA 4UB8E 2Z5HA 5KAIE 1G1JA 1VQOP 1LT1A 1FZBA 2JO6A 2KK7A 2WITA 3EFFK 2E76B 3F5HA 1S9KD 1JNMA 1EC5A 2K1AA 3G6EP 1N7LA 1RQVA 2P7JA 4HM8A 2FKWB 2FYUD 1VQ4P 3CX5H 3VMZA 3H1JD 3GTSA 3OAKA 3EN1A 4I7ZB 2B1XA 1W2BO 2J5UA 3P7KA 1NAYA 3HUSB 4PV1B 1PGOA 2L91A 4NBFD 2OYOA 2GUSA 1LTJB 4NBCD 2JWDA 3VOPA 1H88A 1S2EA 1Q81Q 4JYCA 3CWBJ 3E7KA 5H2FH 1WQLA 1JTHA 3IF4A 1YQ4C 1GZLA 3CMAP 1PFIA 1GTWA 3VP8A 4OWFA 3C8VA 3OW2O 1RQUA 2R5DA 2OYHC 2WVRA 1EXIA 2AXTE 2I1JA 1BCCJ 1QVGO 2ZAEB 4Y99B 2JKVA 3AEBC 2QPZA 3N7NA 4OGQC 4NBGD 3H6PA 3HRNA 3B5ND 3CCUP 1S1CX 1M1KQ 4GIFA 2A45G 3RK3E 1NGMB 1PIXA 3RK3C 1OMIA 4MN4C 2D2CB 3H1LJ 2OYIB 1LWUC 2N9YB 1BGYD 1L4AD 3CX5I 1ZN5A 2FYUK 5KAIH 1FBMA 2B24A 1SS1A 1UUVA 1X79B 1RF0A 3VCAA 5KKZB 1U57A 1K9MQ 2KIKA 1LTGC 3L73D 4XE5B 1L0LK 2FYUG 1G1IA 1JY2P 1J1DC 5KJ7C 3KXDA 1MKMA 5AW3B 3H1IE 1J2JB 2KS1B 3L74E 1AVYA 3PP5A 4RKUJ 1L0LG 1JM1A 1P84D 2QM7A 3O6QA 1DD3A 3H32A 3AE9C 3JSVC 2A06G 3M06A 1Y8AA 1KYOD 1HGZA 4Y28J 4WY4A 5AVSB 5AW4B 1T3UA 3II6A 3V4WA 2SPZA 2R3SA 2YFIA 2NPSB 2VRSA 3SWFA 1N7SB 1GMJA 2IDBA 2N1TA 1TU3F 4NPDA 3O8ZA 3CD6P 2G3AA 1RE4C 2N1TD 3BCCE 1T3JA 1J1EB 4TLFA 2ZYDA 4HM7A 3GTEA 2AXTH 2E74D 3DQYA 4ZKPA 2O3JA 1YITP 2KP8A 1G2CB 2GBXA 4YPCA 1JY2N 3V6IA 3M9QA 1BGYG 2MKVA 1FZCB 1IFMA 3C0DA 1NVOA 4AAYB 3MGNA 3AEDC 1L0ND 1NWQA 2QJYB 1SJGA 2HODA 3HD7A 1S9KE 3L73G 2FYZA 1NAFA 1SVFA 3L72E 3P8MC 3HD7D 3H1HD 1M57D 4W7YA 3H1JE 3H1IJ 2L5GB 3L74J 5CCHA 1L2PA 1GU4A 1YI2P 4UB6E 2JJLA 4JF7A 5CCHD 3GB4A 2NUMA 3FXDA 3CC2P 5AW0B 3L70J 1NH4A 1EXJA 3GZXA 2HFED 2HMNA 2XDJA 1EDKA 2BCCD 1USEA 1HWTC 1U7JA 2YKOA 4EMJB 3M91A 3L71E 3ZDMA 5APUA 1Y9BA 4WWIA 3BVHA 3KPEA 3M0DC 1K05A 3V2RA 1FOSE 1KILB 3Q1MA 1CI6B 1VPCA 2YIUC 1IK7A 5AVYB 3BCCJ 2W27A 3N0QA 3B5NC 1S3JA 2XRXA 2KZJA 1YYCA 3CC4P 5CJ4A 3MTUE 3SSUA 3FWNA 2IBZD 1K8AQ 1X0TA 3TDKA 5APWA 1SFCB 4D6TD 1K73Q 2M0BA 1PP9G 3VMGD 2Z4EA 2KLVA 1L4AC 1PGQA 5KLVD 2PRRA 4H0LB 1JCCA 1SQXK 1AVOA 2HMOA 3NTNA 4PJ0H 4IL6E 4O9BA 4U7JA 3S1KA 4ASWA 5AW8B 3L72J 1RF0C 2JP3A 2PGDA 1PGPA 1SQXG 1HGVA 2JDIH 1NYHA 3CPWO 1P84E 3H1JJ 5AVWB 2UWJE 2QEXP 5K5GB 3RK2B 3CI9A 2QJPB 2FFDB 2WSEH 1WT6A 3GF3A 2K9JB 3KZIH 2MJZA 4HM2A 4BXLA 1QL2A 2BCCG 1NHLA 1M1JA 2ZT9B 2K88A 2JR8A 5AVRB 3WUVA 3TNUB 2P58A 1SP4A 3L71J 2B89A 3L75D 1HTLC 4P1CH 4HM5A 3OA7A 1LWUA 1VM9A 1PZQA 1FZGA 2Q5UA 2N1TC 1AA0A 4B86A 2AEMA 3AE1C 2B87B 4HKZH 5AVUB 1GL2B 2E74C 3GMAA 5AW2B 2P67A 1T2KD 5APTA 5AVTB 2IBZG 4ZKUA 1QGKB 5KLIC 1EZVD 1K04A 4D6TG 1SQBE 4DT0A 4A7PA 2DW3A 2FYNC 1RIEA 2YNYA 3CX5E 2W6BA 1L0NE 4L73A 3FOUA 2I1KA 1IFIA 1CW5A 2KNCA 1NTZE 4HYTB 3LIEA 2JWAA 3H1HE 4I2LC 2V4HA 4IL6H 4TT3H 1UIIA 3OJAB 3HD7C 3I55P 1Q90D 1FAVA 5H2FE 2DE5D 1VQPP 4IFMA 1IJDB 2E4QA 2E5TA 3P8CD 2YXRB 1AQTA 1P84H 1SQQD 1FZFA 2JZAA 3NFQA 2ZVNB 5CCHC 1NTKD 3B8EB 3Q2YA 3VCPA 3GHGC 1IFJA 2FXMA 1FZEA 3T97A 4N3YB 3CCJP 4EI2A 1S5LH 1H0TA 4AQRD 3Q5SA 2M3BA 2KI7B 1LTAC 1N73C 1SQPD 1KB9D 5APYA 3VMHD 2Y9ZA 2IZ0A 1GK6A 2C0XA 2IYPA 3L75G 2GUVA 1HBWA 2XV5A 3PJSK 1OVVA 4YTPC 1W5CE 4RO0A 1ZV8A 1RF1B 1LP1B 3I5CA 4NPFX 1IC2A 3GW6A 3A3YB 3SWYA 2Y9YA 2WSFJ 4HM0A 3AECC 2WSFH 5CBNA 1EZVG 3AEFC 3KYQA 1JOCA 2YO3A 2RKLA 1RH5B 3VTPC 1CZQA 1VQMP 3SFEC 3AEGC 1QL1A 4HM6A 5KLVE 1SQBJ 2WPQA 1JUNA 3GG2A 1UUWA 1L0NJ 2HPCB 3CMEP 1YJNP 3JC22 1P84I 3HUSC 3NXSA 4EDFA 1O7HA 1LTJC 3Q5RA 1QLED 1NTZJ 1SQQK 4HM4A 1L0LD 1NTMD 3H1HJ 1NTKK 4JYBA 1LTIC 1BDDA 3KHUA 1T6AA 5AEWA 4WVZA 1ZRTD 2A06D 4N78D 1SQQG 2IFMA 1DEEG 1NDOA 1KFMA 2AXCA 1NTKG 1SQPK 3UIAA 1GD2E 1O7WA 3H1KG 1G8KB 3RGUA 3M0DA 2ZVOB 5CBOA 4QUQA 3L70G 2Q3IA 1M7LA 1KILD 2O01N 1IFDA 1SQPG 4RESB 3MHVA 3GZYA 4Y99C 3M9BA 3B5NA 3I56P 2ZXXA 3HTKA 2YMKA 4GOFA 1N86A 3ITKA 1M1JC 3L75E 4H13B 5BU8B 3A5TA 2KB7P 2KUBA 2Q6QA 2OYIC 1XTCC 1L4AA 5B5EE 3RBZA 1VQ7P 1JMBA 2OYHB 2O1KA 1T2KC 5TISE 2WT7A 2NVFA 3AE4C 4QDFB 2P2UA 2M5AB 1DD4A 1NTMK 2JEEA 5KLVJ 3FGAD 3N4XA 2ZJSE 1VF5B 3RK3B 4PD4D 1URQB 3RK2D 3TGUD 1FZAA 1NTMG 3E1RA 1Q90C 4NBDD 1KZUB 1R5LA 3CL3D 1BE3G 3P8CE 4Z1MH 5AW5B 1LT9B 5B66E 1HJ0A 3QWOC 2Q9IA 3HE5A 4BRYA 2NZ2A 5AW1B 1OVUA 1JO5A 2PAJA 2WQYC 4KHXA 2FY8A 1KQGB 3R2PA 1D7MA 1J1EC 1GL2D 2ITAA 3P32A 2E75D 5GTHH 3FWLA 3VMAA 1JCDA 1DH3A 3K5BA 1YIJP 1FZCC 2HMMA 1FC2C 3QH9A 4CPGA 1RHZB 1SLQA 1DEBA 1OW7A 4C7RA 5CXMA 1R5SA 3VMXA 5B5EH 5CHXA 2Q3WA 2OGUA 1PP9D 4PJ0E 2BEQD 2KSJA 2Q3EA 4WB4A 5TISH 3G71P 1HH0A 2CPSA 1DIPA 2ZYAA 3R4YA 1KD1Q 3HE4A 2RMZA 3AE8C 2FYUE 3D6ZA 1WMKA 3TGUG 3CCSP 4OVNF 1YHQP 1H89A 4C7NA 1SQXD 1AFOA 2W8ZA 1GW3A 1HUCA 2J58A 2W83C 1L0LE 4NBHD 3GHGA 2E42A 1W2EA 1SQVK 2P10A 2RH0A 2IZ1A 3KZIE 2A06E 3IR9A 4N6JA 4JQ0D 1N73A 5BVZA 2NRGA 2CPBA 3CWBD 1OW6A 4HB1A 1X8YA 1SQVG 2HYNA 1NU1K 3VN0A 2K3RA 1ULJA 3CCQP 1BSHA 3RL0g 4WBAA 2YFLA 5B66H 1Y47A 2QJKB 1EQ7A 2H89C 1KILC 1KQLA 3AE5C 1O7MA 1NU1G 2OQQA 4IL6X 2XSOA 3V2QA 1VQ9P 4L76A 1VDFA 3CXHD 1BCCD 4U3FG 2QVAA 3VP9A 2E76D 1N2DC 4YXWH 1MUUA 1KFNA 4LC1A 1JTHB 1AJYA 2NVEA 1FDOA 3WUUA 2AEFA 1BGYE 1FJKA 1PPJD 2A45H 3GLMA 3H1LD 2XSHA 3H25A 2HG5D 2R32A 3AE3C 3HUSA 4QDDA 1LTJA 2QRXA 1KN7A 3C1LA 5AVVB 2WTYA 3KDPB 3L73E 4PV1D 4C46A 1X9VA 3PHLA 1LTSC 1QX8A 1YTZI 1VQNP 4PD4E 1QVFO 2FYUJ 3MZWB 2ZFCA 5CJ0A 1A02J 2GM4A 2WMMA 2QG4A 4K35A 3RK2C 4XFJA 2FXOA 2R44A 3IFMA 2QJPC 2FFDC 3KQGA 1NJIQ 2OTJP 2M8RA 1ZLLA 3M9HA 4IFDK 2WSEJ 2LXCB 3BRTB 1S5LE 1KYOE 3CWBG 3M0AA 2Y0EA 1OXZA 3FXEA 1RY3A 2RN0A 2H8PD 2ZXEB 5APVA 4H13D 2H43A 2OYIA 3NMDA 4EYYQ 2Q7CA 2D2CD 1GL2C 2E75C 4NB8D 4QDFA 5CMZA 2A45I 1JY3O 1BCCG 3O6QB 4QURA 3G9RA 3H32B 1Q2NA 3Q5PA 1T8ZA 5AVZB 4H44B 2LXBA 2KS1A 1A02F 4WY4B 1GK4A 1PPJG 1PL5A 1VF5D 3H1LG 3CC7P 1PP9E 2HMKA 1URQD 1BGYJ 2KYVA 2HLOA 4IFFA 2XZRA 2N1TB 2W6JH 2W6AA 5KAFE 3FX0A 4GT1A 3U1AA 1YQ3C 1BSNA 3BRVB 2Q1KA 2E74B 4EIJA 1OX3A 3AEAC 3L73J 5AW6B 2NPSA 5KLIB 5AW9B 5APXA 1FDIA 2WPRA 1N7SA 1SQXE 1VQ5P 1IFNA 2IFNA 4PD4H 2FYNB 2NPSD 2BASA 3H1ID 3WUTA 3RL0B 1N7SD 1O7PA 3BATA 4GDOA 1FQTA 1JEKA 3TYYA 1FOSF 1MV8A 3H1KD 2HODB 3HD7B 3V2NA 1KYOH 1EG9A 1YJWP 3L70D 4AIVA 1G2CA 2H7HA 2BCCE 4R4LA 2R5BA 3D71A 4KT0J 3PRJA 1NOHA 1FZCA 1RF1C 2M3EA 4BWNA 2DE7D 1OWAA 2NWFA 1QEXA 1M8OB 2K9YA 2E76C 2KOGA 2AEJA 2XU6A 1OVRA 2IBZE 2YO2A 2WSCJ 3PLNA 5DJTB 4D6TE 4DJGA 2WSCH 3H1LE 4AYCA 4DOJA 3LW5J 1KMIZ 2XNXA 1PP9J 3LW5H 4LGDE 4PD4I 1Q82Q 2IX7C 2KZIA 4ZNCA 1LNQA 4I7ZC 4GODA 2WPSA 2YKQA 4PV1C 2ZYGA 2KXPB 5KAFH 3VMYA 2B9BA 3MP7B 3SFDC 3D70A 3L72D 1KYOI 3H1IG 1SQXJ 3L74G 3JCUH 4LLHA 1EDLA 1BE3D 4M3LA 1KILA 1NKNA 2HMLA 1OFCX 1CI6A 2BMRA 5BU5A 5GTHE 2QSIA 2Y0CA 3W68A 1IO4A 1FE6A 4IOIH 1E79H 4H13C 2BMOA 2BCCJ 3W67A 1SFCA 3S4RA 3A2AA 1X22A 2O1JA 5DJUB 1RE3C 1DX7A 2D2CC 1SFCD 3L71D 3CCRP 2PFXA 4L75A 4HM3A 4DZOA 1VQKP 1HF9A 3BCCG 4H0LD 3CXHH 1ZXGA 5KKZC 1YTZT 4QCKA 1EZVE 2QIWA 4OH8B 1M1JB 3A0BE 3WMM0 1VF5C 4OGQB 5HL4A 4D6TJ 1NO4A 2V7QJ 1HJBA 4K3AA 4R4MA 3MIWA 1URQC 2V7QH 2I8DA 2FFDA 2YVJB 3GCEA 3V5BA 4UB8H 1LTBC 2Z5IA 5KTBA 2K9JA 4W80A 1LWUB 3MUDA 2WZ7A 1IFPA 3L72G 3BASA 1KQFB 1LT9C 1HVVA 1MFZA 3TNUA 2ZT9D 1H8AA 3H1JG 4GKGA 2NPSC 3CLQA 3S9OA 1J1DB 1N7SC 1SQQE 1NTKE 1JMMA 1SQVD 2B87A 1JB0J 1GL2A 3AE6C 3GKEA 3H1KE 2POHA 2NUKA 3L70E 1JY3P 2HR3A 3AE2C 1VQ6P 1KC8Q 2KNCB 1SQPE 1KB9E 1IK9A 3L4FA 1M56D 3CXHI 3D89A 1NU1D 2XNDH 2ZYLA 4H44D 5GTIE 1PV3A 4WY4D 1KV4A 3L71G 3L75J 4U3FD 5CCGA 2IBZI 1XTGB 3TF5A 2OARA 1OW8A 4JBZA 1M90Q 1VQ8P 5CCGD 2QJYC 2XKMA 1S4XA 2LKMA 1PGJA 3T97B 1YJ9P 1H0TB 3D6YA 2KSEA 4JPZB 3V4QA 2GBWA 1S72P 4P1BH 3A7OA 2Y0DA 2E4PA 3CCEP 3F89A 3A0BH 1G8JB 1ZW0A 1SQBD 3RL0D 3CX5D 5EFWB 1MZ9A 1ZMEC 4L74A 1NTME 1FU1A 5APSA 2IPPA 1NTZD 4NPEA 1VCKA 1JY3N 1IZNB 3L37A 3CCLP 1OZHA 1ZRTE 4N78E 2R3CA 1GW4A 3EWKA 1AV1A 1BE3E 2QJKC 1KTMA 1RF1A 1O7NA 1LP1A 3WU2E 1SQQJ 2O01J 5AEUA 3AZCA 1NTKJ 1EDIA 2PP6A 2O01H 5C39A 3G3ZA 1KILE 3H1KJ 3TSIA 3VMID 5AW7B 4ZMDA 2E43A 1O7GA 1FDMA 1SQPJ 4HM1A 1KB9H 1JM0A 2XR8A 1WRGA 2YMYA 5GTIH 2C9NY 1SFCC 4NBBD 4QUPA 1EZVI 4AUWA 2HPCA 4NBAD 2J59M 1LTTC 1CSBA 4YXDC 3PH0A 1GU5A 4H0LC 1KQSO 1VQLP 2DE6D 3LIDA 2FXPA 1SQBK 1ZR2A 2N9BA 2B88A 4QMAA 1S5LX 3B71A 1L0NK 3B4SA 3RBXA 2YIUB 3AEEC 2G8YA 3B5NB 1SQBG 3HTKB 1NTZK 3G4SP 2I7FA 3USSA 3MD0A 5E79E 1L0NG 2C9LY 3TGUE 4W7ZA 1L4AB 1NTZG 1LJ2A 4HJLA 3H1HG 1L0LJ 1NTMJ 2C0WA 1Q7YQ 1LGHB 3MUDC 3ABVC 2ZT9C 3CCVP 2WT7B 4I1LA 1JY2O 1Q86Q 2E5YA 3L36A 1NKZB 3CCMP 4QDCA 1BE3J 1KB9I 4ASVA 4NB9D 1RE3A 1SQVE 3AE7C 2HMJA 1BDCA 1RFSA 1Z56A 4HH2A 2KLUA 3WU2H 2QE7H 4UB6H 2OYHA 2YKPA 1NU1E 2M5AA 4H44C 1GDTA 3A0HE 4I6MC 4WY4C 4U3FE 4HKVA 4OGQD 1USDA 1N8RQ 1URQA 1R8EA 3E1IA 4EOTA 2K37A 3HE5B 2BMQA 2H88C 4BRYB 5CCGC 3L35A 3RK3D 2OTKE 3V2PA 3U1CA 2E75B 2GA1A 2JO1A 5APQA 5KLVK 3EQ2A 3IN6A 2IYOA 1ULIA
chains in the Genus database with same CATH topology
3Q1MA 2YIUC 1IK7A 2NVGA 1KQGB 3N0QA 2XRXA 2E75D 1UIXA 1KORA 2HMLA 2BEZF 2BMRA 2QSIA 3VMGD 1ZOYC 4H13C 2BMOA 2HMMA 4H0LB 1ZP0C 3EQQA 3GL0A 2YFJA 2HMOA 3CWBE 1OW7A 4U7JA 5CXMA 5M1BA 2D2CC 2Q3WA 3GOBA 2FBWC 2BEQD 2JP3A 4HM3A 1NYHA 2CKFA 3Q3DA 1HF9A 1DIPA 3R4YA 4H0LD 1P84E 5L8RJ 5KKZC 3AE8C 1EZVE 4QCKA 3D6ZA 2FYUE 1NYKA 1WMKA 2QIWA 3CXHE 1BCCE 3GF7A 2WPVB 1VF5C 3GL2A 4OGQB 5HL4A 3GF3A 2V7QJ 4R4MA 4HM2A 1L0LE 4NBHD 3IAOA 2YVJB 3GCEA 2P10A 2ZT9B 4NBED 1VL2A 1PPJE 2A06E 5BOKA 1OW6A 4P1CH 1KQFB 4HM5A 1ULJA 3RL0g 1VM9A 2JO6A 2YFLA 2ZT9D 3AE1C 2E76B 2H89C 3S9OA 2E74C 1SQQE 3GMAA 3AE5C 1O7MA 2OQQA 4IL6X 1NTKE 1RQVA 4HM8A 2XSOA 1JB0J 5KLIC 3AE6C 1K04A 3GKEA 3H1KE 2NUKA 3L70E 1SQBE 3GTSA 2FYNC 3AE2C 1RIEA 2E76D 1SQPE 1KB9E 3EN1A 4I7ZB 2B1XA 3CX5E 1L0NE 2J5UA 3D89A 3FOUA 4PV1B 4NBFD 2ZYLA 4H44D 4NBCD 1AJYA 1PV3A 2NVEA 1FDOA 1NTZE 3GLMA 2XSHA 3H25A 4TT3H 3H1HE 3AE3C 1WQLA 4QDDA 1Q90D 1OW8A 1YQ4C 3L73E 4PV1D 2DE5D 2QJYC 2E4QA 3C8VA 3T97B 1RQUA 4PD4E 2JZAA 3D6YA 1EXIA 4XFJA 3Q2YA 3VCPA 2GBWA 4P1BH 2QJPC 2E4PA 3AEBC 2QPZA 4OGQC 4NBGD 1G8JB 3Q5SA 1S1CX 2WSEJ 3RK3E 1NGMB 3VMHD 1PIXA 1KYOE 1OMIA 2D2CB 1ZMEC 1NTME 4YTPC 1VCKA 4H13D 2B24A 1ZRTE 1UUVA 3EWKA 3VCAA 1U57A 2WSFJ 1BE3E 4HM0A 2QJKC 1KTMA 3AECC 1O7NA 2D2CD 2E75C 2O01J 4NB8D 3AEFC 4QDFA 5AEUA 3AZCA 1MKMA 4QURA 3G9RA 3H1IE 3Q5PA 3L74E 1KILE 3SFEC 3AEGC 4RKUJ 4HM6A 3VMID 5KLVE 1JM1A 1O7GA 3O6QA 4H44B 1DD3A 1UUWA 3AE9C 4HM1A 1PL5A 1VF5D 2XR8A 1O7HA 1PP9E 2HMKA 3Q5RA 4NBBD 4Y28J 4QUPA 4HM4A 4NBAD 2YFIA 4YXDC 1YQ3C 2E74B 4H0LC 5AEWA 1GMJA 2DE6D 2FXPA 3AEAC 2IDBA 1NDOA 1S5LX 3B71A 1TU3F 1FDIA 1SQXE 2G3AA 1O7WA 1G8KB 3AEEC 2G8YA 4QUQA 3BCCE 4HM7A 3GTEA 2E74D 2I7FA 3GZYA 3DQYA 1O7PA 4GDOA 3TGUE 1FQTA 2GBXA 2YMKA 2MKVA 4H13B 3L75E 4HJLA 1EG9A 4AIVA 4R4LA 2BCCE 3C0DA 3D71A 4KT0J 4AAYB 3ABVC 3AEDC 2ZT9C 1SJGA 2DE7D 3L72E 4QDCA 2NWFA 4NB9D 1SQVE 3AE7C 2HMJA 2NVFA 1RFSA 3AE4C 4QDFB 3H1JE 1DD4A 2K9YA 2E76C 3FGAD 1NU1E 2IBZE 1VF5B 2WSCJ 4H44C 3GB4A 3H1LE 3LW5J 4U3FE 1KMIZ 2NUMA 4HKVA 4OGQD 1EXJA 3GZXA 1Q90C 2HMNA 4NBDD 1R8EA 4I7ZC 2BMQA 2H88C 4EMJB 4PV1C 4Z1MH 3L71E 2E75B 2JO1A 1HJ0A 1Y9BA 3SFDC 3D70A 3IN6A 2NZ2A 1ULIA 1K05A 2WQYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 D;  3VMH D;  1KYO E;  2I7F A;  3GZY A;  3DQY A;  4P1C H;  1O7P A;  4HM5 A;  2D2C B;  1ULJ A;  2YIU C;  2NVG A;  1VM9 A;  3TGU E;  1FQT A;  2GBX A;  1NTM E;  2JO6 A;  2YFL A;  3N0Q A;  2ZT9 D;  2XRX A;  1VCK A;  2E76 B;  2E75 D;  4H13 D;  4H13 B;  3L75 E;  2HML A;  1SQQ E;  2B24 A;  4HJL A;  1EG9 A;  1O7M A;  1ZRT E;  4AIV A;  2BMR A;  1UUV A;  2BCC E;  3C0D A;  4IL6 X;  1NTK E;  3VCA A;  2WSF J;  1BE3 E;  2QSI A;  4HM8 A;  2XSO A;  4KT0 J;  4AAY B;  4HM0 A;  3VMG D;  1JB0 J;  2QJK C;  5KLI C;  3GKE A;  1O7N A;  3H1K E;  1SJG A;  2D2C D;  2O01 J;  4NB8 D;  4QDF A;  2BMO A;  2NUK A;  5AEU A;  2DE7 D;  3AZC A;  1SQB E;  3L70 E;  2HMM A;  4H0L B;  4QUR A;  3EQQ A;  3GTS A;  2FYN C;  3GL0 A;  2NWF A;  1RIE A;  2HMO A;  2E76 D;  2YFJ A;  3H1I E;  4NB9 D;  1SQP E;  1KB9 E;  1SQV E;  3CWB E;  3L74 E;  3EN1 A;  4I7Z B;  2B1X A;  3CX5 E;  3L72 E;  1L0N E;  2HMJ A;  2NVF A;  4RKU J;  3D89 A;  3FOU A;  1RFS A;  4HM6 A;  4PV1 B;  5CXM A;  3VMI D;  5KLV E;  1JM1 A;  4NBF D;  2ZYL A;  1O7G A;  4QDF B;  4H44 D;  3GOB A;  2Q3W A;  4NBC D;  4H44 B;  3H1J E;  2NVE A;  1UUW A;  1NTZ E;  2K9Y A;  4HM1 A;  4HM3 A;  2XSH A;  3H1H E;  2CKF A;  1VF5 D;  1WQL A;  1NU1 E;  2IBZ E;  4QDD A;  1Q90 D;  1VF5 B;  1P84 E;  2XR8 A;  4H0L D;  2WSC J;  5L8R J;  1O7H A;  1PP9 E;  2HMK A;  5KKZ C;  3GB4 A;  4Y28 J;  4NBB D;  4QUP A;  4HM4 A;  4QCK A;  1EZV E;  3L73 E;  2FYU E;  3H1L E;  4PV1 D;  3LW5 J;  2DE5 D;  4HKV A;  2NUM A;  2QJY C;  1NYK A;  4NBA D;  4U3F E;  2QIW A;  3CXH E;  2YFI A;  1BCC E;  2E4Q A;  4OGQ D;  3GZX A;  3C8V A;  2WPV B;  3GL2 A;  4OGQ B;  2E74 B;  5HL4 A;  1Q90 C;  5AEW A;  4PD4 E;  2HMN A;  2JZA A;  2DE6 D;  4NBD D;  4QDC A;  4HM2 A;  1L0L E;  4NBH D;  2BMQ A;  1NDO A;  4EMJ B;  1S5L X;  2YVJ B;  3VCP A;  2GBW A;  3GCE A;  4P1B H;  2ZT9 B;  2QJP C;  4NBE D;  2E4P A;  2QPZ A;  2E75 B;  1SQX E;  3L71 E;  1O7W A;  4NBG D;  1G8J B;  1G8K B;  1PPJ E;  2A06 E;  5BOK A;  4QUQ A;  3BCC E;  2WSE J;  4HM7 A;  1ULI A;  3GTE A; 
#chains in the Genus database with same CATH topology
 1LT9 A;  5KJ7 A;  1ZR4 A;  2NVG A;  2P1J A;  2QM8 A;  5KLV G;  1FS0 E;  1UIX A;  3RL0 C;  5KJ7 D;  1KOR A;  3JCU E;  3VYI A;  2BEZ F;  3TGU J;  2W90 A;  2LR2 A;  5E79 H;  3U59 A;  3L74 D;  1ZOY C;  4RJT A;  3EFG A;  1ZP0 C;  3EQQ A;  1FJP A;  1EDJ A;  2YFJ A;  3GL0 A;  3CWB E;  5TJH A;  1OIP A;  4HJG H;  5M1B A;  3GOB A;  2FBW C;  3PTZ A;  4KJM A;  1SQV J;  3HE4 B;  2OTL P;  2YXQ B;  4DCK A;  2CKF A;  3Q3D A;  1MFT A;  5L8R J;  4C7N B;  1RE4 A;  1YBK A;  2CK3 H;  2WSS H;  5AVQ B;  3C9I A;  2QA4 P;  1NYK A;  1NU1 J;  3CXH E;  3GHG B;  1BCC E;  3GF7 A;  1U7M A;  2WPV B;  3GL2 A;  1E5W A;  4U3F J;  5AVX B;  3BCC D;  4GOE A;  1N73 B;  3TK1 A;  3IAO A;  3A0H H;  4XA4 A;  3SWK A;  4NBE D;  1VL2 A;  1AQ5 A;  2WWW A;  1PPJ E;  5BOK A;  4UB8 E;  2Z5H A;  5KAI E;  1G1J A;  1VQO P;  1LT1 A;  1FZB A;  2JO6 A;  2KK7 A;  2WIT A;  3EFF K;  2E76 B;  3F5H A;  1S9K D;  1JNM A;  1EC5 A;  2K1A A;  3G6E P;  1N7L A;  1RQV A;  2P7J A;  4HM8 A;  2FKW B;  2FYU D;  1VQ4 P;  3CX5 H;  3VMZ A;  3H1J D;  3GTS A;  3OAK A;  3EN1 A;  4I7Z B;  2B1X A;  1W2B O;  2J5U A;  3P7K A;  1NAY A;  3HUS B;  4PV1 B;  1PGO A;  2L91 A;  4NBF D;  2OYO A;  2GUS A;  1LTJ B;  4NBC D;  2JWD A;  3VOP A;  1H88 A;  1S2E A;  1Q81 Q;  4JYC A;  3CWB J;  3E7K A;  5H2F H;  1WQL A;  1JTH A;  3IF4 A;  1YQ4 C;  1GZL A;  3CMA P;  1PFI A;  1GTW A;  3VP8 A;  4OWF A;  3C8V A;  3OW2 O;  1RQU A;  2R5D A;  2OYH C;  2WVR A;  1EXI A;  2AXT E;  2I1J A;  1BCC J;  1QVG O;  2ZAE B;  4Y99 B;  2JKV A;  3AEB C;  2QPZ A;  3N7N A;  4OGQ C;  4NBG D;  3H6P A;  3HRN A;  3B5N D;  3CCU P;  1S1C X;  1M1K Q;  4GIF A;  2A45 G;  3RK3 E;  1NGM B;  1PIX A;  3RK3 C;  1OMI A;  4MN4 C;  2D2C B;  3H1L J;  2OYI B;  1LWU C;  2N9Y B;  1BGY D;  1L4A D;  3CX5 I;  1ZN5 A;  2FYU K;  5KAI H;  1FBM A;  2B24 A;  1SS1 A;  1UUV A;  1X79 B;  1RF0 A;  3VCA A;  5KKZ B;  1U57 A;  1K9M Q;  2KIK A;  1LTG C;  3L73 D;  4XE5 B;  1L0L K;  2FYU G;  1G1I A;  1JY2 P;  1J1D C;  5KJ7 C;  3KXD A;  1MKM A;  5AW3 B;  3H1I E;  1J2J B;  2KS1 B;  3L74 E;  1AVY A;  3PP5 A;  4RKU J;  1L0L G;  1JM1 A;  1P84 D;  2QM7 A;  3O6Q A;  1DD3 A;  3H32 A;  3AE9 C;  3JSV C;  2A06 G;  3M06 A;  1Y8A A;  1KYO D;  1HGZ A;  4Y28 J;  4WY4 A;  5AVS B;  5AW4 B;  1T3U A;  3II6 A;  3V4W A;  2SPZ A;  2R3S A;  2YFI A;  2NPS B;  2VRS A;  3SWF A;  1N7S B;  1GMJ A;  2IDB A;  2N1T A;  1TU3 F;  4NPD A;  3O8Z A;  3CD6 P;  2G3A A;  1RE4 C;  2N1T D;  3BCC E;  1T3J A;  1J1E B;  4TLF A;  2ZYD A;  4HM7 A;  3GTE A;  2AXT H;  2E74 D;  3DQY A;  4ZKP A;  2O3J A;  1YIT P;  2KP8 A;  1G2C B;  2GBX A;  4YPC A;  1JY2 N;  3V6I A;  3M9Q A;  1BGY G;  2MKV A;  1FZC B;  1IFM A;  3C0D A;  1NVO A;  4AAY B;  3MGN A;  3AED C;  1L0N D;  1NWQ A;  2QJY B;  1SJG A;  2HOD A;  3HD7 A;  1S9K E;  3L73 G;  2FYZ A;  1NAF A;  1SVF A;  3L72 E;  3P8M C;  3HD7 D;  3H1H D;  1M57 D;  4W7Y A;  3H1J E;  3H1I J;  2L5G B;  3L74 J;  5CCH A;  1L2P A;  1GU4 A;  1YI2 P;  4UB6 E;  2JJL A;  4JF7 A;  5CCH D;  3GB4 A;  2NUM A;  3FXD A;  3CC2 P;  5AW0 B;  3L70 J;  1NH4 A;  1EXJ A;  3GZX A;  2HFE D;  2HMN A;  2XDJ A;  1EDK A;  2BCC D;  1USE A;  1HWT C;  1U7J A;  2YKO A;  4EMJ B;  3M91 A;  3L71 E;  3ZDM A;  5APU A;  1Y9B A;  4WWI A;  3BVH A;  3KPE A;  3M0D C;  1K05 A;  3V2R A;  1FOS E;  1KIL B;  3Q1M A;  1CI6 B;  1VPC A;  2YIU C;  1IK7 A;  5AVY B;  3BCC J;  2W27 A;  3N0Q A;  3B5N C;  1S3J A;  2XRX A;  2KZJ A;  1YYC A;  3CC4 P;  5CJ4 A;  3MTU E;  3SSU A;  3FWN A;  2IBZ D;  1K8A Q;  1X0T A;  3TDK A;  5APW A;  1SFC B;  4D6T D;  1K73 Q;  2M0B A;  1PP9 G;  3VMG D;  2Z4E A;  2KLV A;  1L4A C;  1PGQ A;  5KLV D;  2PRR A;  4H0L B;  1JCC A;  1SQX K;  1AVO A;  2HMO A;  3NTN A;  4PJ0 H;  4IL6 E;  4O9B A;  4U7J A;  3S1K A;  4ASW A;  5AW8 B;  3L72 J;  1RF0 C;  2JP3 A;  2PGD A;  1PGP A;  1SQX G;  1HGV A;  2JDI H;  1NYH A;  3CPW O;  1P84 E;  3H1J J;  5AVW B;  2UWJ E;  2QEX P;  5K5G B;  3RK2 B;  3CI9 A;  2QJP B;  2FFD B;  2WSE H;  1WT6 A;  3GF3 A;  2K9J B;  3KZI H;  2MJZ A;  4HM2 A;  4BXL A;  1QL2 A;  2BCC G;  1NHL A;  1M1J A;  2ZT9 B;  2K88 A;  2JR8 A;  5AVR B;  3WUV A;  3TNU B;  2P58 A;  1SP4 A;  3L71 J;  2B89 A;  3L75 D;  1HTL C;  4P1C H;  4HM5 A;  3OA7 A;  1LWU A;  1VM9 A;  1PZQ A;  1FZG A;  2Q5U A;  2N1T C;  1AA0 A;  4B86 A;  2AEM A;  3AE1 C;  2B87 B;  4HKZ H;  5AVU B;  1GL2 B;  2E74 C;  3GMA A;  5AW2 B;  2P67 A;  1T2K D;  5APT A;  5AVT B;  2IBZ G;  4ZKU A;  1QGK B;  5KLI C;  1EZV D;  1K04 A;  4D6T G;  1SQB E;  4DT0 A;  4A7P A;  2DW3 A;  2FYN C;  1RIE A;  2YNY A;  3CX5 E;  2W6B A;  1L0N E;  4L73 A;  3FOU A;  2I1K A;  1IFI A;  1CW5 A;  2KNC A;  1NTZ E;  4HYT B;  3LIE A;  2JWA A;  3H1H E;  4I2L C;  2V4H A;  4IL6 H;  4TT3 H;  1UII A;  3OJA B;  3HD7 C;  3I55 P;  1Q90 D;  1FAV A;  5H2F E;  2DE5 D;  1VQP P;  4IFM A;  1IJD B;  2E4Q A;  2E5T A;  3P8C D;  2YXR B;  1AQT A;  1P84 H;  1SQQ D;  1FZF A;  2JZA A;  3NFQ A;  2ZVN B;  5CCH C;  1NTK D;  3B8E B;  3Q2Y A;  3VCP A;  3GHG C;  1IFJ A;  2FXM A;  1FZE A;  3T97 A;  4N3Y B;  3CCJ P;  4EI2 A;  1S5L H;  1H0T A;  4AQR D;  3Q5S A;  2M3B A;  2KI7 B;  1LTA C;  1N73 C;  1SQP D;  1KB9 D;  5APY A;  3VMH D;  2Y9Z A;  2IZ0 A;  1GK6 A;  2C0X A;  2IYP A;  3L75 G;  2GUV A;  1HBW A;  2XV5 A;  3PJS K;  1OVV A;  4YTP C;  1W5C E;  4RO0 A;  1ZV8 A;  1RF1 B;  1LP1 B;  3I5C A;  4NPF X;  1IC2 A;  3GW6 A;  3A3Y B;  3SWY A;  2Y9Y A;  2WSF J;  4HM0 A;  3AEC C;  2WSF H;  5CBN A;  1EZV G;  3AEF C;  3KYQ A;  1JOC A;  2YO3 A;  2RKL A;  1RH5 B;  3VTP C;  1CZQ A;  1VQM P;  3SFE C;  3AEG C;  1QL1 A;  4HM6 A;  5KLV E;  1SQB J;  2WPQ A;  1JUN A;  3GG2 A;  1UUW A;  1L0N J;  2HPC B;  3CME P;  1YJN P;  3JC2 2;  1P84 I;  3HUS C;  3NXS A;  4EDF A;  1O7H A;  1LTJ C;  3Q5R A;  1QLE D;  1NTZ J;  1SQQ K;  4HM4 A;  1L0L D;  1NTM D;  3H1H J;  1NTK K;  4JYB A;  1LTI C;  1BDD A;  3KHU A;  1T6A A;  5AEW A;  4WVZ A;  1ZRT D;  2A06 D;  4N78 D;  1SQQ G;  2IFM A;  1DEE G;  1NDO A;  1KFM A;  2AXC A;  1NTK G;  1SQP K;  3UIA A;  1GD2 E;  1O7W A;  3H1K G;  1G8K B;  3RGU A;  3M0D A;  2ZVO B;  5CBO A;  4QUQ A;  3L70 G;  2Q3I A;  1M7L A;  1KIL D;  2O01 N;  1IFD A;  1SQP G;  4RES B;  3MHV A;  3GZY A;  4Y99 C;  3M9B A;  3B5N A;  3I56 P;  2ZXX A;  3HTK A;  2YMK A;  4GOF A;  1N86 A;  3ITK A;  1M1J C;  3L75 E;  4H13 B;  5BU8 B;  3A5T A;  2KB7 P;  2KUB A;  2Q6Q A;  2OYI C;  1XTC C;  1L4A A;  5B5E E;  3RBZ A;  1VQ7 P;  1JMB A;  2OYH B;  2O1K A;  1T2K C;  5TIS E;  2WT7 A;  2NVF A;  3AE4 C;  4QDF B;  2P2U A;  2M5A B;  1DD4 A;  1NTM K;  2JEE A;  5KLV J;  3FGA D;  3N4X A;  2ZJS E;  1VF5 B;  3RK3 B;  4PD4 D;  1URQ B;  3RK2 D;  3TGU D;  1FZA A;  1NTM G;  3E1R A;  1Q90 C;  4NBD D;  1KZU B;  1R5L A;  3CL3 D;  1BE3 G;  3P8C E;  4Z1M H;  5AW5 B;  1LT9 B;  5B66 E;  1HJ0 A;  3QWO C;  2Q9I A;  3HE5 A;  4BRY A;  2NZ2 A;  5AW1 B;  1OVU A;  1JO5 A;  2PAJ A;  2WQY C;  4KHX A;  2FY8 A;  1KQG B;  3R2P A;  1D7M A;  1J1E C;  1GL2 D;  2ITA A;  3P32 A;  2E75 D;  5GTH H;  3FWL A;  3VMA A;  1JCD A;  1DH3 A;  3K5B A;  1YIJ P;  1FZC C;  2HMM A;  1FC2 C;  3QH9 A;  4CPG A;  1RHZ B;  1SLQ A;  1DEB A;  1OW7 A;  4C7R A;  5CXM A;  1R5S A;  3VMX A;  5B5E H;  5CHX A;  2Q3W A;  2OGU A;  1PP9 D;  4PJ0 E;  2BEQ D;  2KSJ A;  2Q3E A;  4WB4 A;  5TIS H;  3G71 P;  1HH0 A;  2CPS A;  1DIP A;  2ZYA A;  3R4Y A;  1KD1 Q;  3HE4 A;  2RMZ A;  3AE8 C;  2FYU E;  3D6Z A;  1WMK A;  3TGU G;  3CCS P;  4OVN F;  1YHQ P;  1H89 A;  4C7N A;  1SQX D;  1AFO A;  2W8Z A;  1GW3 A;  1HUC A;  2J58 A;  2W83 C;  1L0L E;  4NBH D;  3GHG A;  2E42 A;  1W2E A;  1SQV K;  2P10 A;  2RH0 A;  2IZ1 A;  3KZI E;  2A06 E;  3IR9 A;  4N6J A;  4JQ0 D;  1N73 A;  5BVZ A;  2NRG A;  2CPB A;  3CWB D;  1OW6 A;  4HB1 A;  1X8Y A;  1SQV G;  2HYN A;  1NU1 K;  3VN0 A;  2K3R A;  1ULJ A;  3CCQ P;  1BSH A;  3RL0 g;  4WBA A;  2YFL A;  5B66 H;  1Y47 A;  2QJK B;  1EQ7 A;  2H89 C;  1KIL C;  1KQL A;  3AE5 C;  1O7M A;  1NU1 G;  2OQQ A;  4IL6 X;  2XSO A;  3V2Q A;  1VQ9 P;  4L76 A;  1VDF A;  3CXH D;  1BCC D;  4U3F G;  2QVA A;  3VP9 A;  2E76 D;  1N2D C;  4YXW H;  1MUU A;  1KFN A;  4LC1 A;  1JTH B;  1AJY A;  2NVE A;  1FDO A;  3WUU A;  2AEF A;  1BGY E;  1FJK A;  1PPJ D;  2A45 H;  3GLM A;  3H1L D;  2XSH A;  3H25 A;  2HG5 D;  2R32 A;  3AE3 C;  3HUS A;  4QDD A;  1LTJ A;  2QRX A;  1KN7 A;  3C1L A;  5AVV B;  2WTY A;  3KDP B;  3L73 E;  4PV1 D;  4C46 A;  1X9V A;  3PHL A;  1LTS C;  1QX8 A;  1YTZ I;  1VQN P;  4PD4 E;  1QVF O;  2FYU J;  3MZW B;  2ZFC A;  5CJ0 A;  1A02 J;  2GM4 A;  2WMM A;  2QG4 A;  4K35 A;  3RK2 C;  4XFJ A;  2FXO A;  2R44 A;  3IFM A;  2QJP C;  2FFD C;  3KQG A;  1NJI Q;  2OTJ P;  2M8R A;  1ZLL A;  3M9H A;  4IFD K;  2WSE J;  2LXC B;  3BRT B;  1S5L E;  1KYO E;  3CWB G;  3M0A A;  2Y0E A;  1OXZ A;  3FXE A;  1RY3 A;  2RN0 A;  2H8P D;  2ZXE B;  5APV A;  4H13 D;  2H43 A;  2OYI A;  3NMD A;  4EYY Q;  2Q7C A;  2D2C D;  1GL2 C;  2E75 C;  4NB8 D;  4QDF A;  5CMZ A;  2A45 I;  1JY3 O;  1BCC G;  3O6Q B;  4QUR A;  3G9R A;  3H32 B;  1Q2N A;  3Q5P A;  1T8Z A;  5AVZ B;  4H44 B;  2LXB A;  2KS1 A;  1A02 F;  4WY4 B;  1GK4 A;  1PPJ G;  1PL5 A;  1VF5 D;  3H1L G;  3CC7 P;  1PP9 E;  2HMK A;  1URQ D;  1BGY J;  2KYV A;  2HLO A;  4IFF A;  2XZR A;  2N1T B;  2W6J H;  2W6A A;  5KAF E;  3FX0 A;  4GT1 A;  3U1A A;  1YQ3 C;  1BSN A;  3BRV B;  2Q1K A;  2E74 B;  4EIJ A;  1OX3 A;  3AEA C;  3L73 J;  5AW6 B;  2NPS A;  5KLI B;  5AW9 B;  5APX A;  1FDI A;  2WPR A;  1N7S A;  1SQX E;  1VQ5 P;  1IFN A;  2IFN A;  4PD4 H;  2FYN B;  2NPS D;  2BAS A;  3H1I D;  3WUT A;  3RL0 B;  1N7S D;  1O7P A;  3BAT A;  4GDO A;  1FQT A;  1JEK A;  3TYY A;  1FOS F;  1MV8 A;  3H1K D;  2HOD B;  3HD7 B;  3V2N A;  1KYO H;  1EG9 A;  1YJW P;  3L70 D;  4AIV A;  1G2C A;  2H7H A;  2BCC E;  4R4L A;  2R5B A;  3D71 A;  4KT0 J;  3PRJ A;  1NOH A;  1FZC A;  1RF1 C;  2M3E A;  4BWN A;  2DE7 D;  1OWA A;  2NWF A;  1QEX A;  1M8O B;  2K9Y A;  2E76 C;  2KOG A;  2AEJ A;  2XU6 A;  1OVR A;  2IBZ E;  2YO2 A;  2WSC J;  3PLN A;  5DJT B;  4D6T E;  4DJG A;  2WSC H;  3H1L E;  4AYC A;  4DOJ A;  3LW5 J;  1KMI Z;  2XNX A;  1PP9 J;  3LW5 H;  4LGD E;  4PD4 I;  1Q82 Q;  2IX7 C;  2KZI A;  4ZNC A;  1LNQ A;  4I7Z C;  4GOD A;  2WPS A;  2YKQ A;  4PV1 C;  2ZYG A;  2KXP B;  5KAF H;  3VMY A;  2B9B A;  3MP7 B;  3SFD C;  3D70 A;  3L72 D;  1KYO I;  3H1I G;  1SQX J;  3L74 G;  3JCU H;  4LLH A;  1EDL A;  1BE3 D;  4M3L A;  1KIL A;  1NKN A;  2HML A;  1OFC X;  1CI6 A;  2BMR A;  5BU5 A;  5GTH E;  2QSI A;  2Y0C A;  3W68 A;  1IO4 A;  1FE6 A;  4IOI H;  1E79 H;  4H13 C;  2BMO A;  2BCC J;  3W67 A;  1SFC A;  3S4R A;  3A2A A;  1X22 A;  2O1J A;  5DJU B;  1RE3 C;  1DX7 A;  2D2C C;  1SFC D;  3L71 D;  3CCR P;  2PFX A;  4L75 A;  4HM3 A;  4DZO A;  1VQK P;  1HF9 A;  3BCC G;  4H0L D;  3CXH H;  1ZXG A;  5KKZ C;  1YTZ T;  4QCK A;  1EZV E;  2QIW A;  4OH8 B;  1M1J B;  3A0B E;  3WMM 0;  1VF5 C;  4OGQ B;  5HL4 A;  4D6T J;  1NO4 A;  2V7Q J;  1HJB A;  4K3A A;  4R4M A;  3MIW A;  1URQ C;  2V7Q H;  2I8D A;  2FFD A;  2YVJ B;  3GCE A;  3V5B A;  4UB8 H;  1LTB C;  2Z5I A;  5KTB A;  2K9J A;  4W80 A;  1LWU B;  3MUD A;  2WZ7 A;  1IFP A;  3L72 G;  3BAS A;  1KQF B;  1LT9 C;  1HVV A;  1MFZ A;  3TNU A;  2ZT9 D;  1H8A A;  3H1J G;  4GKG A;  2NPS C;  3CLQ A;  3S9O A;  1J1D B;  1N7S C;  1SQQ E;  1NTK E;  1JMM A;  1SQV D;  2B87 A;  1JB0 J;  1GL2 A;  3AE6 C;  3GKE A;  3H1K E;  2POH A;  2NUK A;  3L70 E;  1JY3 P;  2HR3 A;  3AE2 C;  1VQ6 P;  1KC8 Q;  2KNC B;  1SQP E;  1KB9 E;  1IK9 A;  3L4F A;  1M56 D;  3CXH I;  3D89 A;  1NU1 D;  2XND H;  2ZYL A;  4H44 D;  5GTI E;  1PV3 A;  4WY4 D;  1KV4 A;  3L71 G;  3L75 J;  4U3F D;  5CCG A;  2IBZ I;  1XTG B;  3TF5 A;  2OAR A;  1OW8 A;  4JBZ A;  1M90 Q;  1VQ8 P;  5CCG D;  2QJY C;  2XKM A;  1S4X A;  2LKM A;  1PGJ A;  3T97 B;  1YJ9 P;  1H0T B;  3D6Y A;  2KSE A;  4JPZ B;  3V4Q A;  2GBW A;  1S72 P;  4P1B H;  3A7O A;  2Y0D A;  2E4P A;  3CCE P;  3F89 A;  3A0B H;  1G8J B;  1ZW0 A;  1SQB D;  3RL0 D;  3CX5 D;  5EFW B;  1MZ9 A;  1ZME C;  4L74 A;  1NTM E;  1FU1 A;  5APS A;  2IPP A;  1NTZ D;  4NPE A;  1VCK A;  1JY3 N;  1IZN B;  3L37 A;  3CCL P;  1OZH A;  1ZRT E;  4N78 E;  2R3C A;  1GW4 A;  3EWK A;  1AV1 A;  1BE3 E;  2QJK C;  1KTM A;  1RF1 A;  1O7N A;  1LP1 A;  3WU2 E;  1SQQ J;  2O01 J;  5AEU A;  3AZC A;  1NTK J;  1EDI A;  2PP6 A;  2O01 H;  5C39 A;  3G3Z A;  1KIL E;  3H1K J;  3TSI A;  3VMI D;  5AW7 B;  4ZMD A;  2E43 A;  1O7G A;  1FDM A;  1SQP J;  4HM1 A;  1KB9 H;  1JM0 A;  2XR8 A;  1WRG A;  2YMY A;  5GTI H;  2C9N Y;  1SFC C;  4NBB D;  4QUP A;  1EZV I;  4AUW A;  2HPC A;  4NBA D;  2J59 M;  1LTT C;  1CSB A;  4YXD C;  3PH0 A;  1GU5 A;  4H0L C;  1KQS O;  1VQL P;  2DE6 D;  3LID A;  2FXP A;  1SQB K;  1ZR2 A;  2N9B A;  2B88 A;  4QMA A;  1S5L X;  3B71 A;  1L0N K;  3B4S A;  3RBX A;  2YIU B;  3AEE C;  2G8Y A;  3B5N B;  1SQB G;  3HTK B;  1NTZ K;  3G4S P;  2I7F A;  3USS A;  3MD0 A;  5E79 E;  1L0N G;  2C9L Y;  3TGU E;  4W7Z A;  1L4A B;  1NTZ G;  1LJ2 A;  4HJL A;  3H1H G;  1L0L J;  1NTM J;  2C0W A;  1Q7Y Q;  1LGH B;  3MUD C;  3ABV C;  2ZT9 C;  3CCV P;  2WT7 B;  4I1L A;  1JY2 O;  1Q86 Q;  2E5Y A;  3L36 A;  1NKZ B;  3CCM P;  4QDC A;  1BE3 J;  1KB9 I;  4ASV A;  4NB9 D;  1RE3 A;  1SQV E;  3AE7 C;  2HMJ A;  1BDC A;  1RFS A;  1Z56 A;  4HH2 A;  2KLU A;  3WU2 H;  2QE7 H;  4UB6 H;  2OYH A;  2YKP A;  1NU1 E;  2M5A A;  4H44 C;  1GDT A;  3A0H E;  4I6M C;  4WY4 C;  4U3F E;  4HKV A;  4OGQ D;  1USD A;  1N8R Q;  1URQ A;  1R8E A;  3E1I A;  4EOT A;  2K37 A;  3HE5 B;  2BMQ A;  2H88 C;  4BRY B;  5CCG C;  3L35 A;  3RK3 D;  2OTK E;  3V2P A;  3U1C A;  2E75 B;  2GA1 A;  2JO1 A;  5APQ A;  5KLV K;  3EQ2 A;  3IN6 A;  2IYO A;  1ULI A; 
#chains in the Genus database with same CATH homology
 3Q1M A;  2YIU C;  1IK7 A;  2NVG A;  1KQG B;  3N0Q A;  2XRX A;  2E75 D;  1UIX A;  1KOR A;  2HML A;  2BEZ F;  2BMR A;  2QSI A;  3VMG D;  1ZOY C;  4H13 C;  2BMO A;  2HMM A;  4H0L B;  1ZP0 C;  3EQQ A;  3GL0 A;  2YFJ A;  2HMO A;  3CWB E;  1OW7 A;  4U7J A;  5CXM A;  5M1B A;  2D2C C;  2Q3W A;  3GOB A;  2FBW C;  2BEQ D;  2JP3 A;  4HM3 A;  1NYH A;  2CKF A;  3Q3D A;  1HF9 A;  1DIP A;  3R4Y A;  4H0L D;  1P84 E;  5L8R J;  5KKZ C;  3AE8 C;  1EZV E;  4QCK A;  3D6Z A;  2FYU E;  1NYK A;  1WMK A;  2QIW A;  3CXH E;  1BCC E;  3GF7 A;  2WPV B;  1VF5 C;  3GL2 A;  4OGQ B;  5HL4 A;  3GF3 A;  2V7Q J;  4R4M A;  4HM2 A;  1L0L E;  4NBH D;  3IAO A;  2YVJ B;  3GCE A;  2P10 A;  2ZT9 B;  4NBE D;  1VL2 A;  1PPJ E;  2A06 E;  5BOK A;  1OW6 A;  4P1C H;  1KQF B;  4HM5 A;  1ULJ A;  3RL0 g;  1VM9 A;  2JO6 A;  2YFL A;  2ZT9 D;  3AE1 C;  2E76 B;  2H89 C;  3S9O A;  2E74 C;  1SQQ E;  3GMA A;  3AE5 C;  1O7M A;  2OQQ A;  4IL6 X;  1NTK E;  1RQV A;  4HM8 A;  2XSO A;  1JB0 J;  5KLI C;  3AE6 C;  1K04 A;  3GKE A;  3H1K E;  2NUK A;  3L70 E;  1SQB E;  3GTS A;  2FYN C;  3AE2 C;  1RIE A;  2E76 D;  1SQP E;  1KB9 E;  3EN1 A;  4I7Z B;  2B1X A;  3CX5 E;  1L0N E;  2J5U A;  3D89 A;  3FOU A;  4PV1 B;  4NBF D;  2ZYL A;  4H44 D;  4NBC D;  1AJY A;  1PV3 A;  2NVE A;  1FDO A;  1NTZ E;  3GLM A;  2XSH A;  3H25 A;  4TT3 H;  3H1H E;  3AE3 C;  1WQL A;  4QDD A;  1Q90 D;  1OW8 A;  1YQ4 C;  3L73 E;  4PV1 D;  2DE5 D;  2QJY C;  2E4Q A;  3C8V A;  3T97 B;  1RQU A;  4PD4 E;  2JZA A;  3D6Y A;  1EXI A;  4XFJ A;  3Q2Y A;  3VCP A;  2GBW A;  4P1B H;  2QJP C;  2E4P A;  3AEB C;  2QPZ A;  4OGQ C;  4NBG D;  1G8J B;  3Q5S A;  1S1C X;  2WSE J;  3RK3 E;  1NGM B;  3VMH D;  1PIX A;  1KYO E;  1OMI A;  2D2C B;  1ZME C;  1NTM E;  4YTP C;  1VCK A;  4H13 D;  2B24 A;  1ZRT E;  1UUV A;  3EWK A;  3VCA A;  1U57 A;  2WSF J;  1BE3 E;  4HM0 A;  2QJK C;  1KTM A;  3AEC C;  1O7N A;  2D2C D;  2E75 C;  2O01 J;  4NB8 D;  3AEF C;  4QDF A;  5AEU A;  3AZC A;  1MKM A;  4QUR A;  3G9R A;  3H1I E;  3Q5P A;  3L74 E;  1KIL E;  3SFE C;  3AEG C;  4RKU J;  4HM6 A;  3VMI D;  5KLV E;  1JM1 A;  1O7G A;  3O6Q A;  4H44 B;  1DD3 A;  1UUW A;  3AE9 C;  4HM1 A;  1PL5 A;  1VF5 D;  2XR8 A;  1O7H A;  1PP9 E;  2HMK A;  3Q5R A;  4NBB D;  4Y28 J;  4QUP A;  4HM4 A;  4NBA D;  2YFI A;  4YXD C;  1YQ3 C;  2E74 B;  4H0L C;  5AEW A;  1GMJ A;  2DE6 D;  2FXP A;  3AEA C;  2IDB A;  1NDO A;  1S5L X;  3B71 A;  1TU3 F;  1FDI A;  1SQX E;  2G3A A;  1O7W A;  1G8K B;  3AEE C;  2G8Y A;  4QUQ A;  3BCC E;  4HM7 A;  3GTE A;  2E74 D;  2I7F A;  3GZY A;  3DQY A;  1O7P A;  4GDO A;  3TGU E;  1FQT A;  2GBX A;  2YMK A;  2MKV A;  4H13 B;  3L75 E;  4HJL A;  1EG9 A;  4AIV A;  4R4L A;  2BCC E;  3C0D A;  3D71 A;  4KT0 J;  4AAY B;  3ABV C;  3AED C;  2ZT9 C;  1SJG A;  2DE7 D;  3L72 E;  4QDC A;  2NWF A;  4NB9 D;  1SQV E;  3AE7 C;  2HMJ A;  2NVF A;  1RFS A;  3AE4 C;  4QDF B;  3H1J E;  1DD4 A;  2K9Y A;  2E76 C;  3FGA D;  1NU1 E;  2IBZ E;  1VF5 B;  2WSC J;  4H44 C;  3GB4 A;  3H1L E;  3LW5 J;  4U3F E;  1KMI Z;  2NUM A;  4HKV A;  4OGQ D;  1EXJ A;  3GZX A;  1Q90 C;  2HMN A;  4NBD D;  1R8E A;  4I7Z C;  2BMQ A;  2H88 C;  4EMJ B;  4PV1 C;  4Z1M H;  3L71 E;  2E75 B;  2JO1 A;  1HJ0 A;  1Y9B A;  3SFD C;  3D70 A;  3IN6 A;  2NZ2 A;  1ULI A;  1K05 A;  2WQY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...