2YIUC

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
b'DFLYYATAGAGTVAAGAAAWTLVNQMNPSADVQALASIQVDVSGVETGTQLTVKWLGKPVFIRRRTEDEIQAGREVDLGQLIDRSAQNSNKPDAPATDENRTMDEAGEWLVMIGVCTHLGCVPIGDGAGDFGGWFCPCHGSHYDTSGRIRRGPAPQNLHIPVAEFLDDTTIKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B
molecule tags Oxidoreductase
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
total genus 48
structure length 174
sequence length 174
chains with identical sequence F
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2yiuC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yiuC02
4HM7A 4HM8A 1EZVE 1ULIA 3GL0A 4H13B 4QDFA 2QPZA 4H0LB 3BCCE 1VM9A 2QSIA 2I7FA 3L75E 4NBGD 2E75B 1SQQE 2HMMA 4U3FE 3VMID 3L73E 4NBDD 2E4QA 3VCAA 4H13D 2E75D 2NWFA 4H44D 2QJPC 4NB8D 1JB0J 4P1CH 1SJGA 3GKEA 4QDCA 3L72E 2BMRA 1PPJE 3CXHE 4QDDA 5AEWA 4HM1A 3L70E 2QJYC 2E74D 4HM6A 4NBBD 3H1JE 4HM0A 3GB4A 2E76B 3GOBA 3GTEA 2FYNC 1VF5B 4HKVA 1PP9E 1SQVE 1L0LE 3C8VA 2DE5D 2GBWA 1NYKA 3H1LE 2ZYLA 2Q3WA 2QIWA 4PV1D 1Q90D 2XSHA 2NUMA 1WQLA 2NUKA 4HM2A 1O7NA 2ZT9B 2XRXA 3TGUE 1ULJA 3L71E 4NBFD 1VF5D 4QCKA 2E74B 2A06E 4NBAD 4QDFB 2JO6A 2YVJB 3VMGD 4PV1B 3VCPA 5KKZC 1NTZE 1NU1E 1BCCE 2HMKA 1SQBE 4RKUJ 2B1XA 2NVGA 4AAYB 4QURA 2D2CD 1O7WA 2XR8A 2DE7D 3GL2A 4EMJB 2QJKC 1NDOA 5KLVE 1KB9E 4H44B 2FYUE 3GZYA 3N0QA 1NTKE 4KT0J 2YFLA 4H0LD 5KLIC 1SQXE 2HMLA 1O7MA 2YFJA 3CX5E 3H1KE 4HM4A 2WPVB 2IBZE 3EN1A 3EQQA 4NB9D 2K9YA 1KYOE 4PD4E 2BCCE 1FQTA 1G8KB 2HMOA 4QUPA 4AIVA 1RIEA 2GBXA 2XSOA 1VCKA 3FOUA 4NBED 1O7PA 5AEUA 1Q90C 3H1HE 1JM1A 3D89A 2WSFJ 2D2CB 2CKFA 3L74E 4P1BH 2B24A 1UUVA 4OGQB 3GZXA 1S5LX 2NVEA 3H1IE 1O7GA 4HM3A 1NTME 2WSEJ 2E4PA 2JZAA 5HL4A 2ZT9D 1RFSA 4Y28J 1UUWA 4IL6X 3AZCA 2YIUC 5BOKA 1ZRTE 3DQYA 1SQPE 3VMHD 3GCEA 3CWBE 1EG9A 4HM5A 2BMOA 2E76D 2HMNA 3LW5J 4NBCD 4I7ZB 2NVFA 4HJLA 1BE3E 3GTSA 5L8RJ 4QUQA 1L0NE 5CXMA 1P84E 2O01J 4OGQD 2YFIA 2WSCJ 3C0DA 1G8JB 2DE6D 4NBHD 1O7HA 2HMJA 2BMQA
chains in the Genus database with same CATH superfamily
1L0LJ 1GL2A 3H1LJ 2AXTE 2NPSC 3GHGC 2R5BA 4H13D 1PPJG 1QL1A 3FWNA 1GL2B 1QEXA 4HM1A 1KQFB 1SQBJ 5KLVD 1L0LG 3H1LG 5AVTB 3B5NA 5AVYB 4JYCA 3Q5PA 1S9KD 2XU6A 1GL2C 2OARA 3A2AA 2NUKA 1L0LK 4U7JA 3RL0C 1BCCJ 1NU1E 4JYBA 3E7KA 4I7ZC 3H1IJ 2PRRA 5K5GB 1N2DC 5CCGD 5KJ7A 5DJUB 2QM8A 3CXHI 1A02F 1Q2NA 2WPVB 3C9IA 3LW5H 4O9BA 1UIIA 2KK7A 2QJYB 5APWA 3M9QA 1PFIA 1JY2P 4HH2A 2KZJA 5AEUA 5AVZB 1L0LD 3H1LD 1VDFA 2NPSB 3AEGC 3AEAC 5C39A 1NTME 2E4PA 3CX5I 1VQPP 3GF3A 3PLNA 5GTHE 2IZ0A 2H8PD 1NTMK 1W5CE 1K04A 1G8JB 2DE6D 1M1JA 1M56D 4QDFA 1GK6A 1AFOA 3BRTB 1EDLA 1S5LE 1RE3C 4U3FE 1JMBA 1NO4A 2FYZA 3ZDMA 5B66E 2YMYA 1HGVA 1YTZT 2O1KA 1QVFO 4HM0A 3H32B 1KMIZ 1FOSE 2Q9IA 2QJPB 4EDFA 3Q5SA 3H1KJ 3TGUE 4WBAA 1KV4A 2SPZA 2FKWB 2IYOA 3QH9A 2OYIA 2QE7H 2HODB 1T3JA 1KB9I 3CXHH 5TISH 2G3AA 2ITAA 4AAYB 2JWAA 3AE3C 1GK4A 2XZRA 5KTBA 1K73Q 3N0QA 1E79H 3BRVB 2YO2A 1FZGA 3RL0B 1SFCA 3EQ2A 4AIVA 2GBXA 1ZOYC 1ZP0C 1JY2O 1EZVI 3HUSC 1S5LX 2GA1A 5M1BA 2Q3IA 1RFSA 3AZCA 4HB1A 3V2QA 3E1RA 4JQ0D 3FXEA 3RBZA 1FZFA 2Y0EA 3VN0A 1JMMA 1GMJA 1QLED 3V4QA 4DZOA 2O01J 1G2CB 3VMAA 1GL2D 3BCCD 4HM7A 3SWFA 5AVVB 2E75B 2YKOA 4NBDD 3MD0A 3CC4P 3V6IA 4NB8D 2WITA 4QDCA 4HM6A 1H8AA 1IFPA 3EWKA 1ZR2A 3GB4A 5KLVG 3F5HA 3WMM0 3L75J 1RHZB 4HJGH 1Q90D 4R4MA 3HRNA 1SQBD 2WZ7A 1VQ8P 2OTLP 2QJKB 1URQB 4QCKA 1CSBA 4QDFB 2KLUA 3H25A 4PV1C 2CPSA 1KN7A 1S3JA 1K9MQ 2H88C 1ZR4A 1S9KE 2XR8A 1VQLP 1Y8AA 1FZCA 1NDOA 5KLVE 1KYOD 3HE5A 1O7MA 1QVGO 3B8EB 2C0WA 3H32A 3HD7B 1HJBA 2HMOA 3L36A 2WSSH 1QL2A 5APSA 1O7PA 3MTUE 2E43A 1NU1K 3HD7A 1H0TA 3L75G 5HL4A 2CPBA 1SQXJ 1LTTC 2KNCB 3L70G 1H0TB 1NU1G 1KC8Q 3A0BH 2GUSA 5KKZB 2KIKA 3RK3E 1L0NE 2KNCA 3QWOC 1FDMA 1U7MA 2RMZA 3D71A 4L74A 2Y9YA 3L70D 4NPDA 4XA4A 1URQC 1SLQA 1CI6B 1OX3A 2C0XA 3CCMP 1EDIA 3AE5C 1NGMB 3F89A 4I1LA 5KAFE 1OIPA 1IK9A 2M3EA 3MHVA 1NKNA 2IFNA 1UIXA 3A7OA 1IFNA 3KQGA 3OJAB 2ZAEB 2E76B 2FYNC 1GW4A 1L0LE 3H1LE 1NYKA 2YO3A 3K5BA 1T3UA 1SQPK 1OZHA 3R4YA 3TGUG 1SQBE 2O01H 2WMMA 4N3YB 4R4LA 3N7NA 3SWKA 2I1KA 2BEZF 1P84H 3M9HA 2HYNA 3CCEP 1NU1J 2E5YA 3L73D 4U3FG 2NZ2A 3IN6A 2H89C 1UUVA 5AVXB 2V7QJ 5CMZA 3H1IE 3AE2C 3CMEP 2ZT9D 3KZIH 1RY3A 3BCCJ 1AQ5A 3Q5RA 2HR3A 5BOKA 1KB9H 5DJTB 1SS1A 3VMHD 1JM0A 3CWBJ 1MV8A 1MFZA 2XKMA 5BU5A 2J59M 4QUQA 3L73G 3ITKA 4OGQD 1IFDA 2YFIA 1PGQA 2G8YA 3VP8A 2CK3H 1LT9C 1IFJA 1O7HA 1Q86Q 2A45I 2QPZA 1OVVA 1GTWA 1VM9A 2QSIA 2I7FA 1JNMA 3I55P 2YXRB 1NTZD 5GTIH 2I8DA 2FXOA 3L75D 2E4QA 1Y9BA 1HTLC 4H44D 2Q1KA 2B9BA 3TNUB 2RKLA 3CCJP 1DIPA 3O6QB 2QIWA 2W6AA 4UB8E 3KDPB 1R5SA 2YNYA 1AVOA 2Y0DA 3L71J 2Z5HA 2E74B 3FWLA 2A45G 3G9RA 4YXWH 2IDBA 2M0BA 2ZYGA 2R3SA 1KQLA 1SQVJ 4AUWA 1RE4C 3II6A 4TLFA 3PRJA 4KT0J 1KILE 3H1KE 1ZXGA 3IFMA 2OTKE 1URQD 3B5NC 2B87A 1BGYD 2BASA 1NJIQ 2MKVA 5APYA 1ZN5A 1RF1C 1IO4A 3ABVC 1G1JA 1SQVD 4HYTB 3S4RA 2IZ1A 2E75C 3MUDA 3V2RA 2W8ZA 5AW2B 4ZMDA 5KLIB 1E5WA 2HODA 2KP8A 2BMQA 1EZVE 4AQRD 2POHA 2AEJA 2O3JA 2OYHC 3L72E 1L4AB 2Q7CA 1NTKD 5APTA 2JR8A 4IFDK 5CCGC 2K9JB 1PGPA 3B5NB 2DE5D 4YTPC 2XSHA 1QX8A 2XRXA 2LR2A 1KYOH 4GT1A 2IPPA 2K1AA 1VF5D 4NBAD 2QM7A 4ZKPA 1G2CA 2KS1B 3EFFK 5CCHA 1N7SC 1KFMA 1SQXE 4IL6H 1T8ZA 2W6BA 5KAIH 3L72D 3IAOA 2YIUB 1L2PA 1BDCA 1CW5A 3RK3C 3CC7P 4OGQB 2XDJA 2JZAA 3PHLA 5KLVJ 1UUWA 2W6JH 1L0ND 3RK3D 1FBMA 4PJ0H 5L8RJ 4W80A 1JEKA 3FXDA 3RK2C 3V5BA 3P7KA 3H1KD 3TYYA 1KB9D 2V7QH 4YXDC 4H13B 1X22A 1PL5A 1FZCB 4WB4A 5BVZA 4UB8H 3HE5B 2B87B 4ASVA 2JEEA 2FYUK 3V2PA 5CCHD 4WWIA 2P2UA 1PPJE 3CXHE 3JC22 2PFXA 2QG4A 2E74D 3L71D 5AW6B 1RH5B 3AE6C 5H2FE 2BCCD 2ZVOB 3A0HE 3W68A 1EDJA 3G71P 1YITP 2IX7C 1U7JA 2KB7P 3L71G 1YJWP 4PV1B 3CCQP 1IFIA 1T2KD 1SQPG 1DX7A 2FXMA 3T97B 2M5AA 1O7WA 4ZNCA 2P58A 3HTKA 2P7JA 1JY3O 3GF7A 4PD4D 4RJTA 1CI6A 3CX5E 1NVOA 2QEXP 1NKZB 4NB9D 1VQKP 1BDDA 1GW3A 3HTKB 3MZWB 2ZYDA 1FQTA 1G8KB 1W2EA 2K9JA 1SFCB 3L37A 4WY4A 4HM3A 4WY4D 1ZRTE 1SP4A 1X79B 1PP9D 3RBXA 4HM5A 4IOIH 2V4HA 1BCCD 1BE3G 4HJLA 2W83C 3NXSA 4PD4I 1J1DB 1FC2C 3L74J 3C0DA 2DW3A 3OAKA 2ZFCA 1JY2N 3BCCE 3HD7D 3KYQA 3SWYA 3M91A 3E1IA 2C9LY 2KYVA 1OVUA 3L73E 1VQ5P 2QJPC 1SJGA 3GKEA 5AVQB 1XTCC 1ZV8A 1VQNP 1FE6A 1VQ7P 2KI7B 2YKPA 4IFFA 3UIAA 3Q3DA 1HUCA 1SQVE 3GHGA 2R32A 5AVWB 3TGUJ 1S5LH 1ULJA 1NAFA 2A06E 4AYCA 2JO6A 2RN0A 1R8EA 1SQQG 2HMKA 5B66H 4W7YA 4JBZA 3IF4A 5APQA 1SQQK 3CL3D 1L4AD 3RK2D 1X0TA 2WPSA 1Q7YQ 4PD4E 1DEEG 2BCCE 3USSA 3TNUA 1FJPA 4NBED 2D2CB 1NWQA 2N9YB 1NTZK 1IFMA 1PGJA 5E79H 3MIWA 3O6QA 3CCRP 1NTZG 1DH3A 5KAIE 1KTMA 2OYOA 3GTSA 4N78D 2FXPA 5CXMA 3H1KG 4OWFA 3P8CE 2O01N 4BRYB 1NTMG 2FYNB 1YTZI 1M8OB 2KOGA 3VMID 1L0NG 3AEEC 3U1CA 4BRYA 3L35A 1YJNP 2IBZD 2LKMA 2WSCH 1KZUB 2AXCA 2WPQA 1RQVA 3PTZA 1VF5B 3EFGA 1VL2A 1MKMA 3M0AA 2PP6A 3JCUE 1J1DC 5B5EE 4NBFD 1N86A 1RE4A 1X8YA 1LGHB 1HBWA 1H89A 1USEA 5KKZC 4RKUJ 3V4WA 4BXLA 4OVNF 3CWBD 1SFCD 2OYIC 3MP7B 1JTHB 1EZVD 1X9VA 4H0LD 2WT7B 2Y0CA 1AQTA 1XTGB 1MUUA 5AVSB 3H1HG 3A0BE 3EQQA 1NTKK 2OTJP 3HD7C 5CCGA 2WT7A 1PIXA 1NTZJ 1L4AA 2JDIH 3GHGB 4C7NB 3D89A 1LTBC 2CKFA 3CD6P 5APVA 3GZXA 3CPWO 4EOTA 2WSEJ 3AE1C 4D6TE 2FYUJ 1P84I 4C7NA 3CLQA 1SQQJ 3IR9A 4WVZA 1NOHA 3D6YA 2N1TB 1OVRA 2MJZA 3VMXA 3AE7C 2B88A 5CBOA 4GDOA 1FZAA 1LWUB 1LP1B 4QMAA 1EC5A 3VP9A 3G3ZA 2JWDA 4I6MC 4I2LC 2A06G 3TGUD 1IC2A 3CX5D 3PH0A 3H1JJ 4JF7A 2QRXA 1KILD 1VQ9P 2FYUG 4D6TG 5KJ7D 1FZBA 1HWTC 2OGUA 3GTEA 4HKVA 4Z1MH 2RH0A 3A5TA 1SQQD 3BCCG 1KILB 1KB9E 4H44B 3GZYA 2YFLA 1M1KQ 5AW3B 2A06D 4W7ZA 1AVYA 3CMAP 1N7LA 3AE8C 1BGYJ 2XSOA 2LXBA 1M57D 3L74E 1O7GA 3AE4C 3FGAD 3PP5A 1LTSC 1S4XA 1N8RQ 1EG9A 3HE4A 1S1CX 4I7ZB 2NVFA 1LJ2A 1ZMEC 2JO1A 1JTHA 4YPCA 3D70A 4NBHD 1N7SB 1ULIA 1PP9G 1FAVA 2PAJA 3H1ID 5CHXA 1RF0C 5B5EH 2N1TC 2NWFA 2KLVA 5TISE 2WTYA 1RF1B 4OGQC 1LTJB 3M0DA 2E5TA 2N9BA 4NPEA 1GD2E 4TT3H 4IFMA 4WY4B 2N1TA 2J5UA 1N7SD 1LTJA 2ZYLA 3NMDA 4C7RA 3R2PA 1OW6A 5BU8B 3P32A 2Q3EA 1NYHA 3O8ZA 2GUVA 3S1KA 1BCCE 4EIJA 2NVGA 3GLMA 2P10A 2KS1A 2HPCB 1BSHA 2K88A 3MUDC 1EZVG 1PP9J 4GKGA 4KHXA 2I1JA 1NTKE 3AE9C 1DEBA 1FOSF 3M9BA 2FYUD 2IBZE 2K9YA 2P67A 2WWWA 2UWJE 1U57A 4QUPA 2M8RA 1Q90C 3WUUA 2JJLA 1L4AC 1IZNB 3TF5A 5EFWB 1KFNA 1FZEA 2WSEH 5AW5B 2K3RA 4MN4C 1S72P 4Y99C 3VMZA 3LIDA 4NBCD 5CCHC 2FBWC 2BCCJ 3G6EP 1BE3E 1JO5A 1SQPD 3H1HJ 1YBKA 1JUNA 3N4XA 1KORA 1BE3D 1IK7A 1YIJP 3L4FA 3L73J 2E75D 3A3YB 3L72J 4XFJA 4QDDA 2L5GB 1YQ3C 1T2KC 4D6TD 2FFDB 4U3FD 3H1HD 4LGDE 3V2NA 2AEMA 3BATA 2NUMA 2AXTH 1WQLA 1EQ7A 1BCCG 3H1JD 3OW2O 1BGYG 2ZVNB 3I56P 1N7SA 4ASWA 3SFDC 1NH4A 1NTZE 1GZLA 1GU4A 3CCVP 2D2CD 5APUA 3T97A 2JKVA 2M5AB 1TU3F 2XNDH 4GIFA 4EMJB 2XV5A 4D6TJ 1HGZA 1SVFA 4GOEA 2FYUE 1YQ4C 1RF1A 4HM4A 2O1JA 1W2BO 1Z56A 4GODA 4DT0A 2H7HA 2BCCG 3VOPA 3B71A 3Q1MA 1VCKA 1T6AA 2IBZG 1HF9A 1DD3A 2B89A 4P1BH 3VMYA 3M0DC 2PGDA 1SQXD 3H1IG 3S9OA 3PJSK 2Q6QA 1NTMD 4M3LA 1RE3A 4IL6E 1VQOP 1SQVK 1PZQA 1OWAA 1WRGA 3GW6A 1AV1A 2J58A 3L70J 1LTAC 5H2FH 1M1JB 4HM8A 3C1LA 1SQVG 1AA0A 3BVHA 1SQQE 2HMMA 1USDA 2R3CA 3AEFC 4PJ0E 3RGUA 2WVRA 4DJGA 1CZQA 2QJYC 1VF5C 1VQMP 2WPRA 4HKZH 4A7PA 2GBWA 3RK3B 2Q3WA 4ZKUA 4PV1D 2QA4P 4C46A 1PPJD 3CXHD 4PD4H 2JP3A 4EI2A 5KJ7C 3BASA 1JY3P 4RO0A 3VCPA 1FDIA 3AECC 3TDKA 1ZLLA 1FS0E 1LWUA 3KZIE 3G4SP 3CCSP 2QJKC 1OW7A 3H6PA 1HVVA 2HMLA 1P84D 3CCLP 3JSVC 3RL0D 2AEFA 1RIEA 4L76A 3VYIA 3U1AA 1Q81Q 1NTKG 5AW4B 2ZXXA 1HJ0A 2Y9ZA 5AW9B 5GTIE 1YI2P 1LT1A 3AEDC 3CX5H 2HMNA 1J1EC 2FY8A 4KJMA 5TJHA 1MZ9A 2NPSD 1EXIA 1KQGB 3NFQA 2ZYAA 1MFTA 3MGNA 1N73B 1KILA 2P1JA 1SQPJ 1LTGC 3VCAA 1N73A 4P1CH 2HLOA 2BMRA 5AEWA 3AEBC 3I5CA 5CJ0A 1FDOA 4NBBD 2HG5D 1K05A 2E76C 2N1TD 1A02J 3VTPC 3HUSB 3FX0A 2Q5UA 1PP9E 2XNXA 4JPZB 3RL0g 3WUTA 4UB6H 4HM2A 2R5DA 1URQA 5AW1B 2Z5IA 2ZJSE 1Q82Q 2K37A 3L74D 2W27A 3W67A 2YVJB 3VMGD 5KAFH 1LWUC 3NTNA 1K8AQ 3CCUP 2YKQA 2QVAA 2M3BA 5AW8B 3D6ZA 5CBNA 2C9NY 4GOFA 2H43A 1SQXK 3A0HH 2VRSA 4WY4C 1FJKA 1VQ4P 5AVUB 3H1HE 3GG2A 1SQXG 2D2CC 3WU2H 2ZXEB 1BSNA 1NAYA 1NTKJ 3DQYA 1EDKA 2KUBA 2YMKA 4CPGA 2BMOA 4L75A 5AW0B 3U59A 1LNQA 2OYIB 3B5ND 4BWNA 1J2JB 2KSEA 1S2EA 1P84E 3GMAA 1NTMJ 1PGOA 4H44C 4K35A 1LP1A 3GL0A 4H0LB 1YYCA 1GU5A 1YHQP 4Y99B 4DOJA 4UB6E 5E79E 1KQSO 3B4SA 1BE3J 1JB0J 1ZW0A 1WMKA 3P8CD 2R44A 4N78E 1D7MA 4LLHA 3GOBA 3CI9A 4L73A 1JY3N 2E42A 3C8VA 1JCCA 4U3FJ 1KYOI 5APXA 1QGKB 2ZT9B 1IJDB 3L71E 1M90Q 4LC1A 2WSFH 2B1XA 2HFED 3WU2E 4QURA 1EXJA 2KXPB 2GM4A 3GL2A 2ZT9C 1AJYA 3RK2B 2E74C 3P8MC 1SQBG 2YXQB 5GTHH 2LXCB 3JCUH 1LTJC 3HUSA 3FOUA 3KPEA 1SQBK 1JM1A 1R5LA 2WSFJ 3KXDA 2B24A 2FFDA 3WUVA 3KHUA 4Y28J 4XE5B 1OFCX 1RF0A 3GCEA 5AVRB 2E76D 1YJ9P 2KZIA 2IFMA 3HE4B 1VPCA 3SFEC 4DCKA 4N6JA 1WT6A 1VQ6P 3L75E 4NBGD 3L74G 1NU1D 3SSUA 1JOCA 1ZRTD 2OYHB 5KLVK 2BEQD 1RQUA 1H88A 2L91A 3L70E 2FFDC 4OH8B 3H1JE 1L0NK 2KSJA 4RESB 5AW7B 1KD1Q 2OYHA 3TK1A 1SFCC 3M06A 2A45H 2NPSA 2NRGA 2WQYC 1O7NA 1KILC 1M7LA 3CC2P 1M1JC 2IYPA 1LT9A 1FZCC 1HH0A 4H0LC 2DE7D 2HPCA 1FU1A 1LT9B 4K3AA 3OA7A 5KLIC 2YFJA 1GDTA 3EN1A 1OW8A 1KYOE 3L72G 1PV3A 2Z4EA 1Y47A 1BGYE 3CWBG 1J1EB 1OXZA 1L0NJ 3Q2YA 5CJ4A 4NPFX 2NVEA 1OMIA 2IBZI 4EYYQ 1LTIC 3TSIA 4IL6X 1NHLA 2YIUC 2OQQA 1N73C 3H1JG 1SQPE 1G1IA 3LIEA 3CWBE 3LW5J 4B86A 1DD4A 2WSCJ 1JCDA 2W90A 4H13C 2HMJA
chains in the Genus database with same CATH topology
4HM8A 2QPZA 1VM9A 2QSIA 2I7FA 1SQQE 2HMMA 3VMID 3AEEC 1Y9BA 3AEFC 4H13D 2E4QA 4H44D 4HM1A 2QJYC 1KQFB 1RQVA 1VF5C 3Q5PA 1VF5B 2GBWA 1VL2A 1DIPA 2Q3WA 1MKMA 2QIWA 4PV1D 2NUKA 2JP3A 4U7JA 4NBFD 2E74B 3VCPA 1FDIA 5KKZC 3G9RA 1NU1E 3AECC 4RKUJ 2IDBA 4I7ZC 2QJKC 1OW7A 4H0LD 4KT0J 2HMLA 1KILE 3H1KE 2WPVB 3EQQA 1PIXA 1RIEA 5AEUA 3D89A 3AEGC 2CKFA 3GZXA 3AEAC 1HJ0A 2MKVA 1NTME 2WSEJ 2E4PA 3AE1C 3GF3A 3ABVC 3AEDC 2HMNA 2E75C 3D6YA 3AE7C 1K04A 1G8JB 4GDOA 1EXIA 2DE6D 1KQGB 2BMQA 1EZVE 4QDFA 4U3FE 3VCAA 4P1CH 3L72E 2BMRA 5AEWA 3AEBC 1FDOA 4NBBD 4HM0A 2E76C 1K05A 1KMIZ 3GTEA 4HKVA 1PP9E 2DE5D 4YTPC 3RL0g 3Q5SA 2XSHA 4HM2A 2XRXA 3TGUE 1VF5D 4NBAD 2YVJB 4Z1MH 3VMGD 2G3AA 4AAYB 3AE3C 1KB9E 4H44B 3GZYA 3N0QA 2YFLA 1SQXE 3D6ZA 3IAOA 3AE8C 4AIVA 2GBXA 2XSOA 1ZOYC 3H1HE 1ZP0C 3L74E 4OGQB 2D2CC 1S5LX 1O7GA 3AE4C 5M1BA 3FGAD 2JZAA 1RFSA 1UUWA 3AZCA 3DQYA 2YMKA 1EG9A 2BMOA 1S1CX 4I7ZB 2NVFA 1GMJA 1ZMEC 5L8RJ 2JO1A 1P84E 2O01J 3GMAA 3D70A 4NBHD 4H44C 4HM7A 1ULIA 4YXDC 3GL0A 4H13B 1PL5A 4H0LB 2E75B 4NBDD 2NWFA 4NB8D 1JB0J 4QDCA 1PPJE 3CXHE 1WMKA 4OGQC 2E74D 4HM6A 3EWKA 3GB4A 3AE6C 4TT3H 3GOBA 2J5UA 3C8VA 2ZYLA 1Q90D 4R4MA 2ZT9B 1OW6A 3L71E 4QCKA 4QDFB 1NYHA 4PV1B 3H25A 1BCCE 4PV1C 2B1XA 2NVGA 3GLMA 2P10A 3T97B 2H88C 4QURA 1EXJA 1O7WA 2XR8A 3GL2A 2ZT9C 1AJYA 1NDOA 5KLVE 3GF7A 2E74C 1NTKE 3AE9C 1O7MA 3CX5E 2IBZE 4NB9D 2K9YA 1U57A 1FQTA 1G8KB 2HMOA 4QUPA 3FOUA 1O7PA 1Q90C 1JM1A 2WSFJ 2B24A 4HM3A 5HL4A 4Y28J 1ZRTE 3GCEA 4HM5A 2E76D 4NBCD 2FBWC 4HJLA 1BE3E 3RK3E 1L0NE 3SFEC 3D71A 3C0DA 3BCCE 1KORA 3L75E 4NBGD 1IK7A 3AE5C 1NGMB 3L73E 2E75D 2QJPC 2BEQD 1SJGA 3GKEA 4XFJA 4QDDA 1RQUA 3L70E 1YQ3C 1UIXA 3H1JE 3Q3DA 2E76B 2FYNC 1SQVE 1L0LE 3H1LE 1NYKA 2NUMA 1WQLA 2WQYC 1O7NA 1ULJA 2A06E 3SFDC 2JO6A 3R4YA 4H0LC 1NTZE 1R8EA 2HMKA 1SQBE 2D2CD 2DE7D 1TU3F 4EMJB 2FYUE 1YQ4C 5KLIC 2YFJA 4R4LA 4HM4A 3EN1A 1OW8A 1KYOE 1PV3A 4PD4E 2BEZF 2BCCE 3B71A 3Q1MA 1VCKA 4NBED 1HF9A 3Q2YA 1DD3A 2D2CB 2NZ2A 4P1BH 3IN6A 2H89C 1UUVA 2V7QJ 2NVEA 1OMIA 3H1IE 3AE2C 2ZT9D 3S9OA 4IL6X 3Q5RA 2YIUC 2OQQA 5BOKA 3O6QA 1SQPE 3VMHD 3CWBE 3LW5J 1KTMA 1DD4A 3GTSA 2FXPA 4QUQA 5CXMA 4OGQD 2YFIA 2G8YA 2WSCJ 1O7HA 4H13C 2HMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM7 A;  4HM8 A;  1EZV E;  1ULI A;  3GL0 A;  4H13 B;  4QDF A;  2QPZ A;  4H0L B;  3BCC E;  1VM9 A;  2QSI A;  2I7F A;  3L75 E;  4NBG D;  2E75 B;  1SQQ E;  2HMM A;  4U3F E;  3VMI D;  3L73 E;  4NBD D;  2E4Q A;  3VCA A;  4H13 D;  2E75 D;  2NWF A;  4H44 D;  2QJP C;  4NB8 D;  1JB0 J;  4P1C H;  1SJG A;  3GKE A;  4QDC A;  3L72 E;  2BMR A;  1PPJ E;  3CXH E;  4QDD A;  5AEW A;  4HM1 A;  3L70 E;  2QJY C;  2E74 D;  4HM6 A;  4NBB D;  3H1J E;  4HM0 A;  3GB4 A;  2E76 B;  3GOB A;  3GTE A;  2FYN C;  1VF5 B;  4HKV A;  1PP9 E;  1SQV E;  1L0L E;  3C8V A;  2DE5 D;  2GBW A;  1NYK A;  3H1L E;  2ZYL A;  2Q3W A;  2QIW A;  4PV1 D;  1Q90 D;  2XSH A;  2NUM A;  1WQL A;  2NUK A;  4HM2 A;  1O7N A;  2ZT9 B;  2XRX A;  3TGU E;  1ULJ A;  3L71 E;  4NBF D;  1VF5 D;  4QCK A;  2E74 B;  2A06 E;  4NBA D;  4QDF B;  2JO6 A;  2YVJ B;  3VMG D;  4PV1 B;  3VCP A;  5KKZ C;  1NTZ E;  1NU1 E;  1BCC E;  2HMK A;  1SQB E;  4RKU J;  2B1X A;  2NVG A;  4AAY B;  4QUR A;  2D2C D;  1O7W A;  2XR8 A;  2DE7 D;  3GL2 A;  4EMJ B;  2QJK C;  1NDO A;  5KLV E;  1KB9 E;  4H44 B;  2FYU E;  3GZY A;  3N0Q A;  1NTK E;  4KT0 J;  2YFL A;  4H0L D;  5KLI C;  1SQX E;  2HML A;  1O7M A;  2YFJ A;  3CX5 E;  3H1K E;  4HM4 A;  2WPV B;  2IBZ E;  3EN1 A;  3EQQ A;  4NB9 D;  2K9Y A;  1KYO E;  4PD4 E;  2BCC E;  1FQT A;  1G8K B;  2HMO A;  4QUP A;  4AIV A;  1RIE A;  2GBX A;  2XSO A;  1VCK A;  3FOU A;  4NBE D;  1O7P A;  5AEU A;  1Q90 C;  3H1H E;  1JM1 A;  3D89 A;  2WSF J;  2D2C B;  2CKF A;  3L74 E;  4P1B H;  2B24 A;  1UUV A;  4OGQ B;  3GZX A;  1S5L X;  2NVE A;  3H1I E;  1O7G A;  4HM3 A;  1NTM E;  2WSE J;  2E4P A;  2JZA A;  5HL4 A;  2ZT9 D;  1RFS A;  4Y28 J;  1UUW A;  4IL6 X;  3AZC A;  2YIU C;  5BOK A;  1ZRT E;  3DQY A;  1SQP E;  3VMH D;  3GCE A;  3CWB E;  1EG9 A;  4HM5 A;  2BMO A;  2E76 D;  2HMN A;  3LW5 J;  4NBC D;  4I7Z B;  2NVF A;  4HJL A;  1BE3 E;  3GTS A;  5L8R J;  4QUQ A;  1L0N E;  5CXM A;  1P84 E;  2O01 J;  4OGQ D;  2YFI A;  2WSC J;  3C0D A;  1G8J B;  2DE6 D;  4NBH D;  1O7H A;  2HMJ A;  2BMQ A; 
#chains in the Genus database with same CATH topology
 1L0L J;  1GL2 A;  3H1L J;  2AXT E;  2NPS C;  3GHG C;  2R5B A;  4H13 D;  1PPJ G;  1QL1 A;  3FWN A;  1GL2 B;  1QEX A;  4HM1 A;  1KQF B;  1SQB J;  5KLV D;  1L0L G;  3H1L G;  5AVT B;  3B5N A;  5AVY B;  4JYC A;  3Q5P A;  1S9K D;  2XU6 A;  1GL2 C;  2OAR A;  3A2A A;  2NUK A;  1L0L K;  4U7J A;  3RL0 C;  1BCC J;  1NU1 E;  4JYB A;  3E7K A;  4I7Z C;  3H1I J;  2PRR A;  5K5G B;  1N2D C;  5CCG D;  5KJ7 A;  5DJU B;  2QM8 A;  3CXH I;  1A02 F;  1Q2N A;  2WPV B;  3C9I A;  3LW5 H;  4O9B A;  1UII A;  2KK7 A;  2QJY B;  5APW A;  3M9Q A;  1PFI A;  1JY2 P;  4HH2 A;  2KZJ A;  5AEU A;  5AVZ B;  1L0L D;  3H1L D;  1VDF A;  2NPS B;  3AEG C;  3AEA C;  5C39 A;  1NTM E;  2E4P A;  3CX5 I;  1VQP P;  3GF3 A;  3PLN A;  5GTH E;  2IZ0 A;  2H8P D;  1NTM K;  1W5C E;  1K04 A;  1G8J B;  2DE6 D;  1M1J A;  1M56 D;  4QDF A;  1GK6 A;  1AFO A;  3BRT B;  1EDL A;  1S5L E;  1RE3 C;  4U3F E;  1JMB A;  1NO4 A;  2FYZ A;  3ZDM A;  5B66 E;  2YMY A;  1HGV A;  1YTZ T;  2O1K A;  1QVF O;  4HM0 A;  3H32 B;  1KMI Z;  1FOS E;  2Q9I A;  2QJP B;  4EDF A;  3Q5S A;  3H1K J;  3TGU E;  4WBA A;  1KV4 A;  2SPZ A;  2FKW B;  2IYO A;  3QH9 A;  2OYI A;  2QE7 H;  2HOD B;  1T3J A;  1KB9 I;  3CXH H;  5TIS H;  2G3A A;  2ITA A;  4AAY B;  2JWA A;  3AE3 C;  1GK4 A;  2XZR A;  5KTB A;  1K73 Q;  3N0Q A;  1E79 H;  3BRV B;  2YO2 A;  1FZG A;  3RL0 B;  1SFC A;  3EQ2 A;  4AIV A;  2GBX A;  1ZOY C;  1ZP0 C;  1JY2 O;  1EZV I;  3HUS C;  1S5L X;  2GA1 A;  5M1B A;  2Q3I A;  1RFS A;  3AZC A;  4HB1 A;  3V2Q A;  3E1R A;  4JQ0 D;  3FXE A;  3RBZ A;  1FZF A;  2Y0E A;  3VN0 A;  1JMM A;  1GMJ A;  1QLE D;  3V4Q A;  4DZO A;  2O01 J;  1G2C B;  3VMA A;  1GL2 D;  3BCC D;  4HM7 A;  3SWF A;  5AVV B;  2E75 B;  2YKO A;  4NBD D;  3MD0 A;  3CC4 P;  3V6I A;  4NB8 D;  2WIT A;  4QDC A;  4HM6 A;  1H8A A;  1IFP A;  3EWK A;  1ZR2 A;  3GB4 A;  5KLV G;  3F5H A;  3WMM 0;  3L75 J;  1RHZ B;  4HJG H;  1Q90 D;  4R4M A;  3HRN A;  1SQB D;  2WZ7 A;  1VQ8 P;  2OTL P;  2QJK B;  1URQ B;  4QCK A;  1CSB A;  4QDF B;  2KLU A;  3H25 A;  4PV1 C;  2CPS A;  1KN7 A;  1S3J A;  1K9M Q;  2H88 C;  1ZR4 A;  1S9K E;  2XR8 A;  1VQL P;  1Y8A A;  1FZC A;  1NDO A;  5KLV E;  1KYO D;  3HE5 A;  1O7M A;  1QVG O;  3B8E B;  2C0W A;  3H32 A;  3HD7 B;  1HJB A;  2HMO A;  3L36 A;  2WSS H;  1QL2 A;  5APS A;  1O7P A;  3MTU E;  2E43 A;  1NU1 K;  3HD7 A;  1H0T A;  3L75 G;  5HL4 A;  2CPB A;  1SQX J;  1LTT C;  2KNC B;  3L70 G;  1H0T B;  1NU1 G;  1KC8 Q;  3A0B H;  2GUS A;  5KKZ B;  2KIK A;  3RK3 E;  1L0N E;  2KNC A;  3QWO C;  1FDM A;  1U7M A;  2RMZ A;  3D71 A;  4L74 A;  2Y9Y A;  3L70 D;  4NPD A;  4XA4 A;  1URQ C;  1SLQ A;  1CI6 B;  1OX3 A;  2C0X A;  3CCM P;  1EDI A;  3AE5 C;  1NGM B;  3F89 A;  4I1L A;  5KAF E;  1OIP A;  1IK9 A;  2M3E A;  3MHV A;  1NKN A;  2IFN A;  1UIX A;  3A7O A;  1IFN A;  3KQG A;  3OJA B;  2ZAE B;  2E76 B;  2FYN C;  1GW4 A;  1L0L E;  3H1L E;  1NYK A;  2YO3 A;  3K5B A;  1T3U A;  1SQP K;  1OZH A;  3R4Y A;  3TGU G;  1SQB E;  2O01 H;  2WMM A;  4N3Y B;  4R4L A;  3N7N A;  3SWK A;  2I1K A;  2BEZ F;  1P84 H;  3M9H A;  2HYN A;  3CCE P;  1NU1 J;  2E5Y A;  3L73 D;  4U3F G;  2NZ2 A;  3IN6 A;  2H89 C;  1UUV A;  5AVX B;  2V7Q J;  5CMZ A;  3H1I E;  3AE2 C;  3CME P;  2ZT9 D;  3KZI H;  1RY3 A;  3BCC J;  1AQ5 A;  3Q5R A;  2HR3 A;  5BOK A;  1KB9 H;  5DJT B;  1SS1 A;  3VMH D;  1JM0 A;  3CWB J;  1MV8 A;  1MFZ A;  2XKM A;  5BU5 A;  2J59 M;  4QUQ A;  3L73 G;  3ITK A;  4OGQ D;  1IFD A;  2YFI A;  1PGQ A;  2G8Y A;  3VP8 A;  2CK3 H;  1LT9 C;  1IFJ A;  1O7H A;  1Q86 Q;  2A45 I;  2QPZ A;  1OVV A;  1GTW A;  1VM9 A;  2QSI A;  2I7F A;  1JNM A;  3I55 P;  2YXR B;  1NTZ D;  5GTI H;  2I8D A;  2FXO A;  3L75 D;  2E4Q A;  1Y9B A;  1HTL C;  4H44 D;  2Q1K A;  2B9B A;  3TNU B;  2RKL A;  3CCJ P;  1DIP A;  3O6Q B;  2QIW A;  2W6A A;  4UB8 E;  3KDP B;  1R5S A;  2YNY A;  1AVO A;  2Y0D A;  3L71 J;  2Z5H A;  2E74 B;  3FWL A;  2A45 G;  3G9R A;  4YXW H;  2IDB A;  2M0B A;  2ZYG A;  2R3S A;  1KQL A;  1SQV J;  4AUW A;  1RE4 C;  3II6 A;  4TLF A;  3PRJ A;  4KT0 J;  1KIL E;  3H1K E;  1ZXG A;  3IFM A;  2OTK E;  1URQ D;  3B5N C;  2B87 A;  1BGY D;  2BAS A;  1NJI Q;  2MKV A;  5APY A;  1ZN5 A;  1RF1 C;  1IO4 A;  3ABV C;  1G1J A;  1SQV D;  4HYT B;  3S4R A;  2IZ1 A;  2E75 C;  3MUD A;  3V2R A;  2W8Z A;  5AW2 B;  4ZMD A;  5KLI B;  1E5W A;  2HOD A;  2KP8 A;  2BMQ A;  1EZV E;  4AQR D;  2POH A;  2AEJ A;  2O3J A;  2OYH C;  3L72 E;  1L4A B;  2Q7C A;  1NTK D;  5APT A;  2JR8 A;  4IFD K;  5CCG C;  2K9J B;  1PGP A;  3B5N B;  2DE5 D;  4YTP C;  2XSH A;  1QX8 A;  2XRX A;  2LR2 A;  1KYO H;  4GT1 A;  2IPP A;  2K1A A;  1VF5 D;  4NBA D;  2QM7 A;  4ZKP A;  1G2C A;  2KS1 B;  3EFF K;  5CCH A;  1N7S C;  1KFM A;  1SQX E;  4IL6 H;  1T8Z A;  2W6B A;  5KAI H;  3L72 D;  3IAO A;  2YIU B;  1L2P A;  1BDC A;  1CW5 A;  3RK3 C;  3CC7 P;  4OGQ B;  2XDJ A;  2JZA A;  3PHL A;  5KLV J;  1UUW A;  2W6J H;  1L0N D;  3RK3 D;  1FBM A;  4PJ0 H;  5L8R J;  4W80 A;  1JEK A;  3FXD A;  3RK2 C;  3V5B A;  3P7K A;  3H1K D;  3TYY A;  1KB9 D;  2V7Q H;  4YXD C;  4H13 B;  1X22 A;  1PL5 A;  1FZC B;  4WB4 A;  5BVZ A;  4UB8 H;  3HE5 B;  2B87 B;  4ASV A;  2JEE A;  2FYU K;  3V2P A;  5CCH D;  4WWI A;  2P2U A;  1PPJ E;  3CXH E;  3JC2 2;  2PFX A;  2QG4 A;  2E74 D;  3L71 D;  5AW6 B;  1RH5 B;  3AE6 C;  5H2F E;  2BCC D;  2ZVO B;  3A0H E;  3W68 A;  1EDJ A;  3G71 P;  1YIT P;  2IX7 C;  1U7J A;  2KB7 P;  3L71 G;  1YJW P;  4PV1 B;  3CCQ P;  1IFI A;  1T2K D;  1SQP G;  1DX7 A;  2FXM A;  3T97 B;  2M5A A;  1O7W A;  4ZNC A;  2P58 A;  3HTK A;  2P7J A;  1JY3 O;  3GF7 A;  4PD4 D;  4RJT A;  1CI6 A;  3CX5 E;  1NVO A;  2QEX P;  1NKZ B;  4NB9 D;  1VQK P;  1BDD A;  1GW3 A;  3HTK B;  3MZW B;  2ZYD A;  1FQT A;  1G8K B;  1W2E A;  2K9J A;  1SFC B;  3L37 A;  4WY4 A;  4HM3 A;  4WY4 D;  1ZRT E;  1SP4 A;  1X79 B;  1PP9 D;  3RBX A;  4HM5 A;  4IOI H;  2V4H A;  1BCC D;  1BE3 G;  4HJL A;  2W83 C;  3NXS A;  4PD4 I;  1J1D B;  1FC2 C;  3L74 J;  3C0D A;  2DW3 A;  3OAK A;  2ZFC A;  1JY2 N;  3BCC E;  3HD7 D;  3KYQ A;  3SWY A;  3M91 A;  3E1I A;  2C9L Y;  2KYV A;  1OVU A;  3L73 E;  1VQ5 P;  2QJP C;  1SJG A;  3GKE A;  5AVQ B;  1XTC C;  1ZV8 A;  1VQN P;  1FE6 A;  1VQ7 P;  2KI7 B;  2YKP A;  4IFF A;  3UIA A;  3Q3D A;  1HUC A;  1SQV E;  3GHG A;  2R32 A;  5AVW B;  3TGU J;  1S5L H;  1ULJ A;  1NAF A;  2A06 E;  4AYC A;  2JO6 A;  2RN0 A;  1R8E A;  1SQQ G;  2HMK A;  5B66 H;  4W7Y A;  4JBZ A;  3IF4 A;  5APQ A;  1SQQ K;  3CL3 D;  1L4A D;  3RK2 D;  1X0T A;  2WPS A;  1Q7Y Q;  4PD4 E;  1DEE G;  2BCC E;  3USS A;  3TNU A;  1FJP A;  4NBE D;  2D2C B;  1NWQ A;  2N9Y B;  1NTZ K;  1IFM A;  1PGJ A;  5E79 H;  3MIW A;  3O6Q A;  3CCR P;  1NTZ G;  1DH3 A;  5KAI E;  1KTM A;  2OYO A;  3GTS A;  4N78 D;  2FXP A;  5CXM A;  3H1K G;  4OWF A;  3P8C E;  2O01 N;  4BRY B;  1NTM G;  2FYN B;  1YTZ I;  1M8O B;  2KOG A;  3VMI D;  1L0N G;  3AEE C;  3U1C A;  4BRY A;  3L35 A;  1YJN P;  2IBZ D;  2LKM A;  2WSC H;  1KZU B;  2AXC A;  2WPQ A;  1RQV A;  3PTZ A;  1VF5 B;  3EFG A;  1VL2 A;  1MKM A;  3M0A A;  2PP6 A;  3JCU E;  1J1D C;  5B5E E;  4NBF D;  1N86 A;  1RE4 A;  1X8Y A;  1LGH B;  1HBW A;  1H89 A;  1USE A;  5KKZ C;  4RKU J;  3V4W A;  4BXL A;  4OVN F;  3CWB D;  1SFC D;  2OYI C;  3MP7 B;  1JTH B;  1EZV D;  1X9V A;  4H0L D;  2WT7 B;  2Y0C A;  1AQT A;  1XTG B;  1MUU A;  5AVS B;  3H1H G;  3A0B E;  3EQQ A;  1NTK K;  2OTJ P;  3HD7 C;  5CCG A;  2WT7 A;  1PIX A;  1NTZ J;  1L4A A;  2JDI H;  3GHG B;  4C7N B;  3D89 A;  1LTB C;  2CKF A;  3CD6 P;  5APV A;  3GZX A;  3CPW O;  4EOT A;  2WSE J;  3AE1 C;  4D6T E;  2FYU J;  1P84 I;  4C7N A;  3CLQ A;  1SQQ J;  3IR9 A;  4WVZ A;  1NOH A;  3D6Y A;  2N1T B;  1OVR A;  2MJZ A;  3VMX A;  3AE7 C;  2B88 A;  5CBO A;  4GDO A;  1FZA A;  1LWU B;  1LP1 B;  4QMA A;  1EC5 A;  3VP9 A;  3G3Z A;  2JWD A;  4I6M C;  4I2L C;  2A06 G;  3TGU D;  1IC2 A;  3CX5 D;  3PH0 A;  3H1J J;  4JF7 A;  2QRX A;  1KIL D;  1VQ9 P;  2FYU G;  4D6T G;  5KJ7 D;  1FZB A;  1HWT C;  2OGU A;  3GTE A;  4HKV A;  4Z1M H;  2RH0 A;  3A5T A;  1SQQ D;  3BCC G;  1KIL B;  1KB9 E;  4H44 B;  3GZY A;  2YFL A;  1M1K Q;  5AW3 B;  2A06 D;  4W7Z A;  1AVY A;  3CMA P;  1N7L A;  3AE8 C;  1BGY J;  2XSO A;  2LXB A;  1M57 D;  3L74 E;  1O7G A;  3AE4 C;  3FGA D;  3PP5 A;  1LTS C;  1S4X A;  1N8R Q;  1EG9 A;  3HE4 A;  1S1C X;  4I7Z B;  2NVF A;  1LJ2 A;  1ZME C;  2JO1 A;  1JTH A;  4YPC A;  3D70 A;  4NBH D;  1N7S B;  1ULI A;  1PP9 G;  1FAV A;  2PAJ A;  3H1I D;  5CHX A;  1RF0 C;  5B5E H;  2N1T C;  2NWF A;  2KLV A;  5TIS E;  2WTY A;  1RF1 B;  4OGQ C;  1LTJ B;  3M0D A;  2E5T A;  2N9B A;  4NPE A;  1GD2 E;  4TT3 H;  4IFM A;  4WY4 B;  2N1T A;  2J5U A;  1N7S D;  1LTJ A;  2ZYL A;  3NMD A;  4C7R A;  3R2P A;  1OW6 A;  5BU8 B;  3P32 A;  2Q3E A;  1NYH A;  3O8Z A;  2GUV A;  3S1K A;  1BCC E;  4EIJ A;  2NVG A;  3GLM A;  2P10 A;  2KS1 A;  2HPC B;  1BSH A;  2K88 A;  3MUD C;  1EZV G;  1PP9 J;  4GKG A;  4KHX A;  2I1J A;  1NTK E;  3AE9 C;  1DEB A;  1FOS F;  3M9B A;  2FYU D;  2IBZ E;  2K9Y A;  2P67 A;  2WWW A;  2UWJ E;  1U57 A;  4QUP A;  2M8R A;  1Q90 C;  3WUU A;  2JJL A;  1L4A C;  1IZN B;  3TF5 A;  5EFW B;  1KFN A;  1FZE A;  2WSE H;  5AW5 B;  2K3R A;  4MN4 C;  1S72 P;  4Y99 C;  3VMZ A;  3LID A;  4NBC D;  5CCH C;  2FBW C;  2BCC J;  3G6E P;  1BE3 E;  1JO5 A;  1SQP D;  3H1H J;  1YBK A;  1JUN A;  3N4X A;  1KOR A;  1BE3 D;  1IK7 A;  1YIJ P;  3L4F A;  3L73 J;  2E75 D;  3A3Y B;  3L72 J;  4XFJ A;  4QDD A;  2L5G B;  1YQ3 C;  1T2K C;  4D6T D;  2FFD B;  4U3F D;  3H1H D;  4LGD E;  3V2N A;  2AEM A;  3BAT A;  2NUM A;  2AXT H;  1WQL A;  1EQ7 A;  1BCC G;  3H1J D;  3OW2 O;  1BGY G;  2ZVN B;  3I56 P;  1N7S A;  4ASW A;  3SFD C;  1NH4 A;  1NTZ E;  1GZL A;  1GU4 A;  3CCV P;  2D2C D;  5APU A;  3T97 A;  2JKV A;  2M5A B;  1TU3 F;  2XND H;  4GIF A;  4EMJ B;  2XV5 A;  4D6T J;  1HGZ A;  1SVF A;  4GOE A;  2FYU E;  1YQ4 C;  1RF1 A;  4HM4 A;  2O1J A;  1W2B O;  1Z56 A;  4GOD A;  4DT0 A;  2H7H A;  2BCC G;  3VOP A;  3B71 A;  3Q1M A;  1VCK A;  1T6A A;  2IBZ G;  1HF9 A;  1DD3 A;  2B89 A;  4P1B H;  3VMY A;  3M0D C;  2PGD A;  1SQX D;  3H1I G;  3S9O A;  3PJS K;  2Q6Q A;  1NTM D;  4M3L A;  1RE3 A;  4IL6 E;  1VQO P;  1SQV K;  1PZQ A;  1OWA A;  1WRG A;  3GW6 A;  1AV1 A;  2J58 A;  3L70 J;  1LTA C;  5H2F H;  1M1J B;  4HM8 A;  3C1L A;  1SQV G;  1AA0 A;  3BVH A;  1SQQ E;  2HMM A;  1USD A;  2R3C A;  3AEF C;  4PJ0 E;  3RGU A;  2WVR A;  4DJG A;  1CZQ A;  2QJY C;  1VF5 C;  1VQM P;  2WPR A;  4HKZ H;  4A7P A;  2GBW A;  3RK3 B;  2Q3W A;  4ZKU A;  4PV1 D;  2QA4 P;  4C46 A;  1PPJ D;  3CXH D;  4PD4 H;  2JP3 A;  4EI2 A;  5KJ7 C;  3BAS A;  1JY3 P;  4RO0 A;  3VCP A;  1FDI A;  3AEC C;  3TDK A;  1ZLL A;  1FS0 E;  1LWU A;  3KZI E;  3G4S P;  3CCS P;  2QJK C;  1OW7 A;  3H6P A;  1HVV A;  2HML A;  1P84 D;  3CCL P;  3JSV C;  3RL0 D;  2AEF A;  1RIE A;  4L76 A;  3VYI A;  3U1A A;  1Q81 Q;  1NTK G;  5AW4 B;  2ZXX A;  1HJ0 A;  2Y9Z A;  5AW9 B;  5GTI E;  1YI2 P;  1LT1 A;  3AED C;  3CX5 H;  2HMN A;  1J1E C;  2FY8 A;  4KJM A;  5TJH A;  1MZ9 A;  2NPS D;  1EXI A;  1KQG B;  3NFQ A;  2ZYA A;  1MFT A;  3MGN A;  1N73 B;  1KIL A;  2P1J A;  1SQP J;  1LTG C;  3VCA A;  1N73 A;  4P1C H;  2HLO A;  2BMR A;  5AEW A;  3AEB C;  3I5C A;  5CJ0 A;  1FDO A;  4NBB D;  2HG5 D;  1K05 A;  2E76 C;  2N1T D;  1A02 J;  3VTP C;  3HUS B;  3FX0 A;  2Q5U A;  1PP9 E;  2XNX A;  4JPZ B;  3RL0 g;  3WUT A;  4UB6 H;  4HM2 A;  2R5D A;  1URQ A;  5AW1 B;  2Z5I A;  2ZJS E;  1Q82 Q;  2K37 A;  3L74 D;  2W27 A;  3W67 A;  2YVJ B;  3VMG D;  5KAF H;  1LWU C;  3NTN A;  1K8A Q;  3CCU P;  2YKQ A;  2QVA A;  2M3B A;  5AW8 B;  3D6Z A;  5CBN A;  2C9N Y;  4GOF A;  2H43 A;  1SQX K;  3A0H H;  2VRS A;  4WY4 C;  1FJK A;  1VQ4 P;  5AVU B;  3H1H E;  3GG2 A;  1SQX G;  2D2C C;  3WU2 H;  2ZXE B;  1BSN A;  1NAY A;  1NTK J;  3DQY A;  1EDK A;  2KUB A;  2YMK A;  4CPG A;  2BMO A;  4L75 A;  5AW0 B;  3U59 A;  1LNQ A;  2OYI B;  3B5N D;  4BWN A;  1J2J B;  2KSE A;  1S2E A;  1P84 E;  3GMA A;  1NTM J;  1PGO A;  4H44 C;  4K35 A;  1LP1 A;  3GL0 A;  4H0L B;  1YYC A;  1GU5 A;  1YHQ P;  4Y99 B;  4DOJ A;  4UB6 E;  5E79 E;  1KQS O;  3B4S A;  1BE3 J;  1JB0 J;  1ZW0 A;  1WMK A;  3P8C D;  2R44 A;  4N78 E;  1D7M A;  4LLH A;  3GOB A;  3CI9 A;  4L73 A;  1JY3 N;  2E42 A;  3C8V A;  1JCC A;  4U3F J;  1KYO I;  5APX A;  1QGK B;  2ZT9 B;  1IJD B;  3L71 E;  1M90 Q;  4LC1 A;  2WSF H;  2B1X A;  2HFE D;  3WU2 E;  4QUR A;  1EXJ A;  2KXP B;  2GM4 A;  3GL2 A;  2ZT9 C;  1AJY A;  3RK2 B;  2E74 C;  3P8M C;  1SQB G;  2YXQ B;  5GTH H;  2LXC B;  3JCU H;  1LTJ C;  3HUS A;  3FOU A;  3KPE A;  1SQB K;  1JM1 A;  1R5L A;  2WSF J;  3KXD A;  2B24 A;  2FFD A;  3WUV A;  3KHU A;  4Y28 J;  4XE5 B;  1OFC X;  1RF0 A;  3GCE A;  5AVR B;  2E76 D;  1YJ9 P;  2KZI A;  2IFM A;  3HE4 B;  1VPC A;  3SFE C;  4DCK A;  4N6J A;  1WT6 A;  1VQ6 P;  3L75 E;  4NBG D;  3L74 G;  1NU1 D;  3SSU A;  1JOC A;  1ZRT D;  2OYH B;  5KLV K;  2BEQ D;  1RQU A;  1H88 A;  2L91 A;  3L70 E;  2FFD C;  4OH8 B;  3H1J E;  1L0N K;  2KSJ A;  4RES B;  5AW7 B;  1KD1 Q;  2OYH A;  3TK1 A;  1SFC C;  3M06 A;  2A45 H;  2NPS A;  2NRG A;  2WQY C;  1O7N A;  1KIL C;  1M7L A;  3CC2 P;  1M1J C;  2IYP A;  1LT9 A;  1FZC C;  1HH0 A;  4H0L C;  2DE7 D;  2HPC A;  1FU1 A;  1LT9 B;  4K3A A;  3OA7 A;  5KLI C;  2YFJ A;  1GDT A;  3EN1 A;  1OW8 A;  1KYO E;  3L72 G;  1PV3 A;  2Z4E A;  1Y47 A;  1BGY E;  3CWB G;  1J1E B;  1OXZ A;  1L0N J;  3Q2Y A;  5CJ4 A;  4NPF X;  2NVE A;  1OMI A;  2IBZ I;  4EYY Q;  1LTI C;  3TSI A;  4IL6 X;  1NHL A;  2YIU C;  2OQQ A;  1N73 C;  3H1J G;  1SQP E;  1G1I A;  3LIE A;  3CWB E;  3LW5 J;  4B86 A;  1DD4 A;  2WSC J;  1JCD A;  2W90 A;  4H13 C;  2HMJ A; 
#chains in the Genus database with same CATH homology
 4HM8 A;  2QPZ A;  1VM9 A;  2QSI A;  2I7F A;  1SQQ E;  2HMM A;  3VMI D;  3AEE C;  1Y9B A;  3AEF C;  4H13 D;  2E4Q A;  4H44 D;  4HM1 A;  2QJY C;  1KQF B;  1RQV A;  1VF5 C;  3Q5P A;  1VF5 B;  2GBW A;  1VL2 A;  1DIP A;  2Q3W A;  1MKM A;  2QIW A;  4PV1 D;  2NUK A;  2JP3 A;  4U7J A;  4NBF D;  2E74 B;  3VCP A;  1FDI A;  5KKZ C;  3G9R A;  1NU1 E;  3AEC C;  4RKU J;  2IDB A;  4I7Z C;  2QJK C;  1OW7 A;  4H0L D;  4KT0 J;  2HML A;  1KIL E;  3H1K E;  2WPV B;  3EQQ A;  1PIX A;  1RIE A;  5AEU A;  3D89 A;  3AEG C;  2CKF A;  3GZX A;  3AEA C;  1HJ0 A;  2MKV A;  1NTM E;  2WSE J;  2E4P A;  3AE1 C;  3GF3 A;  3ABV C;  3AED C;  2HMN A;  2E75 C;  3D6Y A;  3AE7 C;  1K04 A;  1G8J B;  4GDO A;  1EXI A;  2DE6 D;  1KQG B;  2BMQ A;  1EZV E;  4QDF A;  4U3F E;  3VCA A;  4P1C H;  3L72 E;  2BMR A;  5AEW A;  3AEB C;  1FDO A;  4NBB D;  4HM0 A;  2E76 C;  1K05 A;  1KMI Z;  3GTE A;  4HKV A;  1PP9 E;  2DE5 D;  4YTP C;  3RL0 g;  3Q5S A;  2XSH A;  4HM2 A;  2XRX A;  3TGU E;  1VF5 D;  4NBA D;  2YVJ B;  4Z1M H;  3VMG D;  2G3A A;  4AAY B;  3AE3 C;  1KB9 E;  4H44 B;  3GZY A;  3N0Q A;  2YFL A;  1SQX E;  3D6Z A;  3IAO A;  3AE8 C;  4AIV A;  2GBX A;  2XSO A;  1ZOY C;  3H1H E;  1ZP0 C;  3L74 E;  4OGQ B;  2D2C C;  1S5L X;  1O7G A;  3AE4 C;  5M1B A;  3FGA D;  2JZA A;  1RFS A;  1UUW A;  3AZC A;  3DQY A;  2YMK A;  1EG9 A;  2BMO A;  1S1C X;  4I7Z B;  2NVF A;  1GMJ A;  1ZME C;  5L8R J;  2JO1 A;  1P84 E;  2O01 J;  3GMA A;  3D70 A;  4NBH D;  4H44 C;  4HM7 A;  1ULI A;  4YXD C;  3GL0 A;  4H13 B;  1PL5 A;  4H0L B;  2E75 B;  4NBD D;  2NWF A;  4NB8 D;  1JB0 J;  4QDC A;  1PPJ E;  3CXH E;  1WMK A;  4OGQ C;  2E74 D;  4HM6 A;  3EWK A;  3GB4 A;  3AE6 C;  4TT3 H;  3GOB A;  2J5U A;  3C8V A;  2ZYL A;  1Q90 D;  4R4M A;  2ZT9 B;  1OW6 A;  3L71 E;  4QCK A;  4QDF B;  1NYH A;  4PV1 B;  3H25 A;  1BCC E;  4PV1 C;  2B1X A;  2NVG A;  3GLM A;  2P10 A;  3T97 B;  2H88 C;  4QUR A;  1EXJ A;  1O7W A;  2XR8 A;  3GL2 A;  2ZT9 C;  1AJY A;  1NDO A;  5KLV E;  3GF7 A;  2E74 C;  1NTK E;  3AE9 C;  1O7M A;  3CX5 E;  2IBZ E;  4NB9 D;  2K9Y A;  1U57 A;  1FQT A;  1G8K B;  2HMO A;  4QUP A;  3FOU A;  1O7P A;  1Q90 C;  1JM1 A;  2WSF J;  2B24 A;  4HM3 A;  5HL4 A;  4Y28 J;  1ZRT E;  3GCE A;  4HM5 A;  2E76 D;  4NBC D;  2FBW C;  4HJL A;  1BE3 E;  3RK3 E;  1L0N E;  3SFE C;  3D71 A;  3C0D A;  3BCC E;  1KOR A;  3L75 E;  4NBG D;  1IK7 A;  3AE5 C;  1NGM B;  3L73 E;  2E75 D;  2QJP C;  2BEQ D;  1SJG A;  3GKE A;  4XFJ A;  4QDD A;  1RQU A;  3L70 E;  1YQ3 C;  1UIX A;  3H1J E;  3Q3D A;  2E76 B;  2FYN C;  1SQV E;  1L0L E;  3H1L E;  1NYK A;  2NUM A;  1WQL A;  2WQY C;  1O7N A;  1ULJ A;  2A06 E;  3SFD C;  2JO6 A;  3R4Y A;  4H0L C;  1NTZ E;  1R8E A;  2HMK A;  1SQB E;  2D2C D;  2DE7 D;  1TU3 F;  4EMJ B;  2FYU E;  1YQ4 C;  5KLI C;  2YFJ A;  4R4L A;  4HM4 A;  3EN1 A;  1OW8 A;  1KYO E;  1PV3 A;  4PD4 E;  2BEZ F;  2BCC E;  3B71 A;  3Q1M A;  1VCK A;  4NBE D;  1HF9 A;  3Q2Y A;  1DD3 A;  2D2C B;  2NZ2 A;  4P1B H;  3IN6 A;  2H89 C;  1UUV A;  2V7Q J;  2NVE A;  1OMI A;  3H1I E;  3AE2 C;  2ZT9 D;  3S9O A;  4IL6 X;  3Q5R A;  2YIU C;  2OQQ A;  5BOK A;  3O6Q A;  1SQP E;  3VMH D;  3CWB E;  3LW5 J;  1KTM A;  1DD4 A;  3GTS A;  2FXP A;  4QUQ A;  5CXM A;  4OGQ D;  2YFI A;  2G8Y A;  2WSC J;  1O7H A;  4H13 C;  2HMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...