2YIUC

X-ray structure of the dimeric cytochrome bc1 complex from the soil bacterium paracoccus denitrificans at 2.7 angstrom resolution
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
DFLYYATAGAGTVAAGAAAWTLVNQMNPSADVQALASIQVDVSGVETGTQLTVKWLGKPVFIRRRTEDEIQAGREVDLGQLIDRSAQNSNKPDAPATDENRTMDEAGEWLVMIGVCTHLGCVPIGDGAGDFGGWFCPCHGSHYDTSGRIRRGPAPQNLHIPVAEFLDDTTIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME B
publication title X-Ray Structure of the Dimeric Cytochrome Bc(1) Complex from the Soil Bacterium Paracoccus Denitrificans at 2.7-A Resolution.
pubmed doi rcsb
total genus 48
structure length 174
sequence length 174
chains with identical sequence F
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2yiuC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2yiuC02
4P1CH 2B24A 4NBAD 1L0NE 4PD4E 4H44D 3C0DA 2XSHA 1O7WA 2NUKA 4NB9D 1UUWA 1ZRTE 2HMMA 2WSCJ 4H0LB 1O7MA 3GTSA 3L70E 1EZVE 3H1KE 1PPJE 2HMJA 3L72E 2QJKC 1FQTA 1BE3E 2XSOA 4HKVA 4QDDA 2WSFJ 2YIUC 4I7ZB 4QUQA 5CXMA 1SQPE 3TGUE 2BCCE 3VMHD 4H44B 4HM2A 2GBWA 4U3FE 3D89A 2JZAA 2I7FA 3L75E 4H13D 3EQQA 4HM1A 4HM8A 4QDCA 2DE6D 5KKZC 1L0LE 3GKEA 2BMQA 3GL2A 3CWBE 4NBHD 1ULIA 3FOUA 2QIWA 4HM4A 3GZYA 5KLIC 2E75D 2NVEA 4QCKA 2IBZE 4QUPA 1SQQE 2QJPC 1NDOA 3CX5E 3GTEA 1SQVE 4H13B 2HMOA 4HM6A 2BMOA 4NBDD 2E76B 1JM1A 2QPZA 3VMGD 2WSEJ 3N0QA 2E75B 2WPVB 1G8KB 3GZXA 2JO6A 2NVFA 1Q90C 4HM3A 4NBFD 5AEWA 4QDFB 5KLVE 1UUVA 1NTME 2NVGA 3GB4A 1NU1E 1SQXE 2A06E 3H1HE 2NWFA 2O01J 1KB9E 1P84E 2E74D 2YFLA 2NUMA 4NBBD 4Y28J 4PV1D 1JB0J 4OGQD 1VCKA 3GOBA 3AZCA 2E4PA 2HMNA 4HM0A 2FYNC 1VF5D 3CXHE 3L71E 2E4QA 4EMJB 3VCAA 4QURA 2QSIA 2ZT9D 1NTKE 1O7NA 3LW5J 1SJGA 2E74B 4PV1B 1WQLA 4IL6X 4OGQB 3L74E 2Q3WA 5BOKA 4NBGD 1O7HA 3L73E 1VM9A 4HJLA 2XRXA 3H1IE 1EG9A 1O7GA 2QJYC 1BCCE 2YFIA 4QDFA 2K9YA 3BCCE 2CKFA 4NBCD 3VCPA 1VF5B 2BMRA 3GCEA 2GBXA 4KT0J 1SQBE 2ZT9B 4RKUJ 3GL0A 4P1BH 1KYOE 1NYKA 4NB8D 1S5LX 1Q90D 2D2CD 1RIEA 1NTZE 5HL4A 2HMLA 2DE5D 1ULJA 2HMKA 4HM5A 3C8VA 1O7PA 1RFSA 2YVJB 2DE7D 4H0LD 2ZYLA 3VMID 1G8JB 2YFJA 4HM7A 3DQYA 2FYUE 3EN1A 4AIVA 5AEUA 2B1XA 3H1LE 2XR8A 1PP9E 4NBED 4AAYB 3H1JE 5L8RJ 2D2CB 2E76D
chains in the Genus database with same CATH superfamily
3Q5SA 4I1LA 1K05A 3GTSA 3HUSA 5CJ0A 3H32B 1RF0C 4BRYB 1SQPK 4I7ZB 1SQPE 3BCCJ 1XTCC 3WUUA 3D89A 1N73B 3AE7C 3MHVA 2I7FA 1VQPP 4WY4C 3GKEA 2BMQA 1VQ5P 1QL1A 1P84D 2N9YB 3GHGB 3GHGA 4QUPA 4PJ0E 1FDOA 3GTEA 1KILA 2HMOA 3GLMA 4EI2A 1NJIQ 5DJTB 2OYIB 2WMMA 1JM1A 3CI9A 1FJKA 1IFJA 3NFQA 3GZXA 2PRRA 1KB9E 2QA4P 4N78D 2KK7A 1NKNA 1RY3A 3C1LA 3CCUP 3L75J 2HLOA 4KHXA 1TU3F 4GOFA 3V2QA 3PJSK 3VTPC 1JM0A 3KXDA 1NTKG 3LW5J 1VL2A 5KAIE 3TYYA 1KTMA 5AW7B 3BRVB 3H1IG 3CX5I 1BCCG 5KKZB 3CXHI 2ZYDA 2Q1KA 4P1BH 1CSBA 4DJGA 1IFDA 3TNUA 2Z5HA 4PD4H 3TGUD 1IK7A 2M0BA 4YXDC 2FYUG 1EDJA 2XR8A 1PP9E 3H1JG 2KS1B 1URQC 2XSHA 1YYCA 1ZRTE 2HMJA 3CCRP 1JY2O 1BE3E 3EWKA 3W67A 1LTTC 4CPGA 3S1KA 4HM2A 3M9HA 4U3FG 2OARA 4NBHD 1K04A 2WZ7A 3IN6A 3VYIA 2NVEA 2OYHC 2SPZA 4HM6A 1M7LA 2ZYGA 1P84H 2WT7A 2NVFA 2Q3EA 2ZVNB 4WVZA 5AEWA 2ZYAA 4GKGA 2Y0CA 4EDFA 3BCCD 2JDIH 2NUMA 1R8EA 4C7NB 1X8YA 4WY4D 5AW0B 3U59A 3G6EP 3CXHE 5GTHE 3IAOA 1NTMK 5BOKA 3RGUA 4JPZB 4AQRD 1SQBE 2IDBA 1NTZG 3HRNA 2MKVA 4MN4C 5GTIH 4RJTA 5APSA 5CMZA 4L76A 1BDDA 2O01H 2LXBA 5AVQB 1G1JA 1N8RQ 1PPJE 3L72E 4I6MC 4B86A 3L73J 3S4RA 1W5CE 1SQPG 4PV1C 3AE1C 3B5NB 1LJ2A 2ZVOB 1L0LE 1VF5C 1L0NK 1FAVA 2W90A 2FFDC 3VP8A 1M8OB 3VOPA 4GT1A 3M0AA 1URQD 1OVUA 1M90Q 3NMDA 5H2FH 1N2DC 2QG4A 1Q90C 2AXTH 4NBFD 1OW8A 3M0DC 1FC2C 1VQLP 3U1AA 3FXEA 2G8YA 2LXCB 4I7ZC 3AE2C 3BASA 2QJKB 3L71E 1Q2NA 1A02J 3GW6A 5K5GB 3L4FA 2P7JA 1N73C 4L74A 1M57D 1LP1A 3L74E 1KQLA 1Q86Q 2Q3WA 1SQQJ 4RO0A 1KN7A 2YO2A 1PGJA 5TISE 1BSNA 3GHGC 1IZNB 3I56P 2OYIC 1QLED 2QVAA 2HMKA 3C8VA 3TDKA 1RFSA 3VMID 2PGDA 2P10A 2B1XA 3H1LE 1VPCA 1PP9G 5CHXA 1RF1B 3E1RA 3B4SA 1UIIA 2M3EA 2VRSA 3D71A 3H1KE 2IBZD 1R5SA 1NOHA 3P8CE 3BRTB 4XFJA 1EQ7A 2HFED 3LW5H 3KHUA 2DW3A 1QEXA 1NH4A 1KYOI 5B66H 5KKZC 2QIWA 3M9QA 3GZYA 1EXIA 3AE3C 3VMXA 2HPCB 3N0QA 4YPCA 3BATA 3HE5A 4EYYQ 5KLVE 3L73D 2AEJA 3AE4C 1S3JA 4PV1D 2H7HA 2XU6A 3A2AA 1VCKA 1JMMA 1FZFA 3RL0B 1VF5D 3IR9A 2P1JA 1O7NA 2E74B 4EOTA 4L73A 1Y8AA 1GK6A 5KTBA 2IZ0A 1NU1K 1SQVJ 1VM9A 2XRXA 3CCVP 2G3AA 2KB7P 1URQA 4W80A 1Q90D 3QWOC 1W2EA 1SQXJ 1HF9A 1NTKK 3VMZA 5TISH 5APXA 2N9BA 3D70A 1GU5A 2IX7C 5APUA 4K35A 1EC5A 1RQUA 1Y9BA 1N7SB 2WTYA 1AVYA 1SQQD 2ZXXA 2OYHA 2XSOA 4XE5B 3AE5C 3UIAA 1ZR4A 1GDTA 1KILE 4ZKPA 3HTKB 4ASWA 5APWA 1EZVI 3AEDC 2DE6D 1IC2A 3USSA 2QJYB 5CCHC 4NPFX 2B89A 4O9BA 2K9JB 1BGYE 3A0HH 1G2CB 4D6TE 2O01N 2FYUD 4TT3H 1S9KD 2JR8A 1HVVA 3V2NA 1XTGB 1DEEG 2YMKA 3B5NC 3L71G 3FWLA 1KQFB 1T6AA 2KSEA 2KOGA 5AVVB 4U3FD 1IK9A 2YKQA 1USDA 3CCMP 2HG5D 3L74G 1HUCA 2YNYA 3CC2P 3I5CA 4NB8D 1S1CX 1HTLC 2QJPB 1S5LH 3T97B 1KB9I 3T97A 3DQYA 3H1LG 4PD4E 1O7WA 2W27A 2W6BA 1EZVE 1JTHA 2FFDA 3H1KG 1RE4C 2QJKC 4L75A 1FQTA 1SQVD 2WSFJ 2XZRA 1ZN5A 2H89C 4TLFA 3F5HA 4HM8A 4AUWA 2BASA 1EDLA 1SQXD 1AFOA 3M0DA 1ZXGA 2YXQB 3Q1MA 5AVWB 3MZWB 1IFMA 1NGMB 2JP3A 3H32A 1N7LA 1LTSC 1WMKA 4BRYA 2QPZA 1YQ4C 1S72P 1AV1A 1PIXA 2XNXA 1RF1C 3KDPB 1N73A 1YJ9P 5KLVG 3AEEC 1P84E 1SLQA 2KYVA 3VMAA 4IFMA 2PAJA 2QE7H 1Y47A 3I55P 2M3BA 3V2PA 3VCAA 1J1DB 2YIUB 5CCHD 2OYIA 2ZJSE 3AE8C 1QGKB 4OGQB 1OVRA 2HR3A 1FZGA 2M5AB 2P58A 1NU1G 2BEZF 4N78E 2BMRA 1ZOYC 5B5EH 1PFIA 5AW1B 3O8ZA 5KAFH 3H6PA 5HL4A 3RL0g 1NTMJ 4HJGH 1QL2A 1OIPA 5M1BA 1YJWP 2CK3H 2YVJB 2WPQA 2BEQD 2IFMA 3L35A 2KSJA 2E76D 4P1CH 4NBAD 3GMAA 5GTIE 3B5ND 1WT6A 3C0DA 2P67A 3FXDA 2R3SA 2HMMA 3MTUE 2V7QJ 3RL0C 2FYNB 3TGUE 2E74C 1YBKA 4H44B 1K8AQ 4OH8B 1YI2P 1LT9B 1LT9A 4ZNCA 2KS1A 3ZDMA 5AW3B 1VDFA 2KXPB 2R3CA 3OJAB 5BVZA 4H13B 1BGYG 1PGQA 1L0NJ 4D6TG 1KZUB 1M1JB 1M1JA 2CPSA 1YIJP 2E75B 1FOSE 2WPVB 1PP9D 5AVSB 3L70J 1N7SC 1UUVA 2AEMA 1LTBC 2KI7B 3ITKA 2GM4A 1Q81Q 2BCCJ 3AE6C 5H2FE 1U7MA 2AXTE 4HKZH 2QRXA 4JYCA 3CWBJ 2QSIA 2Z4EA 3RK3B 2I8DA 3P7KA 4IL6X 2JO1A 4NBGD 4HJLA 2QJYC 3BCCE 2KZJA 2CKFA 1SFCB 1S2EA 1RIEA 1DX7A 4C7NA 3H1HJ 4K3AA 2H8PD 2AEFA 2DE7D 3IF4A 3N4XA 5AW8B 1Z56A 2CPBA 1JNMA 1MFZA 5AEUA 2B24A 1SQBK 2P2UA 4DT0A 2K1AA 3BVHA 2Q9IA 1UUWA 4WB4A 3ABVC 4H0LB 5CCHA 1EZVG 3LIEA 1MKMA 3CX5D 3CXHD 1VQ8P 1QX8A 2YKPA 3VMHD 2N1TB 1GL2B 3OAKA 1GL2A 2WSEH 3L75E 1CI6B 4LC1A 1NTMD 3II6A 1CZQA 3CMAP 3AECC 2YO3A 1LTGC 4UB6H 5B66E 2QJPC 1JY2N 1AA0A 2E76B 2FYZA 1RE3C 1X22A 3B5NA 1VQ6P 2Y9YA 5AVRB 3RL0D 1JY3O 2XDJA 1L0LK 3RBXA 2E5YA 2A06E 4N6JA 2XV5A 2E74D 2Q7CA 2IFNA 1BDCA 3M9BA 3S9OA 2WSFH 4EMJB 2E4QA 5CCGC 1E5WA 2E42A 1J1EB 1L0ND 2LR2A 1VQOP 2ZT9B 4BXLA 5E79H 3L70D 2B9BA 1N7SD 2OTKE 4I2LC 1NU1J 1RE4A 2BCCD 3EFGA 2D2CB 1YTZI 1YJNP 2O1JA 2FY8A 3CWBD 1H8AA 3O6QB 4C46A 4C7RA 1NTKJ 4Y99B 2E43A 2WSCJ 1O7MA 1SP4A 1Q82Q 4JF7A 4AYCA 2WQYC 1J1DC 2YIUC 3H1IJ 1BCCJ 1FZCB 2XKMA 4ZMDA 3TGUG 4OGQC 2JZAA 3L74D 3H25A 1JCDA 3MP7B 3CX5H 1RF1A 1LGHB 1IJDB 3H1HD 3B71A 3MIWA 3WUTA 1N86A 4QCKA 4GOEA 2IBZE 1MFTA 2FYUJ 3H1JJ 1GD2E 3KQGA 1BE3G 1H89A 4IOIH 2BMOA 4NBDD 2C0WA 3WU2H 2WWWA 1ZR2A 2NRGA 3A0HE 1H0TB 1J2JB 3GB4A 4HH2A 2NWFA 2RN0A 4U3FJ 1ZMEC 2E4PA 1NVOA 2L91A 2FYNC 4H44C 1LWUB 2HPCA 1LWUA 3KYQA 1MUUA 2I1KA 1JY3P 4LGDE 1LT9C 5KLVK 3L73E 3BCCG 2KLUA 1MV8A 1NYKA 5AVZB 3E7KA 4H13C 4YXWH 1RH5B 1FJPA 1M1JC 2E75C 2NPSB 2J58A 2A45H 3G9RA 1HJ0A 3MUDC 5AW9B 1S5LE 3P8MC 1YITP 2OYOA 5CCGD 3QH9A 5AVXB 3PRJA 2NUKA 2ITAA 3GG2A 4DCKA 4IFFA 1SQBG 3TK1A 2XNDH 4HKVA 4QUQA 3RK3C 2HODB 2HODA 1FOSF 1L4AB 4HM1A 3L75G 2IZ1A 1NTZJ 1NYHA 1KFNA 1NU1D 1SFCC 1N7SA 3CCSP 1SQQK 2FXOA 2L5GB 1SQQE 5AVTB 1PPJG 3L72G 2OGUA 1JMBA 5CBNA 1NTKD 4PD4I 3VMGD 3LIDA 1DD3A 3IFMA 2K3RA 3HTKA 5APTA 3FGAD 2ZFCA 3MD0A 2KP8A 1GW3A 3H1ID 1BCCD 2A06G 1L0LG 2YFLA 1SQPJ 4Y28J 3G71P 4H0LC 1QVGO 4OGQD 2B88A 1X79B 1KYOD 3RBZA 2WSSH 2K9JA 4UB8H 1OVVA 4DOJA 1KMIZ 2N1TC 1GL2C 1G2CA 1SJGA 1S9KE 3H1JD 1VQ9P 1FE6A 3G4SP 1W2BO 3A0BH 3KPEA 1T2KC 5KLIB 3HD7B 2JWAA 2E76C 2POHA 4GODA 5B5EE 2ZYLA 1P84I 1FZEA 5KAFE 1KFMA 1WRGA 3PHLA 1VQMP 3CC7P 1FU1A 2Y9ZA 4H44D 4N3YB 1OW7A 3FWNA 3V6IA 3HE4B 3CCEP 4IFDK 2KNCB 2K88A 2K37A 2KNCA 1JUNA 3G3ZA 2WPSA 2IPPA 4H13D 1LTJB 1RE3A 5EFWB 1J1EC 3V4QA 1U7JA 3SFDC 2M8RA 2C9LY 2ZT9C 3PLNA 4NPDA 2E75D 1CW5A 1ZW0A 2IBZG 3CC4P 1NDOA 1PP9J 1SQVE 5KJ7C 1E79H 3U1CA 5CBOA 1HBWA 1G8KB 5CCGA 2D2CC 4QDFB 4IL6H 2R5DA 1BE3J 2Q3IA 1SQXE 3PTZA 3RK3D 4Y99C 3NTNA 1FS0E 2W83C 1EZVD 2WSCH 2HMNA 2GUSA 1NTZD 2PFXA 1PGOA 4BWNA 1FZCC 1RQVA 1SFCD 3KZIH 4ZKUA 1KYOH 2Q5UA 1IO4A 1VQ7P 3L73G 2YFIA 2JWDA 2GBXA 2GUVA 2JEEA 2Z5IA 2KIKA 3HUSB 2RMZA 2MJZA 2DE5D 4HM5A 1SQPD 1K9MQ 1GTWA 2YMYA 1AJYA 1KC8Q 4H0LD 4RESB 4HM7A 3Q5PA 1T3UA 3FX0A 4NPEA 2RH0A 3V4WA 1USEA 2M5AA 2N1TD 1GL2D 1PGPA 3PP5A 3D6ZA 3CCQP 1KILB 1G1IA 1YTZT 1FZBA 1LWUC 3SWKA 3A5TA 1T2KD 1SQBJ 2R44A 1LNQA 1X9VA 3GL2A 3D6YA 1KB9D 3E1IA 2WITA 5APVA 2W6AA 3CD6P 4HYTB 1OX3A 1SQQG 1GW4A 2NPSC 1GK4A 1HJBA 2NZ2A 4UB6E 2JO6A 5AW2B 3W68A 2YKOA 3L72J 2ZAEB 3Q3DA 1YHQP 3JC22 3TNUB 1KQSO 3AEGC 1GU4A 1L0LJ 3JCUH 4QURA 2ZT9D 1L4AC 1O7HA 5KJ7D 3OA7A 1EG9A 2K9YA 3MUDA 1PZQA 2WPRA 1UIXA 3JSVC 5APYA 1DIPA 1DD4A 2RKLA 1ZRTD 2H43A 1S5LX 2D2CD 3V2RA 1L2PA 1BE3D 1AVOA 3A7OA 5AVUB 5E79E 1IFNA 3EN1A 2FXMA 3SFEC 2YXRB 5BU8B 1A02F 1OZHA 1KORA 4W7ZA 3L71J 3TF5A 1SFCA 1EDKA 3RK2B 3L74J 1S4XA 2V4HA 4OWFA 1HH0A 4QDDA 1PL5A 1BSHA 2WT7B 3NXSA 3A3YB 2A45I 3EQQA 4PJ0H 1SS1A 2W6JH 2QM8A 4Z1MH 5KLIC 1GZLA 3HD7C 1HGVA 3H1LJ 3CX5E 1LTAC 1AQTA 1SQVG 1M1KQ 1R5LA 1KB9H 1LT1A 1VQ4P 2N1TA 3CPWO 1OMIA 3H1KJ 1NTME 3OW2O 1CI6A 2HYNA 3VN0A 1SQXG 4GIFA 3WU2E 1OW6A 2J59M 1JB0J 2LKMA 3EQ2A 1SQBD 1OXZA 5KAIH 3C9IA 3AZCA 2QM7A 1KQGB 3GF3A 1LTJC 3L75D 4EIJA 2IBZI 4NBCD 1DEBA 2NPSD 4ASVA 3B8EB 3WMM0 1PPJD 2PP6A 3L72D 3P32A 2JKVA 5KLVJ 3Q5RA 2Y0DA 3K5BA 3CCLP 4KJMA 3M06A 1H88A 2A06D 1L0LD 1L0NE 1ZV8A 4NB9D 1L4AD 3L70E 1JY2P 1X0TA 5AW6B 2BCCE 4YTPC 5KJ7A 3N7NA 4QDCA 2OTLP 3CWBE 3FOUA 3HUSC 3O6QA 3V5BA 4JBZA 1VQNP 1IFPA 1D7MA 1DH3A 3L71D 3L36A 1FZCA 1FZAA 1LP1B 3AEBC 2FXPA 3H1HE 3CXHH 3MGNA 5GTHH 2FBWC 1KILC 1NAYA 3CCJP 1QVFO 5C39A 3EFFK 1VQKP 1RF0A 1KV4A 5TJHA 3HD7D 1JY3N 3H1LD 1NO4A 4UB8E 1O7GA 4WY4B 1BGYJ 3CMEP 4WY4A 1H0TA 3M91A 4XA4A 3GCEA 2Q6QA 4D6TJ 1OFCX 2ZXEB 2OQQA 2V7QH 3H1KD 2C0XA 3P8CD 3WUVA 3A0BE 1G8JB 2YFJA 1T3JA 2GA1A 4WBAA 3TSIA 4NBED 4AAYB 5L8RJ 1T8ZA 2WVRA 4A7PA 1NHLA 1RHZB 1GMJA 4R4MA 1YQ3C 4GDOA 3AEAC 2GBWA 1FBMA 2NPSA 3HE5B 5KLVD 2JJLA 1IFIA 1ULIA 1NWQA 3SWYA 3SWFA 5CJ4A 4U7JA 1ZP0C 4M3LA 1HWTC 4W7YA 5AW4B 4JYBA 1SVFA 2H88C 3R4YA 4HM3A 5AVYB 1L4AA 1NTMG 2NVGA 1LTIC 1NU1E 1MZ9A 4NBBD 1URQB 1JCCA 1OWAA 3RK2C 3PH0A 3GOBA 4IL6E 3SSUA 1NTKE 1FDIA 1WQLA 2OTJP 3H1IE 1BCCE 3VCPA 3KZIE 4KT0J 3AE9C 1KYOE 2OYHB 2FKWB 2HMLA 2E5TA 1ULJA 2IYPA 2KUBA 2IYOA 3F89A 2FYUK 5BU5A 1KILD 2FYUE 2QEXP 3H1JE 3L37A 4AIVA 5DJUB 1EDIA 3VMYA 3Q2YA 1EXJA 1L0NG 2KLVA 1PV3A 5APQA 2R32A 2I1JA 2A45G 3L70G 2C9NY 3HD7A 1BGYD 5CXMA 4D6TD 2BCCG 1JO5A 4U3FE 4DZOA 3AEFC 3VP9A 4HB1A 3CWBG 2AXCA 4HM4A 2R5BA 3CLQA 3HE4A 4WWIA 1JEKA 4JQ0D 2WSEJ 2KZIA 2O3JA 2J5UA 4OVNF 2B87B 2B87A 2O1KA 4LLHA 1LTJA 1AQ5A 2O01J 3H1HG 3TGUJ 1Q7YQ 1SQVK 4HM0A 4QMAA 1NKZB 1JOCA 4PV1B 5AW5B 1HGZA 3JCUE 1SQXK 4QDFA 2W8ZA 3RK3E 1K73Q 4PD4D 1VF5B 2UWJE 1NAFA 3GF7A 4R4LA 4RKUJ 3GL0A 1JTHB 3CL3D 2FFDB 1NTZK 1NTZE 1KD1Q 1ZLLA 3R2PA 2Y0EA 1O7PA 1FDMA 1M56D 3RK2D 1U57A
chains in the Genus database with same CATH topology
1RQUA 1Y9BA 1KORA 3Q5SA 2WSCJ 1O7MA 1K05A 3GTSA 2WQYC 2XSOA 4QDDA 2YIUC 1PL5A 4I7ZB 3AE5C 1SQPE 4OGQC 1KILE 3D89A 2JZAA 3AE7C 2I7FA 3H25A 3EQQA 3AEDC 2DE6D 3GKEA 2BMQA 3B71A 4Z1MH 5KLIC 4QCKA 2IBZE 4QUPA 1FDOA 3CX5E 3GTEA 2HMOA 3GLMA 2BMOA 4NBDD 1JM1A 3GZXA 1OMIA 4TT3H 1NTME 3GB4A 2NWFA 1KB9E 1OW6A 1JB0J 1ZMEC 3AZCA 2E4PA 2FYNC 1TU3F 2YMKA 4H44C 1KQFB 1KQGB 3LW5J 1VL2A 3GF3A 1KTMA 3L73E 4NBCD 4P1BH 1NYKA 4NB8D 4H13C 1S1CX 3Q5RA 2E75C 3T97B 1IK7A 3DQYA 4YXDC 2XR8A 3G9RA 1PP9E 1HJ0A 1L0NE 4PD4E 2XSHA 1O7WA 2NUKA 4NB9D 1ZRTE 3L70E 1EZVE 2HMJA 2QJKC 1FQTA 3EWKA 1BE3E 4HKVA 2WSFJ 4QUQA 4YTPC 2BCCE 2H89C 4HM2A 4HM1A 4HM8A 4QDCA 1NYHA 4NBHD 3CWBE 3FOUA 1K04A 3Q1MA 3IN6A 2NVEA 3O6QA 1SQQE 1NGMB 4HM6A 2JP3A 1WMKA 2QPZA 1YQ4C 3VMGD 3AEBC 1PIXA 2FXPA 1DD3A 2NVFA 5AEWA 3FGAD 3AEEC 3H1HE 1P84E 2YFLA 2NUMA 4Y28J 1R8EA 4H0LC 2FBWC 4OGQD 3CXHE 3VCAA 1KMIZ 1SJGA 3AE8C 4OGQB 3IAOA 5BOKA 1O7GA 2BEZF 2BMRA 3GCEA 1ZOYC 1SQBE 2IDBA 2OQQA 5HL4A 3RL0g 2E76C 2MKVA 5M1BA 2YVJB 2ZYLA 1G8JB 2YFJA 2BEQD 4NBED 4AAYB 5L8RJ 2E76D 4P1CH 4NBAD 3GMAA 4H44D 3C0DA 1OW7A 1GMJA 2HMMA 2V7QJ 4R4MA 1PPJE 3L72E 1YQ3C 4GDOA 2E74C 3TGUE 4PV1C 3AE1C 3AEAC 4H44B 2GBWA 4H13D 1L0LE 1VF5C 3SFDC 1ULIA 2ZT9C 2E75D 4U7JA 1ZP0C 1NDOA 1SQVE 4H13B 2H88C 3R4YA 2E75B 2WPVB 1G8KB 1Q90C 2D2CC 4HM3A 4NBFD 4QDFB 1OW8A 1UUVA 2NVGA 1NU1E 1SQXE 4NBBD 3AE6C 2G8YA 3GOBA 2HMNA 4I7ZC 3AE2C 1RQVA 3L71E 2QSIA 1NTKE 1FDIA 1WQLA 4IL6X 2JO1A 3L74E 2Q3WA 4NBGD 4HJLA 3H1IE 2QJYC 1BCCE 2YFIA 3BCCE 2CKFA 3VCPA 2GBXA 4KT0J 3AE9C 1KYOE 1RIEA 2HMLA 2DE5D 1ULJA 2HMKA 4HM5A 3C8VA 1AJYA 1RFSA 2DE7D 4H0LD 3VMID 4HM7A 2P10A 3Q5PA 2FYUE 5AEUA 2B1XA 3H1LE 3H1JE 4AIVA 2B24A 3Q2YA 1EXJA 1PV3A 1UUWA 3D6ZA 3ABVC 4H0LB 3D71A 3H1KE 1MKMA 4XFJA 5CXMA 3VMHD 4U3FE 3AEFC 3L75E 5KKZC 3GL2A 2QIWA 3D6YA 3AECC 4HM4A 3GZYA 1EXIA 2QJPC 3AE3C 2E76B 2WSEJ 3N0QA 2NZ2A 2JO6A 2J5UA 5KLVE 3AE4C 2A06E 2O01J 2E74D 4PV1D 3Q3DA 1VCKA 4HM0A 3AEGC 3S9OA 1VF5D 4EMJB 2E4QA 4QURA 2ZT9D 1O7NA 2E74B 4PV1B 1O7HA 1VM9A 4QDFA 2XRXA 1EG9A 2G3AA 2K9YA 3RK3E 1UIXA 1VF5B 1DIPA 1DD4A 3GF7A 2ZT9B 4R4LA 4RKUJ 3GL0A 1S5LX 1Q90D 2D2CD 1NTZE 1HF9A 1O7PA 3EN1A 3D70A 3SFEC 1U57A 2D2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C H;  2B24 A;  4NBA D;  1L0N E;  4PD4 E;  4H44 D;  3C0D A;  2XSH A;  1O7W A;  2NUK A;  4NB9 D;  1UUW A;  1ZRT E;  2HMM A;  2WSC J;  4H0L B;  1O7M A;  3GTS A;  3L70 E;  1EZV E;  3H1K E;  1PPJ E;  2HMJ A;  3L72 E;  2QJK C;  1FQT A;  1BE3 E;  2XSO A;  4HKV A;  4QDD A;  2WSF J;  2YIU C;  4I7Z B;  4QUQ A;  5CXM A;  1SQP E;  3TGU E;  2BCC E;  3VMH D;  4H44 B;  4HM2 A;  2GBW A;  4U3F E;  3D89 A;  2JZA A;  2I7F A;  3L75 E;  4H13 D;  3EQQ A;  4HM1 A;  4HM8 A;  4QDC A;  2DE6 D;  5KKZ C;  1L0L E;  3GKE A;  2BMQ A;  3GL2 A;  3CWB E;  4NBH D;  1ULI A;  3FOU A;  2QIW A;  4HM4 A;  3GZY A;  5KLI C;  2E75 D;  2NVE A;  4QCK A;  2IBZ E;  4QUP A;  1SQQ E;  2QJP C;  1NDO A;  3CX5 E;  3GTE A;  1SQV E;  4H13 B;  2HMO A;  4HM6 A;  2BMO A;  4NBD D;  2E76 B;  1JM1 A;  2QPZ A;  3VMG D;  2WSE J;  3N0Q A;  2E75 B;  2WPV B;  1G8K B;  3GZX A;  2JO6 A;  2NVF A;  1Q90 C;  4HM3 A;  4NBF D;  5AEW A;  4QDF B;  5KLV E;  1UUV A;  1NTM E;  2NVG A;  3GB4 A;  1NU1 E;  1SQX E;  2A06 E;  3H1H E;  2NWF A;  2O01 J;  1KB9 E;  1P84 E;  2E74 D;  2YFL A;  2NUM A;  4NBB D;  4Y28 J;  4PV1 D;  1JB0 J;  4OGQ D;  1VCK A;  3GOB A;  3AZC A;  2E4P A;  2HMN A;  4HM0 A;  2FYN C;  1VF5 D;  3CXH E;  3L71 E;  2E4Q A;  4EMJ B;  3VCA A;  4QUR A;  2QSI A;  2ZT9 D;  1NTK E;  1O7N A;  3LW5 J;  1SJG A;  2E74 B;  4PV1 B;  1WQL A;  4IL6 X;  4OGQ B;  3L74 E;  2Q3W A;  5BOK A;  4NBG D;  1O7H A;  3L73 E;  1VM9 A;  4HJL A;  2XRX A;  3H1I E;  1EG9 A;  1O7G A;  2QJY C;  1BCC E;  2YFI A;  4QDF A;  2K9Y A;  3BCC E;  2CKF A;  4NBC D;  3VCP A;  1VF5 B;  2BMR A;  3GCE A;  2GBX A;  4KT0 J;  1SQB E;  2ZT9 B;  4RKU J;  3GL0 A;  4P1B H;  1KYO E;  1NYK A;  4NB8 D;  1S5L X;  1Q90 D;  2D2C D;  1RIE A;  1NTZ E;  5HL4 A;  2HML A;  2DE5 D;  1ULJ A;  2HMK A;  4HM5 A;  3C8V A;  1O7P A;  1RFS A;  2YVJ B;  2DE7 D;  4H0L D;  2ZYL A;  3VMI D;  1G8J B;  2YFJ A;  4HM7 A;  3DQY A;  2FYU E;  3EN1 A;  4AIV A;  5AEU A;  2B1X A;  3H1L E;  2XR8 A;  1PP9 E;  4NBE D;  4AAY B;  3H1J E;  5L8R J;  2D2C B;  2E76 D; 
#chains in the Genus database with same CATH topology
 3Q5S A;  4I1L A;  1K05 A;  3GTS A;  3HUS A;  5CJ0 A;  3H32 B;  1RF0 C;  4BRY B;  1SQP K;  4I7Z B;  1SQP E;  3BCC J;  1XTC C;  3WUU A;  3D89 A;  1N73 B;  3AE7 C;  3MHV A;  2I7F A;  1VQP P;  4WY4 C;  3GKE A;  2BMQ A;  1VQ5 P;  1QL1 A;  1P84 D;  2N9Y B;  3GHG B;  3GHG A;  4QUP A;  4PJ0 E;  1FDO A;  3GTE A;  1KIL A;  2HMO A;  3GLM A;  4EI2 A;  1NJI Q;  5DJT B;  2OYI B;  2WMM A;  1JM1 A;  3CI9 A;  1FJK A;  1IFJ A;  3NFQ A;  3GZX A;  2PRR A;  1KB9 E;  2QA4 P;  4N78 D;  2KK7 A;  1NKN A;  1RY3 A;  3C1L A;  3CCU P;  3L75 J;  2HLO A;  4KHX A;  1TU3 F;  4GOF A;  3V2Q A;  3PJS K;  3VTP C;  1JM0 A;  3KXD A;  1NTK G;  3LW5 J;  1VL2 A;  5KAI E;  3TYY A;  1KTM A;  5AW7 B;  3BRV B;  3H1I G;  3CX5 I;  1BCC G;  5KKZ B;  3CXH I;  2ZYD A;  2Q1K A;  4P1B H;  1CSB A;  4DJG A;  1IFD A;  3TNU A;  2Z5H A;  4PD4 H;  3TGU D;  1IK7 A;  2M0B A;  4YXD C;  2FYU G;  1EDJ A;  2XR8 A;  1PP9 E;  3H1J G;  2KS1 B;  1URQ C;  2XSH A;  1YYC A;  1ZRT E;  2HMJ A;  3CCR P;  1JY2 O;  1BE3 E;  3EWK A;  3W67 A;  1LTT C;  4CPG A;  3S1K A;  4HM2 A;  3M9H A;  4U3F G;  2OAR A;  4NBH D;  1K04 A;  2WZ7 A;  3IN6 A;  3VYI A;  2NVE A;  2OYH C;  2SPZ A;  4HM6 A;  1M7L A;  2ZYG A;  1P84 H;  2WT7 A;  2NVF A;  2Q3E A;  2ZVN B;  4WVZ A;  5AEW A;  2ZYA A;  4GKG A;  2Y0C A;  4EDF A;  3BCC D;  2JDI H;  2NUM A;  1R8E A;  4C7N B;  1X8Y A;  4WY4 D;  5AW0 B;  3U59 A;  3G6E P;  3CXH E;  5GTH E;  3IAO A;  1NTM K;  5BOK A;  3RGU A;  4JPZ B;  4AQR D;  1SQB E;  2IDB A;  1NTZ G;  3HRN A;  2MKV A;  4MN4 C;  5GTI H;  4RJT A;  5APS A;  5CMZ A;  4L76 A;  1BDD A;  2O01 H;  2LXB A;  5AVQ B;  1G1J A;  1N8R Q;  1PPJ E;  3L72 E;  4I6M C;  4B86 A;  3L73 J;  3S4R A;  1W5C E;  1SQP G;  4PV1 C;  3AE1 C;  3B5N B;  1LJ2 A;  2ZVO B;  1L0L E;  1VF5 C;  1L0N K;  1FAV A;  2W90 A;  2FFD C;  3VP8 A;  1M8O B;  3VOP A;  4GT1 A;  3M0A A;  1URQ D;  1OVU A;  1M90 Q;  3NMD A;  5H2F H;  1N2D C;  2QG4 A;  1Q90 C;  2AXT H;  4NBF D;  1OW8 A;  3M0D C;  1FC2 C;  1VQL P;  3U1A A;  3FXE A;  2G8Y A;  2LXC B;  4I7Z C;  3AE2 C;  3BAS A;  2QJK B;  3L71 E;  1Q2N A;  1A02 J;  3GW6 A;  5K5G B;  3L4F A;  2P7J A;  1N73 C;  4L74 A;  1M57 D;  1LP1 A;  3L74 E;  1KQL A;  1Q86 Q;  2Q3W A;  1SQQ J;  4RO0 A;  1KN7 A;  2YO2 A;  1PGJ A;  5TIS E;  1BSN A;  3GHG C;  1IZN B;  3I56 P;  2OYI C;  1QLE D;  2QVA A;  2HMK A;  3C8V A;  3TDK A;  1RFS A;  3VMI D;  2PGD A;  2P10 A;  2B1X A;  3H1L E;  1VPC A;  1PP9 G;  5CHX A;  1RF1 B;  3E1R A;  3B4S A;  1UII A;  2M3E A;  2VRS A;  3D71 A;  3H1K E;  2IBZ D;  1R5S A;  1NOH A;  3P8C E;  3BRT B;  4XFJ A;  1EQ7 A;  2HFE D;  3LW5 H;  3KHU A;  2DW3 A;  1QEX A;  1NH4 A;  1KYO I;  5B66 H;  5KKZ C;  2QIW A;  3M9Q A;  3GZY A;  1EXI A;  3AE3 C;  3VMX A;  2HPC B;  3N0Q A;  4YPC A;  3BAT A;  3HE5 A;  4EYY Q;  5KLV E;  3L73 D;  2AEJ A;  3AE4 C;  1S3J A;  4PV1 D;  2H7H A;  2XU6 A;  3A2A A;  1VCK A;  1JMM A;  1FZF A;  3RL0 B;  1VF5 D;  3IR9 A;  2P1J A;  1O7N A;  2E74 B;  4EOT A;  4L73 A;  1Y8A A;  1GK6 A;  5KTB A;  2IZ0 A;  1NU1 K;  1SQV J;  1VM9 A;  2XRX A;  3CCV P;  2G3A A;  2KB7 P;  1URQ A;  4W80 A;  1Q90 D;  3QWO C;  1W2E A;  1SQX J;  1HF9 A;  1NTK K;  3VMZ A;  5TIS H;  5APX A;  2N9B A;  3D70 A;  1GU5 A;  2IX7 C;  5APU A;  4K35 A;  1EC5 A;  1RQU A;  1Y9B A;  1N7S B;  2WTY A;  1AVY A;  1SQQ D;  2ZXX A;  2OYH A;  2XSO A;  4XE5 B;  3AE5 C;  3UIA A;  1ZR4 A;  1GDT A;  1KIL E;  4ZKP A;  3HTK B;  4ASW A;  5APW A;  1EZV I;  3AED C;  2DE6 D;  1IC2 A;  3USS A;  2QJY B;  5CCH C;  4NPF X;  2B89 A;  4O9B A;  2K9J B;  1BGY E;  3A0H H;  1G2C B;  4D6T E;  2O01 N;  2FYU D;  4TT3 H;  1S9K D;  2JR8 A;  1HVV A;  3V2N A;  1XTG B;  1DEE G;  2YMK A;  3B5N C;  3L71 G;  3FWL A;  1KQF B;  1T6A A;  2KSE A;  2KOG A;  5AVV B;  4U3F D;  1IK9 A;  2YKQ A;  1USD A;  3CCM P;  2HG5 D;  3L74 G;  1HUC A;  2YNY A;  3CC2 P;  3I5C A;  4NB8 D;  1S1C X;  1HTL C;  2QJP B;  1S5L H;  3T97 B;  1KB9 I;  3T97 A;  3DQY A;  3H1L G;  4PD4 E;  1O7W A;  2W27 A;  2W6B A;  1EZV E;  1JTH A;  2FFD A;  3H1K G;  1RE4 C;  2QJK C;  4L75 A;  1FQT A;  1SQV D;  2WSF J;  2XZR A;  1ZN5 A;  2H89 C;  4TLF A;  3F5H A;  4HM8 A;  4AUW A;  2BAS A;  1EDL A;  1SQX D;  1AFO A;  3M0D A;  1ZXG A;  2YXQ B;  3Q1M A;  5AVW B;  3MZW B;  1IFM A;  1NGM B;  2JP3 A;  3H32 A;  1N7L A;  1LTS C;  1WMK A;  4BRY A;  2QPZ A;  1YQ4 C;  1S72 P;  1AV1 A;  1PIX A;  2XNX A;  1RF1 C;  3KDP B;  1N73 A;  1YJ9 P;  5KLV G;  3AEE C;  1P84 E;  1SLQ A;  2KYV A;  3VMA A;  4IFM A;  2PAJ A;  2QE7 H;  1Y47 A;  3I55 P;  2M3B A;  3V2P A;  3VCA A;  1J1D B;  2YIU B;  5CCH D;  2OYI A;  2ZJS E;  3AE8 C;  1QGK B;  4OGQ B;  1OVR A;  2HR3 A;  1FZG A;  2M5A B;  2P58 A;  1NU1 G;  2BEZ F;  4N78 E;  2BMR A;  1ZOY C;  5B5E H;  1PFI A;  5AW1 B;  3O8Z A;  5KAF H;  3H6P A;  5HL4 A;  3RL0 g;  1NTM J;  4HJG H;  1QL2 A;  1OIP A;  5M1B A;  1YJW P;  2CK3 H;  2YVJ B;  2WPQ A;  2BEQ D;  2IFM A;  3L35 A;  2KSJ A;  2E76 D;  4P1C H;  4NBA D;  3GMA A;  5GTI E;  3B5N D;  1WT6 A;  3C0D A;  2P67 A;  3FXD A;  2R3S A;  2HMM A;  3MTU E;  2V7Q J;  3RL0 C;  2FYN B;  3TGU E;  2E74 C;  1YBK A;  4H44 B;  1K8A Q;  4OH8 B;  1YI2 P;  1LT9 B;  1LT9 A;  4ZNC A;  2KS1 A;  3ZDM A;  5AW3 B;  1VDF A;  2KXP B;  2R3C A;  3OJA B;  5BVZ A;  4H13 B;  1BGY G;  1PGQ A;  1L0N J;  4D6T G;  1KZU B;  1M1J B;  1M1J A;  2CPS A;  1YIJ P;  2E75 B;  1FOS E;  2WPV B;  1PP9 D;  5AVS B;  3L70 J;  1N7S C;  1UUV A;  2AEM A;  1LTB C;  2KI7 B;  3ITK A;  2GM4 A;  1Q81 Q;  2BCC J;  3AE6 C;  5H2F E;  1U7M A;  2AXT E;  4HKZ H;  2QRX A;  4JYC A;  3CWB J;  2QSI A;  2Z4E A;  3RK3 B;  2I8D A;  3P7K A;  4IL6 X;  2JO1 A;  4NBG D;  4HJL A;  2QJY C;  3BCC E;  2KZJ A;  2CKF A;  1SFC B;  1S2E A;  1RIE A;  1DX7 A;  4C7N A;  3H1H J;  4K3A A;  2H8P D;  2AEF A;  2DE7 D;  3IF4 A;  3N4X A;  5AW8 B;  1Z56 A;  2CPB A;  1JNM A;  1MFZ A;  5AEU A;  2B24 A;  1SQB K;  2P2U A;  4DT0 A;  2K1A A;  3BVH A;  2Q9I A;  1UUW A;  4WB4 A;  3ABV C;  4H0L B;  5CCH A;  1EZV G;  3LIE A;  1MKM A;  3CX5 D;  3CXH D;  1VQ8 P;  1QX8 A;  2YKP A;  3VMH D;  2N1T B;  1GL2 B;  3OAK A;  1GL2 A;  2WSE H;  3L75 E;  1CI6 B;  4LC1 A;  1NTM D;  3II6 A;  1CZQ A;  3CMA P;  3AEC C;  2YO3 A;  1LTG C;  4UB6 H;  5B66 E;  2QJP C;  1JY2 N;  1AA0 A;  2E76 B;  2FYZ A;  1RE3 C;  1X22 A;  3B5N A;  1VQ6 P;  2Y9Y A;  5AVR B;  3RL0 D;  1JY3 O;  2XDJ A;  1L0L K;  3RBX A;  2E5Y A;  2A06 E;  4N6J A;  2XV5 A;  2E74 D;  2Q7C A;  2IFN A;  1BDC A;  3M9B A;  3S9O A;  2WSF H;  4EMJ B;  2E4Q A;  5CCG C;  1E5W A;  2E42 A;  1J1E B;  1L0N D;  2LR2 A;  1VQO P;  2ZT9 B;  4BXL A;  5E79 H;  3L70 D;  2B9B A;  1N7S D;  2OTK E;  4I2L C;  1NU1 J;  1RE4 A;  2BCC D;  3EFG A;  2D2C B;  1YTZ I;  1YJN P;  2O1J A;  2FY8 A;  3CWB D;  1H8A A;  3O6Q B;  4C46 A;  4C7R A;  1NTK J;  4Y99 B;  2E43 A;  2WSC J;  1O7M A;  1SP4 A;  1Q82 Q;  4JF7 A;  4AYC A;  2WQY C;  1J1D C;  2YIU C;  3H1I J;  1BCC J;  1FZC B;  2XKM A;  4ZMD A;  3TGU G;  4OGQ C;  2JZA A;  3L74 D;  3H25 A;  1JCD A;  3MP7 B;  3CX5 H;  1RF1 A;  1LGH B;  1IJD B;  3H1H D;  3B71 A;  3MIW A;  3WUT A;  1N86 A;  4QCK A;  4GOE A;  2IBZ E;  1MFT A;  2FYU J;  3H1J J;  1GD2 E;  3KQG A;  1BE3 G;  1H89 A;  4IOI H;  2BMO A;  4NBD D;  2C0W A;  3WU2 H;  2WWW A;  1ZR2 A;  2NRG A;  3A0H E;  1H0T B;  1J2J B;  3GB4 A;  4HH2 A;  2NWF A;  2RN0 A;  4U3F J;  1ZME C;  2E4P A;  1NVO A;  2L91 A;  2FYN C;  4H44 C;  1LWU B;  2HPC A;  1LWU A;  3KYQ A;  1MUU A;  2I1K A;  1JY3 P;  4LGD E;  1LT9 C;  5KLV K;  3L73 E;  3BCC G;  2KLU A;  1MV8 A;  1NYK A;  5AVZ B;  3E7K A;  4H13 C;  4YXW H;  1RH5 B;  1FJP A;  1M1J C;  2E75 C;  2NPS B;  2J58 A;  2A45 H;  3G9R A;  1HJ0 A;  3MUD C;  5AW9 B;  1S5L E;  3P8M C;  1YIT P;  2OYO A;  5CCG D;  3QH9 A;  5AVX B;  3PRJ A;  2NUK A;  2ITA A;  3GG2 A;  4DCK A;  4IFF A;  1SQB G;  3TK1 A;  2XND H;  4HKV A;  4QUQ A;  3RK3 C;  2HOD B;  2HOD A;  1FOS F;  1L4A B;  4HM1 A;  3L75 G;  2IZ1 A;  1NTZ J;  1NYH A;  1KFN A;  1NU1 D;  1SFC C;  1N7S A;  3CCS P;  1SQQ K;  2FXO A;  2L5G B;  1SQQ E;  5AVT B;  1PPJ G;  3L72 G;  2OGU A;  1JMB A;  5CBN A;  1NTK D;  4PD4 I;  3VMG D;  3LID A;  1DD3 A;  3IFM A;  2K3R A;  3HTK A;  5APT A;  3FGA D;  2ZFC A;  3MD0 A;  2KP8 A;  1GW3 A;  3H1I D;  1BCC D;  2A06 G;  1L0L G;  2YFL A;  1SQP J;  4Y28 J;  3G71 P;  4H0L C;  1QVG O;  4OGQ D;  2B88 A;  1X79 B;  1KYO D;  3RBZ A;  2WSS H;  2K9J A;  4UB8 H;  1OVV A;  4DOJ A;  1KMI Z;  2N1T C;  1GL2 C;  1G2C A;  1SJG A;  1S9K E;  3H1J D;  1VQ9 P;  1FE6 A;  3G4S P;  1W2B O;  3A0B H;  3KPE A;  1T2K C;  5KLI B;  3HD7 B;  2JWA A;  2E76 C;  2POH A;  4GOD A;  5B5E E;  2ZYL A;  1P84 I;  1FZE A;  5KAF E;  1KFM A;  1WRG A;  3PHL A;  1VQM P;  3CC7 P;  1FU1 A;  2Y9Z A;  4H44 D;  4N3Y B;  1OW7 A;  3FWN A;  3V6I A;  3HE4 B;  3CCE P;  4IFD K;  2KNC B;  2K88 A;  2K37 A;  2KNC A;  1JUN A;  3G3Z A;  2WPS A;  2IPP A;  4H13 D;  1LTJ B;  1RE3 A;  5EFW B;  1J1E C;  3V4Q A;  1U7J A;  3SFD C;  2M8R A;  2C9L Y;  2ZT9 C;  3PLN A;  4NPD A;  2E75 D;  1CW5 A;  1ZW0 A;  2IBZ G;  3CC4 P;  1NDO A;  1PP9 J;  1SQV E;  5KJ7 C;  1E79 H;  3U1C A;  5CBO A;  1HBW A;  1G8K B;  5CCG A;  2D2C C;  4QDF B;  4IL6 H;  2R5D A;  1BE3 J;  2Q3I A;  1SQX E;  3PTZ A;  3RK3 D;  4Y99 C;  3NTN A;  1FS0 E;  2W83 C;  1EZV D;  2WSC H;  2HMN A;  2GUS A;  1NTZ D;  2PFX A;  1PGO A;  4BWN A;  1FZC C;  1RQV A;  1SFC D;  3KZI H;  4ZKU A;  1KYO H;  2Q5U A;  1IO4 A;  1VQ7 P;  3L73 G;  2YFI A;  2JWD A;  2GBX A;  2GUV A;  2JEE A;  2Z5I A;  2KIK A;  3HUS B;  2RMZ A;  2MJZ A;  2DE5 D;  4HM5 A;  1SQP D;  1K9M Q;  1GTW A;  2YMY A;  1AJY A;  1KC8 Q;  4H0L D;  4RES B;  4HM7 A;  3Q5P A;  1T3U A;  3FX0 A;  4NPE A;  2RH0 A;  3V4W A;  1USE A;  2M5A A;  2N1T D;  1GL2 D;  1PGP A;  3PP5 A;  3D6Z A;  3CCQ P;  1KIL B;  1G1I A;  1YTZ T;  1FZB A;  1LWU C;  3SWK A;  3A5T A;  1T2K D;  1SQB J;  2R44 A;  1LNQ A;  1X9V A;  3GL2 A;  3D6Y A;  1KB9 D;  3E1I A;  2WIT A;  5APV A;  2W6A A;  3CD6 P;  4HYT B;  1OX3 A;  1SQQ G;  1GW4 A;  2NPS C;  1GK4 A;  1HJB A;  2NZ2 A;  4UB6 E;  2JO6 A;  5AW2 B;  3W68 A;  2YKO A;  3L72 J;  2ZAE B;  3Q3D A;  1YHQ P;  3JC2 2;  3TNU B;  1KQS O;  3AEG C;  1GU4 A;  1L0L J;  3JCU H;  4QUR A;  2ZT9 D;  1L4A C;  1O7H A;  5KJ7 D;  3OA7 A;  1EG9 A;  2K9Y A;  3MUD A;  1PZQ A;  2WPR A;  1UIX A;  3JSV C;  5APY A;  1DIP A;  1DD4 A;  2RKL A;  1ZRT D;  2H43 A;  1S5L X;  2D2C D;  3V2R A;  1L2P A;  1BE3 D;  1AVO A;  3A7O A;  5AVU B;  5E79 E;  1IFN A;  3EN1 A;  2FXM A;  3SFE C;  2YXR B;  5BU8 B;  1A02 F;  1OZH A;  1KOR A;  4W7Z A;  3L71 J;  3TF5 A;  1SFC A;  1EDK A;  3RK2 B;  3L74 J;  1S4X A;  2V4H A;  4OWF A;  1HH0 A;  4QDD A;  1PL5 A;  1BSH A;  2WT7 B;  3NXS A;  3A3Y B;  2A45 I;  3EQQ A;  4PJ0 H;  1SS1 A;  2W6J H;  2QM8 A;  4Z1M H;  5KLI C;  1GZL A;  3HD7 C;  1HGV A;  3H1L J;  3CX5 E;  1LTA C;  1AQT A;  1SQV G;  1M1K Q;  1R5L A;  1KB9 H;  1LT1 A;  1VQ4 P;  2N1T A;  3CPW O;  1OMI A;  3H1K J;  1NTM E;  3OW2 O;  1CI6 A;  2HYN A;  3VN0 A;  1SQX G;  4GIF A;  3WU2 E;  1OW6 A;  2J59 M;  1JB0 J;  2LKM A;  3EQ2 A;  1SQB D;  1OXZ A;  5KAI H;  3C9I A;  3AZC A;  2QM7 A;  1KQG B;  3GF3 A;  1LTJ C;  3L75 D;  4EIJ A;  2IBZ I;  4NBC D;  1DEB A;  2NPS D;  4ASV A;  3B8E B;  3WMM 0;  1PPJ D;  2PP6 A;  3L72 D;  3P32 A;  2JKV A;  5KLV J;  3Q5R A;  2Y0D A;  3K5B A;  3CCL P;  4KJM A;  3M06 A;  1H88 A;  2A06 D;  1L0L D;  1L0N E;  1ZV8 A;  4NB9 D;  1L4A D;  3L70 E;  1JY2 P;  1X0T A;  5AW6 B;  2BCC E;  4YTP C;  5KJ7 A;  3N7N A;  4QDC A;  2OTL P;  3CWB E;  3FOU A;  3HUS C;  3O6Q A;  3V5B A;  4JBZ A;  1VQN P;  1IFP A;  1D7M A;  1DH3 A;  3L71 D;  3L36 A;  1FZC A;  1FZA A;  1LP1 B;  3AEB C;  2FXP A;  3H1H E;  3CXH H;  3MGN A;  5GTH H;  2FBW C;  1KIL C;  1NAY A;  3CCJ P;  1QVF O;  5C39 A;  3EFF K;  1VQK P;  1RF0 A;  1KV4 A;  5TJH A;  3HD7 D;  1JY3 N;  3H1L D;  1NO4 A;  4UB8 E;  1O7G A;  4WY4 B;  1BGY J;  3CME P;  4WY4 A;  1H0T A;  3M91 A;  4XA4 A;  3GCE A;  2Q6Q A;  4D6T J;  1OFC X;  2ZXE B;  2OQQ A;  2V7Q H;  3H1K D;  2C0X A;  3P8C D;  3WUV A;  3A0B E;  1G8J B;  2YFJ A;  1T3J A;  2GA1 A;  4WBA A;  3TSI A;  4NBE D;  4AAY B;  5L8R J;  1T8Z A;  2WVR A;  4A7P A;  1NHL A;  1RHZ B;  1GMJ A;  4R4M A;  1YQ3 C;  4GDO A;  3AEA C;  2GBW A;  1FBM A;  2NPS A;  3HE5 B;  5KLV D;  2JJL A;  1IFI A;  1ULI A;  1NWQ A;  3SWY A;  3SWF A;  5CJ4 A;  4U7J A;  1ZP0 C;  4M3L A;  1HWT C;  4W7Y A;  5AW4 B;  4JYB A;  1SVF A;  2H88 C;  3R4Y A;  4HM3 A;  5AVY B;  1L4A A;  1NTM G;  2NVG A;  1LTI C;  1NU1 E;  1MZ9 A;  4NBB D;  1URQ B;  1JCC A;  1OWA A;  3RK2 C;  3PH0 A;  3GOB A;  4IL6 E;  3SSU A;  1NTK E;  1FDI A;  1WQL A;  2OTJ P;  3H1I E;  1BCC E;  3VCP A;  3KZI E;  4KT0 J;  3AE9 C;  1KYO E;  2OYH B;  2FKW B;  2HML A;  2E5T A;  1ULJ A;  2IYP A;  2KUB A;  2IYO A;  3F89 A;  2FYU K;  5BU5 A;  1KIL D;  2FYU E;  2QEX P;  3H1J E;  3L37 A;  4AIV A;  5DJU B;  1EDI A;  3VMY A;  3Q2Y A;  1EXJ A;  1L0N G;  2KLV A;  1PV3 A;  5APQ A;  2R32 A;  2I1J A;  2A45 G;  3L70 G;  2C9N Y;  3HD7 A;  1BGY D;  5CXM A;  4D6T D;  2BCC G;  1JO5 A;  4U3F E;  4DZO A;  3AEF C;  3VP9 A;  4HB1 A;  3CWB G;  2AXC A;  4HM4 A;  2R5B A;  3CLQ A;  3HE4 A;  4WWI A;  1JEK A;  4JQ0 D;  2WSE J;  2KZI A;  2O3J A;  2J5U A;  4OVN F;  2B87 B;  2B87 A;  2O1K A;  4LLH A;  1LTJ A;  1AQ5 A;  2O01 J;  3H1H G;  3TGU J;  1Q7Y Q;  1SQV K;  4HM0 A;  4QMA A;  1NKZ B;  1JOC A;  4PV1 B;  5AW5 B;  1HGZ A;  3JCU E;  1SQX K;  4QDF A;  2W8Z A;  3RK3 E;  1K73 Q;  4PD4 D;  1VF5 B;  2UWJ E;  1NAF A;  3GF7 A;  4R4L A;  4RKU J;  3GL0 A;  1JTH B;  3CL3 D;  2FFD B;  1NTZ K;  1NTZ E;  1KD1 Q;  1ZLL A;  3R2P A;  2Y0E A;  1O7P A;  1FDM A;  1M56 D;  3RK2 D;  1U57 A; 
#chains in the Genus database with same CATH homology
 1RQU A;  1Y9B A;  1KOR A;  3Q5S A;  2WSC J;  1O7M A;  1K05 A;  3GTS A;  2WQY C;  2XSO A;  4QDD A;  2YIU C;  1PL5 A;  4I7Z B;  3AE5 C;  1SQP E;  4OGQ C;  1KIL E;  3D89 A;  2JZA A;  3AE7 C;  2I7F A;  3H25 A;  3EQQ A;  3AED C;  2DE6 D;  3GKE A;  2BMQ A;  3B71 A;  4Z1M H;  5KLI C;  4QCK A;  2IBZ E;  4QUP A;  1FDO A;  3CX5 E;  3GTE A;  2HMO A;  3GLM A;  2BMO A;  4NBD D;  1JM1 A;  3GZX A;  1OMI A;  4TT3 H;  1NTM E;  3GB4 A;  2NWF A;  1KB9 E;  1OW6 A;  1JB0 J;  1ZME C;  3AZC A;  2E4P A;  2FYN C;  1TU3 F;  2YMK A;  4H44 C;  1KQF B;  1KQG B;  3LW5 J;  1VL2 A;  3GF3 A;  1KTM A;  3L73 E;  4NBC D;  4P1B H;  1NYK A;  4NB8 D;  4H13 C;  1S1C X;  3Q5R A;  2E75 C;  3T97 B;  1IK7 A;  3DQY A;  4YXD C;  2XR8 A;  3G9R A;  1PP9 E;  1HJ0 A;  1L0N E;  4PD4 E;  2XSH A;  1O7W A;  2NUK A;  4NB9 D;  1ZRT E;  3L70 E;  1EZV E;  2HMJ A;  2QJK C;  1FQT A;  3EWK A;  1BE3 E;  4HKV A;  2WSF J;  4QUQ A;  4YTP C;  2BCC E;  2H89 C;  4HM2 A;  4HM1 A;  4HM8 A;  4QDC A;  1NYH A;  4NBH D;  3CWB E;  3FOU A;  1K04 A;  3Q1M A;  3IN6 A;  2NVE A;  3O6Q A;  1SQQ E;  1NGM B;  4HM6 A;  2JP3 A;  1WMK A;  2QPZ A;  1YQ4 C;  3VMG D;  3AEB C;  1PIX A;  2FXP A;  1DD3 A;  2NVF A;  5AEW A;  3FGA D;  3AEE C;  3H1H E;  1P84 E;  2YFL A;  2NUM A;  4Y28 J;  1R8E A;  4H0L C;  2FBW C;  4OGQ D;  3CXH E;  3VCA A;  1KMI Z;  1SJG A;  3AE8 C;  4OGQ B;  3IAO A;  5BOK A;  1O7G A;  2BEZ F;  2BMR A;  3GCE A;  1ZOY C;  1SQB E;  2IDB A;  2OQQ A;  5HL4 A;  3RL0 g;  2E76 C;  2MKV A;  5M1B A;  2YVJ B;  2ZYL A;  1G8J B;  2YFJ A;  2BEQ D;  4NBE D;  4AAY B;  5L8R J;  2E76 D;  4P1C H;  4NBA D;  3GMA A;  4H44 D;  3C0D A;  1OW7 A;  1GMJ A;  2HMM A;  2V7Q J;  4R4M A;  1PPJ E;  3L72 E;  1YQ3 C;  4GDO A;  2E74 C;  3TGU E;  4PV1 C;  3AE1 C;  3AEA C;  4H44 B;  2GBW A;  4H13 D;  1L0L E;  1VF5 C;  3SFD C;  1ULI A;  2ZT9 C;  2E75 D;  4U7J A;  1ZP0 C;  1NDO A;  1SQV E;  4H13 B;  2H88 C;  3R4Y A;  2E75 B;  2WPV B;  1G8K B;  1Q90 C;  2D2C C;  4HM3 A;  4NBF D;  4QDF B;  1OW8 A;  1UUV A;  2NVG A;  1NU1 E;  1SQX E;  4NBB D;  3AE6 C;  2G8Y A;  3GOB A;  2HMN A;  4I7Z C;  3AE2 C;  1RQV A;  3L71 E;  2QSI A;  1NTK E;  1FDI A;  1WQL A;  4IL6 X;  2JO1 A;  3L74 E;  2Q3W A;  4NBG D;  4HJL A;  3H1I E;  2QJY C;  1BCC E;  2YFI A;  3BCC E;  2CKF A;  3VCP A;  2GBX A;  4KT0 J;  3AE9 C;  1KYO E;  1RIE A;  2HML A;  2DE5 D;  1ULJ A;  2HMK A;  4HM5 A;  3C8V A;  1AJY A;  1RFS A;  2DE7 D;  4H0L D;  3VMI D;  4HM7 A;  2P10 A;  3Q5P A;  2FYU E;  5AEU A;  2B1X A;  3H1L E;  3H1J E;  4AIV A;  2B24 A;  3Q2Y A;  1EXJ A;  1PV3 A;  1UUW A;  3D6Z A;  3ABV C;  4H0L B;  3D71 A;  3H1K E;  1MKM A;  4XFJ A;  5CXM A;  3VMH D;  4U3F E;  3AEF C;  3L75 E;  5KKZ C;  3GL2 A;  2QIW A;  3D6Y A;  3AEC C;  4HM4 A;  3GZY A;  1EXI A;  2QJP C;  3AE3 C;  2E76 B;  2WSE J;  3N0Q A;  2NZ2 A;  2JO6 A;  2J5U A;  5KLV E;  3AE4 C;  2A06 E;  2O01 J;  2E74 D;  4PV1 D;  3Q3D A;  1VCK A;  4HM0 A;  3AEG C;  3S9O A;  1VF5 D;  4EMJ B;  2E4Q A;  4QUR A;  2ZT9 D;  1O7N A;  2E74 B;  4PV1 B;  1O7H A;  1VM9 A;  4QDF A;  2XRX A;  1EG9 A;  2G3A A;  2K9Y A;  3RK3 E;  1UIX A;  1VF5 B;  1DIP A;  1DD4 A;  3GF7 A;  2ZT9 B;  4R4L A;  4RKU J;  3GL0 A;  1S5L X;  1Q90 D;  2D2C D;  1NTZ E;  1HF9 A;  1O7P A;  3EN1 A;  3D70 A;  3SFE C;  1U57 A;  2D2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...