2XSOA

Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 138
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xsoA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xsoA01
4NBHA 3GTSA 2E4PA 2QJYC 3H1HE 1NYKA 1SQVE 4NBFA 3VMIA 4HM3A 4QDFA 2HMJA 3L73E 3TGUE 1WW9A 4NB9A 2GBXA 2HMMA 3VMHA 1Q90C 2HMOA 1EG9A 3GTEA 4NB8D 4NBFD 2BMOA 2I7FA 4AIVA 1O7GA 4QDDA 3L72E 3GOBA 2YVJB 5KLIC 2JO6A 4NB9D 4NBHD 4QURA 3EQQA 1PPJE 1G8JB 2E76D 3VMID 2DE5D 4QCKA 4QDCA 2A06E 1RIEA 3H1LE 2GBWA 3GL0A 4HM5A 3L74E 1ULIA 2YFLA 2BMQA 3FOUA 4NBGA 3EN1A 5AEWA 2QJPC 3GL2A 4HM6A 1VM9A 3CX5E 1VCKA 4NBAD 2DE7A 3N0QA 2FYNC 2JZAA 2YFJA 3H1KE 1P84E 4NBDD 5HL4A 3VCPA 2DE5A 4HM0A 4QDFB 1O7NA 4NBAA 4OGQD 4PV1D 2HMNA 2DE7D 3VMGA 1O7WA 1SQPE 2NUMA 4PD4E 4NBED 1NU1E 4H0LD 3H1JE 1SQQE 1O7MA 4NBDA 4HKVA 3BCCE 3L75E 4EMJB 1BE3E 3VMGD 1ZRTE 2ZYLA 2YFIA 4QUQA 1FQTA 1SQXE 2QJKC 2XR8A 4HM2A 5KKZC 2ZT9D 4H44D 3CXHE 2E75D 2D2CD 3GCEA 1SQBE 4NBBA 2E74D 2HMLA 2B24A 2NWFA 3L71E 3GCFA 1JM1A 2HMKA 2NUKA 3GZXA 4P1CH 1VF5D 5BOKA 2Q3WA 3VCAA 1Z03A 2DE6A 4NBBD 3L70E 1L0LE 4H13D 3CWBE 2BCCE 2IBZE 2CKFA 4NBEA 1Z01A 4NB8A 2BMRA 1L0NE 4AAYB 3GKQA 1NTZE 3GKEA 1UUVA 2XRXA 4NBCD 1RFSA 1PP9E 2NVFA 2FYUE 3AZCA 1EZVE 1UUWA 2YIUC 4HJLA 3H1IE 4HM7A 1NTME 3DQYA 3GB4A 4HM8A 2NVEA 1KB9E 1SJGA 2E4QA 4HM1A 1G8KB 2NVGA 3GZYA 4NBGD 4P1BH 4QUPA 5AEUA 5KLVE 2XSOA 1KYOE 4NBCA 2B1XA 1O7HA 1BCCE 1ULJA 3D89A 1WQLA 4HM4A 4U3FE 1Z02A 2XSHA 2QPZA 1O7PA 1NTKE 3C0DA 5CXMA 2DE6D 1NDOA 3VMHD
chains in the Genus database with same CATH superfamily
4NBHA 3GTSA 2E4PA 2QJYC 3H1HE 1NYKA 1SQVE 4NBFA 3VMIA 4HM3A 4QDFA 2HMJA 3L73E 3TGUE 1WW9A 4NB9A 2GBXA 2HMMA 3VMHA 1Q90C 2HMOA 1EG9A 3GTEA 4NB8D 4NBFD 2BMOA 2I7FA 4AIVA 1O7GA 4QDDA 3L72E 3GOBA 2YVJB 5KLIC 2JO6A 4NB9D 4NBHD 4QURA 3EQQA 1PPJE 1G8JB 2E76D 3VMID 2DE5D 4QCKA 4QDCA 2A06E 1RIEA 3H1LE 2GBWA 3GL0A 4HM5A 3L74E 1ULIA 2YFLA 2BMQA 3FOUA 4NBGA 3EN1A 5AEWA 2QJPC 3GL2A 4HM6A 1VM9A 3CX5E 1VCKA 4NBAD 2DE7A 3N0QA 2FYNC 2JZAA 2YFJA 3H1KE 1P84E 4NBDD 5HL4A 3VCPA 2DE5A 4HM0A 4QDFB 1O7NA 4NBAA 4OGQD 4PV1D 2HMNA 2DE7D 3VMGA 1O7WA 1SQPE 2NUMA 4PD4E 4NBED 1NU1E 4H0LD 3H1JE 1SQQE 1O7MA 4NBDA 4HKVA 3BCCE 3L75E 4EMJB 1BE3E 3VMGD 1ZRTE 2ZYLA 2YFIA 4QUQA 1FQTA 1SQXE 2QJKC 2XR8A 4HM2A 5KKZC 2ZT9D 4H44D 3CXHE 2E75D 2D2CD 3GCEA 1SQBE 4NBBA 2E74D 2HMLA 2B24A 2NWFA 3L71E 3GCFA 1JM1A 2HMKA 2NUKA 3GZXA 4P1CH 1VF5D 5BOKA 2Q3WA 3VCAA 1Z03A 2DE6A 4NBBD 3L70E 1L0LE 4H13D 3CWBE 2BCCE 2IBZE 2CKFA 4NBEA 1Z01A 4NB8A 2BMRA 1L0NE 4AAYB 3GKQA 1NTZE 3GKEA 1UUVA 2XRXA 4NBCD 1RFSA 1PP9E 2NVFA 2FYUE 3AZCA 1EZVE 1UUWA 2YIUC 4HJLA 3H1IE 4HM7A 1NTME 3DQYA 3GB4A 4HM8A 2NVEA 1KB9E 1SJGA 2E4QA 4HM1A 1G8KB 2NVGA 3GZYA 4NBGD 4P1BH 4QUPA 5AEUA 5KLVE 2XSOA 1KYOE 4NBCA 2B1XA 1O7HA 1BCCE 1ULJA 3D89A 1WQLA 4HM4A 4U3FE 1Z02A 2XSHA 2QPZA 1O7PA 1NTKE 3C0DA 5CXMA 2DE6D 1NDOA 3VMHD
chains in the Genus database with same CATH topology
4NBHA 3GTSA 2E4PA 2QJYC 3H1HE 1NYKA 1SQVE 4NBFA 3VMIA 4HM3A 4QDFA 2HMJA 3L73E 3TGUE 1WW9A 4NB9A 2GBXA 2HMMA 3VMHA 1Q90C 2HMOA 1EG9A 3GTEA 4NB8D 4NBFD 2BMOA 2I7FA 4AIVA 1O7GA 4QDDA 3L72E 3GOBA 2YVJB 5KLIC 2JO6A 4NB9D 4NBHD 4QURA 3EQQA 1PPJE 1G8JB 2E76D 3VMID 2DE5D 4QCKA 4QDCA 2A06E 1RIEA 3H1LE 2GBWA 3GL0A 4HM5A 3L74E 1ULIA 2YFLA 2BMQA 3FOUA 4NBGA 3EN1A 5AEWA 2QJPC 3GL2A 4HM6A 1VM9A 3CX5E 1VCKA 4NBAD 2DE7A 3N0QA 2FYNC 2JZAA 2YFJA 3H1KE 1P84E 4NBDD 5HL4A 3VCPA 2DE5A 4HM0A 4QDFB 1O7NA 4NBAA 4OGQD 4PV1D 2HMNA 2DE7D 3VMGA 1O7WA 1SQPE 2NUMA 4PD4E 4NBED 1NU1E 4H0LD 3H1JE 1SQQE 1O7MA 4NBDA 4HKVA 3BCCE 3L75E 4EMJB 1BE3E 3VMGD 1ZRTE 2ZYLA 2YFIA 4QUQA 1FQTA 1SQXE 2QJKC 2XR8A 4HM2A 5KKZC 2ZT9D 4H44D 3CXHE 2E75D 2D2CD 3GCEA 1SQBE 4NBBA 2E74D 2HMLA 2B24A 2NWFA 3L71E 3GCFA 1JM1A 2HMKA 2NUKA 3GZXA 4P1CH 1VF5D 5BOKA 2Q3WA 3VCAA 1Z03A 2DE6A 4NBBD 3L70E 1L0LE 4H13D 3CWBE 2BCCE 2IBZE 2CKFA 4NBEA 1Z01A 4NB8A 2BMRA 1L0NE 4AAYB 3GKQA 1NTZE 3GKEA 1UUVA 2XRXA 4NBCD 1RFSA 1PP9E 2NVFA 2FYUE 3AZCA 1EZVE 1UUWA 2YIUC 4HJLA 3H1IE 4HM7A 1NTME 3DQYA 3GB4A 4HM8A 2NVEA 1KB9E 1SJGA 2E4QA 4HM1A 1G8KB 2NVGA 3GZYA 4NBGD 4P1BH 4QUPA 5AEUA 5KLVE 2XSOA 1KYOE 4NBCA 2B1XA 1O7HA 1BCCE 1ULJA 3D89A 1WQLA 4HM4A 4U3FE 1Z02A 2XSHA 2QPZA 1O7PA 1NTKE 3C0DA 5CXMA 2DE6D 1NDOA 3VMHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBH A;  3GTS A;  2E4P A;  2QJY C;  3H1H E;  1NYK A;  1SQV E;  4NBF A;  3VMI A;  4HM3 A;  4QDF A;  2HMJ A;  3L73 E;  3TGU E;  1WW9 A;  4NB9 A;  2GBX A;  2HMM A;  3VMH A;  1Q90 C;  2HMO A;  1EG9 A;  3GTE A;  4NB8 D;  4NBF D;  2BMO A;  2I7F A;  4AIV A;  1O7G A;  4QDD A;  3L72 E;  3GOB A;  2YVJ B;  5KLI C;  2JO6 A;  4NB9 D;  4NBH D;  4QUR A;  3EQQ A;  1PPJ E;  1G8J B;  2E76 D;  3VMI D;  2DE5 D;  4QCK A;  4QDC A;  2A06 E;  1RIE A;  3H1L E;  2GBW A;  3GL0 A;  4HM5 A;  3L74 E;  1ULI A;  2YFL A;  2BMQ A;  3FOU A;  4NBG A;  3EN1 A;  5AEW A;  2QJP C;  3GL2 A;  4HM6 A;  1VM9 A;  3CX5 E;  1VCK A;  4NBA D;  2DE7 A;  3N0Q A;  2FYN C;  2JZA A;  2YFJ A;  3H1K E;  1P84 E;  4NBD D;  5HL4 A;  3VCP A;  2DE5 A;  4HM0 A;  4QDF B;  1O7N A;  4NBA A;  4OGQ D;  4PV1 D;  2HMN A;  2DE7 D;  3VMG A;  1O7W A;  1SQP E;  2NUM A;  4PD4 E;  4NBE D;  1NU1 E;  4H0L D;  3H1J E;  1SQQ E;  1O7M A;  4NBD A;  4HKV A;  3BCC E;  3L75 E;  4EMJ B;  1BE3 E;  3VMG D;  1ZRT E;  2ZYL A;  2YFI A;  4QUQ A;  1FQT A;  1SQX E;  2QJK C;  2XR8 A;  4HM2 A;  5KKZ C;  2ZT9 D;  4H44 D;  3CXH E;  2E75 D;  2D2C D;  3GCE A;  1SQB E;  4NBB A;  2E74 D;  2HML A;  2B24 A;  2NWF A;  3L71 E;  3GCF A;  1JM1 A;  2HMK A;  2NUK A;  3GZX A;  4P1C H;  1VF5 D;  5BOK A;  2Q3W A;  3VCA A;  1Z03 A;  2DE6 A;  4NBB D;  3L70 E;  1L0L E;  4H13 D;  3CWB E;  2BCC E;  2IBZ E;  2CKF A;  4NBE A;  1Z01 A;  4NB8 A;  2BMR A;  1L0N E;  4AAY B;  3GKQ A;  1NTZ E;  3GKE A;  1UUV A;  2XRX A;  4NBC D;  1RFS A;  1PP9 E;  2NVF A;  2FYU E;  3AZC A;  1EZV E;  1UUW A;  2YIU C;  4HJL A;  3H1I E;  4HM7 A;  1NTM E;  3DQY A;  3GB4 A;  4HM8 A;  2NVE A;  1KB9 E;  1SJG A;  2E4Q A;  4HM1 A;  1G8K B;  2NVG A;  3GZY A;  4NBG D;  4P1B H;  4QUP A;  5AEU A;  5KLV E;  2XSO A;  1KYO E;  4NBC A;  2B1X A;  1O7H A;  1BCC E;  1ULJ A;  3D89 A;  1WQL A;  4HM4 A;  4U3F E;  1Z02 A;  2XSH A;  2QPZ A;  1O7P A;  1NTK E;  3C0D A;  5CXM A;  2DE6 D;  1NDO A;  3VMH D; 
#chains in the Genus database with same CATH topology
 4NBH A;  3GTS A;  2E4P A;  2QJY C;  3H1H E;  1NYK A;  1SQV E;  4NBF A;  3VMI A;  4HM3 A;  4QDF A;  2HMJ A;  3L73 E;  3TGU E;  1WW9 A;  4NB9 A;  2GBX A;  2HMM A;  3VMH A;  1Q90 C;  2HMO A;  1EG9 A;  3GTE A;  4NB8 D;  4NBF D;  2BMO A;  2I7F A;  4AIV A;  1O7G A;  4QDD A;  3L72 E;  3GOB A;  2YVJ B;  5KLI C;  2JO6 A;  4NB9 D;  4NBH D;  4QUR A;  3EQQ A;  1PPJ E;  1G8J B;  2E76 D;  3VMI D;  2DE5 D;  4QCK A;  4QDC A;  2A06 E;  1RIE A;  3H1L E;  2GBW A;  3GL0 A;  4HM5 A;  3L74 E;  1ULI A;  2YFL A;  2BMQ A;  3FOU A;  4NBG A;  3EN1 A;  5AEW A;  2QJP C;  3GL2 A;  4HM6 A;  1VM9 A;  3CX5 E;  1VCK A;  4NBA D;  2DE7 A;  3N0Q A;  2FYN C;  2JZA A;  2YFJ A;  3H1K E;  1P84 E;  4NBD D;  5HL4 A;  3VCP A;  2DE5 A;  4HM0 A;  4QDF B;  1O7N A;  4NBA A;  4OGQ D;  4PV1 D;  2HMN A;  2DE7 D;  3VMG A;  1O7W A;  1SQP E;  2NUM A;  4PD4 E;  4NBE D;  1NU1 E;  4H0L D;  3H1J E;  1SQQ E;  1O7M A;  4NBD A;  4HKV A;  3BCC E;  3L75 E;  4EMJ B;  1BE3 E;  3VMG D;  1ZRT E;  2ZYL A;  2YFI A;  4QUQ A;  1FQT A;  1SQX E;  2QJK C;  2XR8 A;  4HM2 A;  5KKZ C;  2ZT9 D;  4H44 D;  3CXH E;  2E75 D;  2D2C D;  3GCE A;  1SQB E;  4NBB A;  2E74 D;  2HML A;  2B24 A;  2NWF A;  3L71 E;  3GCF A;  1JM1 A;  2HMK A;  2NUK A;  3GZX A;  4P1C H;  1VF5 D;  5BOK A;  2Q3W A;  3VCA A;  1Z03 A;  2DE6 A;  4NBB D;  3L70 E;  1L0L E;  4H13 D;  3CWB E;  2BCC E;  2IBZ E;  2CKF A;  4NBE A;  1Z01 A;  4NB8 A;  2BMR A;  1L0N E;  4AAY B;  3GKQ A;  1NTZ E;  3GKE A;  1UUV A;  2XRX A;  4NBC D;  1RFS A;  1PP9 E;  2NVF A;  2FYU E;  3AZC A;  1EZV E;  1UUW A;  2YIU C;  4HJL A;  3H1I E;  4HM7 A;  1NTM E;  3DQY A;  3GB4 A;  4HM8 A;  2NVE A;  1KB9 E;  1SJG A;  2E4Q A;  4HM1 A;  1G8K B;  2NVG A;  3GZY A;  4NBG D;  4P1B H;  4QUP A;  5AEU A;  5KLV E;  2XSO A;  1KYO E;  4NBC A;  2B1X A;  1O7H A;  1BCC E;  1ULJ A;  3D89 A;  1WQL A;  4HM4 A;  4U3F E;  1Z02 A;  2XSH A;  2QPZ A;  1O7P A;  1NTK E;  3C0D A;  5CXM A;  2DE6 D;  1NDO A;  3VMH D; 
#chains in the Genus database with same CATH homology
 4NBH A;  3GTS A;  2E4P A;  2QJY C;  3H1H E;  1NYK A;  1SQV E;  4NBF A;  3VMI A;  4HM3 A;  4QDF A;  2HMJ A;  3L73 E;  3TGU E;  1WW9 A;  4NB9 A;  2GBX A;  2HMM A;  3VMH A;  1Q90 C;  2HMO A;  1EG9 A;  3GTE A;  4NB8 D;  4NBF D;  2BMO A;  2I7F A;  4AIV A;  1O7G A;  4QDD A;  3L72 E;  3GOB A;  2YVJ B;  5KLI C;  2JO6 A;  4NB9 D;  4NBH D;  4QUR A;  3EQQ A;  1PPJ E;  1G8J B;  2E76 D;  3VMI D;  2DE5 D;  4QCK A;  4QDC A;  2A06 E;  1RIE A;  3H1L E;  2GBW A;  3GL0 A;  4HM5 A;  3L74 E;  1ULI A;  2YFL A;  2BMQ A;  3FOU A;  4NBG A;  3EN1 A;  5AEW A;  2QJP C;  3GL2 A;  4HM6 A;  1VM9 A;  3CX5 E;  1VCK A;  4NBA D;  2DE7 A;  3N0Q A;  2FYN C;  2JZA A;  2YFJ A;  3H1K E;  1P84 E;  4NBD D;  5HL4 A;  3VCP A;  2DE5 A;  4HM0 A;  4QDF B;  1O7N A;  4NBA A;  4OGQ D;  4PV1 D;  2HMN A;  2DE7 D;  3VMG A;  1O7W A;  1SQP E;  2NUM A;  4PD4 E;  4NBE D;  1NU1 E;  4H0L D;  3H1J E;  1SQQ E;  1O7M A;  4NBD A;  4HKV A;  3BCC E;  3L75 E;  4EMJ B;  1BE3 E;  3VMG D;  1ZRT E;  2ZYL A;  2YFI A;  4QUQ A;  1FQT A;  1SQX E;  2QJK C;  2XR8 A;  4HM2 A;  5KKZ C;  2ZT9 D;  4H44 D;  3CXH E;  2E75 D;  2D2C D;  3GCE A;  1SQB E;  4NBB A;  2E74 D;  2HML A;  2B24 A;  2NWF A;  3L71 E;  3GCF A;  1JM1 A;  2HMK A;  2NUK A;  3GZX A;  4P1C H;  1VF5 D;  5BOK A;  2Q3W A;  3VCA A;  1Z03 A;  2DE6 A;  4NBB D;  3L70 E;  1L0L E;  4H13 D;  3CWB E;  2BCC E;  2IBZ E;  2CKF A;  4NBE A;  1Z01 A;  4NB8 A;  2BMR A;  1L0N E;  4AAY B;  3GKQ A;  1NTZ E;  3GKE A;  1UUV A;  2XRX A;  4NBC D;  1RFS A;  1PP9 E;  2NVF A;  2FYU E;  3AZC A;  1EZV E;  1UUW A;  2YIU C;  4HJL A;  3H1I E;  4HM7 A;  1NTM E;  3DQY A;  3GB4 A;  4HM8 A;  2NVE A;  1KB9 E;  1SJG A;  2E4Q A;  4HM1 A;  1G8K B;  2NVG A;  3GZY A;  4NBG D;  4P1B H;  4QUP A;  5AEU A;  5KLV E;  2XSO A;  1KYO E;  4NBC A;  2B1X A;  1O7H A;  1BCC E;  1ULJ A;  3D89 A;  1WQL A;  4HM4 A;  4U3F E;  1Z02 A;  2XSH A;  2QPZ A;  1O7P A;  1NTK E;  3C0D A;  5CXM A;  2DE6 D;  1NDO A;  3VMH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...