2XSOA

Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPAMNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 138
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xsoA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xsoA01
4P1BH 4H44D 1L0NE 3VMID 3L74E 4HM8A 4NBCA 2JO6A 1G8KB 4NBGA 1PP9E 3CX5E 1RFSA 4OGQD 4NB8A 3L73E 5KKZC 2DE7D 2D2CD 2NUKA 2YFIA 4PD4E 2YFJA 4NBBA 2NVFA 2YFLA 4EMJB 4AAYB 3GB4A 1NDOA 4NBHA 1SJGA 4NBDA 2HMNA 4QDFA 1SQVE 3BCCE 2DE6D 1EZVE 4QDFB 2HMLA 3L71E 1O7PA 2XSOA 1SQBE 3GKEA 5AEWA 3VMGD 4U3FE 1O7GA 3FOUA 1KYOE 3VMHD 3VMIA 4HM5A 1L0LE 3H1IE 1SQPE 1NTKE 4QCKA 1KB9E 1FQTA 4NBED 3EN1A 4HM0A 2A06E 2CKFA 2DE7A 5KLIC 2BMQA 1WW9A 4QDDA 4HM2A 2QJPC 3EQQA 3C0DA 4HM4A 4QURA 2ZYLA 2BMOA 4HKVA 4NB9A 1RIEA 2NVEA 3DQYA 1UUVA 4HM6A 5HL4A 4NB9D 1ZRTE 2XSHA 2DE6A 1Z02A 5AEUA 3GCEA 3TGUE 3CWBE 2IBZE 2Q3WA 1EG9A 1Q90C 4H13D 3VMGA 3H1LE 1NTME 5CXMA 5KLVE 3VMHA 1SQQE 2HMJA 4HM7A 2B1XA 4AIVA 4NBFD 3GKQA 2E4PA 4NBEA 2GBWA 2NWFA 3GTSA 4NBAD 2B24A 5BOKA 3VCAA 4PV1D 3CXHE 3GZXA 2NVGA 1O7MA 2NUMA 2XRXA 2E4QA 1BCCE 2QPZA 3GZYA 4QDCA 2BMRA 1UUWA 2HMKA 2BCCE 3H1HE 2ZT9D 2GBXA 2HMOA 1ULIA 3GCFA 3H1JE 4NBFA 1Z03A 4HM3A 2YIUC 2DE5D 1WQLA 1ULJA 3H1KE 4NBAA 2XR8A 1Z01A 2QJYC 2FYNC 3L70E 4HM1A 1VCKA 2E75D 2QJKC 3AZCA 4NBCD 4QUQA 2HMMA 4NBGD 1O7WA 1PPJE 1NYKA 2E74D 4NB8D 4QUPA 1NTZE 1O7HA 3GL2A 2FYUE 3VCPA 1BE3E 1SQXE 1VF5D 1G8JB 3GTEA 1VM9A 3N0QA 4P1CH 1O7NA 4NBBD 3GOBA 1JM1A 4NBHD 4NBDD 3GL0A 2E76D 2I7FA 2YVJB 3L75E 1NU1E 4H0LD 2DE5A 3L72E 2JZAA 3D89A 4HJLA 1P84E
chains in the Genus database with same CATH superfamily
4P1BH 4H44D 1L0NE 3VMID 3L74E 4HM8A 4NBCA 2JO6A 1G8KB 4NBGA 1PP9E 3CX5E 1RFSA 4OGQD 4NB8A 3L73E 5KKZC 2DE7D 2D2CD 2NUKA 2YFIA 4PD4E 2YFJA 4NBBA 2NVFA 2YFLA 4EMJB 4AAYB 3GB4A 1NDOA 4NBHA 1SJGA 4NBDA 2HMNA 4QDFA 1SQVE 3BCCE 2DE6D 1EZVE 4QDFB 2HMLA 3L71E 1O7PA 2XSOA 1SQBE 3GKEA 5AEWA 3VMGD 4U3FE 1O7GA 3FOUA 1KYOE 3VMHD 3VMIA 4HM5A 1L0LE 3H1IE 1SQPE 1NTKE 4QCKA 1KB9E 1FQTA 4NBED 3EN1A 4HM0A 2A06E 2CKFA 2DE7A 5KLIC 2BMQA 1WW9A 4QDDA 4HM2A 2QJPC 3EQQA 3C0DA 4HM4A 4QURA 2ZYLA 2BMOA 4HKVA 4NB9A 1RIEA 2NVEA 3DQYA 1UUVA 4HM6A 5HL4A 4NB9D 1ZRTE 2XSHA 2DE6A 1Z02A 5AEUA 3GCEA 3TGUE 3CWBE 2IBZE 2Q3WA 1EG9A 1Q90C 4H13D 3VMGA 3H1LE 1NTME 5CXMA 5KLVE 3VMHA 1SQQE 2HMJA 4HM7A 2B1XA 4AIVA 4NBFD 3GKQA 2E4PA 4NBEA 2GBWA 2NWFA 3GTSA 4NBAD 2B24A 5BOKA 3VCAA 4PV1D 3CXHE 3GZXA 2NVGA 1O7MA 2NUMA 2XRXA 2E4QA 1BCCE 2QPZA 3GZYA 4QDCA 2BMRA 1UUWA 2HMKA 2BCCE 3H1HE 2ZT9D 2GBXA 2HMOA 1ULIA 3GCFA 3H1JE 4NBFA 1Z03A 4HM3A 2YIUC 2DE5D 1WQLA 1ULJA 3H1KE 4NBAA 2XR8A 1Z01A 2QJYC 2FYNC 3L70E 4HM1A 1VCKA 2E75D 2QJKC 3AZCA 4NBCD 4QUQA 2HMMA 4NBGD 1O7WA 1PPJE 1NYKA 2E74D 4NB8D 4QUPA 1NTZE 1O7HA 3GL2A 2FYUE 3VCPA 1BE3E 1SQXE 1VF5D 1G8JB 3GTEA 1VM9A 3N0QA 4P1CH 1O7NA 4NBBD 3GOBA 1JM1A 4NBHD 4NBDD 3GL0A 2E76D 2I7FA 2YVJB 3L75E 1NU1E 4H0LD 2DE5A 3L72E 2JZAA 3D89A 4HJLA 1P84E
chains in the Genus database with same CATH topology
4P1BH 4H44D 1L0NE 3VMID 3L74E 4HM8A 4NBCA 2JO6A 1G8KB 4NBGA 1PP9E 3CX5E 1RFSA 4OGQD 4NB8A 3L73E 5KKZC 2DE7D 2D2CD 2NUKA 2YFIA 4PD4E 2YFJA 4NBBA 2NVFA 2YFLA 4EMJB 4AAYB 3GB4A 1NDOA 4NBHA 1SJGA 4NBDA 2HMNA 4QDFA 1SQVE 3BCCE 2DE6D 1EZVE 4QDFB 2HMLA 3L71E 1O7PA 2XSOA 1SQBE 3GKEA 5AEWA 3VMGD 4U3FE 1O7GA 3FOUA 1KYOE 3VMHD 3VMIA 4HM5A 1L0LE 3H1IE 1SQPE 1NTKE 4QCKA 1KB9E 1FQTA 4NBED 3EN1A 4HM0A 2A06E 2CKFA 2DE7A 5KLIC 2BMQA 1WW9A 4QDDA 4HM2A 2QJPC 3EQQA 3C0DA 4HM4A 4QURA 2ZYLA 2BMOA 4HKVA 4NB9A 1RIEA 2NVEA 3DQYA 1UUVA 4HM6A 5HL4A 4NB9D 1ZRTE 2XSHA 2DE6A 1Z02A 5AEUA 3GCEA 3TGUE 3CWBE 2IBZE 2Q3WA 1EG9A 1Q90C 4H13D 3VMGA 3H1LE 1NTME 5CXMA 5KLVE 3VMHA 1SQQE 2HMJA 4HM7A 2B1XA 4AIVA 4NBFD 3GKQA 2E4PA 4NBEA 2GBWA 2NWFA 3GTSA 4NBAD 2B24A 5BOKA 3VCAA 4PV1D 3CXHE 3GZXA 2NVGA 1O7MA 2NUMA 2XRXA 2E4QA 1BCCE 2QPZA 3GZYA 4QDCA 2BMRA 1UUWA 2HMKA 2BCCE 3H1HE 2ZT9D 2GBXA 2HMOA 1ULIA 3GCFA 3H1JE 4NBFA 1Z03A 4HM3A 2YIUC 2DE5D 1WQLA 1ULJA 3H1KE 4NBAA 2XR8A 1Z01A 2QJYC 2FYNC 3L70E 4HM1A 1VCKA 2E75D 2QJKC 3AZCA 4NBCD 4QUQA 2HMMA 4NBGD 1O7WA 1PPJE 1NYKA 2E74D 4NB8D 4QUPA 1NTZE 1O7HA 3GL2A 2FYUE 3VCPA 1BE3E 1SQXE 1VF5D 1G8JB 3GTEA 1VM9A 3N0QA 4P1CH 1O7NA 4NBBD 3GOBA 1JM1A 4NBHD 4NBDD 3GL0A 2E76D 2I7FA 2YVJB 3L75E 1NU1E 4H0LD 2DE5A 3L72E 2JZAA 3D89A 4HJLA 1P84E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1B H;  4H44 D;  1L0N E;  3VMI D;  3L74 E;  4HM8 A;  4NBC A;  2JO6 A;  1G8K B;  4NBG A;  1PP9 E;  3CX5 E;  1RFS A;  4OGQ D;  4NB8 A;  3L73 E;  5KKZ C;  2DE7 D;  2D2C D;  2NUK A;  2YFI A;  4PD4 E;  2YFJ A;  4NBB A;  2NVF A;  2YFL A;  4EMJ B;  4AAY B;  3GB4 A;  1NDO A;  4NBH A;  1SJG A;  4NBD A;  2HMN A;  4QDF A;  1SQV E;  3BCC E;  2DE6 D;  1EZV E;  4QDF B;  2HML A;  3L71 E;  1O7P A;  2XSO A;  1SQB E;  3GKE A;  5AEW A;  3VMG D;  4U3F E;  1O7G A;  3FOU A;  1KYO E;  3VMH D;  3VMI A;  4HM5 A;  1L0L E;  3H1I E;  1SQP E;  1NTK E;  4QCK A;  1KB9 E;  1FQT A;  4NBE D;  3EN1 A;  4HM0 A;  2A06 E;  2CKF A;  2DE7 A;  5KLI C;  2BMQ A;  1WW9 A;  4QDD A;  4HM2 A;  2QJP C;  3EQQ A;  3C0D A;  4HM4 A;  4QUR A;  2ZYL A;  2BMO A;  4HKV A;  4NB9 A;  1RIE A;  2NVE A;  3DQY A;  1UUV A;  4HM6 A;  5HL4 A;  4NB9 D;  1ZRT E;  2XSH A;  2DE6 A;  1Z02 A;  5AEU A;  3GCE A;  3TGU E;  3CWB E;  2IBZ E;  2Q3W A;  1EG9 A;  1Q90 C;  4H13 D;  3VMG A;  3H1L E;  1NTM E;  5CXM A;  5KLV E;  3VMH A;  1SQQ E;  2HMJ A;  4HM7 A;  2B1X A;  4AIV A;  4NBF D;  3GKQ A;  2E4P A;  4NBE A;  2GBW A;  2NWF A;  3GTS A;  4NBA D;  2B24 A;  5BOK A;  3VCA A;  4PV1 D;  3CXH E;  3GZX A;  2NVG A;  1O7M A;  2NUM A;  2XRX A;  2E4Q A;  1BCC E;  2QPZ A;  3GZY A;  4QDC A;  2BMR A;  1UUW A;  2HMK A;  2BCC E;  3H1H E;  2ZT9 D;  2GBX A;  2HMO A;  1ULI A;  3GCF A;  3H1J E;  4NBF A;  1Z03 A;  4HM3 A;  2YIU C;  2DE5 D;  1WQL A;  1ULJ A;  3H1K E;  4NBA A;  2XR8 A;  1Z01 A;  2QJY C;  2FYN C;  3L70 E;  4HM1 A;  1VCK A;  2E75 D;  2QJK C;  3AZC A;  4NBC D;  4QUQ A;  2HMM A;  4NBG D;  1O7W A;  1PPJ E;  1NYK A;  2E74 D;  4NB8 D;  4QUP A;  1NTZ E;  1O7H A;  3GL2 A;  2FYU E;  3VCP A;  1BE3 E;  1SQX E;  1VF5 D;  1G8J B;  3GTE A;  1VM9 A;  3N0Q A;  4P1C H;  1O7N A;  4NBB D;  3GOB A;  1JM1 A;  4NBH D;  4NBD D;  3GL0 A;  2E76 D;  2I7F A;  2YVJ B;  3L75 E;  1NU1 E;  4H0L D;  2DE5 A;  3L72 E;  2JZA A;  3D89 A;  4HJL A;  1P84 E; 
#chains in the Genus database with same CATH topology
 4P1B H;  4H44 D;  1L0N E;  3VMI D;  3L74 E;  4HM8 A;  4NBC A;  2JO6 A;  1G8K B;  4NBG A;  1PP9 E;  3CX5 E;  1RFS A;  4OGQ D;  4NB8 A;  3L73 E;  5KKZ C;  2DE7 D;  2D2C D;  2NUK A;  2YFI A;  4PD4 E;  2YFJ A;  4NBB A;  2NVF A;  2YFL A;  4EMJ B;  4AAY B;  3GB4 A;  1NDO A;  4NBH A;  1SJG A;  4NBD A;  2HMN A;  4QDF A;  1SQV E;  3BCC E;  2DE6 D;  1EZV E;  4QDF B;  2HML A;  3L71 E;  1O7P A;  2XSO A;  1SQB E;  3GKE A;  5AEW A;  3VMG D;  4U3F E;  1O7G A;  3FOU A;  1KYO E;  3VMH D;  3VMI A;  4HM5 A;  1L0L E;  3H1I E;  1SQP E;  1NTK E;  4QCK A;  1KB9 E;  1FQT A;  4NBE D;  3EN1 A;  4HM0 A;  2A06 E;  2CKF A;  2DE7 A;  5KLI C;  2BMQ A;  1WW9 A;  4QDD A;  4HM2 A;  2QJP C;  3EQQ A;  3C0D A;  4HM4 A;  4QUR A;  2ZYL A;  2BMO A;  4HKV A;  4NB9 A;  1RIE A;  2NVE A;  3DQY A;  1UUV A;  4HM6 A;  5HL4 A;  4NB9 D;  1ZRT E;  2XSH A;  2DE6 A;  1Z02 A;  5AEU A;  3GCE A;  3TGU E;  3CWB E;  2IBZ E;  2Q3W A;  1EG9 A;  1Q90 C;  4H13 D;  3VMG A;  3H1L E;  1NTM E;  5CXM A;  5KLV E;  3VMH A;  1SQQ E;  2HMJ A;  4HM7 A;  2B1X A;  4AIV A;  4NBF D;  3GKQ A;  2E4P A;  4NBE A;  2GBW A;  2NWF A;  3GTS A;  4NBA D;  2B24 A;  5BOK A;  3VCA A;  4PV1 D;  3CXH E;  3GZX A;  2NVG A;  1O7M A;  2NUM A;  2XRX A;  2E4Q A;  1BCC E;  2QPZ A;  3GZY A;  4QDC A;  2BMR A;  1UUW A;  2HMK A;  2BCC E;  3H1H E;  2ZT9 D;  2GBX A;  2HMO A;  1ULI A;  3GCF A;  3H1J E;  4NBF A;  1Z03 A;  4HM3 A;  2YIU C;  2DE5 D;  1WQL A;  1ULJ A;  3H1K E;  4NBA A;  2XR8 A;  1Z01 A;  2QJY C;  2FYN C;  3L70 E;  4HM1 A;  1VCK A;  2E75 D;  2QJK C;  3AZC A;  4NBC D;  4QUQ A;  2HMM A;  4NBG D;  1O7W A;  1PPJ E;  1NYK A;  2E74 D;  4NB8 D;  4QUP A;  1NTZ E;  1O7H A;  3GL2 A;  2FYU E;  3VCP A;  1BE3 E;  1SQX E;  1VF5 D;  1G8J B;  3GTE A;  1VM9 A;  3N0Q A;  4P1C H;  1O7N A;  4NBB D;  3GOB A;  1JM1 A;  4NBH D;  4NBD D;  3GL0 A;  2E76 D;  2I7F A;  2YVJ B;  3L75 E;  1NU1 E;  4H0L D;  2DE5 A;  3L72 E;  2JZA A;  3D89 A;  4HJL A;  1P84 E; 
#chains in the Genus database with same CATH homology
 4P1B H;  4H44 D;  1L0N E;  3VMI D;  3L74 E;  4HM8 A;  4NBC A;  2JO6 A;  1G8K B;  4NBG A;  1PP9 E;  3CX5 E;  1RFS A;  4OGQ D;  4NB8 A;  3L73 E;  5KKZ C;  2DE7 D;  2D2C D;  2NUK A;  2YFI A;  4PD4 E;  2YFJ A;  4NBB A;  2NVF A;  2YFL A;  4EMJ B;  4AAY B;  3GB4 A;  1NDO A;  4NBH A;  1SJG A;  4NBD A;  2HMN A;  4QDF A;  1SQV E;  3BCC E;  2DE6 D;  1EZV E;  4QDF B;  2HML A;  3L71 E;  1O7P A;  2XSO A;  1SQB E;  3GKE A;  5AEW A;  3VMG D;  4U3F E;  1O7G A;  3FOU A;  1KYO E;  3VMH D;  3VMI A;  4HM5 A;  1L0L E;  3H1I E;  1SQP E;  1NTK E;  4QCK A;  1KB9 E;  1FQT A;  4NBE D;  3EN1 A;  4HM0 A;  2A06 E;  2CKF A;  2DE7 A;  5KLI C;  2BMQ A;  1WW9 A;  4QDD A;  4HM2 A;  2QJP C;  3EQQ A;  3C0D A;  4HM4 A;  4QUR A;  2ZYL A;  2BMO A;  4HKV A;  4NB9 A;  1RIE A;  2NVE A;  3DQY A;  1UUV A;  4HM6 A;  5HL4 A;  4NB9 D;  1ZRT E;  2XSH A;  2DE6 A;  1Z02 A;  5AEU A;  3GCE A;  3TGU E;  3CWB E;  2IBZ E;  2Q3W A;  1EG9 A;  1Q90 C;  4H13 D;  3VMG A;  3H1L E;  1NTM E;  5CXM A;  5KLV E;  3VMH A;  1SQQ E;  2HMJ A;  4HM7 A;  2B1X A;  4AIV A;  4NBF D;  3GKQ A;  2E4P A;  4NBE A;  2GBW A;  2NWF A;  3GTS A;  4NBA D;  2B24 A;  5BOK A;  3VCA A;  4PV1 D;  3CXH E;  3GZX A;  2NVG A;  1O7M A;  2NUM A;  2XRX A;  2E4Q A;  1BCC E;  2QPZ A;  3GZY A;  4QDC A;  2BMR A;  1UUW A;  2HMK A;  2BCC E;  3H1H E;  2ZT9 D;  2GBX A;  2HMO A;  1ULI A;  3GCF A;  3H1J E;  4NBF A;  1Z03 A;  4HM3 A;  2YIU C;  2DE5 D;  1WQL A;  1ULJ A;  3H1K E;  4NBA A;  2XR8 A;  1Z01 A;  2QJY C;  2FYN C;  3L70 E;  4HM1 A;  1VCK A;  2E75 D;  2QJK C;  3AZC A;  4NBC D;  4QUQ A;  2HMM A;  4NBG D;  1O7W A;  1PPJ E;  1NYK A;  2E74 D;  4NB8 D;  4QUP A;  1NTZ E;  1O7H A;  3GL2 A;  2FYU E;  3VCP A;  1BE3 E;  1SQX E;  1VF5 D;  1G8J B;  3GTE A;  1VM9 A;  3N0Q A;  4P1C H;  1O7N A;  4NBB D;  3GOB A;  1JM1 A;  4NBH D;  4NBD D;  3GL0 A;  2E76 D;  2I7F A;  2YVJ B;  3L75 E;  1NU1 E;  4H0L D;  2DE5 A;  3L72 E;  2JZA A;  3D89 A;  4HJL A;  1P84 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...