2NVGA

Soluble domain of rieske iron sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGAHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvgA00
1ULIA 1NTKE 4NBDD 2DE5D 4NBGD 2XR8A 2JZAA 4OGQD 3L72E 3TGUE 2BMRA 2YFIA 1L0LE 2JO6A 2QJKC 1O7MA 4P1CH 2GBXA 1VF5D 1BCCE 2NVFA 4QURA 2HMOA 1NU1E 2NVEA 3GB4A 1G8JB 3VMID 3EN1A 2B1XA 3CWBE 1RFSA 1FQTA 2HMNA 4NB9D 5KLIC 2DE7D 1O7PA 4HM4A 4H13D 3H1JE 1EG9A 3VMHD 4QUQA 2FYNC 5KKZC 1SQPE 5HL4A 2XRXA 1P84E 2HMJA 3L74E 1ZRTE 3BCCE 1PPJE 1O7HA 2A06E 1SQBE 4HM7A 3GKEA 1KYOE 4PV1D 3GTEA 3H1IE 4U3FE 2NUKA 2E4QA 2YFJA 1JM1A 2HMMA 3GCEA 3GOBA 3GZYA 4QDCA 4P1BH 3CX5E 1O7NA 2YVJB 1SJGA 3H1KE 1G8KB 4AAYB 2IBZE 2FYUE 1EZVE 1SQXE 5CXMA 5BOKA 3GZXA 1O7GA 2QPZA 2E74D 4HM6A 2NUMA 2B24A 2I7FA 4HM8A 1VM9A 3FOUA 4NB8D 2HMKA 4AIVA 2QJPC 4QCKA 2E4PA 4HM5A 4HM0A 4NBCD 2XSHA 2CKFA 2YFLA 2YIUC 3GL0A 1SQQE 3GL2A 1SQVE 2Q3WA 3D89A 4NBED 1KB9E 1NTZE 2E76D 3N0QA 1UUVA 2BCCE 5KLVE 1BE3E 4HM3A 2QJYC 1RIEA 2BMOA 2HMLA 4NBHD 1ULJA 4H0LD 4HM1A 2NVGA 2E75D 4H44D 3CXHE 3H1HE 4NBAD 1L0NE 3H1LE 4QDFA 4QDDA 3EQQA 1O7WA 3DQYA 1NYKA 1PP9E 3VCPA 3GTSA 2DE6D 2NWFA 4PD4E 3L73E 4HM2A 3AZCA 4QUPA 4HJLA 1UUWA 1NDOA 3L71E 4HKVA 3C0DA 3VMGD 3L70E 4QDFB 1VCKA 5AEUA 1Q90C 2ZT9D 2D2CD 1NTME 4EMJB 5AEWA 4NBFD 4NBBD 2GBWA 2ZYLA 3L75E 3VCAA 2XSOA 1WQLA 2BMQA
chains in the Genus database with same CATH superfamily
1ULIA 1NTKE 4NBDD 2DE5D 4NBGD 2XR8A 2JZAA 4OGQD 3L72E 3TGUE 2BMRA 2YFIA 1L0LE 2JO6A 2QJKC 1O7MA 4P1CH 2GBXA 1VF5D 1BCCE 2NVFA 4QURA 2HMOA 1NU1E 2NVEA 3GB4A 1G8JB 3VMID 3EN1A 2B1XA 3CWBE 1RFSA 1FQTA 2HMNA 4NB9D 5KLIC 2DE7D 1O7PA 4HM4A 4H13D 3H1JE 1EG9A 3VMHD 4QUQA 2FYNC 5KKZC 1SQPE 5HL4A 2XRXA 1P84E 2HMJA 3L74E 1ZRTE 3BCCE 1PPJE 1O7HA 2A06E 1SQBE 4HM7A 3GKEA 1KYOE 4PV1D 3GTEA 3H1IE 4U3FE 2NUKA 2E4QA 2YFJA 1JM1A 2HMMA 3GCEA 3GOBA 3GZYA 4QDCA 4P1BH 3CX5E 1O7NA 2YVJB 1SJGA 3H1KE 1G8KB 4AAYB 2IBZE 2FYUE 1EZVE 1SQXE 5CXMA 5BOKA 3GZXA 1O7GA 2QPZA 2E74D 4HM6A 2NUMA 2B24A 2I7FA 4HM8A 1VM9A 3FOUA 4NB8D 2HMKA 4AIVA 2QJPC 4QCKA 2E4PA 4HM5A 4HM0A 4NBCD 2XSHA 2CKFA 2YFLA 2YIUC 3GL0A 1SQQE 3GL2A 1SQVE 2Q3WA 3D89A 4NBED 1KB9E 1NTZE 2E76D 3N0QA 1UUVA 2BCCE 5KLVE 1BE3E 4HM3A 2QJYC 1RIEA 2BMOA 2HMLA 4NBHD 1ULJA 4H0LD 4HM1A 2NVGA 2E75D 4H44D 3CXHE 3H1HE 4NBAD 1L0NE 3H1LE 4QDFA 4QDDA 3EQQA 1O7WA 3DQYA 1NYKA 1PP9E 3VCPA 3GTSA 2DE6D 2NWFA 4PD4E 3L73E 4HM2A 3AZCA 4QUPA 4HJLA 1UUWA 1NDOA 3L71E 4HKVA 3C0DA 3VMGD 3L70E 4QDFB 1VCKA 5AEUA 1Q90C 2ZT9D 2D2CD 1NTME 4EMJB 5AEWA 4NBFD 4NBBD 2GBWA 2ZYLA 3L75E 3VCAA 2XSOA 1WQLA 2BMQA
chains in the Genus database with same CATH topology
1ULIA 1NTKE 4NBDD 2DE5D 4NBGD 2XR8A 2JZAA 4OGQD 3L72E 3TGUE 2BMRA 2YFIA 1L0LE 2JO6A 2QJKC 1O7MA 4P1CH 2GBXA 1VF5D 1BCCE 2NVFA 4QURA 2HMOA 1NU1E 2NVEA 3GB4A 1G8JB 3VMID 3EN1A 2B1XA 3CWBE 1RFSA 1FQTA 2HMNA 4NB9D 5KLIC 2DE7D 1O7PA 4HM4A 4H13D 3H1JE 1EG9A 3VMHD 4QUQA 2FYNC 5KKZC 1SQPE 5HL4A 2XRXA 1P84E 2HMJA 3L74E 1ZRTE 3BCCE 1PPJE 1O7HA 2A06E 1SQBE 4HM7A 3GKEA 1KYOE 4PV1D 3GTEA 3H1IE 4U3FE 2NUKA 2E4QA 2YFJA 1JM1A 2HMMA 3GCEA 3GOBA 3GZYA 4QDCA 4P1BH 3CX5E 1O7NA 2YVJB 1SJGA 3H1KE 1G8KB 4AAYB 2IBZE 2FYUE 1EZVE 1SQXE 5CXMA 5BOKA 3GZXA 1O7GA 2QPZA 2E74D 4HM6A 2NUMA 2B24A 2I7FA 4HM8A 1VM9A 3FOUA 4NB8D 2HMKA 4AIVA 2QJPC 4QCKA 2E4PA 4HM5A 4HM0A 4NBCD 2XSHA 2CKFA 2YFLA 2YIUC 3GL0A 1SQQE 3GL2A 1SQVE 2Q3WA 3D89A 4NBED 1KB9E 1NTZE 2E76D 3N0QA 1UUVA 2BCCE 5KLVE 1BE3E 4HM3A 2QJYC 1RIEA 2BMOA 2HMLA 4NBHD 1ULJA 4H0LD 4HM1A 2NVGA 2E75D 4H44D 3CXHE 3H1HE 4NBAD 1L0NE 3H1LE 4QDFA 4QDDA 3EQQA 1O7WA 3DQYA 1NYKA 1PP9E 3VCPA 3GTSA 2DE6D 2NWFA 4PD4E 3L73E 4HM2A 3AZCA 4QUPA 4HJLA 1UUWA 1NDOA 3L71E 4HKVA 3C0DA 3VMGD 3L70E 4QDFB 1VCKA 5AEUA 1Q90C 2ZT9D 2D2CD 1NTME 4EMJB 5AEWA 4NBFD 4NBBD 2GBWA 2ZYLA 3L75E 3VCAA 2XSOA 1WQLA 2BMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI A;  1NTK E;  4NBD D;  2DE5 D;  4NBG D;  2XR8 A;  2JZA A;  4OGQ D;  3L72 E;  3TGU E;  2BMR A;  2YFI A;  1L0L E;  2JO6 A;  2QJK C;  1O7M A;  4P1C H;  2GBX A;  1VF5 D;  1BCC E;  2NVF A;  4QUR A;  2HMO A;  1NU1 E;  2NVE A;  3GB4 A;  1G8J B;  3VMI D;  3EN1 A;  2B1X A;  3CWB E;  1RFS A;  1FQT A;  2HMN A;  4NB9 D;  5KLI C;  2DE7 D;  1O7P A;  4HM4 A;  4H13 D;  3H1J E;  1EG9 A;  3VMH D;  4QUQ A;  2FYN C;  5KKZ C;  1SQP E;  5HL4 A;  2XRX A;  1P84 E;  2HMJ A;  3L74 E;  1ZRT E;  3BCC E;  1PPJ E;  1O7H A;  2A06 E;  1SQB E;  4HM7 A;  3GKE A;  1KYO E;  4PV1 D;  3GTE A;  3H1I E;  4U3F E;  2NUK A;  2E4Q A;  2YFJ A;  1JM1 A;  2HMM A;  3GCE A;  3GOB A;  3GZY A;  4QDC A;  4P1B H;  3CX5 E;  1O7N A;  2YVJ B;  1SJG A;  3H1K E;  1G8K B;  4AAY B;  2IBZ E;  2FYU E;  1EZV E;  1SQX E;  5CXM A;  5BOK A;  3GZX A;  1O7G A;  2QPZ A;  2E74 D;  4HM6 A;  2NUM A;  2B24 A;  2I7F A;  4HM8 A;  1VM9 A;  3FOU A;  4NB8 D;  2HMK A;  4AIV A;  2QJP C;  4QCK A;  2E4P A;  4HM5 A;  4HM0 A;  4NBC D;  2XSH A;  2CKF A;  2YFL A;  2YIU C;  3GL0 A;  1SQQ E;  3GL2 A;  1SQV E;  2Q3W A;  3D89 A;  4NBE D;  1KB9 E;  1NTZ E;  2E76 D;  3N0Q A;  1UUV A;  2BCC E;  5KLV E;  1BE3 E;  4HM3 A;  2QJY C;  1RIE A;  2BMO A;  2HML A;  4NBH D;  1ULJ A;  4H0L D;  4HM1 A;  2NVG A;  2E75 D;  4H44 D;  3CXH E;  3H1H E;  4NBA D;  1L0N E;  3H1L E;  4QDF A;  4QDD A;  3EQQ A;  1O7W A;  3DQY A;  1NYK A;  1PP9 E;  3VCP A;  3GTS A;  2DE6 D;  2NWF A;  4PD4 E;  3L73 E;  4HM2 A;  3AZC A;  4QUP A;  4HJL A;  1UUW A;  1NDO A;  3L71 E;  4HKV A;  3C0D A;  3VMG D;  3L70 E;  4QDF B;  1VCK A;  5AEU A;  1Q90 C;  2ZT9 D;  2D2C D;  1NTM E;  4EMJ B;  5AEW A;  4NBF D;  4NBB D;  2GBW A;  2ZYL A;  3L75 E;  3VCA A;  2XSO A;  1WQL A;  2BMQ A; 
#chains in the Genus database with same CATH topology
 1ULI A;  1NTK E;  4NBD D;  2DE5 D;  4NBG D;  2XR8 A;  2JZA A;  4OGQ D;  3L72 E;  3TGU E;  2BMR A;  2YFI A;  1L0L E;  2JO6 A;  2QJK C;  1O7M A;  4P1C H;  2GBX A;  1VF5 D;  1BCC E;  2NVF A;  4QUR A;  2HMO A;  1NU1 E;  2NVE A;  3GB4 A;  1G8J B;  3VMI D;  3EN1 A;  2B1X A;  3CWB E;  1RFS A;  1FQT A;  2HMN A;  4NB9 D;  5KLI C;  2DE7 D;  1O7P A;  4HM4 A;  4H13 D;  3H1J E;  1EG9 A;  3VMH D;  4QUQ A;  2FYN C;  5KKZ C;  1SQP E;  5HL4 A;  2XRX A;  1P84 E;  2HMJ A;  3L74 E;  1ZRT E;  3BCC E;  1PPJ E;  1O7H A;  2A06 E;  1SQB E;  4HM7 A;  3GKE A;  1KYO E;  4PV1 D;  3GTE A;  3H1I E;  4U3F E;  2NUK A;  2E4Q A;  2YFJ A;  1JM1 A;  2HMM A;  3GCE A;  3GOB A;  3GZY A;  4QDC A;  4P1B H;  3CX5 E;  1O7N A;  2YVJ B;  1SJG A;  3H1K E;  1G8K B;  4AAY B;  2IBZ E;  2FYU E;  1EZV E;  1SQX E;  5CXM A;  5BOK A;  3GZX A;  1O7G A;  2QPZ A;  2E74 D;  4HM6 A;  2NUM A;  2B24 A;  2I7F A;  4HM8 A;  1VM9 A;  3FOU A;  4NB8 D;  2HMK A;  4AIV A;  2QJP C;  4QCK A;  2E4P A;  4HM5 A;  4HM0 A;  4NBC D;  2XSH A;  2CKF A;  2YFL A;  2YIU C;  3GL0 A;  1SQQ E;  3GL2 A;  1SQV E;  2Q3W A;  3D89 A;  4NBE D;  1KB9 E;  1NTZ E;  2E76 D;  3N0Q A;  1UUV A;  2BCC E;  5KLV E;  1BE3 E;  4HM3 A;  2QJY C;  1RIE A;  2BMO A;  2HML A;  4NBH D;  1ULJ A;  4H0L D;  4HM1 A;  2NVG A;  2E75 D;  4H44 D;  3CXH E;  3H1H E;  4NBA D;  1L0N E;  3H1L E;  4QDF A;  4QDD A;  3EQQ A;  1O7W A;  3DQY A;  1NYK A;  1PP9 E;  3VCP A;  3GTS A;  2DE6 D;  2NWF A;  4PD4 E;  3L73 E;  4HM2 A;  3AZC A;  4QUP A;  4HJL A;  1UUW A;  1NDO A;  3L71 E;  4HKV A;  3C0D A;  3VMG D;  3L70 E;  4QDF B;  1VCK A;  5AEU A;  1Q90 C;  2ZT9 D;  2D2C D;  1NTM E;  4EMJ B;  5AEW A;  4NBF D;  4NBB D;  2GBW A;  2ZYL A;  3L75 E;  3VCA A;  2XSO A;  1WQL A;  2BMQ A; 
#chains in the Genus database with same CATH homology
 1ULI A;  1NTK E;  4NBD D;  2DE5 D;  4NBG D;  2XR8 A;  2JZA A;  4OGQ D;  3L72 E;  3TGU E;  2BMR A;  2YFI A;  1L0L E;  2JO6 A;  2QJK C;  1O7M A;  4P1C H;  2GBX A;  1VF5 D;  1BCC E;  2NVF A;  4QUR A;  2HMO A;  1NU1 E;  2NVE A;  3GB4 A;  1G8J B;  3VMI D;  3EN1 A;  2B1X A;  3CWB E;  1RFS A;  1FQT A;  2HMN A;  4NB9 D;  5KLI C;  2DE7 D;  1O7P A;  4HM4 A;  4H13 D;  3H1J E;  1EG9 A;  3VMH D;  4QUQ A;  2FYN C;  5KKZ C;  1SQP E;  5HL4 A;  2XRX A;  1P84 E;  2HMJ A;  3L74 E;  1ZRT E;  3BCC E;  1PPJ E;  1O7H A;  2A06 E;  1SQB E;  4HM7 A;  3GKE A;  1KYO E;  4PV1 D;  3GTE A;  3H1I E;  4U3F E;  2NUK A;  2E4Q A;  2YFJ A;  1JM1 A;  2HMM A;  3GCE A;  3GOB A;  3GZY A;  4QDC A;  4P1B H;  3CX5 E;  1O7N A;  2YVJ B;  1SJG A;  3H1K E;  1G8K B;  4AAY B;  2IBZ E;  2FYU E;  1EZV E;  1SQX E;  5CXM A;  5BOK A;  3GZX A;  1O7G A;  2QPZ A;  2E74 D;  4HM6 A;  2NUM A;  2B24 A;  2I7F A;  4HM8 A;  1VM9 A;  3FOU A;  4NB8 D;  2HMK A;  4AIV A;  2QJP C;  4QCK A;  2E4P A;  4HM5 A;  4HM0 A;  4NBC D;  2XSH A;  2CKF A;  2YFL A;  2YIU C;  3GL0 A;  1SQQ E;  3GL2 A;  1SQV E;  2Q3W A;  3D89 A;  4NBE D;  1KB9 E;  1NTZ E;  2E76 D;  3N0Q A;  1UUV A;  2BCC E;  5KLV E;  1BE3 E;  4HM3 A;  2QJY C;  1RIE A;  2BMO A;  2HML A;  4NBH D;  1ULJ A;  4H0L D;  4HM1 A;  2NVG A;  2E75 D;  4H44 D;  3CXH E;  3H1H E;  4NBA D;  1L0N E;  3H1L E;  4QDF A;  4QDD A;  3EQQ A;  1O7W A;  3DQY A;  1NYK A;  1PP9 E;  3VCP A;  3GTS A;  2DE6 D;  2NWF A;  4PD4 E;  3L73 E;  4HM2 A;  3AZC A;  4QUP A;  4HJL A;  1UUW A;  1NDO A;  3L71 E;  4HKV A;  3C0D A;  3VMG D;  3L70 E;  4QDF B;  1VCK A;  5AEU A;  1Q90 C;  2ZT9 D;  2D2C D;  1NTM E;  4EMJ B;  5AEW A;  4NBF D;  4NBB D;  2GBW A;  2ZYL A;  3L75 E;  3VCA A;  2XSO A;  1WQL A;  2BMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...