2NVGA

Soluble domain of rieske iron sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGAHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvgA00
3VMID 2YIUC 3FOUA 2FYNC 2GBXA 1Q90C 3H1HE 3N0QA 4QCKA 1JM1A 1NTZE 1O7MA 4HKVA 1O7PA 4HM8A 2GBWA 3VCAA 1SJGA 1L0LE 2E4PA 3CWBE 3H1IE 3VCPA 1O7HA 1SQBE 2HMJA 3BCCE 3L75E 2ZT9D 2HMLA 3VMHD 1VF5D 2YFLA 3GL2A 1P84E 4NB8D 2QJKC 1EZVE 4HM3A 4HM4A 4NBGD 1G8KB 4NBCD 2BMOA 2BMRA 4QDCA 3AZCA 2IBZE 1EG9A 2XSOA 3CXHE 3GB4A 1NU1E 2BMQA 2XRXA 4NBED 1G8JB 2NVGA 5KLIC 3L72E 2A06E 4HM1A 2DE7D 3GZYA 4NBDD 1NTME 2B1XA 1UUWA 3GKEA 2DE6D 3C0DA 4NBFD 5HL4A 4PD4E 4HM6A 4P1BH 3GOBA 3EN1A 1O7WA 1O7NA 4QUQA 3L71E 2E75D 1SQQE 3H1LE 2B24A 2DE5D 4QDFA 1ULIA 3D89A 2NVEA 2NUMA 2ZYLA 2JO6A 3GZXA 1O7GA 2E4QA 3GTSA 3TGUE 2E74D 4EMJB 3H1KE 1WQLA 1BE3E 1KYOE 4NB9D 3GCEA 5KLVE 3H1JE 2JZAA 1SQXE 4H0LD 4PV1D 4QURA 5CXMA 1NTKE 1PPJE 1UUVA 2NWFA 3EQQA 2XR8A 3CX5E 1VCKA 2E76D 4NBHD 4HM5A 4HM7A 2HMNA 2NUKA 4QDDA 4AAYB 2D2CD 1KB9E 1FQTA 2YFJA 1NDOA 2QPZA 3GTEA 1L0NE 1RFSA 4P1CH 5KKZC 2I7FA 1PP9E 3VMGD 4QUPA 1NYKA 2XSHA 3L74E 2NVFA 2HMKA 2Q3WA 3L70E 4H44D 5BOKA 1BCCE 4NBAD 1RIEA 1SQPE 2QJPC 4H13D 2HMOA 2QJYC 4HJLA 3DQYA 4HM2A 5AEUA 2BCCE 4QDFB 4AIVA 1ZRTE 4HM0A 1SQVE 2CKFA 2YVJB 3L73E 2FYUE 4U3FE 2HMMA 2YFIA 4OGQD 1VM9A 1ULJA 4NBBD 3GL0A 5AEWA
chains in the Genus database with same CATH superfamily
3VMID 2YIUC 3FOUA 2FYNC 2GBXA 1Q90C 3H1HE 3N0QA 4QCKA 1JM1A 1NTZE 1O7MA 4HKVA 1O7PA 4HM8A 2GBWA 3VCAA 1SJGA 1L0LE 2E4PA 3CWBE 3H1IE 3VCPA 1O7HA 1SQBE 2HMJA 3BCCE 3L75E 2ZT9D 2HMLA 3VMHD 1VF5D 2YFLA 3GL2A 1P84E 4NB8D 2QJKC 1EZVE 4HM3A 4HM4A 4NBGD 1G8KB 4NBCD 2BMOA 2BMRA 4QDCA 3AZCA 2IBZE 1EG9A 2XSOA 3CXHE 3GB4A 1NU1E 2BMQA 2XRXA 4NBED 1G8JB 2NVGA 5KLIC 3L72E 2A06E 4HM1A 2DE7D 3GZYA 4NBDD 1NTME 2B1XA 1UUWA 3GKEA 2DE6D 3C0DA 4NBFD 5HL4A 4PD4E 4HM6A 4P1BH 3GOBA 3EN1A 1O7WA 1O7NA 4QUQA 3L71E 2E75D 1SQQE 3H1LE 2B24A 2DE5D 4QDFA 1ULIA 3D89A 2NVEA 2NUMA 2ZYLA 2JO6A 3GZXA 1O7GA 2E4QA 3GTSA 3TGUE 2E74D 4EMJB 3H1KE 1WQLA 1BE3E 1KYOE 4NB9D 3GCEA 5KLVE 3H1JE 2JZAA 1SQXE 4H0LD 4PV1D 4QURA 5CXMA 1NTKE 1PPJE 1UUVA 2NWFA 3EQQA 2XR8A 3CX5E 1VCKA 2E76D 4NBHD 4HM5A 4HM7A 2HMNA 2NUKA 4QDDA 4AAYB 2D2CD 1KB9E 1FQTA 2YFJA 1NDOA 2QPZA 3GTEA 1L0NE 1RFSA 4P1CH 5KKZC 2I7FA 1PP9E 3VMGD 4QUPA 1NYKA 2XSHA 3L74E 2NVFA 2HMKA 2Q3WA 3L70E 4H44D 5BOKA 1BCCE 4NBAD 1RIEA 1SQPE 2QJPC 4H13D 2HMOA 2QJYC 4HJLA 3DQYA 4HM2A 5AEUA 2BCCE 4QDFB 4AIVA 1ZRTE 4HM0A 1SQVE 2CKFA 2YVJB 3L73E 2FYUE 4U3FE 2HMMA 2YFIA 4OGQD 1VM9A 1ULJA 4NBBD 3GL0A 5AEWA
chains in the Genus database with same CATH topology
3VMID 2YIUC 3FOUA 2FYNC 2GBXA 1Q90C 3H1HE 3N0QA 4QCKA 1JM1A 1NTZE 1O7MA 4HKVA 1O7PA 4HM8A 2GBWA 3VCAA 1SJGA 1L0LE 2E4PA 3CWBE 3H1IE 3VCPA 1O7HA 1SQBE 2HMJA 3BCCE 3L75E 2ZT9D 2HMLA 3VMHD 1VF5D 2YFLA 3GL2A 1P84E 4NB8D 2QJKC 1EZVE 4HM3A 4HM4A 4NBGD 1G8KB 4NBCD 2BMOA 2BMRA 4QDCA 3AZCA 2IBZE 1EG9A 2XSOA 3CXHE 3GB4A 1NU1E 2BMQA 2XRXA 4NBED 1G8JB 2NVGA 5KLIC 3L72E 2A06E 4HM1A 2DE7D 3GZYA 4NBDD 1NTME 2B1XA 1UUWA 3GKEA 2DE6D 3C0DA 4NBFD 5HL4A 4PD4E 4HM6A 4P1BH 3GOBA 3EN1A 1O7WA 1O7NA 4QUQA 3L71E 2E75D 1SQQE 3H1LE 2B24A 2DE5D 4QDFA 1ULIA 3D89A 2NVEA 2NUMA 2ZYLA 2JO6A 3GZXA 1O7GA 2E4QA 3GTSA 3TGUE 2E74D 4EMJB 3H1KE 1WQLA 1BE3E 1KYOE 4NB9D 3GCEA 5KLVE 3H1JE 2JZAA 1SQXE 4H0LD 4PV1D 4QURA 5CXMA 1NTKE 1PPJE 1UUVA 2NWFA 3EQQA 2XR8A 3CX5E 1VCKA 2E76D 4NBHD 4HM5A 4HM7A 2HMNA 2NUKA 4QDDA 4AAYB 2D2CD 1KB9E 1FQTA 2YFJA 1NDOA 2QPZA 3GTEA 1L0NE 1RFSA 4P1CH 5KKZC 2I7FA 1PP9E 3VMGD 4QUPA 1NYKA 2XSHA 3L74E 2NVFA 2HMKA 2Q3WA 3L70E 4H44D 5BOKA 1BCCE 4NBAD 1RIEA 1SQPE 2QJPC 4H13D 2HMOA 2QJYC 4HJLA 3DQYA 4HM2A 5AEUA 2BCCE 4QDFB 4AIVA 1ZRTE 4HM0A 1SQVE 2CKFA 2YVJB 3L73E 2FYUE 4U3FE 2HMMA 2YFIA 4OGQD 1VM9A 1ULJA 4NBBD 3GL0A 5AEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI D;  2YIU C;  3FOU A;  2FYN C;  2GBX A;  1Q90 C;  3H1H E;  3N0Q A;  4QCK A;  1JM1 A;  1NTZ E;  1O7M A;  4HKV A;  1O7P A;  4HM8 A;  2GBW A;  3VCA A;  1SJG A;  1L0L E;  2E4P A;  3CWB E;  3H1I E;  3VCP A;  1O7H A;  1SQB E;  2HMJ A;  3BCC E;  3L75 E;  2ZT9 D;  2HML A;  3VMH D;  1VF5 D;  2YFL A;  3GL2 A;  1P84 E;  4NB8 D;  2QJK C;  1EZV E;  4HM3 A;  4HM4 A;  4NBG D;  1G8K B;  4NBC D;  2BMO A;  2BMR A;  4QDC A;  3AZC A;  2IBZ E;  1EG9 A;  2XSO A;  3CXH E;  3GB4 A;  1NU1 E;  2BMQ A;  2XRX A;  4NBE D;  1G8J B;  2NVG A;  5KLI C;  3L72 E;  2A06 E;  4HM1 A;  2DE7 D;  3GZY A;  4NBD D;  1NTM E;  2B1X A;  1UUW A;  3GKE A;  2DE6 D;  3C0D A;  4NBF D;  5HL4 A;  4PD4 E;  4HM6 A;  4P1B H;  3GOB A;  3EN1 A;  1O7W A;  1O7N A;  4QUQ A;  3L71 E;  2E75 D;  1SQQ E;  3H1L E;  2B24 A;  2DE5 D;  4QDF A;  1ULI A;  3D89 A;  2NVE A;  2NUM A;  2ZYL A;  2JO6 A;  3GZX A;  1O7G A;  2E4Q A;  3GTS A;  3TGU E;  2E74 D;  4EMJ B;  3H1K E;  1WQL A;  1BE3 E;  1KYO E;  4NB9 D;  3GCE A;  5KLV E;  3H1J E;  2JZA A;  1SQX E;  4H0L D;  4PV1 D;  4QUR A;  5CXM A;  1NTK E;  1PPJ E;  1UUV A;  2NWF A;  3EQQ A;  2XR8 A;  3CX5 E;  1VCK A;  2E76 D;  4NBH D;  4HM5 A;  4HM7 A;  2HMN A;  2NUK A;  4QDD A;  4AAY B;  2D2C D;  1KB9 E;  1FQT A;  2YFJ A;  1NDO A;  2QPZ A;  3GTE A;  1L0N E;  1RFS A;  4P1C H;  5KKZ C;  2I7F A;  1PP9 E;  3VMG D;  4QUP A;  1NYK A;  2XSH A;  3L74 E;  2NVF A;  2HMK A;  2Q3W A;  3L70 E;  4H44 D;  5BOK A;  1BCC E;  4NBA D;  1RIE A;  1SQP E;  2QJP C;  4H13 D;  2HMO A;  2QJY C;  4HJL A;  3DQY A;  4HM2 A;  5AEU A;  2BCC E;  4QDF B;  4AIV A;  1ZRT E;  4HM0 A;  1SQV E;  2CKF A;  2YVJ B;  3L73 E;  2FYU E;  4U3F E;  2HMM A;  2YFI A;  4OGQ D;  1VM9 A;  1ULJ A;  4NBB D;  3GL0 A;  5AEW A; 
#chains in the Genus database with same CATH topology
 3VMI D;  2YIU C;  3FOU A;  2FYN C;  2GBX A;  1Q90 C;  3H1H E;  3N0Q A;  4QCK A;  1JM1 A;  1NTZ E;  1O7M A;  4HKV A;  1O7P A;  4HM8 A;  2GBW A;  3VCA A;  1SJG A;  1L0L E;  2E4P A;  3CWB E;  3H1I E;  3VCP A;  1O7H A;  1SQB E;  2HMJ A;  3BCC E;  3L75 E;  2ZT9 D;  2HML A;  3VMH D;  1VF5 D;  2YFL A;  3GL2 A;  1P84 E;  4NB8 D;  2QJK C;  1EZV E;  4HM3 A;  4HM4 A;  4NBG D;  1G8K B;  4NBC D;  2BMO A;  2BMR A;  4QDC A;  3AZC A;  2IBZ E;  1EG9 A;  2XSO A;  3CXH E;  3GB4 A;  1NU1 E;  2BMQ A;  2XRX A;  4NBE D;  1G8J B;  2NVG A;  5KLI C;  3L72 E;  2A06 E;  4HM1 A;  2DE7 D;  3GZY A;  4NBD D;  1NTM E;  2B1X A;  1UUW A;  3GKE A;  2DE6 D;  3C0D A;  4NBF D;  5HL4 A;  4PD4 E;  4HM6 A;  4P1B H;  3GOB A;  3EN1 A;  1O7W A;  1O7N A;  4QUQ A;  3L71 E;  2E75 D;  1SQQ E;  3H1L E;  2B24 A;  2DE5 D;  4QDF A;  1ULI A;  3D89 A;  2NVE A;  2NUM A;  2ZYL A;  2JO6 A;  3GZX A;  1O7G A;  2E4Q A;  3GTS A;  3TGU E;  2E74 D;  4EMJ B;  3H1K E;  1WQL A;  1BE3 E;  1KYO E;  4NB9 D;  3GCE A;  5KLV E;  3H1J E;  2JZA A;  1SQX E;  4H0L D;  4PV1 D;  4QUR A;  5CXM A;  1NTK E;  1PPJ E;  1UUV A;  2NWF A;  3EQQ A;  2XR8 A;  3CX5 E;  1VCK A;  2E76 D;  4NBH D;  4HM5 A;  4HM7 A;  2HMN A;  2NUK A;  4QDD A;  4AAY B;  2D2C D;  1KB9 E;  1FQT A;  2YFJ A;  1NDO A;  2QPZ A;  3GTE A;  1L0N E;  1RFS A;  4P1C H;  5KKZ C;  2I7F A;  1PP9 E;  3VMG D;  4QUP A;  1NYK A;  2XSH A;  3L74 E;  2NVF A;  2HMK A;  2Q3W A;  3L70 E;  4H44 D;  5BOK A;  1BCC E;  4NBA D;  1RIE A;  1SQP E;  2QJP C;  4H13 D;  2HMO A;  2QJY C;  4HJL A;  3DQY A;  4HM2 A;  5AEU A;  2BCC E;  4QDF B;  4AIV A;  1ZRT E;  4HM0 A;  1SQV E;  2CKF A;  2YVJ B;  3L73 E;  2FYU E;  4U3F E;  2HMM A;  2YFI A;  4OGQ D;  1VM9 A;  1ULJ A;  4NBB D;  3GL0 A;  5AEW A; 
#chains in the Genus database with same CATH homology
 3VMI D;  2YIU C;  3FOU A;  2FYN C;  2GBX A;  1Q90 C;  3H1H E;  3N0Q A;  4QCK A;  1JM1 A;  1NTZ E;  1O7M A;  4HKV A;  1O7P A;  4HM8 A;  2GBW A;  3VCA A;  1SJG A;  1L0L E;  2E4P A;  3CWB E;  3H1I E;  3VCP A;  1O7H A;  1SQB E;  2HMJ A;  3BCC E;  3L75 E;  2ZT9 D;  2HML A;  3VMH D;  1VF5 D;  2YFL A;  3GL2 A;  1P84 E;  4NB8 D;  2QJK C;  1EZV E;  4HM3 A;  4HM4 A;  4NBG D;  1G8K B;  4NBC D;  2BMO A;  2BMR A;  4QDC A;  3AZC A;  2IBZ E;  1EG9 A;  2XSO A;  3CXH E;  3GB4 A;  1NU1 E;  2BMQ A;  2XRX A;  4NBE D;  1G8J B;  2NVG A;  5KLI C;  3L72 E;  2A06 E;  4HM1 A;  2DE7 D;  3GZY A;  4NBD D;  1NTM E;  2B1X A;  1UUW A;  3GKE A;  2DE6 D;  3C0D A;  4NBF D;  5HL4 A;  4PD4 E;  4HM6 A;  4P1B H;  3GOB A;  3EN1 A;  1O7W A;  1O7N A;  4QUQ A;  3L71 E;  2E75 D;  1SQQ E;  3H1L E;  2B24 A;  2DE5 D;  4QDF A;  1ULI A;  3D89 A;  2NVE A;  2NUM A;  2ZYL A;  2JO6 A;  3GZX A;  1O7G A;  2E4Q A;  3GTS A;  3TGU E;  2E74 D;  4EMJ B;  3H1K E;  1WQL A;  1BE3 E;  1KYO E;  4NB9 D;  3GCE A;  5KLV E;  3H1J E;  2JZA A;  1SQX E;  4H0L D;  4PV1 D;  4QUR A;  5CXM A;  1NTK E;  1PPJ E;  1UUV A;  2NWF A;  3EQQ A;  2XR8 A;  3CX5 E;  1VCK A;  2E76 D;  4NBH D;  4HM5 A;  4HM7 A;  2HMN A;  2NUK A;  4QDD A;  4AAY B;  2D2C D;  1KB9 E;  1FQT A;  2YFJ A;  1NDO A;  2QPZ A;  3GTE A;  1L0N E;  1RFS A;  4P1C H;  5KKZ C;  2I7F A;  1PP9 E;  3VMG D;  4QUP A;  1NYK A;  2XSH A;  3L74 E;  2NVF A;  2HMK A;  2Q3W A;  3L70 E;  4H44 D;  5BOK A;  1BCC E;  4NBA D;  1RIE A;  1SQP E;  2QJP C;  4H13 D;  2HMO A;  2QJY C;  4HJL A;  3DQY A;  4HM2 A;  5AEU A;  2BCC E;  4QDF B;  4AIV A;  1ZRT E;  4HM0 A;  1SQV E;  2CKF A;  2YVJ B;  3L73 E;  2FYU E;  4U3F E;  2HMM A;  2YFI A;  4OGQ D;  1VM9 A;  1ULJ A;  4NBB D;  3GL0 A;  5AEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...