2NVGA

Soluble domain of rieske iron sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
b'LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGAHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvgA00
3GTSA 4PD4E 2ZT9D 3VMGD 4H44D 1NTKE 2HMLA 2NVGA 4EMJB 4HM1A 2I7FA 4NBGD 4AAYB 1NYKA 1FQTA 2CKFA 4PV1D 1NTZE 1EZVE 2HMMA 5KKZC 1UUVA 2E74D 3C0DA 2NWFA 4NB9D 1SQVE 5AEWA 3BCCE 2YFJA 1EG9A 4H13D 2A06E 3EN1A 4QDFB 2E75D 3D89A 2NUKA 2BMRA 3GOBA 1O7NA 2D2CD 4NBDD 2XRXA 3H1HE 4HM2A 3GZYA 1L0LE 2E4PA 3AZCA 2QJKC 3VMID 5KLVE 3GZXA 2ZYLA 1VCKA 3GB4A 2DE6D 2NUMA 5KLIC 1O7PA 1O7GA 3CWBE 3L73E 4NBED 1SJGA 3GTEA 2HMOA 1UUWA 2FYNC 1KYOE 2HMKA 1SQBE 5HL4A 1SQPE 2DE7D 1Q90C 2NVEA 2BMOA 1RFSA 3VMHD 3L74E 2GBWA 1ULIA 1PP9E 2B24A 4QUQA 5BOKA 2BMQA 1JM1A 4U3FE 4QDDA 2YIUC 3H1IE 1P84E 3GL0A 1BCCE 3N0QA 1NDOA 1BE3E 1KB9E 4QCKA 1RIEA 2DE5D 1SQXE 1PPJE 2HMNA 2YVJB 2HMJA 1L0NE 2XSHA 4HKVA 3L75E 4HM8A 4QUPA 2XR8A 1G8JB 3FOUA 3L71E 2GBXA 4NBHD 1O7MA 4P1BH 3TGUE 3GKEA 3H1LE 1ZRTE 2QJYC 4HM5A 4NBBD 3H1KE 2YFIA 4HM4A 3VCPA 3CXHE 1NU1E 1VF5D 2B1XA 2Q3WA 4NB8D 3VCAA 3GCEA 4HJLA 2XSOA 2E4QA 1O7HA 1WQLA 4NBCD 4AIVA 4HM6A 4P1CH 4QURA 1SQQE 2FYUE 5CXMA 1G8KB 3DQYA 3EQQA 1NTME 2QJPC 1VM9A 3GL2A 3L72E 4HM7A 3CX5E 2JZAA 1ULJA 4NBFD 4QDFA 4QDCA 3L70E 2JO6A 4H0LD 4HM0A 4NBAD 2IBZE 2QPZA 2E76D 2BCCE 5AEUA 2NVFA 4OGQD 1O7WA 3H1JE 4HM3A 2YFLA
chains in the Genus database with same CATH superfamily
3GTSA 4PD4E 2ZT9D 3VMGD 4H44D 1NTKE 2HMLA 2NVGA 4EMJB 4HM1A 2I7FA 4NBGD 4AAYB 1NYKA 1FQTA 2CKFA 4PV1D 1NTZE 1EZVE 2HMMA 5KKZC 1UUVA 2E74D 3C0DA 2NWFA 4NB9D 1SQVE 5AEWA 3BCCE 2YFJA 1EG9A 4H13D 2A06E 3EN1A 4QDFB 2E75D 3D89A 2NUKA 2BMRA 3GOBA 1O7NA 2D2CD 4NBDD 2XRXA 3H1HE 4HM2A 3GZYA 1L0LE 2E4PA 3AZCA 2QJKC 3VMID 5KLVE 3GZXA 2ZYLA 1VCKA 3GB4A 2DE6D 2NUMA 5KLIC 1O7PA 1O7GA 3CWBE 3L73E 4NBED 1SJGA 3GTEA 2HMOA 1UUWA 2FYNC 1KYOE 2HMKA 1SQBE 5HL4A 1SQPE 2DE7D 1Q90C 2NVEA 2BMOA 1RFSA 3VMHD 3L74E 2GBWA 1ULIA 1PP9E 2B24A 4QUQA 5BOKA 2BMQA 1JM1A 4U3FE 4QDDA 2YIUC 3H1IE 1P84E 3GL0A 1BCCE 3N0QA 1NDOA 1BE3E 1KB9E 4QCKA 1RIEA 2DE5D 1SQXE 1PPJE 2HMNA 2YVJB 2HMJA 1L0NE 2XSHA 4HKVA 3L75E 4HM8A 4QUPA 2XR8A 1G8JB 3FOUA 3L71E 2GBXA 4NBHD 1O7MA 4P1BH 3TGUE 3GKEA 3H1LE 1ZRTE 2QJYC 4HM5A 4NBBD 3H1KE 2YFIA 4HM4A 3VCPA 3CXHE 1NU1E 1VF5D 2B1XA 2Q3WA 4NB8D 3VCAA 3GCEA 4HJLA 2XSOA 2E4QA 1O7HA 1WQLA 4NBCD 4AIVA 4HM6A 4P1CH 4QURA 1SQQE 2FYUE 5CXMA 1G8KB 3DQYA 3EQQA 1NTME 2QJPC 1VM9A 3GL2A 3L72E 4HM7A 3CX5E 2JZAA 1ULJA 4NBFD 4QDFA 4QDCA 3L70E 2JO6A 4H0LD 4HM0A 4NBAD 2IBZE 2QPZA 2E76D 2BCCE 5AEUA 2NVFA 4OGQD 1O7WA 3H1JE 4HM3A 2YFLA
chains in the Genus database with same CATH topology
3GTSA 4PD4E 2ZT9D 3VMGD 4H44D 1NTKE 2HMLA 2NVGA 4EMJB 4HM1A 2I7FA 4NBGD 4AAYB 1NYKA 1FQTA 2CKFA 4PV1D 1NTZE 1EZVE 2HMMA 5KKZC 1UUVA 2E74D 3C0DA 2NWFA 4NB9D 1SQVE 5AEWA 3BCCE 2YFJA 1EG9A 4H13D 2A06E 3EN1A 4QDFB 2E75D 3D89A 2NUKA 2BMRA 3GOBA 1O7NA 2D2CD 4NBDD 2XRXA 3H1HE 4HM2A 3GZYA 1L0LE 2E4PA 3AZCA 2QJKC 3VMID 5KLVE 3GZXA 2ZYLA 1VCKA 3GB4A 2DE6D 2NUMA 5KLIC 1O7PA 1O7GA 3CWBE 3L73E 4NBED 1SJGA 3GTEA 2HMOA 1UUWA 2FYNC 1KYOE 2HMKA 1SQBE 5HL4A 1SQPE 2DE7D 1Q90C 2NVEA 2BMOA 1RFSA 3VMHD 3L74E 2GBWA 1ULIA 1PP9E 2B24A 4QUQA 5BOKA 2BMQA 1JM1A 4U3FE 4QDDA 2YIUC 3H1IE 1P84E 3GL0A 1BCCE 3N0QA 1NDOA 1BE3E 1KB9E 4QCKA 1RIEA 2DE5D 1SQXE 1PPJE 2HMNA 2YVJB 2HMJA 1L0NE 2XSHA 4HKVA 3L75E 4HM8A 4QUPA 2XR8A 1G8JB 3FOUA 3L71E 2GBXA 4NBHD 1O7MA 4P1BH 3TGUE 3GKEA 3H1LE 1ZRTE 2QJYC 4HM5A 4NBBD 3H1KE 2YFIA 4HM4A 3VCPA 3CXHE 1NU1E 1VF5D 2B1XA 2Q3WA 4NB8D 3VCAA 3GCEA 4HJLA 2XSOA 2E4QA 1O7HA 1WQLA 4NBCD 4AIVA 4HM6A 4P1CH 4QURA 1SQQE 2FYUE 5CXMA 1G8KB 3DQYA 3EQQA 1NTME 2QJPC 1VM9A 3GL2A 3L72E 4HM7A 3CX5E 2JZAA 1ULJA 4NBFD 4QDFA 4QDCA 3L70E 2JO6A 4H0LD 4HM0A 4NBAD 2IBZE 2QPZA 2E76D 2BCCE 5AEUA 2NVFA 4OGQD 1O7WA 3H1JE 4HM3A 2YFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTS A;  4PD4 E;  2ZT9 D;  3VMG D;  4H44 D;  1NTK E;  2HML A;  2NVG A;  4EMJ B;  4HM1 A;  2I7F A;  4NBG D;  4AAY B;  1NYK A;  1FQT A;  2CKF A;  4PV1 D;  1NTZ E;  1EZV E;  2HMM A;  5KKZ C;  1UUV A;  2E74 D;  3C0D A;  2NWF A;  4NB9 D;  1SQV E;  5AEW A;  3BCC E;  2YFJ A;  1EG9 A;  4H13 D;  2A06 E;  3EN1 A;  4QDF B;  2E75 D;  3D89 A;  2NUK A;  2BMR A;  3GOB A;  1O7N A;  2D2C D;  4NBD D;  2XRX A;  3H1H E;  4HM2 A;  3GZY A;  1L0L E;  2E4P A;  3AZC A;  2QJK C;  3VMI D;  5KLV E;  3GZX A;  2ZYL A;  1VCK A;  3GB4 A;  2DE6 D;  2NUM A;  5KLI C;  1O7P A;  1O7G A;  3CWB E;  3L73 E;  4NBE D;  1SJG A;  3GTE A;  2HMO A;  1UUW A;  2FYN C;  1KYO E;  2HMK A;  1SQB E;  5HL4 A;  1SQP E;  2DE7 D;  1Q90 C;  2NVE A;  2BMO A;  1RFS A;  3VMH D;  3L74 E;  2GBW A;  1ULI A;  1PP9 E;  2B24 A;  4QUQ A;  5BOK A;  2BMQ A;  1JM1 A;  4U3F E;  4QDD A;  2YIU C;  3H1I E;  1P84 E;  3GL0 A;  1BCC E;  3N0Q A;  1NDO A;  1BE3 E;  1KB9 E;  4QCK A;  1RIE A;  2DE5 D;  1SQX E;  1PPJ E;  2HMN A;  2YVJ B;  2HMJ A;  1L0N E;  2XSH A;  4HKV A;  3L75 E;  4HM8 A;  4QUP A;  2XR8 A;  1G8J B;  3FOU A;  3L71 E;  2GBX A;  4NBH D;  1O7M A;  4P1B H;  3TGU E;  3GKE A;  3H1L E;  1ZRT E;  2QJY C;  4HM5 A;  4NBB D;  3H1K E;  2YFI A;  4HM4 A;  3VCP A;  3CXH E;  1NU1 E;  1VF5 D;  2B1X A;  2Q3W A;  4NB8 D;  3VCA A;  3GCE A;  4HJL A;  2XSO A;  2E4Q A;  1O7H A;  1WQL A;  4NBC D;  4AIV A;  4HM6 A;  4P1C H;  4QUR A;  1SQQ E;  2FYU E;  5CXM A;  1G8K B;  3DQY A;  3EQQ A;  1NTM E;  2QJP C;  1VM9 A;  3GL2 A;  3L72 E;  4HM7 A;  3CX5 E;  2JZA A;  1ULJ A;  4NBF D;  4QDF A;  4QDC A;  3L70 E;  2JO6 A;  4H0L D;  4HM0 A;  4NBA D;  2IBZ E;  2QPZ A;  2E76 D;  2BCC E;  5AEU A;  2NVF A;  4OGQ D;  1O7W A;  3H1J E;  4HM3 A;  2YFL A; 
#chains in the Genus database with same CATH topology
 3GTS A;  4PD4 E;  2ZT9 D;  3VMG D;  4H44 D;  1NTK E;  2HML A;  2NVG A;  4EMJ B;  4HM1 A;  2I7F A;  4NBG D;  4AAY B;  1NYK A;  1FQT A;  2CKF A;  4PV1 D;  1NTZ E;  1EZV E;  2HMM A;  5KKZ C;  1UUV A;  2E74 D;  3C0D A;  2NWF A;  4NB9 D;  1SQV E;  5AEW A;  3BCC E;  2YFJ A;  1EG9 A;  4H13 D;  2A06 E;  3EN1 A;  4QDF B;  2E75 D;  3D89 A;  2NUK A;  2BMR A;  3GOB A;  1O7N A;  2D2C D;  4NBD D;  2XRX A;  3H1H E;  4HM2 A;  3GZY A;  1L0L E;  2E4P A;  3AZC A;  2QJK C;  3VMI D;  5KLV E;  3GZX A;  2ZYL A;  1VCK A;  3GB4 A;  2DE6 D;  2NUM A;  5KLI C;  1O7P A;  1O7G A;  3CWB E;  3L73 E;  4NBE D;  1SJG A;  3GTE A;  2HMO A;  1UUW A;  2FYN C;  1KYO E;  2HMK A;  1SQB E;  5HL4 A;  1SQP E;  2DE7 D;  1Q90 C;  2NVE A;  2BMO A;  1RFS A;  3VMH D;  3L74 E;  2GBW A;  1ULI A;  1PP9 E;  2B24 A;  4QUQ A;  5BOK A;  2BMQ A;  1JM1 A;  4U3F E;  4QDD A;  2YIU C;  3H1I E;  1P84 E;  3GL0 A;  1BCC E;  3N0Q A;  1NDO A;  1BE3 E;  1KB9 E;  4QCK A;  1RIE A;  2DE5 D;  1SQX E;  1PPJ E;  2HMN A;  2YVJ B;  2HMJ A;  1L0N E;  2XSH A;  4HKV A;  3L75 E;  4HM8 A;  4QUP A;  2XR8 A;  1G8J B;  3FOU A;  3L71 E;  2GBX A;  4NBH D;  1O7M A;  4P1B H;  3TGU E;  3GKE A;  3H1L E;  1ZRT E;  2QJY C;  4HM5 A;  4NBB D;  3H1K E;  2YFI A;  4HM4 A;  3VCP A;  3CXH E;  1NU1 E;  1VF5 D;  2B1X A;  2Q3W A;  4NB8 D;  3VCA A;  3GCE A;  4HJL A;  2XSO A;  2E4Q A;  1O7H A;  1WQL A;  4NBC D;  4AIV A;  4HM6 A;  4P1C H;  4QUR A;  1SQQ E;  2FYU E;  5CXM A;  1G8K B;  3DQY A;  3EQQ A;  1NTM E;  2QJP C;  1VM9 A;  3GL2 A;  3L72 E;  4HM7 A;  3CX5 E;  2JZA A;  1ULJ A;  4NBF D;  4QDF A;  4QDC A;  3L70 E;  2JO6 A;  4H0L D;  4HM0 A;  4NBA D;  2IBZ E;  2QPZ A;  2E76 D;  2BCC E;  5AEU A;  2NVF A;  4OGQ D;  1O7W A;  3H1J E;  4HM3 A;  2YFL A; 
#chains in the Genus database with same CATH homology
 3GTS A;  4PD4 E;  2ZT9 D;  3VMG D;  4H44 D;  1NTK E;  2HML A;  2NVG A;  4EMJ B;  4HM1 A;  2I7F A;  4NBG D;  4AAY B;  1NYK A;  1FQT A;  2CKF A;  4PV1 D;  1NTZ E;  1EZV E;  2HMM A;  5KKZ C;  1UUV A;  2E74 D;  3C0D A;  2NWF A;  4NB9 D;  1SQV E;  5AEW A;  3BCC E;  2YFJ A;  1EG9 A;  4H13 D;  2A06 E;  3EN1 A;  4QDF B;  2E75 D;  3D89 A;  2NUK A;  2BMR A;  3GOB A;  1O7N A;  2D2C D;  4NBD D;  2XRX A;  3H1H E;  4HM2 A;  3GZY A;  1L0L E;  2E4P A;  3AZC A;  2QJK C;  3VMI D;  5KLV E;  3GZX A;  2ZYL A;  1VCK A;  3GB4 A;  2DE6 D;  2NUM A;  5KLI C;  1O7P A;  1O7G A;  3CWB E;  3L73 E;  4NBE D;  1SJG A;  3GTE A;  2HMO A;  1UUW A;  2FYN C;  1KYO E;  2HMK A;  1SQB E;  5HL4 A;  1SQP E;  2DE7 D;  1Q90 C;  2NVE A;  2BMO A;  1RFS A;  3VMH D;  3L74 E;  2GBW A;  1ULI A;  1PP9 E;  2B24 A;  4QUQ A;  5BOK A;  2BMQ A;  1JM1 A;  4U3F E;  4QDD A;  2YIU C;  3H1I E;  1P84 E;  3GL0 A;  1BCC E;  3N0Q A;  1NDO A;  1BE3 E;  1KB9 E;  4QCK A;  1RIE A;  2DE5 D;  1SQX E;  1PPJ E;  2HMN A;  2YVJ B;  2HMJ A;  1L0N E;  2XSH A;  4HKV A;  3L75 E;  4HM8 A;  4QUP A;  2XR8 A;  1G8J B;  3FOU A;  3L71 E;  2GBX A;  4NBH D;  1O7M A;  4P1B H;  3TGU E;  3GKE A;  3H1L E;  1ZRT E;  2QJY C;  4HM5 A;  4NBB D;  3H1K E;  2YFI A;  4HM4 A;  3VCP A;  3CXH E;  1NU1 E;  1VF5 D;  2B1X A;  2Q3W A;  4NB8 D;  3VCA A;  3GCE A;  4HJL A;  2XSO A;  2E4Q A;  1O7H A;  1WQL A;  4NBC D;  4AIV A;  4HM6 A;  4P1C H;  4QUR A;  1SQQ E;  2FYU E;  5CXM A;  1G8K B;  3DQY A;  3EQQ A;  1NTM E;  2QJP C;  1VM9 A;  3GL2 A;  3L72 E;  4HM7 A;  3CX5 E;  2JZA A;  1ULJ A;  4NBF D;  4QDF A;  4QDC A;  3L70 E;  2JO6 A;  4H0L D;  4HM0 A;  4NBA D;  2IBZ E;  2QPZ A;  2E76 D;  2BCC E;  5AEU A;  2NVF A;  4OGQ D;  1O7W A;  3H1J E;  4HM3 A;  2YFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...