2NVGA

Soluble domain of rieske iron sulfur protein.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGAHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nvgA00
1ULIA 2I7FA 3VCAA 1PPJE 1VM9A 3H1JE 4EMJB 4QCKA 1G8JB 4NB8D 1O7PA 1L0LE 1UUWA 2XSOA 5AEWA 3L70E 4NBDD 3VCPA 4H13D 2HMNA 4NBAD 4NBED 2YFLA 1PP9E 4HM3A 4AIVA 1O7MA 3H1KE 1SJGA 2QJPC 4OGQD 2NVFA 4PD4E 2CKFA 4NBFD 2NVEA 3VMGD 4P1CH 3L73E 1O7HA 1SQVE 1RIEA 2NUKA 2BCCE 3AZCA 1EG9A 3GCEA 2YVJB 3EN1A 1ZRTE 3C0DA 2JO6A 2Q3WA 3DQYA 4QURA 4QUPA 3GOBA 2XSHA 1KB9E 4HM5A 1NTME 5BOKA 4HKVA 1NYKA 1O7WA 1BE3E 2FYUE 3CWBE 5HL4A 4HM8A 2NUMA 2GBWA 2HMOA 2E76D 2B1XA 4H0LD 3GZYA 1NDOA 2HMKA 2BMQA 2YFIA 3L71E 4P1BH 3EQQA 3GKEA 4HM6A 2D2CD 2E74D 1SQPE 1JM1A 2NVGA 4QDFA 3CX5E 2HMLA 1FQTA 1KYOE 3CXHE 3GL0A 2GBXA 2ZYLA 2BMRA 4HM0A 3GZXA 1NTZE 1Q90C 1WQLA 5KKZC 3FOUA 2XR8A 5AEUA 1SQBE 2E4PA 4HM1A 2ZT9D 2HMMA 1VF5D 3D89A 1VCKA 2JZAA 4PV1D 1G8KB 4NBCD 3GL2A 5KLVE 1SQQE 3L74E 4HM7A 1BCCE 2QJKC 2E4QA 3H1IE 1ULJA 2HMJA 3GTSA 1NTKE 2DE6D 4AAYB 4U3FE 2XRXA 3L75E 5CXMA 3TGUE 2DE5D 3H1HE 3BCCE 4QDCA 4NB9D 4HJLA 4QDDA 4HM4A 4NBGD 2A06E 1SQXE 2DE7D 4QDFB 1O7GA 4NBBD 2BMOA 3GTEA 3L72E 3GB4A 4QUQA 1L0NE 2NWFA 5KLIC 3VMID 2QPZA 1NU1E 2E75D 2YFJA 3H1LE 4HM2A 1RFSA 1O7NA 4NBHD 2FYNC 1UUVA 1EZVE 2IBZE 3VMHD 2QJYC 2B24A 2YIUC 4H44D 3N0QA 1P84E
chains in the Genus database with same CATH superfamily
1ULIA 2I7FA 3VCAA 1PPJE 1VM9A 3H1JE 4EMJB 4QCKA 1G8JB 4NB8D 1O7PA 1L0LE 1UUWA 2XSOA 5AEWA 3L70E 4NBDD 3VCPA 4H13D 2HMNA 4NBAD 4NBED 2YFLA 1PP9E 4HM3A 4AIVA 1O7MA 3H1KE 1SJGA 2QJPC 4OGQD 2NVFA 4PD4E 2CKFA 4NBFD 2NVEA 3VMGD 4P1CH 3L73E 1O7HA 1SQVE 1RIEA 2NUKA 2BCCE 3AZCA 1EG9A 3GCEA 2YVJB 3EN1A 1ZRTE 3C0DA 2JO6A 2Q3WA 3DQYA 4QURA 4QUPA 3GOBA 2XSHA 1KB9E 4HM5A 1NTME 5BOKA 4HKVA 1NYKA 1O7WA 1BE3E 2FYUE 3CWBE 5HL4A 4HM8A 2NUMA 2GBWA 2HMOA 2E76D 2B1XA 4H0LD 3GZYA 1NDOA 2HMKA 2BMQA 2YFIA 3L71E 4P1BH 3EQQA 3GKEA 4HM6A 2D2CD 2E74D 1SQPE 1JM1A 2NVGA 4QDFA 3CX5E 2HMLA 1FQTA 1KYOE 3CXHE 3GL0A 2GBXA 2ZYLA 2BMRA 4HM0A 3GZXA 1NTZE 1Q90C 1WQLA 5KKZC 3FOUA 2XR8A 5AEUA 1SQBE 2E4PA 4HM1A 2ZT9D 2HMMA 1VF5D 3D89A 1VCKA 2JZAA 4PV1D 1G8KB 4NBCD 3GL2A 5KLVE 1SQQE 3L74E 4HM7A 1BCCE 2QJKC 2E4QA 3H1IE 1ULJA 2HMJA 3GTSA 1NTKE 2DE6D 4AAYB 4U3FE 2XRXA 3L75E 5CXMA 3TGUE 2DE5D 3H1HE 3BCCE 4QDCA 4NB9D 4HJLA 4QDDA 4HM4A 4NBGD 2A06E 1SQXE 2DE7D 4QDFB 1O7GA 4NBBD 2BMOA 3GTEA 3L72E 3GB4A 4QUQA 1L0NE 2NWFA 5KLIC 3VMID 2QPZA 1NU1E 2E75D 2YFJA 3H1LE 4HM2A 1RFSA 1O7NA 4NBHD 2FYNC 1UUVA 1EZVE 2IBZE 3VMHD 2QJYC 2B24A 2YIUC 4H44D 3N0QA 1P84E
chains in the Genus database with same CATH topology
1ULIA 2I7FA 3VCAA 1PPJE 1VM9A 3H1JE 4EMJB 4QCKA 1G8JB 4NB8D 1O7PA 1L0LE 1UUWA 2XSOA 5AEWA 3L70E 4NBDD 3VCPA 4H13D 2HMNA 4NBAD 4NBED 2YFLA 1PP9E 4HM3A 4AIVA 1O7MA 3H1KE 1SJGA 2QJPC 4OGQD 2NVFA 4PD4E 2CKFA 4NBFD 2NVEA 3VMGD 4P1CH 3L73E 1O7HA 1SQVE 1RIEA 2NUKA 2BCCE 3AZCA 1EG9A 3GCEA 2YVJB 3EN1A 1ZRTE 3C0DA 2JO6A 2Q3WA 3DQYA 4QURA 4QUPA 3GOBA 2XSHA 1KB9E 4HM5A 1NTME 5BOKA 4HKVA 1NYKA 1O7WA 1BE3E 2FYUE 3CWBE 5HL4A 4HM8A 2NUMA 2GBWA 2HMOA 2E76D 2B1XA 4H0LD 3GZYA 1NDOA 2HMKA 2BMQA 2YFIA 3L71E 4P1BH 3EQQA 3GKEA 4HM6A 2D2CD 2E74D 1SQPE 1JM1A 2NVGA 4QDFA 3CX5E 2HMLA 1FQTA 1KYOE 3CXHE 3GL0A 2GBXA 2ZYLA 2BMRA 4HM0A 3GZXA 1NTZE 1Q90C 1WQLA 5KKZC 3FOUA 2XR8A 5AEUA 1SQBE 2E4PA 4HM1A 2ZT9D 2HMMA 1VF5D 3D89A 1VCKA 2JZAA 4PV1D 1G8KB 4NBCD 3GL2A 5KLVE 1SQQE 3L74E 4HM7A 1BCCE 2QJKC 2E4QA 3H1IE 1ULJA 2HMJA 3GTSA 1NTKE 2DE6D 4AAYB 4U3FE 2XRXA 3L75E 5CXMA 3TGUE 2DE5D 3H1HE 3BCCE 4QDCA 4NB9D 4HJLA 4QDDA 4HM4A 4NBGD 2A06E 1SQXE 2DE7D 4QDFB 1O7GA 4NBBD 2BMOA 3GTEA 3L72E 3GB4A 4QUQA 1L0NE 2NWFA 5KLIC 3VMID 2QPZA 1NU1E 2E75D 2YFJA 3H1LE 4HM2A 1RFSA 1O7NA 4NBHD 2FYNC 1UUVA 1EZVE 2IBZE 3VMHD 2QJYC 2B24A 2YIUC 4H44D 3N0QA 1P84E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULI A;  2I7F A;  3VCA A;  1PPJ E;  1VM9 A;  3H1J E;  4EMJ B;  4QCK A;  1G8J B;  4NB8 D;  1O7P A;  1L0L E;  1UUW A;  2XSO A;  5AEW A;  3L70 E;  4NBD D;  3VCP A;  4H13 D;  2HMN A;  4NBA D;  4NBE D;  2YFL A;  1PP9 E;  4HM3 A;  4AIV A;  1O7M A;  3H1K E;  1SJG A;  2QJP C;  4OGQ D;  2NVF A;  4PD4 E;  2CKF A;  4NBF D;  2NVE A;  3VMG D;  4P1C H;  3L73 E;  1O7H A;  1SQV E;  1RIE A;  2NUK A;  2BCC E;  3AZC A;  1EG9 A;  3GCE A;  2YVJ B;  3EN1 A;  1ZRT E;  3C0D A;  2JO6 A;  2Q3W A;  3DQY A;  4QUR A;  4QUP A;  3GOB A;  2XSH A;  1KB9 E;  4HM5 A;  1NTM E;  5BOK A;  4HKV A;  1NYK A;  1O7W A;  1BE3 E;  2FYU E;  3CWB E;  5HL4 A;  4HM8 A;  2NUM A;  2GBW A;  2HMO A;  2E76 D;  2B1X A;  4H0L D;  3GZY A;  1NDO A;  2HMK A;  2BMQ A;  2YFI A;  3L71 E;  4P1B H;  3EQQ A;  3GKE A;  4HM6 A;  2D2C D;  2E74 D;  1SQP E;  1JM1 A;  2NVG A;  4QDF A;  3CX5 E;  2HML A;  1FQT A;  1KYO E;  3CXH E;  3GL0 A;  2GBX A;  2ZYL A;  2BMR A;  4HM0 A;  3GZX A;  1NTZ E;  1Q90 C;  1WQL A;  5KKZ C;  3FOU A;  2XR8 A;  5AEU A;  1SQB E;  2E4P A;  4HM1 A;  2ZT9 D;  2HMM A;  1VF5 D;  3D89 A;  1VCK A;  2JZA A;  4PV1 D;  1G8K B;  4NBC D;  3GL2 A;  5KLV E;  1SQQ E;  3L74 E;  4HM7 A;  1BCC E;  2QJK C;  2E4Q A;  3H1I E;  1ULJ A;  2HMJ A;  3GTS A;  1NTK E;  2DE6 D;  4AAY B;  4U3F E;  2XRX A;  3L75 E;  5CXM A;  3TGU E;  2DE5 D;  3H1H E;  3BCC E;  4QDC A;  4NB9 D;  4HJL A;  4QDD A;  4HM4 A;  4NBG D;  2A06 E;  1SQX E;  2DE7 D;  4QDF B;  1O7G A;  4NBB D;  2BMO A;  3GTE A;  3L72 E;  3GB4 A;  4QUQ A;  1L0N E;  2NWF A;  5KLI C;  3VMI D;  2QPZ A;  1NU1 E;  2E75 D;  2YFJ A;  3H1L E;  4HM2 A;  1RFS A;  1O7N A;  4NBH D;  2FYN C;  1UUV A;  1EZV E;  2IBZ E;  3VMH D;  2QJY C;  2B24 A;  2YIU C;  4H44 D;  3N0Q A;  1P84 E; 
#chains in the Genus database with same CATH topology
 1ULI A;  2I7F A;  3VCA A;  1PPJ E;  1VM9 A;  3H1J E;  4EMJ B;  4QCK A;  1G8J B;  4NB8 D;  1O7P A;  1L0L E;  1UUW A;  2XSO A;  5AEW A;  3L70 E;  4NBD D;  3VCP A;  4H13 D;  2HMN A;  4NBA D;  4NBE D;  2YFL A;  1PP9 E;  4HM3 A;  4AIV A;  1O7M A;  3H1K E;  1SJG A;  2QJP C;  4OGQ D;  2NVF A;  4PD4 E;  2CKF A;  4NBF D;  2NVE A;  3VMG D;  4P1C H;  3L73 E;  1O7H A;  1SQV E;  1RIE A;  2NUK A;  2BCC E;  3AZC A;  1EG9 A;  3GCE A;  2YVJ B;  3EN1 A;  1ZRT E;  3C0D A;  2JO6 A;  2Q3W A;  3DQY A;  4QUR A;  4QUP A;  3GOB A;  2XSH A;  1KB9 E;  4HM5 A;  1NTM E;  5BOK A;  4HKV A;  1NYK A;  1O7W A;  1BE3 E;  2FYU E;  3CWB E;  5HL4 A;  4HM8 A;  2NUM A;  2GBW A;  2HMO A;  2E76 D;  2B1X A;  4H0L D;  3GZY A;  1NDO A;  2HMK A;  2BMQ A;  2YFI A;  3L71 E;  4P1B H;  3EQQ A;  3GKE A;  4HM6 A;  2D2C D;  2E74 D;  1SQP E;  1JM1 A;  2NVG A;  4QDF A;  3CX5 E;  2HML A;  1FQT A;  1KYO E;  3CXH E;  3GL0 A;  2GBX A;  2ZYL A;  2BMR A;  4HM0 A;  3GZX A;  1NTZ E;  1Q90 C;  1WQL A;  5KKZ C;  3FOU A;  2XR8 A;  5AEU A;  1SQB E;  2E4P A;  4HM1 A;  2ZT9 D;  2HMM A;  1VF5 D;  3D89 A;  1VCK A;  2JZA A;  4PV1 D;  1G8K B;  4NBC D;  3GL2 A;  5KLV E;  1SQQ E;  3L74 E;  4HM7 A;  1BCC E;  2QJK C;  2E4Q A;  3H1I E;  1ULJ A;  2HMJ A;  3GTS A;  1NTK E;  2DE6 D;  4AAY B;  4U3F E;  2XRX A;  3L75 E;  5CXM A;  3TGU E;  2DE5 D;  3H1H E;  3BCC E;  4QDC A;  4NB9 D;  4HJL A;  4QDD A;  4HM4 A;  4NBG D;  2A06 E;  1SQX E;  2DE7 D;  4QDF B;  1O7G A;  4NBB D;  2BMO A;  3GTE A;  3L72 E;  3GB4 A;  4QUQ A;  1L0N E;  2NWF A;  5KLI C;  3VMI D;  2QPZ A;  1NU1 E;  2E75 D;  2YFJ A;  3H1L E;  4HM2 A;  1RFS A;  1O7N A;  4NBH D;  2FYN C;  1UUV A;  1EZV E;  2IBZ E;  3VMH D;  2QJY C;  2B24 A;  2YIU C;  4H44 D;  3N0Q A;  1P84 E; 
#chains in the Genus database with same CATH homology
 1ULI A;  2I7F A;  3VCA A;  1PPJ E;  1VM9 A;  3H1J E;  4EMJ B;  4QCK A;  1G8J B;  4NB8 D;  1O7P A;  1L0L E;  1UUW A;  2XSO A;  5AEW A;  3L70 E;  4NBD D;  3VCP A;  4H13 D;  2HMN A;  4NBA D;  4NBE D;  2YFL A;  1PP9 E;  4HM3 A;  4AIV A;  1O7M A;  3H1K E;  1SJG A;  2QJP C;  4OGQ D;  2NVF A;  4PD4 E;  2CKF A;  4NBF D;  2NVE A;  3VMG D;  4P1C H;  3L73 E;  1O7H A;  1SQV E;  1RIE A;  2NUK A;  2BCC E;  3AZC A;  1EG9 A;  3GCE A;  2YVJ B;  3EN1 A;  1ZRT E;  3C0D A;  2JO6 A;  2Q3W A;  3DQY A;  4QUR A;  4QUP A;  3GOB A;  2XSH A;  1KB9 E;  4HM5 A;  1NTM E;  5BOK A;  4HKV A;  1NYK A;  1O7W A;  1BE3 E;  2FYU E;  3CWB E;  5HL4 A;  4HM8 A;  2NUM A;  2GBW A;  2HMO A;  2E76 D;  2B1X A;  4H0L D;  3GZY A;  1NDO A;  2HMK A;  2BMQ A;  2YFI A;  3L71 E;  4P1B H;  3EQQ A;  3GKE A;  4HM6 A;  2D2C D;  2E74 D;  1SQP E;  1JM1 A;  2NVG A;  4QDF A;  3CX5 E;  2HML A;  1FQT A;  1KYO E;  3CXH E;  3GL0 A;  2GBX A;  2ZYL A;  2BMR A;  4HM0 A;  3GZX A;  1NTZ E;  1Q90 C;  1WQL A;  5KKZ C;  3FOU A;  2XR8 A;  5AEU A;  1SQB E;  2E4P A;  4HM1 A;  2ZT9 D;  2HMM A;  1VF5 D;  3D89 A;  1VCK A;  2JZA A;  4PV1 D;  1G8K B;  4NBC D;  3GL2 A;  5KLV E;  1SQQ E;  3L74 E;  4HM7 A;  1BCC E;  2QJK C;  2E4Q A;  3H1I E;  1ULJ A;  2HMJ A;  3GTS A;  1NTK E;  2DE6 D;  4AAY B;  4U3F E;  2XRX A;  3L75 E;  5CXM A;  3TGU E;  2DE5 D;  3H1H E;  3BCC E;  4QDC A;  4NB9 D;  4HJL A;  4QDD A;  4HM4 A;  4NBG D;  2A06 E;  1SQX E;  2DE7 D;  4QDF B;  1O7G A;  4NBB D;  2BMO A;  3GTE A;  3L72 E;  3GB4 A;  4QUQ A;  1L0N E;  2NWF A;  5KLI C;  3VMI D;  2QPZ A;  1NU1 E;  2E75 D;  2YFJ A;  3H1L E;  4HM2 A;  1RFS A;  1O7N A;  4NBH D;  2FYN C;  1UUV A;  1EZV E;  2IBZ E;  3VMH D;  2QJY C;  2B24 A;  2YIU C;  4H44 D;  3N0Q A;  1P84 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...