1NYKA

Crystal structure of the rieske protein from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
156
structure length
156
Chain Sequence
TPEKEPLKPGDILVYAQGGGEPKPIRLEELKPGDPFVLAYPMDPKTKVVKSGEAKNTLLVARFDPEELAPEVAQHAAEGVVAYSAVCTHLGCIVSQWVADEEAALCPCHGGVYDLRHGAQVIAGPPPRPVPQLPVRVEDGVLVAAGEFLGPVGVQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Rieske iron-sulfur protein
publication title High resolution structure of the soluble, respiratory-type Rieske protein from Thermus thermophilus: Analysis and Comparison
pubmed doi rcsb
source organism Thermus thermophilus
total genus 36
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1nykA00
4HM7A 4NBGD 1NDOA 5HL4A 3GCEA 1EZVE 1VF5D 5KLVE 2E76D 5BOKA 1NU1E 1Q90C 2NVFA 1RFSA 2DE7D 2E4QA 3L71E 2YIUC 1SQPE 2ZT9D 2E75D 5CXMA 4QURA 3VMID 4NBHD 4NBAD 4NBBD 1EG9A 1NTME 4HM6A 2ZYLA 1SJGA 4HM3A 2QJKC 3C0DA 2XSHA 2B24A 2IBZE 3EN1A 2NWFA 4HM2A 4NBED 1SQXE 3VMGD 3GZYA 2E4PA 3GL0A 4HM5A 1O7MA 1VM9A 2HMMA 1BE3E 3VMHD 3CX5E 4NB9D 3VCPA 3L75E 3L73E 1NTKE 4AIVA 4HJLA 1G8KB 4H0LD 1UUWA 2DE5D 2YFJA 2QJYC 3CWBE 2A06E 3FOUA 3EQQA 2QJPC 1L0NE 4QDCA 2B1XA 1O7NA 2XRXA 2YFIA 4NBDD 3DQYA 2JZAA 1ULIA 2HMNA 3BCCE 3CXHE 3H1JE 1O7GA 4EMJB 2D2CD 1PP9E 5KKZC 2GBXA 1KB9E 2HMKA 3GOBA 3GZXA 3GL2A 5AEWA 2DE6D 2E74D 1O7HA 1SQVE 2HMOA 2XR8A 4HM0A 2CKFA 3H1IE 3GTSA 3L70E 4NBFD 1UUVA 1ZRTE 4HM4A 4HM1A 1ULJA 4HM8A 3TGUE 4OGQD 1L0LE 1VCKA 2NVEA 3GB4A 2BMQA 3H1HE 4P1CH 4AAYB 1BCCE 2I7FA 4PD4E 2GBWA 3D89A 4H13D 3H1LE 2FYNC 3L72E 2HMLA 1O7WA 2BMOA 4H44D 1JM1A 1PPJE 2BCCE 4P1BH 2QPZA 5KLIC 2NUMA 4QUPA 4U3FE 5AEUA 1KYOE 4NBCD 3L74E 4QCKA 2BMRA 3GTEA 3VCAA 4NB8D 2YVJB 1P84E 4QDFB 1RIEA 1O7PA 2Q3WA 1SQQE 2HMJA 2NVGA 2XSOA 2JO6A 3GKEA 2NUKA 4QDFA 1WQLA 4QDDA 1NTZE 2FYUE 3H1KE 3N0QA 4HKVA 1NYKA 1G8JB 3AZCA 1SQBE 4QUQA 4PV1D 2YFLA 1FQTA
chains in the Genus database with same CATH superfamily
4HM7A 4NBGD 1NDOA 5HL4A 3GCEA 1EZVE 1VF5D 5KLVE 2E76D 5BOKA 1NU1E 1Q90C 2NVFA 1RFSA 2DE7D 2E4QA 3L71E 2YIUC 1SQPE 2ZT9D 2E75D 5CXMA 4QURA 3VMID 4NBHD 4NBAD 4NBBD 1EG9A 1NTME 4HM6A 2ZYLA 1SJGA 4HM3A 2QJKC 3C0DA 2XSHA 2B24A 2IBZE 3EN1A 2NWFA 4HM2A 4NBED 1SQXE 3VMGD 3GZYA 2E4PA 3GL0A 4HM5A 1O7MA 1VM9A 2HMMA 1BE3E 3VMHD 3CX5E 4NB9D 3VCPA 3L75E 3L73E 1NTKE 4AIVA 4HJLA 1G8KB 4H0LD 1UUWA 2DE5D 2YFJA 2QJYC 3CWBE 2A06E 3FOUA 3EQQA 2QJPC 1L0NE 4QDCA 2B1XA 1O7NA 2XRXA 2YFIA 4NBDD 3DQYA 2JZAA 1ULIA 2HMNA 3BCCE 3CXHE 3H1JE 1O7GA 4EMJB 2D2CD 1PP9E 5KKZC 2GBXA 1KB9E 2HMKA 3GOBA 3GZXA 3GL2A 5AEWA 2DE6D 2E74D 1O7HA 1SQVE 2HMOA 2XR8A 4HM0A 2CKFA 3H1IE 3GTSA 3L70E 4NBFD 1UUVA 1ZRTE 4HM4A 4HM1A 1ULJA 4HM8A 3TGUE 4OGQD 1L0LE 1VCKA 2NVEA 3GB4A 2BMQA 3H1HE 4P1CH 4AAYB 1BCCE 2I7FA 4PD4E 2GBWA 3D89A 4H13D 3H1LE 2FYNC 3L72E 2HMLA 1O7WA 2BMOA 4H44D 1JM1A 1PPJE 2BCCE 4P1BH 2QPZA 5KLIC 2NUMA 4QUPA 4U3FE 5AEUA 1KYOE 4NBCD 3L74E 4QCKA 2BMRA 3GTEA 3VCAA 4NB8D 2YVJB 1P84E 4QDFB 1RIEA 1O7PA 2Q3WA 1SQQE 2HMJA 2NVGA 2XSOA 2JO6A 3GKEA 2NUKA 4QDFA 1WQLA 4QDDA 1NTZE 2FYUE 3H1KE 3N0QA 4HKVA 1NYKA 1G8JB 3AZCA 1SQBE 4QUQA 4PV1D 2YFLA 1FQTA
chains in the Genus database with same CATH topology
4HM7A 4NBGD 1NDOA 5HL4A 3GCEA 1EZVE 1VF5D 5KLVE 2E76D 5BOKA 1NU1E 1Q90C 2NVFA 1RFSA 2DE7D 2E4QA 3L71E 2YIUC 1SQPE 2ZT9D 2E75D 5CXMA 4QURA 3VMID 4NBHD 4NBAD 4NBBD 1EG9A 1NTME 4HM6A 2ZYLA 1SJGA 4HM3A 2QJKC 3C0DA 2XSHA 2B24A 2IBZE 3EN1A 2NWFA 4HM2A 4NBED 1SQXE 3VMGD 3GZYA 2E4PA 3GL0A 4HM5A 1O7MA 1VM9A 2HMMA 1BE3E 3VMHD 3CX5E 4NB9D 3VCPA 3L75E 3L73E 1NTKE 4AIVA 4HJLA 1G8KB 4H0LD 1UUWA 2DE5D 2YFJA 2QJYC 3CWBE 2A06E 3FOUA 3EQQA 2QJPC 1L0NE 4QDCA 2B1XA 1O7NA 2XRXA 2YFIA 4NBDD 3DQYA 2JZAA 1ULIA 2HMNA 3BCCE 3CXHE 3H1JE 1O7GA 4EMJB 2D2CD 1PP9E 5KKZC 2GBXA 1KB9E 2HMKA 3GOBA 3GZXA 3GL2A 5AEWA 2DE6D 2E74D 1O7HA 1SQVE 2HMOA 2XR8A 4HM0A 2CKFA 3H1IE 3GTSA 3L70E 4NBFD 1UUVA 1ZRTE 4HM4A 4HM1A 1ULJA 4HM8A 3TGUE 4OGQD 1L0LE 1VCKA 2NVEA 3GB4A 2BMQA 3H1HE 4P1CH 4AAYB 1BCCE 2I7FA 4PD4E 2GBWA 3D89A 4H13D 3H1LE 2FYNC 3L72E 2HMLA 1O7WA 2BMOA 4H44D 1JM1A 1PPJE 2BCCE 4P1BH 2QPZA 5KLIC 2NUMA 4QUPA 4U3FE 5AEUA 1KYOE 4NBCD 3L74E 4QCKA 2BMRA 3GTEA 3VCAA 4NB8D 2YVJB 1P84E 4QDFB 1RIEA 1O7PA 2Q3WA 1SQQE 2HMJA 2NVGA 2XSOA 2JO6A 3GKEA 2NUKA 4QDFA 1WQLA 4QDDA 1NTZE 2FYUE 3H1KE 3N0QA 4HKVA 1NYKA 1G8JB 3AZCA 1SQBE 4QUQA 4PV1D 2YFLA 1FQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM7 A;  4NBG D;  1NDO A;  5HL4 A;  3GCE A;  1EZV E;  1VF5 D;  5KLV E;  2E76 D;  5BOK A;  1NU1 E;  1Q90 C;  2NVF A;  1RFS A;  2DE7 D;  2E4Q A;  3L71 E;  2YIU C;  1SQP E;  2ZT9 D;  2E75 D;  5CXM A;  4QUR A;  3VMI D;  4NBH D;  4NBA D;  4NBB D;  1EG9 A;  1NTM E;  4HM6 A;  2ZYL A;  1SJG A;  4HM3 A;  2QJK C;  3C0D A;  2XSH A;  2B24 A;  2IBZ E;  3EN1 A;  2NWF A;  4HM2 A;  4NBE D;  1SQX E;  3VMG D;  3GZY A;  2E4P A;  3GL0 A;  4HM5 A;  1O7M A;  1VM9 A;  2HMM A;  1BE3 E;  3VMH D;  3CX5 E;  4NB9 D;  3VCP A;  3L75 E;  3L73 E;  1NTK E;  4AIV A;  4HJL A;  1G8K B;  4H0L D;  1UUW A;  2DE5 D;  2YFJ A;  2QJY C;  3CWB E;  2A06 E;  3FOU A;  3EQQ A;  2QJP C;  1L0N E;  4QDC A;  2B1X A;  1O7N A;  2XRX A;  2YFI A;  4NBD D;  3DQY A;  2JZA A;  1ULI A;  2HMN A;  3BCC E;  3CXH E;  3H1J E;  1O7G A;  4EMJ B;  2D2C D;  1PP9 E;  5KKZ C;  2GBX A;  1KB9 E;  2HMK A;  3GOB A;  3GZX A;  3GL2 A;  5AEW A;  2DE6 D;  2E74 D;  1O7H A;  1SQV E;  2HMO A;  2XR8 A;  4HM0 A;  2CKF A;  3H1I E;  3GTS A;  3L70 E;  4NBF D;  1UUV A;  1ZRT E;  4HM4 A;  4HM1 A;  1ULJ A;  4HM8 A;  3TGU E;  4OGQ D;  1L0L E;  1VCK A;  2NVE A;  3GB4 A;  2BMQ A;  3H1H E;  4P1C H;  4AAY B;  1BCC E;  2I7F A;  4PD4 E;  2GBW A;  3D89 A;  4H13 D;  3H1L E;  2FYN C;  3L72 E;  2HML A;  1O7W A;  2BMO A;  4H44 D;  1JM1 A;  1PPJ E;  2BCC E;  4P1B H;  2QPZ A;  5KLI C;  2NUM A;  4QUP A;  4U3F E;  5AEU A;  1KYO E;  4NBC D;  3L74 E;  4QCK A;  2BMR A;  3GTE A;  3VCA A;  4NB8 D;  2YVJ B;  1P84 E;  4QDF B;  1RIE A;  1O7P A;  2Q3W A;  1SQQ E;  2HMJ A;  2NVG A;  2XSO A;  2JO6 A;  3GKE A;  2NUK A;  4QDF A;  1WQL A;  4QDD A;  1NTZ E;  2FYU E;  3H1K E;  3N0Q A;  4HKV A;  1NYK A;  1G8J B;  3AZC A;  1SQB E;  4QUQ A;  4PV1 D;  2YFL A;  1FQT A; 
#chains in the Genus database with same CATH topology
 4HM7 A;  4NBG D;  1NDO A;  5HL4 A;  3GCE A;  1EZV E;  1VF5 D;  5KLV E;  2E76 D;  5BOK A;  1NU1 E;  1Q90 C;  2NVF A;  1RFS A;  2DE7 D;  2E4Q A;  3L71 E;  2YIU C;  1SQP E;  2ZT9 D;  2E75 D;  5CXM A;  4QUR A;  3VMI D;  4NBH D;  4NBA D;  4NBB D;  1EG9 A;  1NTM E;  4HM6 A;  2ZYL A;  1SJG A;  4HM3 A;  2QJK C;  3C0D A;  2XSH A;  2B24 A;  2IBZ E;  3EN1 A;  2NWF A;  4HM2 A;  4NBE D;  1SQX E;  3VMG D;  3GZY A;  2E4P A;  3GL0 A;  4HM5 A;  1O7M A;  1VM9 A;  2HMM A;  1BE3 E;  3VMH D;  3CX5 E;  4NB9 D;  3VCP A;  3L75 E;  3L73 E;  1NTK E;  4AIV A;  4HJL A;  1G8K B;  4H0L D;  1UUW A;  2DE5 D;  2YFJ A;  2QJY C;  3CWB E;  2A06 E;  3FOU A;  3EQQ A;  2QJP C;  1L0N E;  4QDC A;  2B1X A;  1O7N A;  2XRX A;  2YFI A;  4NBD D;  3DQY A;  2JZA A;  1ULI A;  2HMN A;  3BCC E;  3CXH E;  3H1J E;  1O7G A;  4EMJ B;  2D2C D;  1PP9 E;  5KKZ C;  2GBX A;  1KB9 E;  2HMK A;  3GOB A;  3GZX A;  3GL2 A;  5AEW A;  2DE6 D;  2E74 D;  1O7H A;  1SQV E;  2HMO A;  2XR8 A;  4HM0 A;  2CKF A;  3H1I E;  3GTS A;  3L70 E;  4NBF D;  1UUV A;  1ZRT E;  4HM4 A;  4HM1 A;  1ULJ A;  4HM8 A;  3TGU E;  4OGQ D;  1L0L E;  1VCK A;  2NVE A;  3GB4 A;  2BMQ A;  3H1H E;  4P1C H;  4AAY B;  1BCC E;  2I7F A;  4PD4 E;  2GBW A;  3D89 A;  4H13 D;  3H1L E;  2FYN C;  3L72 E;  2HML A;  1O7W A;  2BMO A;  4H44 D;  1JM1 A;  1PPJ E;  2BCC E;  4P1B H;  2QPZ A;  5KLI C;  2NUM A;  4QUP A;  4U3F E;  5AEU A;  1KYO E;  4NBC D;  3L74 E;  4QCK A;  2BMR A;  3GTE A;  3VCA A;  4NB8 D;  2YVJ B;  1P84 E;  4QDF B;  1RIE A;  1O7P A;  2Q3W A;  1SQQ E;  2HMJ A;  2NVG A;  2XSO A;  2JO6 A;  3GKE A;  2NUK A;  4QDF A;  1WQL A;  4QDD A;  1NTZ E;  2FYU E;  3H1K E;  3N0Q A;  4HKV A;  1NYK A;  1G8J B;  3AZC A;  1SQB E;  4QUQ A;  4PV1 D;  2YFL A;  1FQT A; 
#chains in the Genus database with same CATH homology
 4HM7 A;  4NBG D;  1NDO A;  5HL4 A;  3GCE A;  1EZV E;  1VF5 D;  5KLV E;  2E76 D;  5BOK A;  1NU1 E;  1Q90 C;  2NVF A;  1RFS A;  2DE7 D;  2E4Q A;  3L71 E;  2YIU C;  1SQP E;  2ZT9 D;  2E75 D;  5CXM A;  4QUR A;  3VMI D;  4NBH D;  4NBA D;  4NBB D;  1EG9 A;  1NTM E;  4HM6 A;  2ZYL A;  1SJG A;  4HM3 A;  2QJK C;  3C0D A;  2XSH A;  2B24 A;  2IBZ E;  3EN1 A;  2NWF A;  4HM2 A;  4NBE D;  1SQX E;  3VMG D;  3GZY A;  2E4P A;  3GL0 A;  4HM5 A;  1O7M A;  1VM9 A;  2HMM A;  1BE3 E;  3VMH D;  3CX5 E;  4NB9 D;  3VCP A;  3L75 E;  3L73 E;  1NTK E;  4AIV A;  4HJL A;  1G8K B;  4H0L D;  1UUW A;  2DE5 D;  2YFJ A;  2QJY C;  3CWB E;  2A06 E;  3FOU A;  3EQQ A;  2QJP C;  1L0N E;  4QDC A;  2B1X A;  1O7N A;  2XRX A;  2YFI A;  4NBD D;  3DQY A;  2JZA A;  1ULI A;  2HMN A;  3BCC E;  3CXH E;  3H1J E;  1O7G A;  4EMJ B;  2D2C D;  1PP9 E;  5KKZ C;  2GBX A;  1KB9 E;  2HMK A;  3GOB A;  3GZX A;  3GL2 A;  5AEW A;  2DE6 D;  2E74 D;  1O7H A;  1SQV E;  2HMO A;  2XR8 A;  4HM0 A;  2CKF A;  3H1I E;  3GTS A;  3L70 E;  4NBF D;  1UUV A;  1ZRT E;  4HM4 A;  4HM1 A;  1ULJ A;  4HM8 A;  3TGU E;  4OGQ D;  1L0L E;  1VCK A;  2NVE A;  3GB4 A;  2BMQ A;  3H1H E;  4P1C H;  4AAY B;  1BCC E;  2I7F A;  4PD4 E;  2GBW A;  3D89 A;  4H13 D;  3H1L E;  2FYN C;  3L72 E;  2HML A;  1O7W A;  2BMO A;  4H44 D;  1JM1 A;  1PPJ E;  2BCC E;  4P1B H;  2QPZ A;  5KLI C;  2NUM A;  4QUP A;  4U3F E;  5AEU A;  1KYO E;  4NBC D;  3L74 E;  4QCK A;  2BMR A;  3GTE A;  3VCA A;  4NB8 D;  2YVJ B;  1P84 E;  4QDF B;  1RIE A;  1O7P A;  2Q3W A;  1SQQ E;  2HMJ A;  2NVG A;  2XSO A;  2JO6 A;  3GKE A;  2NUK A;  4QDF A;  1WQL A;  4QDD A;  1NTZ E;  2FYU E;  3H1K E;  3N0Q A;  4HKV A;  1NYK A;  1G8J B;  3AZC A;  1SQB E;  4QUQ A;  4PV1 D;  2YFL A;  1FQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...