1SQBE

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqbE02
2QJYC 4HM1A 1ULJA 3CWBE 3GB4A 1VM9A 1L0LE 2FYNC 2QJPC 1O7GA 4OGQD 1SQXE 4EMJB 2JZAA 4NBFD 3L73E 2NUMA 3GKEA 1G8KB 2YIUC 3GZXA 4D6TE 4H0LD 1BE3E 2HMNA 1O7PA 3EQQA 2E76D 2CKFA 2YFJA 2YFLA 1SQBE 4AAYB 1ZRTE 4QCKA 5AEUA 2DE6D 3H1IE 1SJGA 3GTEA 1NTZE 4HKVA 1Q90C 3GOBA 1WQLA 4NBED 2XR8A 3VCPA 4H44D 1L0NE 2B24A 2NVGA 3H1JE 4HM8A 4NBDD 1UUVA 2BCCE 3H1KE 2NWFA 1NTME 5KLIC 2FYUE 2YFIA 4H13D 4QDCA 4NBAD 2IBZE 3GL0A 4QURA 4NB8D 4AIVA 1PP9E 2HMLA 2A06E 5KKZC 4NBBD 2B1XA 4HM7A 3VCAA 4QUQA 1RFSA 3L72E 3AZCA 4QDFB 2JO6A 4NB9D 4HJLA 2E75D 4HM5A 3H1HE 1SQPE 1SQQE 1KYOE 1G8JB 2Q3WA 2XRXA 2GBXA 2I7FA 1NTKE 3EN1A 2HMMA 1EG9A 4QUPA 3C0DA 1O7WA 2BMOA 1P84E 1NU1E 5CXMA 5KLVE 1O7HA 1UUWA 2QJKC 3FOUA 1O7MA 3BCCE 4HM0A 1KB9E 4U3FE 4NBGD 2ZT9D 2DE7D 2GBWA 2YVJB 3TGUE 2D2CD 1NYKA 2HMKA 4QDFA 4P1BH 1ULIA 3H1LE 1EZVE 2ZYLA 3GZYA 3VMID 1JM1A 1VCKA 4PV1D 1O7NA 3D89A 4NBCD 1SQVE 3L71E 3GL2A 3CX5E 2E4QA 1NDOA 4HM2A 5HL4A 5AEWA 3CXHE 2DE5D 2XSOA 4HM6A 4QDDA 1RIEA 3GTSA 3L75E 3DQYA 2NUKA 3VMHD 3L70E 2NVFA 1BCCE 2BMQA 2HMJA 1PPJE 4NBHD 4HM3A 4PD4E 1FQTA 5BOKA 4HM4A 1VF5D 2BMRA 2XSHA 4P1CH 3L74E 1BGYE 2E4PA 2E74D 2NVEA 3GCEA 3N0QA 3VMGD 2HMOA 2QPZA
chains in the Genus database with same CATH superfamily
3HE5B 4UB8E 5KLVG 1LWUC 1YITP 1LTAC 2IFNA 1SQXE 3M9HA 1RE3A 2B87B 1SVFA 3E7KA 2WSEJ 1OW8A 1SQBD 4AAYB 3M9QA 1HGVA 2NPSC 2W6JH 1SQXJ 3M0AA 1FJPA 3O6QA 2KSJA 3VMYA 2M3EA 2Z4EA 2OTLP 4TT3H 1LTIC 2YMKA 2WPSA 2E76C 1BSNA 1JOCA 2BCCE 4NPFX 2JO1A 3CCEP 3F5HA 2AXTE 1RH5B 2NZ2A 2FFDA 1ZLLA 1NKNA 2KNCB 1YTZT 1IK7A 1SQQE 1G8JB 1S5LX 4L73A 2BCCJ 3HD7C 3B8EB 2K37A 5CCHA 1KB9H 4PD4H 1P84E 1NU1E 2YKQA 3QH9A 5GTHE 4AQRD 2BEZF 2E75C 1FOSE 1SQQJ 1QL2A 2JDIH 2ZT9D 2FBWC 2D2CD 1NTMG 3CWBD 3RK3D 1PP9G 4PV1D 1GD2E 3OAKA 2QM8A 4IFDK 1URQC 1NU1J 5HL4A 1H0TA 2QVAA 3L75D 1S5LH 5AVVB 5AVQB 1DEBA 1X8YA 4HB1A 2W8ZA 2BEQD 2RMZA 1Q2NA 3GB4A 2KZIA 2ZYAA 5KTBA 4DOJA 5KJ7D 5CJ0A 1BE3D 4H0LD 5B5EH 2M0BA 2JR8A 1P84I 5AVSB 3MP7B 4U7JA 5AEUA 1L4AC 3S9OA 1QVGO 4N3YB 5AVRB 1KD1Q 4L74A 1PGPA 4NBED 2E42A 2Q7CA 1FZGA 2ZT9B 1QEXA 2FYUK 3RK3B 5AW5B 1GU4A 3LIDA 3VN0A 2WVRA 1G2CA 4GODA 4QDFB 1IFPA 3A0HH 2W27A 3B71A 3KYQA 4K3AA 2KS1A 3EFFK 2G3AA 2V7QJ 5AW6B 1IK9A 4YXWH 4NBGD 1N86A 4WBAA 4PJ0H 2YVJB 1NYKA 3CPWO 1FZCB 2QE7H 1A02J 4UB6E 1JEKA 1OVVA 1SQVE 3GL2A 3AEAC 2IX7C 2H8PD 5BU5A 2XSOA 3VTPC 1KILB 2OYHA 2W6BA 1NAYA 2FYZA 1BCCE 1PPJE 1FQTA 1PZQA 1MV8A 3TYYA 1GL2B 2AEMA 1SQVJ 1HVVA 2GUVA 2NPSD 3BRTB 1T3UA 5AVUB 2K88A 1FDMA 1KQGB 5KKZB 1RY3A 1MZ9A 3K5BA 1BCCJ 2O01J 2E76D 1N7LA 2E74C 5KAFH 4BRYA 4H44B 3H1ID 4OGQC 3GOBA 2UWJE 3U1CA 3I5CA 5KLVK 2B24A 3G4SP 3VOPA 1J1EC 3CWBG 3H1KD 3UIAA 2I8DA 5AW0B 1RE3C 4BWNA 2KI7B 4NB8D 3CI9A 4HM7A 3L72D 4ASWA 1M1KQ 3GMAA 5K5GB 1SS1A 2C0WA 3AE1C 3V2PA 3IF4A 2E75D 1EXJA 3CX5H 2KLVA 1N7SD 3I55P 1U7MA 1T3JA 2MKVA 4ZKPA 3P8CD 1JCDA 4IFFA 4EYYQ 1ULIA 3H1LE 1EZVE 2IBZG 1SQXD 1KYOI 1GTWA 5APVA 4NBCD 2FFDC 2DE5D 1E5WA 3DQYA 2H88C 2V4HA 2WT7B 3A7OA 2GM4A 3H1LJ 2AXCA 1NTKG 4PD4E 3AECC 3HD7B 1L0LK 1UIIA 3AE3C 3HTKB 1IZNB 2W90A 3BCCG 1VM9A 2FYNC 1L4AD 3RK2C 2ZVOB 3TGUG 1LNQA 2E75B 3LIEA 3JCUH 1Y9BA 1VF5C 3FWNA 1GZLA 1WMKA 2H89C 3G3ZA 1M7LA 3L35A 3GHGA 1URQB 3H32A 2M5AA 1Y8AA 1NAFA 5APSA 2E5YA 3VCPA 3L74G 1BGYG 1HF9A 4R4LA 2AXTH 1NU1D 2B89A 5AVZB 1DD3A 2HMLA 2WTYA 5B5EE 1Y47A 2QM7A 4A7PA 4PD4I 1LTBC 4RJTA 1UIXA 3T97A 4HJLA 1JM0A 3Q3DA 1SQPD 4JQ0D 3CXHH 3OA7A 5H2FH 4HKZH 2XRXA 5AVYB 1P84H 3KHUA 2JKVA 2ZFCA 1AQ5A 5CHXA 1RHZB 1O7HA 1N7SA 4IL6E 1W2BO 1YQ4C 3F89A 3RL0g 1JM1A 1EQ7A 3A0HE 3V2RA 4CPGA 4HM6A 2KP8A 1Q7YQ 3M0DA 3VP8A 3MIWA 2R3SA 2H7HA 2BMQA 4HM3A 2B88A 2A45I 2E74D 4XFJA 5AVTB 1ZP0C 1FZAA 1LTJB 2ZYDA 4HM1A 4OGQD 3VMAA 1G1IA 1L2PA 3V6IA 1HBWA 4EMJB 2Q3IA 2NUMA 1SQBK 1OFCX 2YFJA 1N73C 1HTLC 2IZ0A 3AE9C 5TJHA 2OYHC 2OARA 4N78D 3CMEP 1CW5A 4B86A 2OYIA 2XZRA 1L0NE 2CK3H 1UUVA 2LKMA 1NTMD 3P32A 2PRRA 1OWAA 4RKUJ 1SQXG 2ZJSE 3GL0A 4QURA 4KJMA 1FDOA 2FY8A 1LGHB 3IAOA 5KAFE 4WB4A 5KAIH 3H1HE 2VRSA 1ZXGA 1EG9A 2MJZA 3MTUE 2KSEA 5APXA 4OGQB 1PPJD 2Z5HA 3FX0A 1O7MA 2QJYB 2HG5D 4U3FE 3H1HJ 1LJ2A 2BCCG 1SFCA 1N8RQ 3HRNA 1FZFA 3V4QA 2XV5A 1RE4A 3CCQP 5AW8B 2O01N 3CX5E 1NDOA 1S1CX 5AEWA 1GK4A 3RK2D 2N1TA 4U3FJ 1SQQG 1M1JA 3PH0A 1LT9A 5APUA 3V5BA 3FWLA 5BOKA 1VF5D 3AE8C 1CI6A 2NVEA 1HH0A 3IFMA 1NU1G 1OIPA 1BDDA 3L73E 3EFGA 4M3LA 4HYTB 1SJGA 1KYOH 1VQLP 4HKVA 2IZ1A 3HUSB 3L73J 2WWWA 2ZYGA 1IFDA 4JBZA 3CX5I 3H1JE 1VL2A 2IPPA 2FYUE 3JCUE 3CC4P 1EZVD 1IFNA 4Y99C 3GHGC 3H1JJ 4Z1MH 3RBXA 4NPDA 1TU3F 2WPRA 3B4SA 2GBXA 2FYUJ 1H0TB 1NVOA 4XE5B 1WRGA 3M91A 2K9JA 1OW7A 3TNUA 1KB9D 2FKWB 1S3JA 1JB0J 3SFEC 1NJIQ 3TK1A 1LTTC 2LXCB 3VMID 4KHXA 1O7NA 4GOFA 3CXHE 3HE4A 4W80A 1JY3P 5H2FE 1RQVA 3B5NC 5B66E 3MD0A 2YNYA 3VMGD 1N7SC 3HE5A 2R5BA 1NGMB 3AE4C 3GZXA 1YYCA 1SQVG 1OW6A 2O3JA 2I1KA 2HR3A 1JTHA 3GF7A 3C8VA 1FZBA 1NTZE 3M0DC 2OTKE 1EDKA 3A3YB 1BCCG 1PPJG 4IL6X 3N7NA 2YKOA 4WY4D 5EFWB 4HM8A 2A45H 3CXHI 2NWFA 2WPQA 2IBZD 1NTZJ 2GUSA 3JC22 3A2AA 2LR2A 4AIVA 3AEEC 1FAVA 2B1XA 2PGDA 2M8RA 2QRXA 4C7NB 4NB9D 2KNCA 2L5GB 2Q3WA 2AEFA 1NTKD 2D2CB 2HPCB 2BASA 1EC5A 4QUPA 5CMZA 5AVWB 1GMJA 4IL6H 2OYHB 2JWAA 2OYIC 2QJKC 1T8ZA 3BCCD 4PV1B 3SWKA 4IFMA 3KDPB 2QJPB 1JO5A 3TGUD 3PP5A 3Q5PA 2SPZA 2B9BA 2J58A 1J2JB 2YIUB 1VCKA 3L71E 5KAIE 1KQLA 4HM2A 4I7ZC 2YXQB 2WITA 4K35A 1YQ3C 4BRYB 2NVFA 1DD4A 1MFZA 1AJYA 1R8EA 3L74D 1BGYD 2Y9ZA 1JUNA 1RQUA 4LGDE 3L4FA 2HYNA 4H0LB 3L71J 4AUWA 2WPVB 3SWYA 1L0LE 5TISE 1S9KD 1H8AA 1L0ND 1SFCC 1KZUB 1N73A 1WT6A 3H1LG 1EZVG 1RE4C 2CKFA 3QWOC 2N1TC 1L0LJ 1M1JC 1LT9C 3MUDA 5AVXB 4Y28J 1KTMA 1X0TA 4NBDD 1PGOA 3BASA 1FU1A 4U3FD 2YO3A 3WUUA 2A06E 1NWQA 4WY4A 3N4XA 1RFSA 1SQPK 2CPBA 1KYOE 1LP1B 2JEEA 1IJDB 1J1DC 2O1JA 2HFED 1GW3A 2NRGA 2DW3A 4R4MA 3SWFA 4W7ZA 1XTGB 1GK6A 3NXSA 1NOHA 4WWIA 2KYVA 1AA0A 1LWUB 3B5ND 1RF1C 1BSHA 3D6YA 2A45G 3RBZA 2JP3A 3GTSA 2NPSB 3GLMA 1VQ5P 3L70E 4Y99B 3GHGB 3AEFC 3GCEA 1GL2A 2M5AB 2E76B 1ZV8A 1X9VA 1O7GA 2IFMA 3L70J 3CLQA 3EQQA 4GKGA 2FXMA 3PRJA 3ABVC 4ZNCA 1M8OB 1SQBE 3KPEA 3T97B 1W2EA 2AEJA 2N9YB 4MN4C 4I2LC 1WQLA 3D71A 3L37A 1NTMK 1SQBJ 2BCCD 5BVZA 4XA4A 4KT0J 1IFIA 1N7SB 2YMYA 5APQA 3U59A 4ZKUA 3H6PA 1SQQD 2L91A 3CCVP 1P84D 4HH2A 3MGNA 3FOUA 1L0NG 3CCJP 1W5CE 2E43A 1JY2N 3RK3E 2KK7A 2R3CA 2IDBA 3B5NA 2ITAA 3H1HG 1SFCD 3L75E 1YJWP 1L4AB 1FDIA 1VPCA 5B66H 3Q1MA 3E1IA 1NTZD 2J5UA 3HTKA 2N1TD 1Q81Q 3G6EP 3TF5A 1KORA 4U3FG 3LW5H 3L75J 2C9NY 3KQGA 2PAJA 4D6TE 1BE3E 2PP6A 2J59M 3IR9A 4YXDC 1O7PA 2KIKA 1NKZB 2WSFJ 1HJ0A 3GTEA 3TDKA 3W68A 4I7ZB 2JWDA 3P8MC 4D6TJ 5L8RJ 1BE3J 2Y0CA 1KILE 2JJLA 3ZDMA 1JCCA 3WUTA 4GOEA 1JNMA 3A0BE 1DIPA 1ZMEC 1FC2C 2IYPA 1YBKA 3L73G 3CCLP 1FS0E 1ZW0A 5APYA 4ZMDA 1VQNP 1G1JA 2N9BA 2QEXP 3FGAD 1JY2O 2N1TB 3MUDC 2BMOA 1OVUA 1NH4A 1LT9B 1PV3A 3R2PA 3CMAP 2W6AA 1VQKP 3P7KA 3H1JG 1CI6B 4I6MC 2FYUG 1SQVD 4WY4C 3IN6A 3NMDA 3EQ2A 4EI2A 3W67A 2E74B 1KQFB 1OVRA 1RIEA 1Q82Q 1BCCD 3CCUP 1YHQP 1PL5A 2C9LY 1DX7A 4JYBA 5TISH 1M90Q 1QX8A 1LTJA 3L36A 3BVHA 4DCKA 1J1EB 1RF0C 3WU2H 2QSIA 4BXLA 1KFMA 3CCMP 4GDOA 3JSVC 1KFNA 3V2NA 3VYIA 1MKMA 4HJGH 4JPZB 1IC2A 3H1IE 5AW2B 1KILC 1Q90C 3O6QB 1KYOD 1PGQA 3D6ZA 1D7MA 3AE7C 1GL2C 1M56D 1FBMA 1ZOYC 2P1JA 3H1KE 2K9JB 3H1IJ 3NTNA 5DJTB 3TNUB 5KKZC 4LLHA 4GT1A 2OQQA 2WZ7A 2WSCH 4QUQA 3L72E 3AZCA 3A5TA 2FFDB 1E79H 4H44C 1NTKK 3H1KJ 3VP9A 1NTZG 2I7FA 3KZIH 3L72J 3GW6A 1RF1A 4GIFA 3AEDC 2FYNB 4DZOA 1QVFO 2HODA 3RK2B 4OWFA 2GBWA 1YIJP 4P1BH 2Y0DA 3H1LD 2KOGA 2YKPA 1K73Q 3CC7P 1YTZI 3RL0C 3AE6C 4TLFA 1VF5B 2E4QA 1T2KC 1NYHA 1XTCC 1HWTC 4OH8B 3BRVB 4JF7A 1JTHB 4PD4D 3V2QA 5AW4B 1YJNP 4ASVA 1L0NK 1SLQA 2CPSA 2GA1A 4NBFD 5APTA 3Q2YA 1N2DC 2ZXXA 2HMNA 5M1BA 2R32A 1PGJA 3L71G 4EOTA 1S4XA 2DE6D 3HUSA 1IFMA 2Q6QA 2H43A 2B87A 1NO4A 2OGUA 5APWA 1L0LG 1BDCA 2R5DA 1YI2P 2YFIA 5E79E 1G2CB 4IOIH 3EWKA 4HM5A 5CCGA 1SQPE 3LW5J 2KS1B 1FOSF 2FXPA 2K3RA 4H13C 3EN1A 1O7WA 1T6AA 5KLVE 5DJUB 2POHA 2WQYC 3SFDC 1IFJA 1SQPJ 2XDJA 5AW3B 2A06G 1VQ7P 3D89A 3PTZA 5BU8B 4D6TD 5KLVJ 1N73B 3VMXA 1K05A 1DH3A 2Q9IA 1ZR2A 4NBHD 3Q5RA 1H88A 2WSFH 2PFXA 2BMRA 4P1CH 3AE5C 1SQXK 2OYOA 1ULJA 1U57A 1KILD 1Q90D 1G8KB 1GU5A 1EDLA 1GL2D 4W7YA 1ZRTE 1KN7A 1LTSC 4WY4B 3R4YA 3MZWB 2P10A 3L70G 4N78E 3A0BH 4H44D 4YPCA 1LTJC 3AE2C 3SSUA 5AW7B 3WU2E 1K04A 1NTME 4L75A 4NBAD 1PP9E 2ZAEB 4NBBD 1A02F 1AVYA 1SQQK 4C7NA 1PIXA 5CBNA 1AQTA 3H1HD 1SQBG 4I1LA 1H89A 4DT0A 3G71P 1NTMJ 1NU1K 2HPCA 1VQMP 3RL0D 1PP9J 2HMMA 2Z5IA 1T2KD 1LTGC 5GTIH 2Y9YA 5CBOA 4EIJA 3CCRP 5AW1B 4QDFA 2RH0A 1ZN5A 2Q1KA 1HUCA 2KUBA 3CX5D 1FE6A 3BATA 1AFOA 2R44A 1X79B 4QDDA 4OVNF 2YO2A 2QG4A 1NTZK 2NUKA 2WSCJ 5KJ7A 3KZIE 3AEGC 1SP4A 1RF0A 2WMMA 1FZCA 2QJYC 2RKLA 3OJAB 1VQPP 1GW4A 3O8ZA 3L73D 2IYOA 1PFIA 3HD7D 2Q3EA 1R5LA 3ITKA 5C39A 1KILA 3WMM0 2YFLA 3GF3A 1USDA 3RL0B 3PLNA 3L75G 3H32B 1KV4A 4L76A 2K9YA 2XR8A 3II6A 3H1JD 1IO4A 1URQD 2FYUD 5KLIC 4H13D 2O1KA 3V4WA 1EDJA 4D6TG 1VDFA 1BE3G 2LXBA 1ZR4A 1LP1A 3B5NB 3HUSC 2C0XA 3C0DA 2WSEH 1UUWA 2E5TA 4HM0A 1KB9E 2KZJA 5CCHC 1LWUA 4UB8H 1VQ6P 3GG2A 1FZEA 2W83C 1SQVK 1QGKB 2M3BA 3H25A 2P2UA 3CXHD 5CCGC 1KC8Q 3Q5SA 2NPSA 4C46A 1AV1A 1S5LE 2G8YA 3TSIA 2ZVNB 1VQOP 1LT1A 2E4PA 1OZHA 3CC2P 2QPZA 4O9BA 4H13B 1EZVI 3CWBE 4QMAA 3PJSK 2OTJP 2ZXEB 2XU6A 3E1RA 2JZAA 3GKEA 3C1LA 4WVZA 2P67A 1GDTA 1MFTA 1CZQA 2WT7A 3CWBJ 1KB9I 3I56P 1U7JA 2KB7P 3HD7A 2I1JA 3G9RA 2OYIB 2QJKB 2NVGA 3NFQA 2P58A 5E79H 5GTHH 5KLVD 4QDCA 2IBZE 4RO0A 5AW9B 3MHVA 1URQA 2JO6A 2HLOA 3U1AA 1S72P 3H1IG 4DJGA 3CCSP 3AEBC 2FXOA 3D70A 1NTKE 3PHLA 5CXMA 4YTPC 2XNXA 3BCCE 1NHLA 2WSSH 3USSA 3TGUE 2HMKA 3H1KG 4N6JA 2QIWA 1SFCB 2Q5UA 2ZYLA 4PJ0E 1NTKJ 2QA4P 3L71D 1K9MQ 3C9IA 3L72G 1KMIZ 1YJ9P 3CD6P 1K8AQ 1MUUA 3BCCJ 4JYCA 3VMZA 1FJKA 1L4AA 3TGUJ 3VMHD 2ZT9C 1ZRTD 1M1JB 1JMMA 2D2CC 4RESB 2IBZI 3RK3C 4HM4A 3L74E 1BGYE 3N0QA 5GTIE 4PV1C 3FXEA 1L0LD 2QJPC 2K1AA 1S9KE 2YIUC 2XNDH 2V7QH 1Q86Q 3RGUA 1PP9D 1BGYJ 3L74J 1R5SA 3S4RA 1JY3N 3OW2O 2KXPB 4QCKA 2P7JA 1J1DB 1L0NJ 1EDIA 5KJ7C 1QL1A 3FXDA 4H0LC 5CJ4A 1Z56A 1FZCC 3M06A 1DEEG 1OMIA 1USEA 1RF1B 1QLED 1JMBA 2A06D 1VQ9P 3VCAA 2HODB 4UB6H 1JY2P 5CCHD 3S1KA 1KQSO 1OX3A 4EDFA 2KLUA 2YXRB 1VQ4P 1HGZA 2O01H 2RN0A 5CCGD 2XKMA 1OXZA 1S2EA 2DE7D 4NPEA 3GZYA 1X22A 5KLIB 2Y0EA 4LC1A 1EXIA 4AYCA 3HE4B 1AVOA 1SQPG 1CSBA 3M9BA 4C7RA 3L70D 3P8CE 3WUVA 2HMJA 3CL3D 2XSHA 3KXDA 2HMOA 1VQ8P 1JY3O 1M57D 1HJBA
chains in the Genus database with same CATH topology
2QJYC 4HM1A 1ULJA 3CWBE 3GB4A 1VM9A 1L0LE 2FYNC 2QJPC 1O7GA 4OGQD 1SQXE 4EMJB 2JZAA 4NBFD 3L73E 2NUMA 3GKEA 1G8KB 2YIUC 3GZXA 4D6TE 4H0LD 1BE3E 2HMNA 1O7PA 3EQQA 2E76D 2CKFA 2YFJA 2YFLA 1SQBE 4AAYB 1ZRTE 4QCKA 5AEUA 2DE6D 3H1IE 1SJGA 3GTEA 1NTZE 4HKVA 1Q90C 3GOBA 1WQLA 4NBED 2XR8A 3VCPA 4H44D 1L0NE 2B24A 2NVGA 3H1JE 4HM8A 4NBDD 1UUVA 2BCCE 3H1KE 2NWFA 1NTME 5KLIC 2FYUE 2YFIA 4H13D 4QDCA 4NBAD 2IBZE 3GL0A 4QURA 4NB8D 4AIVA 1PP9E 2HMLA 2A06E 5KKZC 4NBBD 2B1XA 4HM7A 3VCAA 4QUQA 1RFSA 3L72E 3AZCA 4QDFB 2JO6A 4NB9D 4HJLA 2E75D 4HM5A 3H1HE 1SQPE 1SQQE 1KYOE 1G8JB 2Q3WA 2XRXA 2GBXA 2I7FA 1NTKE 3EN1A 2HMMA 1EG9A 4QUPA 3C0DA 1O7WA 2BMOA 1P84E 1NU1E 5CXMA 5KLVE 1O7HA 1UUWA 2QJKC 3FOUA 1O7MA 3BCCE 4HM0A 1KB9E 4U3FE 4NBGD 2ZT9D 2DE7D 2GBWA 2YVJB 3TGUE 2D2CD 1NYKA 2HMKA 4QDFA 4P1BH 1ULIA 3H1LE 1EZVE 2ZYLA 3GZYA 3VMID 1JM1A 1VCKA 4PV1D 1O7NA 3D89A 4NBCD 1SQVE 3L71E 3GL2A 3CX5E 2E4QA 1NDOA 4HM2A 5HL4A 5AEWA 3CXHE 2DE5D 2XSOA 4HM6A 4QDDA 1RIEA 3GTSA 3L75E 3DQYA 2NUKA 3VMHD 3L70E 2NVFA 1BCCE 2BMQA 2HMJA 1PPJE 4NBHD 4HM3A 4PD4E 1FQTA 5BOKA 4HM4A 1VF5D 2BMRA 2XSHA 4P1CH 3L74E 1BGYE 2E4PA 2E74D 2NVEA 3GCEA 3N0QA 3VMGD 2HMOA 2QPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  4HM1 A;  1ULJ A;  3CWB E;  3GB4 A;  1VM9 A;  1L0L E;  2FYN C;  2QJP C;  1O7G A;  4OGQ D;  1SQX E;  4EMJ B;  2JZA A;  4NBF D;  3L73 E;  2NUM A;  3GKE A;  1G8K B;  2YIU C;  3GZX A;  4D6T E;  4H0L D;  1BE3 E;  2HMN A;  1O7P A;  3EQQ A;  2E76 D;  2CKF A;  2YFJ A;  2YFL A;  1SQB E;  4AAY B;  1ZRT E;  4QCK A;  5AEU A;  2DE6 D;  3H1I E;  1SJG A;  3GTE A;  1NTZ E;  4HKV A;  1Q90 C;  3GOB A;  1WQL A;  4NBE D;  2XR8 A;  3VCP A;  4H44 D;  1L0N E;  2B24 A;  2NVG A;  3H1J E;  4HM8 A;  4NBD D;  1UUV A;  2BCC E;  3H1K E;  2NWF A;  1NTM E;  5KLI C;  2FYU E;  2YFI A;  4H13 D;  4QDC A;  4NBA D;  2IBZ E;  3GL0 A;  4QUR A;  4NB8 D;  4AIV A;  1PP9 E;  2HML A;  2A06 E;  5KKZ C;  4NBB D;  2B1X A;  4HM7 A;  3VCA A;  4QUQ A;  1RFS A;  3L72 E;  3AZC A;  4QDF B;  2JO6 A;  4NB9 D;  4HJL A;  2E75 D;  4HM5 A;  3H1H E;  1SQP E;  1SQQ E;  1KYO E;  1G8J B;  2Q3W A;  2XRX A;  2GBX A;  2I7F A;  1NTK E;  3EN1 A;  2HMM A;  1EG9 A;  4QUP A;  3C0D A;  1O7W A;  2BMO A;  1P84 E;  1NU1 E;  5CXM A;  5KLV E;  1O7H A;  1UUW A;  2QJK C;  3FOU A;  1O7M A;  3BCC E;  4HM0 A;  1KB9 E;  4U3F E;  4NBG D;  2ZT9 D;  2DE7 D;  2GBW A;  2YVJ B;  3TGU E;  2D2C D;  1NYK A;  2HMK A;  4QDF A;  4P1B H;  1ULI A;  3H1L E;  1EZV E;  2ZYL A;  3GZY A;  3VMI D;  1JM1 A;  1VCK A;  4PV1 D;  1O7N A;  3D89 A;  4NBC D;  1SQV E;  3L71 E;  3GL2 A;  3CX5 E;  2E4Q A;  1NDO A;  4HM2 A;  5HL4 A;  5AEW A;  3CXH E;  2DE5 D;  2XSO A;  4HM6 A;  4QDD A;  1RIE A;  3GTS A;  3L75 E;  3DQY A;  2NUK A;  3VMH D;  3L70 E;  2NVF A;  1BCC E;  2BMQ A;  2HMJ A;  1PPJ E;  4NBH D;  4HM3 A;  4PD4 E;  1FQT A;  5BOK A;  4HM4 A;  1VF5 D;  2BMR A;  2XSH A;  4P1C H;  3L74 E;  1BGY E;  2E4P A;  2E74 D;  2NVE A;  3GCE A;  3N0Q A;  3VMG D;  2HMO A;  2QPZ A; 
#chains in the Genus database with same CATH topology
 3HE5 B;  4UB8 E;  5KLV G;  1LWU C;  1YIT P;  1LTA C;  2IFN A;  1SQX E;  3M9H A;  1RE3 A;  2B87 B;  1SVF A;  3E7K A;  2WSE J;  1OW8 A;  1SQB D;  4AAY B;  3M9Q A;  1HGV A;  2NPS C;  2W6J H;  1SQX J;  3M0A A;  1FJP A;  3O6Q A;  2KSJ A;  3VMY A;  2M3E A;  2Z4E A;  2OTL P;  4TT3 H;  1LTI C;  2YMK A;  2WPS A;  2E76 C;  1BSN A;  1JOC A;  2BCC E;  4NPF X;  2JO1 A;  3CCE P;  3F5H A;  2AXT E;  1RH5 B;  2NZ2 A;  2FFD A;  1ZLL A;  1NKN A;  2KNC B;  1YTZ T;  1IK7 A;  1SQQ E;  1G8J B;  1S5L X;  4L73 A;  2BCC J;  3HD7 C;  3B8E B;  2K37 A;  5CCH A;  1KB9 H;  4PD4 H;  1P84 E;  1NU1 E;  2YKQ A;  3QH9 A;  5GTH E;  4AQR D;  2BEZ F;  2E75 C;  1FOS E;  1SQQ J;  1QL2 A;  2JDI H;  2ZT9 D;  2FBW C;  2D2C D;  1NTM G;  3CWB D;  3RK3 D;  1PP9 G;  4PV1 D;  1GD2 E;  3OAK A;  2QM8 A;  4IFD K;  1URQ C;  1NU1 J;  5HL4 A;  1H0T A;  2QVA A;  3L75 D;  1S5L H;  5AVV B;  5AVQ B;  1DEB A;  1X8Y A;  4HB1 A;  2W8Z A;  2BEQ D;  2RMZ A;  1Q2N A;  3GB4 A;  2KZI A;  2ZYA A;  5KTB A;  4DOJ A;  5KJ7 D;  5CJ0 A;  1BE3 D;  4H0L D;  5B5E H;  2M0B A;  2JR8 A;  1P84 I;  5AVS B;  3MP7 B;  4U7J A;  5AEU A;  1L4A C;  3S9O A;  1QVG O;  4N3Y B;  5AVR B;  1KD1 Q;  4L74 A;  1PGP A;  4NBE D;  2E42 A;  2Q7C A;  1FZG A;  2ZT9 B;  1QEX A;  2FYU K;  3RK3 B;  5AW5 B;  1GU4 A;  3LID A;  3VN0 A;  2WVR A;  1G2C A;  4GOD A;  4QDF B;  1IFP A;  3A0H H;  2W27 A;  3B71 A;  3KYQ A;  4K3A A;  2KS1 A;  3EFF K;  2G3A A;  2V7Q J;  5AW6 B;  1IK9 A;  4YXW H;  4NBG D;  1N86 A;  4WBA A;  4PJ0 H;  2YVJ B;  1NYK A;  3CPW O;  1FZC B;  2QE7 H;  1A02 J;  4UB6 E;  1JEK A;  1OVV A;  1SQV E;  3GL2 A;  3AEA C;  2IX7 C;  2H8P D;  5BU5 A;  2XSO A;  3VTP C;  1KIL B;  2OYH A;  2W6B A;  1NAY A;  2FYZ A;  1BCC E;  1PPJ E;  1FQT A;  1PZQ A;  1MV8 A;  3TYY A;  1GL2 B;  2AEM A;  1SQV J;  1HVV A;  2GUV A;  2NPS D;  3BRT B;  1T3U A;  5AVU B;  2K88 A;  1FDM A;  1KQG B;  5KKZ B;  1RY3 A;  1MZ9 A;  3K5B A;  1BCC J;  2O01 J;  2E76 D;  1N7L A;  2E74 C;  5KAF H;  4BRY A;  4H44 B;  3H1I D;  4OGQ C;  3GOB A;  2UWJ E;  3U1C A;  3I5C A;  5KLV K;  2B24 A;  3G4S P;  3VOP A;  1J1E C;  3CWB G;  3H1K D;  3UIA A;  2I8D A;  5AW0 B;  1RE3 C;  4BWN A;  2KI7 B;  4NB8 D;  3CI9 A;  4HM7 A;  3L72 D;  4ASW A;  1M1K Q;  3GMA A;  5K5G B;  1SS1 A;  2C0W A;  3AE1 C;  3V2P A;  3IF4 A;  2E75 D;  1EXJ A;  3CX5 H;  2KLV A;  1N7S D;  3I55 P;  1U7M A;  1T3J A;  2MKV A;  4ZKP A;  3P8C D;  1JCD A;  4IFF A;  4EYY Q;  1ULI A;  3H1L E;  1EZV E;  2IBZ G;  1SQX D;  1KYO I;  1GTW A;  5APV A;  4NBC D;  2FFD C;  2DE5 D;  1E5W A;  3DQY A;  2H88 C;  2V4H A;  2WT7 B;  3A7O A;  2GM4 A;  3H1L J;  2AXC A;  1NTK G;  4PD4 E;  3AEC C;  3HD7 B;  1L0L K;  1UII A;  3AE3 C;  3HTK B;  1IZN B;  2W90 A;  3BCC G;  1VM9 A;  2FYN C;  1L4A D;  3RK2 C;  2ZVO B;  3TGU G;  1LNQ A;  2E75 B;  3LIE A;  3JCU H;  1Y9B A;  1VF5 C;  3FWN A;  1GZL A;  1WMK A;  2H89 C;  3G3Z A;  1M7L A;  3L35 A;  3GHG A;  1URQ B;  3H32 A;  2M5A A;  1Y8A A;  1NAF A;  5APS A;  2E5Y A;  3VCP A;  3L74 G;  1BGY G;  1HF9 A;  4R4L A;  2AXT H;  1NU1 D;  2B89 A;  5AVZ B;  1DD3 A;  2HML A;  2WTY A;  5B5E E;  1Y47 A;  2QM7 A;  4A7P A;  4PD4 I;  1LTB C;  4RJT A;  1UIX A;  3T97 A;  4HJL A;  1JM0 A;  3Q3D A;  1SQP D;  4JQ0 D;  3CXH H;  3OA7 A;  5H2F H;  4HKZ H;  2XRX A;  5AVY B;  1P84 H;  3KHU A;  2JKV A;  2ZFC A;  1AQ5 A;  5CHX A;  1RHZ B;  1O7H A;  1N7S A;  4IL6 E;  1W2B O;  1YQ4 C;  3F89 A;  3RL0 g;  1JM1 A;  1EQ7 A;  3A0H E;  3V2R A;  4CPG A;  4HM6 A;  2KP8 A;  1Q7Y Q;  3M0D A;  3VP8 A;  3MIW A;  2R3S A;  2H7H A;  2BMQ A;  4HM3 A;  2B88 A;  2A45 I;  2E74 D;  4XFJ A;  5AVT B;  1ZP0 C;  1FZA A;  1LTJ B;  2ZYD A;  4HM1 A;  4OGQ D;  3VMA A;  1G1I A;  1L2P A;  3V6I A;  1HBW A;  4EMJ B;  2Q3I A;  2NUM A;  1SQB K;  1OFC X;  2YFJ A;  1N73 C;  1HTL C;  2IZ0 A;  3AE9 C;  5TJH A;  2OYH C;  2OAR A;  4N78 D;  3CME P;  1CW5 A;  4B86 A;  2OYI A;  2XZR A;  1L0N E;  2CK3 H;  1UUV A;  2LKM A;  1NTM D;  3P32 A;  2PRR A;  1OWA A;  4RKU J;  1SQX G;  2ZJS E;  3GL0 A;  4QUR A;  4KJM A;  1FDO A;  2FY8 A;  1LGH B;  3IAO A;  5KAF E;  4WB4 A;  5KAI H;  3H1H E;  2VRS A;  1ZXG A;  1EG9 A;  2MJZ A;  3MTU E;  2KSE A;  5APX A;  4OGQ B;  1PPJ D;  2Z5H A;  3FX0 A;  1O7M A;  2QJY B;  2HG5 D;  4U3F E;  3H1H J;  1LJ2 A;  2BCC G;  1SFC A;  1N8R Q;  3HRN A;  1FZF A;  3V4Q A;  2XV5 A;  1RE4 A;  3CCQ P;  5AW8 B;  2O01 N;  3CX5 E;  1NDO A;  1S1C X;  5AEW A;  1GK4 A;  3RK2 D;  2N1T A;  4U3F J;  1SQQ G;  1M1J A;  3PH0 A;  1LT9 A;  5APU A;  3V5B A;  3FWL A;  5BOK A;  1VF5 D;  3AE8 C;  1CI6 A;  2NVE A;  1HH0 A;  3IFM A;  1NU1 G;  1OIP A;  1BDD A;  3L73 E;  3EFG A;  4M3L A;  4HYT B;  1SJG A;  1KYO H;  1VQL P;  4HKV A;  2IZ1 A;  3HUS B;  3L73 J;  2WWW A;  2ZYG A;  1IFD A;  4JBZ A;  3CX5 I;  3H1J E;  1VL2 A;  2IPP A;  2FYU E;  3JCU E;  3CC4 P;  1EZV D;  1IFN A;  4Y99 C;  3GHG C;  3H1J J;  4Z1M H;  3RBX A;  4NPD A;  1TU3 F;  2WPR A;  3B4S A;  2GBX A;  2FYU J;  1H0T B;  1NVO A;  4XE5 B;  1WRG A;  3M91 A;  2K9J A;  1OW7 A;  3TNU A;  1KB9 D;  2FKW B;  1S3J A;  1JB0 J;  3SFE C;  1NJI Q;  3TK1 A;  1LTT C;  2LXC B;  3VMI D;  4KHX A;  1O7N A;  4GOF A;  3CXH E;  3HE4 A;  4W80 A;  1JY3 P;  5H2F E;  1RQV A;  3B5N C;  5B66 E;  3MD0 A;  2YNY A;  3VMG D;  1N7S C;  3HE5 A;  2R5B A;  1NGM B;  3AE4 C;  3GZX A;  1YYC A;  1SQV G;  1OW6 A;  2O3J A;  2I1K A;  2HR3 A;  1JTH A;  3GF7 A;  3C8V A;  1FZB A;  1NTZ E;  3M0D C;  2OTK E;  1EDK A;  3A3Y B;  1BCC G;  1PPJ G;  4IL6 X;  3N7N A;  2YKO A;  4WY4 D;  5EFW B;  4HM8 A;  2A45 H;  3CXH I;  2NWF A;  2WPQ A;  2IBZ D;  1NTZ J;  2GUS A;  3JC2 2;  3A2A A;  2LR2 A;  4AIV A;  3AEE C;  1FAV A;  2B1X A;  2PGD A;  2M8R A;  2QRX A;  4C7N B;  4NB9 D;  2KNC A;  2L5G B;  2Q3W A;  2AEF A;  1NTK D;  2D2C B;  2HPC B;  2BAS A;  1EC5 A;  4QUP A;  5CMZ A;  5AVW B;  1GMJ A;  4IL6 H;  2OYH B;  2JWA A;  2OYI C;  2QJK C;  1T8Z A;  3BCC D;  4PV1 B;  3SWK A;  4IFM A;  3KDP B;  2QJP B;  1JO5 A;  3TGU D;  3PP5 A;  3Q5P A;  2SPZ A;  2B9B A;  2J58 A;  1J2J B;  2YIU B;  1VCK A;  3L71 E;  5KAI E;  1KQL A;  4HM2 A;  4I7Z C;  2YXQ B;  2WIT A;  4K35 A;  1YQ3 C;  4BRY B;  2NVF A;  1DD4 A;  1MFZ A;  1AJY A;  1R8E A;  3L74 D;  1BGY D;  2Y9Z A;  1JUN A;  1RQU A;  4LGD E;  3L4F A;  2HYN A;  4H0L B;  3L71 J;  4AUW A;  2WPV B;  3SWY A;  1L0L E;  5TIS E;  1S9K D;  1H8A A;  1L0N D;  1SFC C;  1KZU B;  1N73 A;  1WT6 A;  3H1L G;  1EZV G;  1RE4 C;  2CKF A;  3QWO C;  2N1T C;  1L0L J;  1M1J C;  1LT9 C;  3MUD A;  5AVX B;  4Y28 J;  1KTM A;  1X0T A;  4NBD D;  1PGO A;  3BAS A;  1FU1 A;  4U3F D;  2YO3 A;  3WUU A;  2A06 E;  1NWQ A;  4WY4 A;  3N4X A;  1RFS A;  1SQP K;  2CPB A;  1KYO E;  1LP1 B;  2JEE A;  1IJD B;  1J1D C;  2O1J A;  2HFE D;  1GW3 A;  2NRG A;  2DW3 A;  4R4M A;  3SWF A;  4W7Z A;  1XTG B;  1GK6 A;  3NXS A;  1NOH A;  4WWI A;  2KYV A;  1AA0 A;  1LWU B;  3B5N D;  1RF1 C;  1BSH A;  3D6Y A;  2A45 G;  3RBZ A;  2JP3 A;  3GTS A;  2NPS B;  3GLM A;  1VQ5 P;  3L70 E;  4Y99 B;  3GHG B;  3AEF C;  3GCE A;  1GL2 A;  2M5A B;  2E76 B;  1ZV8 A;  1X9V A;  1O7G A;  2IFM A;  3L70 J;  3CLQ A;  3EQQ A;  4GKG A;  2FXM A;  3PRJ A;  3ABV C;  4ZNC A;  1M8O B;  1SQB E;  3KPE A;  3T97 B;  1W2E A;  2AEJ A;  2N9Y B;  4MN4 C;  4I2L C;  1WQL A;  3D71 A;  3L37 A;  1NTM K;  1SQB J;  2BCC D;  5BVZ A;  4XA4 A;  4KT0 J;  1IFI A;  1N7S B;  2YMY A;  5APQ A;  3U59 A;  4ZKU A;  3H6P A;  1SQQ D;  2L91 A;  3CCV P;  1P84 D;  4HH2 A;  3MGN A;  3FOU A;  1L0N G;  3CCJ P;  1W5C E;  2E43 A;  1JY2 N;  3RK3 E;  2KK7 A;  2R3C A;  2IDB A;  3B5N A;  2ITA A;  3H1H G;  1SFC D;  3L75 E;  1YJW P;  1L4A B;  1FDI A;  1VPC A;  5B66 H;  3Q1M A;  3E1I A;  1NTZ D;  2J5U A;  3HTK A;  2N1T D;  1Q81 Q;  3G6E P;  3TF5 A;  1KOR A;  4U3F G;  3LW5 H;  3L75 J;  2C9N Y;  3KQG A;  2PAJ A;  4D6T E;  1BE3 E;  2PP6 A;  2J59 M;  3IR9 A;  4YXD C;  1O7P A;  2KIK A;  1NKZ B;  2WSF J;  1HJ0 A;  3GTE A;  3TDK A;  3W68 A;  4I7Z B;  2JWD A;  3P8M C;  4D6T J;  5L8R J;  1BE3 J;  2Y0C A;  1KIL E;  2JJL A;  3ZDM A;  1JCC A;  3WUT A;  4GOE A;  1JNM A;  3A0B E;  1DIP A;  1ZME C;  1FC2 C;  2IYP A;  1YBK A;  3L73 G;  3CCL P;  1FS0 E;  1ZW0 A;  5APY A;  4ZMD A;  1VQN P;  1G1J A;  2N9B A;  2QEX P;  3FGA D;  1JY2 O;  2N1T B;  3MUD C;  2BMO A;  1OVU A;  1NH4 A;  1LT9 B;  1PV3 A;  3R2P A;  3CMA P;  2W6A A;  1VQK P;  3P7K A;  3H1J G;  1CI6 B;  4I6M C;  2FYU G;  1SQV D;  4WY4 C;  3IN6 A;  3NMD A;  3EQ2 A;  4EI2 A;  3W67 A;  2E74 B;  1KQF B;  1OVR A;  1RIE A;  1Q82 Q;  1BCC D;  3CCU P;  1YHQ P;  1PL5 A;  2C9L Y;  1DX7 A;  4JYB A;  5TIS H;  1M90 Q;  1QX8 A;  1LTJ A;  3L36 A;  3BVH A;  4DCK A;  1J1E B;  1RF0 C;  3WU2 H;  2QSI A;  4BXL A;  1KFM A;  3CCM P;  4GDO A;  3JSV C;  1KFN A;  3V2N A;  3VYI A;  1MKM A;  4HJG H;  4JPZ B;  1IC2 A;  3H1I E;  5AW2 B;  1KIL C;  1Q90 C;  3O6Q B;  1KYO D;  1PGQ A;  3D6Z A;  1D7M A;  3AE7 C;  1GL2 C;  1M56 D;  1FBM A;  1ZOY C;  2P1J A;  3H1K E;  2K9J B;  3H1I J;  3NTN A;  5DJT B;  3TNU B;  5KKZ C;  4LLH A;  4GT1 A;  2OQQ A;  2WZ7 A;  2WSC H;  4QUQ A;  3L72 E;  3AZC A;  3A5T A;  2FFD B;  1E79 H;  4H44 C;  1NTK K;  3H1K J;  3VP9 A;  1NTZ G;  2I7F A;  3KZI H;  3L72 J;  3GW6 A;  1RF1 A;  4GIF A;  3AED C;  2FYN B;  4DZO A;  1QVF O;  2HOD A;  3RK2 B;  4OWF A;  2GBW A;  1YIJ P;  4P1B H;  2Y0D A;  3H1L D;  2KOG A;  2YKP A;  1K73 Q;  3CC7 P;  1YTZ I;  3RL0 C;  3AE6 C;  4TLF A;  1VF5 B;  2E4Q A;  1T2K C;  1NYH A;  1XTC C;  1HWT C;  4OH8 B;  3BRV B;  4JF7 A;  1JTH B;  4PD4 D;  3V2Q A;  5AW4 B;  1YJN P;  4ASV A;  1L0N K;  1SLQ A;  2CPS A;  2GA1 A;  4NBF D;  5APT A;  3Q2Y A;  1N2D C;  2ZXX A;  2HMN A;  5M1B A;  2R32 A;  1PGJ A;  3L71 G;  4EOT A;  1S4X A;  2DE6 D;  3HUS A;  1IFM A;  2Q6Q A;  2H43 A;  2B87 A;  1NO4 A;  2OGU A;  5APW A;  1L0L G;  1BDC A;  2R5D A;  1YI2 P;  2YFI A;  5E79 E;  1G2C B;  4IOI H;  3EWK A;  4HM5 A;  5CCG A;  1SQP E;  3LW5 J;  2KS1 B;  1FOS F;  2FXP A;  2K3R A;  4H13 C;  3EN1 A;  1O7W A;  1T6A A;  5KLV E;  5DJU B;  2POH A;  2WQY C;  3SFD C;  1IFJ A;  1SQP J;  2XDJ A;  5AW3 B;  2A06 G;  1VQ7 P;  3D89 A;  3PTZ A;  5BU8 B;  4D6T D;  5KLV J;  1N73 B;  3VMX A;  1K05 A;  1DH3 A;  2Q9I A;  1ZR2 A;  4NBH D;  3Q5R A;  1H88 A;  2WSF H;  2PFX A;  2BMR A;  4P1C H;  3AE5 C;  1SQX K;  2OYO A;  1ULJ A;  1U57 A;  1KIL D;  1Q90 D;  1G8K B;  1GU5 A;  1EDL A;  1GL2 D;  4W7Y A;  1ZRT E;  1KN7 A;  1LTS C;  4WY4 B;  3R4Y A;  3MZW B;  2P10 A;  3L70 G;  4N78 E;  3A0B H;  4H44 D;  4YPC A;  1LTJ C;  3AE2 C;  3SSU A;  5AW7 B;  3WU2 E;  1K04 A;  1NTM E;  4L75 A;  4NBA D;  1PP9 E;  2ZAE B;  4NBB D;  1A02 F;  1AVY A;  1SQQ K;  4C7N A;  1PIX A;  5CBN A;  1AQT A;  3H1H D;  1SQB G;  4I1L A;  1H89 A;  4DT0 A;  3G71 P;  1NTM J;  1NU1 K;  2HPC A;  1VQM P;  3RL0 D;  1PP9 J;  2HMM A;  2Z5I A;  1T2K D;  1LTG C;  5GTI H;  2Y9Y A;  5CBO A;  4EIJ A;  3CCR P;  5AW1 B;  4QDF A;  2RH0 A;  1ZN5 A;  2Q1K A;  1HUC A;  2KUB A;  3CX5 D;  1FE6 A;  3BAT A;  1AFO A;  2R44 A;  1X79 B;  4QDD A;  4OVN F;  2YO2 A;  2QG4 A;  1NTZ K;  2NUK A;  2WSC J;  5KJ7 A;  3KZI E;  3AEG C;  1SP4 A;  1RF0 A;  2WMM A;  1FZC A;  2QJY C;  2RKL A;  3OJA B;  1VQP P;  1GW4 A;  3O8Z A;  3L73 D;  2IYO A;  1PFI A;  3HD7 D;  2Q3E A;  1R5L A;  3ITK A;  5C39 A;  1KIL A;  3WMM 0;  2YFL A;  3GF3 A;  1USD A;  3RL0 B;  3PLN A;  3L75 G;  3H32 B;  1KV4 A;  4L76 A;  2K9Y A;  2XR8 A;  3II6 A;  3H1J D;  1IO4 A;  1URQ D;  2FYU D;  5KLI C;  4H13 D;  2O1K A;  3V4W A;  1EDJ A;  4D6T G;  1VDF A;  1BE3 G;  2LXB A;  1ZR4 A;  1LP1 A;  3B5N B;  3HUS C;  2C0X A;  3C0D A;  2WSE H;  1UUW A;  2E5T A;  4HM0 A;  1KB9 E;  2KZJ A;  5CCH C;  1LWU A;  4UB8 H;  1VQ6 P;  3GG2 A;  1FZE A;  2W83 C;  1SQV K;  1QGK B;  2M3B A;  3H25 A;  2P2U A;  3CXH D;  5CCG C;  1KC8 Q;  3Q5S A;  2NPS A;  4C46 A;  1AV1 A;  1S5L E;  2G8Y A;  3TSI A;  2ZVN B;  1VQO P;  1LT1 A;  2E4P A;  1OZH A;  3CC2 P;  2QPZ A;  4O9B A;  4H13 B;  1EZV I;  3CWB E;  4QMA A;  3PJS K;  2OTJ P;  2ZXE B;  2XU6 A;  3E1R A;  2JZA A;  3GKE A;  3C1L A;  4WVZ A;  2P67 A;  1GDT A;  1MFT A;  1CZQ A;  2WT7 A;  3CWB J;  1KB9 I;  3I56 P;  1U7J A;  2KB7 P;  3HD7 A;  2I1J A;  3G9R A;  2OYI B;  2QJK B;  2NVG A;  3NFQ A;  2P58 A;  5E79 H;  5GTH H;  5KLV D;  4QDC A;  2IBZ E;  4RO0 A;  5AW9 B;  3MHV A;  1URQ A;  2JO6 A;  2HLO A;  3U1A A;  1S72 P;  3H1I G;  4DJG A;  3CCS P;  3AEB C;  2FXO A;  3D70 A;  1NTK E;  3PHL A;  5CXM A;  4YTP C;  2XNX A;  3BCC E;  1NHL A;  2WSS H;  3USS A;  3TGU E;  2HMK A;  3H1K G;  4N6J A;  2QIW A;  1SFC B;  2Q5U A;  2ZYL A;  4PJ0 E;  1NTK J;  2QA4 P;  3L71 D;  1K9M Q;  3C9I A;  3L72 G;  1KMI Z;  1YJ9 P;  3CD6 P;  1K8A Q;  1MUU A;  3BCC J;  4JYC A;  3VMZ A;  1FJK A;  1L4A A;  3TGU J;  3VMH D;  2ZT9 C;  1ZRT D;  1M1J B;  1JMM A;  2D2C C;  4RES B;  2IBZ I;  3RK3 C;  4HM4 A;  3L74 E;  1BGY E;  3N0Q A;  5GTI E;  4PV1 C;  3FXE A;  1L0L D;  2QJP C;  2K1A A;  1S9K E;  2YIU C;  2XND H;  2V7Q H;  1Q86 Q;  3RGU A;  1PP9 D;  1BGY J;  3L74 J;  1R5S A;  3S4R A;  1JY3 N;  3OW2 O;  2KXP B;  4QCK A;  2P7J A;  1J1D B;  1L0N J;  1EDI A;  5KJ7 C;  1QL1 A;  3FXD A;  4H0L C;  5CJ4 A;  1Z56 A;  1FZC C;  3M06 A;  1DEE G;  1OMI A;  1USE A;  1RF1 B;  1QLE D;  1JMB A;  2A06 D;  1VQ9 P;  3VCA A;  2HOD B;  4UB6 H;  1JY2 P;  5CCH D;  3S1K A;  1KQS O;  1OX3 A;  4EDF A;  2KLU A;  2YXR B;  1VQ4 P;  1HGZ A;  2O01 H;  2RN0 A;  5CCG D;  2XKM A;  1OXZ A;  1S2E A;  2DE7 D;  4NPE A;  3GZY A;  1X22 A;  5KLI B;  2Y0E A;  4LC1 A;  1EXI A;  4AYC A;  3HE4 B;  1AVO A;  1SQP G;  1CSB A;  3M9B A;  4C7R A;  3L70 D;  3P8C E;  3WUV A;  2HMJ A;  3CL3 D;  2XSH A;  3KXD A;  2HMO A;  1VQ8 P;  1JY3 O;  1M57 D;  1HJB A; 
#chains in the Genus database with same CATH homology
 2QJY C;  4HM1 A;  1ULJ A;  3CWB E;  3GB4 A;  1VM9 A;  1L0L E;  2FYN C;  2QJP C;  1O7G A;  4OGQ D;  1SQX E;  4EMJ B;  2JZA A;  4NBF D;  3L73 E;  2NUM A;  3GKE A;  1G8K B;  2YIU C;  3GZX A;  4D6T E;  4H0L D;  1BE3 E;  2HMN A;  1O7P A;  3EQQ A;  2E76 D;  2CKF A;  2YFJ A;  2YFL A;  1SQB E;  4AAY B;  1ZRT E;  4QCK A;  5AEU A;  2DE6 D;  3H1I E;  1SJG A;  3GTE A;  1NTZ E;  4HKV A;  1Q90 C;  3GOB A;  1WQL A;  4NBE D;  2XR8 A;  3VCP A;  4H44 D;  1L0N E;  2B24 A;  2NVG A;  3H1J E;  4HM8 A;  4NBD D;  1UUV A;  2BCC E;  3H1K E;  2NWF A;  1NTM E;  5KLI C;  2FYU E;  2YFI A;  4H13 D;  4QDC A;  4NBA D;  2IBZ E;  3GL0 A;  4QUR A;  4NB8 D;  4AIV A;  1PP9 E;  2HML A;  2A06 E;  5KKZ C;  4NBB D;  2B1X A;  4HM7 A;  3VCA A;  4QUQ A;  1RFS A;  3L72 E;  3AZC A;  4QDF B;  2JO6 A;  4NB9 D;  4HJL A;  2E75 D;  4HM5 A;  3H1H E;  1SQP E;  1SQQ E;  1KYO E;  1G8J B;  2Q3W A;  2XRX A;  2GBX A;  2I7F A;  1NTK E;  3EN1 A;  2HMM A;  1EG9 A;  4QUP A;  3C0D A;  1O7W A;  2BMO A;  1P84 E;  1NU1 E;  5CXM A;  5KLV E;  1O7H A;  1UUW A;  2QJK C;  3FOU A;  1O7M A;  3BCC E;  4HM0 A;  1KB9 E;  4U3F E;  4NBG D;  2ZT9 D;  2DE7 D;  2GBW A;  2YVJ B;  3TGU E;  2D2C D;  1NYK A;  2HMK A;  4QDF A;  4P1B H;  1ULI A;  3H1L E;  1EZV E;  2ZYL A;  3GZY A;  3VMI D;  1JM1 A;  1VCK A;  4PV1 D;  1O7N A;  3D89 A;  4NBC D;  1SQV E;  3L71 E;  3GL2 A;  3CX5 E;  2E4Q A;  1NDO A;  4HM2 A;  5HL4 A;  5AEW A;  3CXH E;  2DE5 D;  2XSO A;  4HM6 A;  4QDD A;  1RIE A;  3GTS A;  3L75 E;  3DQY A;  2NUK A;  3VMH D;  3L70 E;  2NVF A;  1BCC E;  2BMQ A;  2HMJ A;  1PPJ E;  4NBH D;  4HM3 A;  4PD4 E;  1FQT A;  5BOK A;  4HM4 A;  1VF5 D;  2BMR A;  2XSH A;  4P1C H;  3L74 E;  1BGY E;  2E4P A;  2E74 D;  2NVE A;  3GCE A;  3N0Q A;  3VMG D;  2HMO A;  2QPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...