1SQBE

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqbE02
3L72E 2Q3WA 4QDFA 4OGQD 4NB9D 3D89A 1G8KB 1BE3E 1ULJA 4QDDA 2GBWA 5HL4A 1VCKA 4H44D 3VMHD 2YFJA 1FQTA 3L71E 2B24A 2BMQA 1JM1A 4NBFD 1SQQE 1NTKE 4HJLA 1EG9A 3GKEA 2NUMA 5KKZC 1UUWA 2NVGA 4HM6A 4AAYB 2ZT9D 3GTEA 3GOBA 2XR8A 3FOUA 1L0LE 3L75E 3N0QA 3H1IE 2YIUC 2E4PA 4PV1D 4NBBD 5KLVE 1NU1E 3VCPA 3GB4A 3AZCA 1NTZE 2E75D 4P1BH 1SQBE 5AEUA 4PD4E 1UUVA 2CKFA 4QDFB 1NDOA 2XSHA 1O7MA 3GZXA 4QUQA 2DE7D 1KYOE 3GTSA 3VMID 2FYNC 4NBED 2YFIA 1EZVE 3EQQA 1BCCE 3H1JE 1WQLA 2FYUE 2DE6D 4HKVA 4AIVA 2A06E 5KLIC 4EMJB 3CWBE 4D6TE 4HM5A 4H0LD 3VMGD 1SQXE 2JZAA 3GL0A 3GZYA 1ULIA 3CXHE 5CXMA 1O7GA 3BCCE 2QJKC 2DE5D 4QUPA 2ZYLA 1O7WA 3TGUE 1RFSA 1SQVE 2HMMA 4NBAD 2BMOA 1NTME 2BMRA 2E74D 2QJYC 3CX5E 4HM2A 3EN1A 2IBZE 2NUKA 2HMKA 4HM4A 4NBDD 3H1LE 1P84E 4NBHD 2NVEA 3L74E 1G8JB 3VCAA 3C0DA 1VF5D 2XRXA 4QDCA 5BOKA 1O7PA 1KB9E 2QJPC 2BCCE 1RIEA 1VM9A 4U3FE 1ZRTE 2HMNA 2D2CD 5AEWA 2HMOA 4H13D 4HM3A 4P1CH 3H1KE 1SJGA 2HMJA 2YVJB 2HMLA 3DQYA 1SQPE 3GL2A 3H1HE 3GCEA 2JO6A 1L0NE 1BGYE 1Q90C 3L70E 1O7NA 4NBGD 2NWFA 1NYKA 4HM0A 4NB8D 4QCKA 3L73E 2QPZA 1O7HA 2E4QA 4HM8A 2GBXA 2I7FA 2XSOA 1PP9E 4NBCD 2YFLA 2E76D 4HM1A 4QURA 2NVFA 2B1XA 1PPJE 4HM7A
chains in the Genus database with same CATH superfamily
1LTSC 1RE3A 1ULJA 3Q1MA 3IAOA 2KOGA 2KK7A 1VCKA 3VMHD 1RF0A 3L71D 4U3FG 3PJSK 2IDBA 1UUWA 2Q5UA 2KLUA 1SQPG 1YHQP 1KN7A 2AEFA 3GTEA 3P8MC 1S5LX 5CJ0A 1S9KD 3V6IA 1W2EA 2E76B 5GTHH 4KHXA 4B86A 1PPJG 2E75D 2XU6A 4GDOA 1DEBA 5E79H 4NBED 2A45G 4ZNCA 1EZVD 3BATA 1JCDA 2KZJA 3RBXA 1WQLA 3I5CA 2FFDC 2ITAA 1KILA 1GK6A 2ZT9B 1YJ9P 2G3AA 3B4SA 4H44C 3WU2E 3T97A 2ZYLA 3H1LJ 3G6EP 2R32A 2KB7P 1HJ0A 1HTLC 4OH8B 3MTUE 2FXPA 1VQ9P 2IYPA 4PV1C 1KB9D 2QSIA 3P8CD 2HFED 2QA4P 2HMNA 2FYUG 4GODA 4C7RA 2Q3EA 3HUSC 3GL2A 3HRNA 2JO6A 2QIWA 1ZXGA 3LW5J 1KILB 2QJPB 2HPCA 3IR9A 3L70D 1FDIA 1SQXG 1PL5A 3L73D 2XZRA 1EQ7A 5AW7B 1BDCA 1GZLA 3T97B 1EDJA 3F5HA 4R4MA 2IZ0A 1M8OB 2B1XA 2ZVOB 4DCKA 1FU1A 1G8KB 1EDLA 3L74G 4L75A 1A02F 1OVVA 3L37A 2E5YA 3MUDC 5TISE 1YQ3C 4ASVA 1VQPP 1SQQE 1T8ZA 1JY2P 2ZYDA 2GUSA 2H8PD 1N73A 1R8EA 2NVGA 2A06D 1FZAA 2HPCB 2FFDA 3WU2H 2XR8A 2YIUC 3Q2YA 1ZOYC 4JYCA 1S1CX 5AW9B 1FZFA 1ZW0A 2OQQA 3E1RA 1GU5A 3I55P 3NXSA 1KFNA 1LT9C 1NTKG 1JNMA 1N7SB 2JEEA 5AVVB 3O8ZA 3G71P 5CCHD 1N73B 3GW6A 2P2UA 3CC2P 1O7WA 4XFJA 1CI6A 3M9BA 4NBAD 2CK3H 3M9QA 5KLVG 3CCLP 2BEZF 2R3SA 3D70A 2XRXA 4H0LC 2XKMA 1LWUA 1ZRTE 5TISH 2ZFCA 5C39A 2HMLA 3CC7P 1AQ5A 1FDOA 1BSHA 1L0NE 2Y0EA 3MUDA 5AW6B 1FOSE 3NFQA 4RO0A 2XSOA 2YXRB 2KSJA 1CI6B 3W67A 1Y47A 2K88A 2JJLA 1GDTA 4NB9D 4OVNF 2N1TD 2Y9YA 1BDDA 1PIXA 4W7YA 2KIKA 1S5LE 1JMMA 1LWUB 2XNDH 2I1KA 3GOBA 3B71A 1SQBJ 1GD2E 1LT1A 3VCPA 2LXBA 1NTZE 2KXPB 1QGKB 4PD4E 2YIUB 1KYOE 2FYNC 2QJKB 1N7SD 5APXA 1LJ2A 3SWFA 3ZDMA 4D6TE 4HM5A 1SQVJ 5APUA 3RK2C 3Q3DA 4XE5B 4AQRD 4I6MC 2BMRA 5AVZB 3G9RA 2FYZA 4I7ZC 2JR8A 5BOKA 2BCCE 1Q82Q 3VMZA 3D6ZA 1S5LH 1SJGA 1OMIA 5AW1B 4ZKPA 3CCVP 4H0LB 5APSA 3PP5A 4HM0A 1NYKA 3H6PA 5CCGD 3WUUA 1SQQK 4PD4I 2KLVA 3BCCG 1FAVA 3M9HA 1YJNP 4JBZA 5AW4B 3JCUE 1RF1C 1FE6A 4WWIA 3H1LG 4PD4H 3H32A 5KAFE 1QL2A 1KYOH 1X22A 3HE5A 2MJZA 2B9BA 2ZYGA 4NBFD 5AVXB 1GL2A 1DD4A 4HKZH 1NU1J 4Y28J 4KT0J 5B66E 1IK7A 2G8YA 3ABVC 1CZQA 1J1EB 3IFMA 3L36A 3TNUA 2ZXXA 3U1CA 4RESB 2YFIA 3V5BA 3CCUP 2A06E 1EDKA 5KLIC 3GLMA 1L0NJ 3TSIA 3FXEA 3CPWO 2P7JA 1YBKA 3KHUA 3AE3C 2FYNB 4LLHA 1GL2B 1JUNA 3TGUE 1L0NK 1NTME 1LP1A 3BASA 2KUBA 2SPZA 2NPSC 3JCUH 1NJIQ 1FJKA 5AW8B 2CPSA 5KAFH 1AV1A 4JYBA 1LTAC 1IFIA 2P67A 1RF1A 1HWTC 2HMJA 3CXHI 4DOJA 1WRGA 1O7HA 3HTKA 1K9MQ 3V2PA 1EXJA 2BASA 1PP9E 4A7PA 1VQNP 5CHXA 4NBCD 5B66H 4R4LA 3CXHH 1NTZJ 1LP1B 1DIPA 4OGQD 1PGPA 3L71J 1CSBA 2IX7C 1MV8A 4GOFA 4NPFX 2YKPA 1NTZK 1OW8A 2YFJA 1RH5B 2B24A 3H1KG 4D6TJ 1SQQD 1EG9A 1GK4A 4I2LC 1L0LE 4IFDK 5APQA 3HTKB 2E4PA 3TYYA 2YNYA 3N4XA 3K5BA 2R3CA 1KORA 2VRSA 3RK3E 2V7QH 3S4RA 2BCCJ 1BE3G 4TLFA 3GTSA 1MUUA 1HGZA 1NYHA 1ZR2A 1GL2D 3CMEP 3A3YB 1H0TA 3PRJA 3MGNA 3AE5C 1NAYA 1QX8A 3L75G 5KAIE 3WUTA 1NWQA 2E75B 3SWYA 3TK1A 2NVEA 3CCMP 1GU4A 1VF5D 1SQBG 2O01J 1KQLA 5CCHC 1O7PA 1J1DB 1M7LA 3L70J 1YTZI 1ZRTD 3H1JG 3L73J 1PGQA 3DQYA 1JY3P 1L0ND 1CW5A 1DX7A 2C0WA 1H0TB 3USSA 3VOPA 3G4SP 1SQVG 3V2RA 2FBWC 5DJTB 4BRYA 3L72E 5TJHA 2FKWB 2Q3WA 1PV3A 1E5WA 2O01N 1T3JA 3H25A 1MFZA 3EFGA 2NUMA 2IYOA 3IF4A 1USDA 2N9YB 2N1TC 3TGUJ 4EIJA 3FOUA 2KYVA 1NTMJ 2PGDA 3B5ND 5KAIH 2LR2A 2AEMA 1NTZD 3CCEP 4BRYB 1HBWA 1NTMK 1UUVA 4PD4D 3RL0g 1KYOD 4EI2A 2WPQA 1H88A 2PP6A 4AYCA 1R5SA 4L73A 2MKVA 2GM4A 5CCHA 3CWBE 1VQ7P 4D6TD 3VMGD 1EDIA 1JB0J 2DW3A 1IFDA 4M3LA 1JMBA 2E74D 3EQ2A 3H1IG 1T3UA 1N7SC 1NU1G 5APWA 1N73C 3C0DA 1MZ9A 3HD7D 3JSVC 2BCCD 1S2EA 2HMOA 3H1HE 5APTA 4CPGA 1BGYE 1L0LJ 1LTIC 1URQD 1RY3A 1YYCA 3AE8C 3Q5SA 1JY2N 2P1JA 2IBZG 2N1TA 1L0LK 4LC1A 1M90Q 2J58A 1RQVA 2JWAA 1N86A 5APYA 1OWAA 1YIJP 1T2KC 4YPCA 2B89A 1L4AD 4C7NB 2V4HA 3AE4C 2RN0A 1LWUC 3CXHD 2IFNA 5DJUB 2N1TB 1YQ4C 1HGVA 1N7SA 1BCCE 2J59M 3L71G 5AVQB 3KDPB 2AXTE 2Y9ZA 5AVUB 3SSUA 2GA1A 2H89C 5EFWB 2QJKC 1PFIA 4D6TG 3TGUD 1NTMD 3L72J 4GOEA 3HE4A 4NBDD 2Z5IA 2WWWA 1VPCA 2YKOA 4U3FE 2JWDA 1EZVG 3MD0A 2P10A 3VN0A 1SQPE 2D2CB 4BXLA 3CD6P 5CCGA 1HF9A 1MFTA 5GTIH 1PP9D 2L91A 5AVWB 3FWLA 4QURA 5BU8B 3G3ZA 1Q86Q 1VQLP 1PPJE 3VP8A 3HE4B 2HODA 3AEDC 2K37A 3SFDC 1YTZT 2Y0CA 1FQTA 2JDIH 2WVRA 3CWBJ 1N8RQ 4IOIH 1LTJB 3KXDA 5KKZC 3ITKA 2AXTH 1Q2NA 3N7NA 3L70G 2RKLA 5CBOA 3CCRP 3L73G 2FY8A 2XDJA 2YMKA 1L0LD 2LKMA 1XTGB 2E43A 3RK3D 1FZCC 4P1BH 2R5DA 2HODB 3VMXA 1NDOA 1KQFB 1G1IA 3GZXA 4GKGA 1NAFA 2FYUE 4HKVA 1VQ8P 1NO4A 3A2AA 2H43A 1J1EC 4LGDE 1BGYJ 1IZNB 1SQXE 1Y8AA 2QM7A 2A06G 3SFEC 4O9BA 4K3AA 2WITA 2DE5D 2A45I 2Y0DA 5AVSB 3R2PA 2W6JH 3S1KA 2WSEH 2IPPA 3L74E 1GL2C 1ZP0C 4QDCA 2Q7CA 2A45H 2D2CD 4H13D 2IZ1A 2YVJB 1ZV8A 2Q3IA 2QVAA 3EWKA 1VF5C 2UWJE 2IBZI 1LNQA 4EDFA 2O3JA 1SLQA 1K05A 2NVFA 4HM7A 4I1LA 3L72D 1WMKA 1YI2P 3D89A 3C1LA 1SQQJ 1KQGB 1K73Q 1BCCJ 2ZXEB 1FZCA 1TU3F 4H44D 1BSNA 4YXDC 3RL0D 1KMIZ 1NTKE 4N78E 1FOSF 1LGHB 1JO5A 2NZ2A 1JTHA 1DD3A 1SFCB 2HLOA 5AVYB 1OX3A 4PV1D 2K9JA 1IC2A 5KKZB 1KD1Q 5KLVE 1QEXA 1U7JA 4OGQB 5AEUA 1UIIA 2CKFA 1O7MA 2W6BA 4WY4D 2QE7H 1QL1A 3PHLA 2OYIA 1FZCB 3LIDA 2OTKE 1SQPJ 3CWBD 2M5AB 3CXHE 1JTHB 1SQPK 4HB1A 1KC8Q 1W5CE 3VTPC 2YXQB 2ZYAA 3EN1A 2K9JB 3AEFC 1WT6A 1FC2C 1PGOA 4NPDA 1FDMA 1G8JB 3S9OA 1OVRA 3A7OA 2Z5HA 3R4YA 1E79H 2OYIB 4P1CH 2E75C 1M1JA 3KYQA 2E74C 2ZAEB 4RKUJ 1YITP 3H1HD 3A0HE 2AXCA 3MIWA 1BGYD 1J1DC 1FZBA 3HD7C 2WSFH 3M0DC 2KS1A 1VF5B 2OTJP 2QG4A 2WSCH 2ZVNB 4ZMDA 5BVZA 5KJ7D 3M0AA 3AE7C 3V4QA 1SFCD 4JF7A 2WMMA 1M1JB 2RH0A 4HM6A 2FYUK 1EXIA 1AVOA 3CC4P 4ASWA 2NRGA 3B5NA 2R5BA 2M0BA 1SQXK 5B5EE 2OGUA 1OZHA 3CCJP 2C9NY 1OW7A 2WPRA 3F89A 3L74J 4OWFA 4UB6E 1L4AC 2E42A 2KS1B 2KNCA 2H88C 1BCCD 2WSSH 2ZJSE 3A0HH 2JZAA 1KILE 1M56D 2N9BA 3BCCE 3B5NB 3MP7B 1OXZA 2W83C 1QVGO 1Z56A 1JY3N 4HM4A 4Y99B 3HD7A 3H1LE 1P84E 3U59A 5AVTB 1IFMA 3TF5A 2KNCB 2PRRA 3M0DA 4U3FD 1NTKJ 2P58A 1IFJA 2B88A 3CCQP 1SQPD 3FWNA 1URQA 1NTKK 2E74B 2WPVB 4HM1A 5B5EH 1PPJD 1S72P 2HYNA 1R5LA 4UB6H 1ZR4A 3HD7B 2JKVA 2HG5D 4QDDA 1XTCC 5KLVK 2E5TA 2Q6QA 1D7MA 4N6JA 2Z4EA 2I8DA 4PJ0H 1L4AA 4K35A 4XA4A 2IFMA 1P84I 3CL3D 3L35A 1YJWP 1URQB 2OTLP 3D71A 1VQ5P 1MKMA 2C0XA 3AEEC 4NBBD 4NPEA 1KZUB 1P84H 2XSHA 4QUQA 1IJDB 1S3JA 4GT1A 2FYUD 2DE6D 1X79B 2QJYB 4EMJB 5CMZA 1L4AB 1SQQG 3CI9A 3RK3C 2WT7A 1SQXD 5AW5B 2V7QJ 3P7KA 3LW5H 3D6YA 5AW0B 1Y9BA 1Q90D 1H89A 3L74D 2KZIA 3AE9C 3JC22 3H1KE 3LIEA 1KV4A 1PP9J 4NB8D 2WT7B 4HM8A 2GBXA 3AE1C 2I7FA 1OFCX 3GHGC 2D2CC 4H13C 4WBAA 1N2DC 4QDFA 1QLED 1S4XA 3OA7A 1BE3E 1FZEA 2K1AA 4C7NA 1VQKP 1LTTC 1NTKD 2XNXA 4N78D 1VL2A 1L0NG 3KPEA 4AAYB 2NPSD 3BCCJ 3QWOC 1N7LA 3L75E 4BWNA 2L5GB 3BRTB 1G1JA 1LTJC 3Q5RA 5KLVD 3AZCA 1AFOA 3RL0C 1ZMEC 2WQYC 1SQBE 5CCGC 4QDFB 3VP9A 3AEAC 1K04A 3H1JE 5AW3B 2CPBA 1NOHA 3GF3A 1RHZB 5GTIE 3AE2C 1Q81Q 1O7GA 1SQVE 4WY4C 3CCSP 3WMM0 3CX5E 2QRXA 1NVOA 4HM2A 1NKNA 2NUKA 3RK3B 4NBHD 1NTZG 3GHGA 1GW3A 2KSEA 2BEQD 2YMYA 1FBMA 1VM9A 4ZKUA 1G2CA 3IN6A 3P32A 4QCKA 3AEGC 1M1KQ 2PAJA 1IFPA 1IK9A 2E76D 3W68A 3KQGA 3WUVA 3M91A 1LTBC 2GBWA 1LTJA 3GHGB 5HL4A 2BCCG 2Q9IA 2B87A 4H13B 4EOTA 3CX5I 1G2CB 2ZT9D 2WZ7A 3FGAD 1IFNA 1NHLA 3VMAA 5L8RJ 3H1IE 1FJPA 3EFFK 4JPZB 5KJ7C 3CX5H 1NU1E 1KFMA 3A5TA 3HUSA 2FFDB 1SFCC 1NKZB 1QVFO 4WY4A 3PH0A 3BRVB 1A02J 3MHVA 4L74A 4H44B 3E7KA 3H1KJ 4AIVA 2B87B 3RL0B 4OGQC 1KTMA 2KP8A 1OVUA 1KILD 3V2NA 1VQMP 1LTGC 3BCCD 4PV1B 2HMMA 5KTBA 2IBZE 3GMAA 1H8AA 2HMKA 3VYIA 3H1LD 1P84D 3HUSB 1BE3J 2HR3A 4WY4B 4DZOA 3H1HJ 4IL6X 1HUCA 1JEKA 3UIAA 4DT0A 3GCEA 1VQ6P 3M06A 2QPZA 1RQUA 2I1JA 3L75J 2OYIC 3TGUG 3CLQA 1NTMG 2M3BA 4L76A 2K9YA 4UB8E 1LT9A 3VMYA 3MZWB 1DEEG 5KJ7A 3H1JJ 4RJTA 1SFCA 3L71E 1EC5A 1SQBK 3GKEA 1S9KE 4C46A 1VQOP 5CJ4A 1PP9G 2W90A 5BU5A 1M1JC 3GB4A 3RGUA 4W80A 1AJYA 3FXDA 3TDKA 1SQVK 4HYTB 1LT9B 1UIXA 3OAKA 2DE7D 5K5GB 2QEXP 1JY3O 2M5AA 1EZVE 3OJAB 1GW4A 1SVFA 3CMAP 4IFMA 1JOCA 1T6AA 3GZYA 3AEBC 1JM0A 4HH2A 1USEA 1L0LG 3O6QA 2BMOA 2JP3A 3SWKA 1FS0E 1W2BO 3AECC 1T2KD 4UB8H 2J5UA 4U3FJ 1KYOI 1AA0A 3B5NC 1KB9E 3P8CE 1GTWA 4QMAA 5AEWA 4Y99C 3H1KD 2K3RA 1Q7YQ 1J2JB 1Q90C 3L70E 1O7NA 4NBGD 3L73E 4KJMA 2E4QA 1IO4A 3H1IJ 2FXOA 4YTPC 2WSEJ 3PLNA 1EZVI 3O6QB 2W27A 1NH4A 2POHA 1BE3D 3GG2A 1NU1K 2O1KA 1SS1A 4W7ZA 1X9VA 2BMQA 1JM1A 1RE4C 3H32B 1ZLLA 5AW2B 1PZQA 3HE5B 1JCCA 3N0QA 3L75D 4MN4C 1KB9I 3V2QA 5H2FE 1OIPA 3L72G 2FYUJ 1SQBD 1PGJA 1URQC 5AVRB 3VMID 1KB9H 2QM8A 3C9IA 1SQXJ 3RK2B 3H1JD 3B8EB 5CBNA 1NGMB 2O01H 3I56P 3TNUB 4H0LD 4TT3H 3GL0A 1VQ4P 1ULIA 4I7ZB 4AUWA 5CXMA 4YXWH 2OYHC 1RFSA 2YKQA 1L2PA 1SQVD 2QJYC 3CX5D 4WVZA 3Q5PA 1K8AQ 2Q1KA 4IL6E 3KZIE 3C8VA 2XV5A 3VCAA 1X8YA 3GF7A 2OARA 4PJ0E 1VDFA 1RIEA 4WB4A 3QH9A 4JQ0D 2W6AA 3CWBG 2PFXA 3V4WA 2NWFA 1RF1B 1RE4A 4IFFA 3PTZA 2W8ZA 2M8RA 1HJBA 5H2FH 1HH0A 1JY2O 2WTYA 3A0BE 3II6A 1KQSO 4GIFA 4EYYQ 2E76C 4HJLA 2LXCB 3RBZA 2NPSA 3H1HG 1BGYG 1SP4A 2KI7B 5KLVJ 3L4FA 2WSFJ 3H1ID 1RE3C 1OW6A 5APVA 1AVYA 2WSCJ 2YO3A 3BVHA 1NU1D 2YO2A 4HJGH 5KLIB 2C9LY 4IL6H 2OYHA 3KZIH 1RF0C 1HVVA 3RK2D 2ZT9C 3E1IA 3NTNA 2R44A 3EQQA 2FXMA 3NMDA 2OYOA 1ZN5A 1DH3A 1GMJA 1AQTA 2NPSB 2GUVA 4QUPA 1FZGA 4U7JA 5GTHE 4N3YB 2RMZA 1M57D 2IBZD 2H7HA 5E79E 3A0BH 2OYHB 1KILC 2QJPC 4Z1MH 3U1AA 4DJGA 4HM3A 1BCCG 2WPSA 3FX0A 5M1BA 2AEJA 2O1JA 1U57A 1U7MA 3OW2O 2JO1A 2YFLA 2M3EA 3AE6C 1X0TA
chains in the Genus database with same CATH topology
3L72E 2Q3WA 4QDFA 4OGQD 4NB9D 3D89A 1G8KB 1BE3E 1ULJA 4QDDA 2GBWA 5HL4A 1VCKA 4H44D 3VMHD 2YFJA 1FQTA 3L71E 2B24A 2BMQA 1JM1A 4NBFD 1SQQE 1NTKE 4HJLA 1EG9A 3GKEA 2NUMA 5KKZC 1UUWA 2NVGA 4HM6A 4AAYB 2ZT9D 3GTEA 3GOBA 2XR8A 3FOUA 1L0LE 3L75E 3N0QA 3H1IE 2YIUC 2E4PA 4PV1D 4NBBD 5KLVE 1NU1E 3VCPA 3GB4A 3AZCA 1NTZE 2E75D 4P1BH 1SQBE 5AEUA 4PD4E 1UUVA 2CKFA 4QDFB 1NDOA 2XSHA 1O7MA 3GZXA 4QUQA 2DE7D 1KYOE 3GTSA 3VMID 2FYNC 4NBED 2YFIA 1EZVE 3EQQA 1BCCE 3H1JE 1WQLA 2FYUE 2DE6D 4HKVA 4AIVA 2A06E 5KLIC 4EMJB 3CWBE 4D6TE 4HM5A 4H0LD 3VMGD 1SQXE 2JZAA 3GL0A 3GZYA 1ULIA 3CXHE 5CXMA 1O7GA 3BCCE 2QJKC 2DE5D 4QUPA 2ZYLA 1O7WA 3TGUE 1RFSA 1SQVE 2HMMA 4NBAD 2BMOA 1NTME 2BMRA 2E74D 2QJYC 3CX5E 4HM2A 3EN1A 2IBZE 2NUKA 2HMKA 4HM4A 4NBDD 3H1LE 1P84E 4NBHD 2NVEA 3L74E 1G8JB 3VCAA 3C0DA 1VF5D 2XRXA 4QDCA 5BOKA 1O7PA 1KB9E 2QJPC 2BCCE 1RIEA 1VM9A 4U3FE 1ZRTE 2HMNA 2D2CD 5AEWA 2HMOA 4H13D 4HM3A 4P1CH 3H1KE 1SJGA 2HMJA 2YVJB 2HMLA 3DQYA 1SQPE 3GL2A 3H1HE 3GCEA 2JO6A 1L0NE 1BGYE 1Q90C 3L70E 1O7NA 4NBGD 2NWFA 1NYKA 4HM0A 4NB8D 4QCKA 3L73E 2QPZA 1O7HA 2E4QA 4HM8A 2GBXA 2I7FA 2XSOA 1PP9E 4NBCD 2YFLA 2E76D 4HM1A 4QURA 2NVFA 2B1XA 1PPJE 4HM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 E;  2Q3W A;  4QDF A;  4OGQ D;  4NB9 D;  3D89 A;  1G8K B;  1BE3 E;  1ULJ A;  4QDD A;  2GBW A;  5HL4 A;  1VCK A;  4H44 D;  3VMH D;  2YFJ A;  1FQT A;  3L71 E;  2B24 A;  2BMQ A;  1JM1 A;  4NBF D;  1SQQ E;  1NTK E;  4HJL A;  1EG9 A;  3GKE A;  2NUM A;  5KKZ C;  1UUW A;  2NVG A;  4HM6 A;  4AAY B;  2ZT9 D;  3GTE A;  3GOB A;  2XR8 A;  3FOU A;  1L0L E;  3L75 E;  3N0Q A;  3H1I E;  2YIU C;  2E4P A;  4PV1 D;  4NBB D;  5KLV E;  1NU1 E;  3VCP A;  3GB4 A;  3AZC A;  1NTZ E;  2E75 D;  4P1B H;  1SQB E;  5AEU A;  4PD4 E;  1UUV A;  2CKF A;  4QDF B;  1NDO A;  2XSH A;  1O7M A;  3GZX A;  4QUQ A;  2DE7 D;  1KYO E;  3GTS A;  3VMI D;  2FYN C;  4NBE D;  2YFI A;  1EZV E;  3EQQ A;  1BCC E;  3H1J E;  1WQL A;  2FYU E;  2DE6 D;  4HKV A;  4AIV A;  2A06 E;  5KLI C;  4EMJ B;  3CWB E;  4D6T E;  4HM5 A;  4H0L D;  3VMG D;  1SQX E;  2JZA A;  3GL0 A;  3GZY A;  1ULI A;  3CXH E;  5CXM A;  1O7G A;  3BCC E;  2QJK C;  2DE5 D;  4QUP A;  2ZYL A;  1O7W A;  3TGU E;  1RFS A;  1SQV E;  2HMM A;  4NBA D;  2BMO A;  1NTM E;  2BMR A;  2E74 D;  2QJY C;  3CX5 E;  4HM2 A;  3EN1 A;  2IBZ E;  2NUK A;  2HMK A;  4HM4 A;  4NBD D;  3H1L E;  1P84 E;  4NBH D;  2NVE A;  3L74 E;  1G8J B;  3VCA A;  3C0D A;  1VF5 D;  2XRX A;  4QDC A;  5BOK A;  1O7P A;  1KB9 E;  2QJP C;  2BCC E;  1RIE A;  1VM9 A;  4U3F E;  1ZRT E;  2HMN A;  2D2C D;  5AEW A;  2HMO A;  4H13 D;  4HM3 A;  4P1C H;  3H1K E;  1SJG A;  2HMJ A;  2YVJ B;  2HML A;  3DQY A;  1SQP E;  3GL2 A;  3H1H E;  3GCE A;  2JO6 A;  1L0N E;  1BGY E;  1Q90 C;  3L70 E;  1O7N A;  4NBG D;  2NWF A;  1NYK A;  4HM0 A;  4NB8 D;  4QCK A;  3L73 E;  2QPZ A;  1O7H A;  2E4Q A;  4HM8 A;  2GBX A;  2I7F A;  2XSO A;  1PP9 E;  4NBC D;  2YFL A;  2E76 D;  4HM1 A;  4QUR A;  2NVF A;  2B1X A;  1PPJ E;  4HM7 A; 
#chains in the Genus database with same CATH topology
 1LTS C;  1RE3 A;  1ULJ A;  3Q1M A;  3IAO A;  2KOG A;  2KK7 A;  1VCK A;  3VMH D;  1RF0 A;  3L71 D;  4U3F G;  3PJS K;  2IDB A;  1UUW A;  2Q5U A;  2KLU A;  1SQP G;  1YHQ P;  1KN7 A;  2AEF A;  3GTE A;  3P8M C;  1S5L X;  5CJ0 A;  1S9K D;  3V6I A;  1W2E A;  2E76 B;  5GTH H;  4KHX A;  4B86 A;  1PPJ G;  2E75 D;  2XU6 A;  4GDO A;  1DEB A;  5E79 H;  4NBE D;  2A45 G;  4ZNC A;  1EZV D;  3BAT A;  1JCD A;  2KZJ A;  3RBX A;  1WQL A;  3I5C A;  2FFD C;  2ITA A;  1KIL A;  1GK6 A;  2ZT9 B;  1YJ9 P;  2G3A A;  3B4S A;  4H44 C;  3WU2 E;  3T97 A;  2ZYL A;  3H1L J;  3G6E P;  2R32 A;  2KB7 P;  1HJ0 A;  1HTL C;  4OH8 B;  3MTU E;  2FXP A;  1VQ9 P;  2IYP A;  4PV1 C;  1KB9 D;  2QSI A;  3P8C D;  2HFE D;  2QA4 P;  2HMN A;  2FYU G;  4GOD A;  4C7R A;  2Q3E A;  3HUS C;  3GL2 A;  3HRN A;  2JO6 A;  2QIW A;  1ZXG A;  3LW5 J;  1KIL B;  2QJP B;  2HPC A;  3IR9 A;  3L70 D;  1FDI A;  1SQX G;  1PL5 A;  3L73 D;  2XZR A;  1EQ7 A;  5AW7 B;  1BDC A;  1GZL A;  3T97 B;  1EDJ A;  3F5H A;  4R4M A;  2IZ0 A;  1M8O B;  2B1X A;  2ZVO B;  4DCK A;  1FU1 A;  1G8K B;  1EDL A;  3L74 G;  4L75 A;  1A02 F;  1OVV A;  3L37 A;  2E5Y A;  3MUD C;  5TIS E;  1YQ3 C;  4ASV A;  1VQP P;  1SQQ E;  1T8Z A;  1JY2 P;  2ZYD A;  2GUS A;  2H8P D;  1N73 A;  1R8E A;  2NVG A;  2A06 D;  1FZA A;  2HPC B;  2FFD A;  3WU2 H;  2XR8 A;  2YIU C;  3Q2Y A;  1ZOY C;  4JYC A;  1S1C X;  5AW9 B;  1FZF A;  1ZW0 A;  2OQQ A;  3E1R A;  1GU5 A;  3I55 P;  3NXS A;  1KFN A;  1LT9 C;  1NTK G;  1JNM A;  1N7S B;  2JEE A;  5AVV B;  3O8Z A;  3G71 P;  5CCH D;  1N73 B;  3GW6 A;  2P2U A;  3CC2 P;  1O7W A;  4XFJ A;  1CI6 A;  3M9B A;  4NBA D;  2CK3 H;  3M9Q A;  5KLV G;  3CCL P;  2BEZ F;  2R3S A;  3D70 A;  2XRX A;  4H0L C;  2XKM A;  1LWU A;  1ZRT E;  5TIS H;  2ZFC A;  5C39 A;  2HML A;  3CC7 P;  1AQ5 A;  1FDO A;  1BSH A;  1L0N E;  2Y0E A;  3MUD A;  5AW6 B;  1FOS E;  3NFQ A;  4RO0 A;  2XSO A;  2YXR B;  2KSJ A;  1CI6 B;  3W67 A;  1Y47 A;  2K88 A;  2JJL A;  1GDT A;  4NB9 D;  4OVN F;  2N1T D;  2Y9Y A;  1BDD A;  1PIX A;  4W7Y A;  2KIK A;  1S5L E;  1JMM A;  1LWU B;  2XND H;  2I1K A;  3GOB A;  3B71 A;  1SQB J;  1GD2 E;  1LT1 A;  3VCP A;  2LXB A;  1NTZ E;  2KXP B;  1QGK B;  4PD4 E;  2YIU B;  1KYO E;  2FYN C;  2QJK B;  1N7S D;  5APX A;  1LJ2 A;  3SWF A;  3ZDM A;  4D6T E;  4HM5 A;  1SQV J;  5APU A;  3RK2 C;  3Q3D A;  4XE5 B;  4AQR D;  4I6M C;  2BMR A;  5AVZ B;  3G9R A;  2FYZ A;  4I7Z C;  2JR8 A;  5BOK A;  2BCC E;  1Q82 Q;  3VMZ A;  3D6Z A;  1S5L H;  1SJG A;  1OMI A;  5AW1 B;  4ZKP A;  3CCV P;  4H0L B;  5APS A;  3PP5 A;  4HM0 A;  1NYK A;  3H6P A;  5CCG D;  3WUU A;  1SQQ K;  4PD4 I;  2KLV A;  3BCC G;  1FAV A;  3M9H A;  1YJN P;  4JBZ A;  5AW4 B;  3JCU E;  1RF1 C;  1FE6 A;  4WWI A;  3H1L G;  4PD4 H;  3H32 A;  5KAF E;  1QL2 A;  1KYO H;  1X22 A;  3HE5 A;  2MJZ A;  2B9B A;  2ZYG A;  4NBF D;  5AVX B;  1GL2 A;  1DD4 A;  4HKZ H;  1NU1 J;  4Y28 J;  4KT0 J;  5B66 E;  1IK7 A;  2G8Y A;  3ABV C;  1CZQ A;  1J1E B;  3IFM A;  3L36 A;  3TNU A;  2ZXX A;  3U1C A;  4RES B;  2YFI A;  3V5B A;  3CCU P;  2A06 E;  1EDK A;  5KLI C;  3GLM A;  1L0N J;  3TSI A;  3FXE A;  3CPW O;  2P7J A;  1YBK A;  3KHU A;  3AE3 C;  2FYN B;  4LLH A;  1GL2 B;  1JUN A;  3TGU E;  1L0N K;  1NTM E;  1LP1 A;  3BAS A;  2KUB A;  2SPZ A;  2NPS C;  3JCU H;  1NJI Q;  1FJK A;  5AW8 B;  2CPS A;  5KAF H;  1AV1 A;  4JYB A;  1LTA C;  1IFI A;  2P67 A;  1RF1 A;  1HWT C;  2HMJ A;  3CXH I;  4DOJ A;  1WRG A;  1O7H A;  3HTK A;  1K9M Q;  3V2P A;  1EXJ A;  2BAS A;  1PP9 E;  4A7P A;  1VQN P;  5CHX A;  4NBC D;  5B66 H;  4R4L A;  3CXH H;  1NTZ J;  1LP1 B;  1DIP A;  4OGQ D;  1PGP A;  3L71 J;  1CSB A;  2IX7 C;  1MV8 A;  4GOF A;  4NPF X;  2YKP A;  1NTZ K;  1OW8 A;  2YFJ A;  1RH5 B;  2B24 A;  3H1K G;  4D6T J;  1SQQ D;  1EG9 A;  1GK4 A;  4I2L C;  1L0L E;  4IFD K;  5APQ A;  3HTK B;  2E4P A;  3TYY A;  2YNY A;  3N4X A;  3K5B A;  2R3C A;  1KOR A;  2VRS A;  3RK3 E;  2V7Q H;  3S4R A;  2BCC J;  1BE3 G;  4TLF A;  3GTS A;  1MUU A;  1HGZ A;  1NYH A;  1ZR2 A;  1GL2 D;  3CME P;  3A3Y B;  1H0T A;  3PRJ A;  3MGN A;  3AE5 C;  1NAY A;  1QX8 A;  3L75 G;  5KAI E;  3WUT A;  1NWQ A;  2E75 B;  3SWY A;  3TK1 A;  2NVE A;  3CCM P;  1GU4 A;  1VF5 D;  1SQB G;  2O01 J;  1KQL A;  5CCH C;  1O7P A;  1J1D B;  1M7L A;  3L70 J;  1YTZ I;  1ZRT D;  3H1J G;  3L73 J;  1PGQ A;  3DQY A;  1JY3 P;  1L0N D;  1CW5 A;  1DX7 A;  2C0W A;  1H0T B;  3USS A;  3VOP A;  3G4S P;  1SQV G;  3V2R A;  2FBW C;  5DJT B;  4BRY A;  3L72 E;  5TJH A;  2FKW B;  2Q3W A;  1PV3 A;  1E5W A;  2O01 N;  1T3J A;  3H25 A;  1MFZ A;  3EFG A;  2NUM A;  2IYO A;  3IF4 A;  1USD A;  2N9Y B;  2N1T C;  3TGU J;  4EIJ A;  3FOU A;  2KYV A;  1NTM J;  2PGD A;  3B5N D;  5KAI H;  2LR2 A;  2AEM A;  1NTZ D;  3CCE P;  4BRY B;  1HBW A;  1NTM K;  1UUV A;  4PD4 D;  3RL0 g;  1KYO D;  4EI2 A;  2WPQ A;  1H88 A;  2PP6 A;  4AYC A;  1R5S A;  4L73 A;  2MKV A;  2GM4 A;  5CCH A;  3CWB E;  1VQ7 P;  4D6T D;  3VMG D;  1EDI A;  1JB0 J;  2DW3 A;  1IFD A;  4M3L A;  1JMB A;  2E74 D;  3EQ2 A;  3H1I G;  1T3U A;  1N7S C;  1NU1 G;  5APW A;  1N73 C;  3C0D A;  1MZ9 A;  3HD7 D;  3JSV C;  2BCC D;  1S2E A;  2HMO A;  3H1H E;  5APT A;  4CPG A;  1BGY E;  1L0L J;  1LTI C;  1URQ D;  1RY3 A;  1YYC A;  3AE8 C;  3Q5S A;  1JY2 N;  2P1J A;  2IBZ G;  2N1T A;  1L0L K;  4LC1 A;  1M90 Q;  2J58 A;  1RQV A;  2JWA A;  1N86 A;  5APY A;  1OWA A;  1YIJ P;  1T2K C;  4YPC A;  2B89 A;  1L4A D;  4C7N B;  2V4H A;  3AE4 C;  2RN0 A;  1LWU C;  3CXH D;  2IFN A;  5DJU B;  2N1T B;  1YQ4 C;  1HGV A;  1N7S A;  1BCC E;  2J59 M;  3L71 G;  5AVQ B;  3KDP B;  2AXT E;  2Y9Z A;  5AVU B;  3SSU A;  2GA1 A;  2H89 C;  5EFW B;  2QJK C;  1PFI A;  4D6T G;  3TGU D;  1NTM D;  3L72 J;  4GOE A;  3HE4 A;  4NBD D;  2Z5I A;  2WWW A;  1VPC A;  2YKO A;  4U3F E;  2JWD A;  1EZV G;  3MD0 A;  2P10 A;  3VN0 A;  1SQP E;  2D2C B;  4BXL A;  3CD6 P;  5CCG A;  1HF9 A;  1MFT A;  5GTI H;  1PP9 D;  2L91 A;  5AVW B;  3FWL A;  4QUR A;  5BU8 B;  3G3Z A;  1Q86 Q;  1VQL P;  1PPJ E;  3VP8 A;  3HE4 B;  2HOD A;  3AED C;  2K37 A;  3SFD C;  1YTZ T;  2Y0C A;  1FQT A;  2JDI H;  2WVR A;  3CWB J;  1N8R Q;  4IOI H;  1LTJ B;  3KXD A;  5KKZ C;  3ITK A;  2AXT H;  1Q2N A;  3N7N A;  3L70 G;  2RKL A;  5CBO A;  3CCR P;  3L73 G;  2FY8 A;  2XDJ A;  2YMK A;  1L0L D;  2LKM A;  1XTG B;  2E43 A;  3RK3 D;  1FZC C;  4P1B H;  2R5D A;  2HOD B;  3VMX A;  1NDO A;  1KQF B;  1G1I A;  3GZX A;  4GKG A;  1NAF A;  2FYU E;  4HKV A;  1VQ8 P;  1NO4 A;  3A2A A;  2H43 A;  1J1E C;  4LGD E;  1BGY J;  1IZN B;  1SQX E;  1Y8A A;  2QM7 A;  2A06 G;  3SFE C;  4O9B A;  4K3A A;  2WIT A;  2DE5 D;  2A45 I;  2Y0D A;  5AVS B;  3R2P A;  2W6J H;  3S1K A;  2WSE H;  2IPP A;  3L74 E;  1GL2 C;  1ZP0 C;  4QDC A;  2Q7C A;  2A45 H;  2D2C D;  4H13 D;  2IZ1 A;  2YVJ B;  1ZV8 A;  2Q3I A;  2QVA A;  3EWK A;  1VF5 C;  2UWJ E;  2IBZ I;  1LNQ A;  4EDF A;  2O3J A;  1SLQ A;  1K05 A;  2NVF A;  4HM7 A;  4I1L A;  3L72 D;  1WMK A;  1YI2 P;  3D89 A;  3C1L A;  1SQQ J;  1KQG B;  1K73 Q;  1BCC J;  2ZXE B;  1FZC A;  1TU3 F;  4H44 D;  1BSN A;  4YXD C;  3RL0 D;  1KMI Z;  1NTK E;  4N78 E;  1FOS F;  1LGH B;  1JO5 A;  2NZ2 A;  1JTH A;  1DD3 A;  1SFC B;  2HLO A;  5AVY B;  1OX3 A;  4PV1 D;  2K9J A;  1IC2 A;  5KKZ B;  1KD1 Q;  5KLV E;  1QEX A;  1U7J A;  4OGQ B;  5AEU A;  1UII A;  2CKF A;  1O7M A;  2W6B A;  4WY4 D;  2QE7 H;  1QL1 A;  3PHL A;  2OYI A;  1FZC B;  3LID A;  2OTK E;  1SQP J;  3CWB D;  2M5A B;  3CXH E;  1JTH B;  1SQP K;  4HB1 A;  1KC8 Q;  1W5C E;  3VTP C;  2YXQ B;  2ZYA A;  3EN1 A;  2K9J B;  3AEF C;  1WT6 A;  1FC2 C;  1PGO A;  4NPD A;  1FDM A;  1G8J B;  3S9O A;  1OVR A;  3A7O A;  2Z5H A;  3R4Y A;  1E79 H;  2OYI B;  4P1C H;  2E75 C;  1M1J A;  3KYQ A;  2E74 C;  2ZAE B;  4RKU J;  1YIT P;  3H1H D;  3A0H E;  2AXC A;  3MIW A;  1BGY D;  1J1D C;  1FZB A;  3HD7 C;  2WSF H;  3M0D C;  2KS1 A;  1VF5 B;  2OTJ P;  2QG4 A;  2WSC H;  2ZVN B;  4ZMD A;  5BVZ A;  5KJ7 D;  3M0A A;  3AE7 C;  3V4Q A;  1SFC D;  4JF7 A;  2WMM A;  1M1J B;  2RH0 A;  4HM6 A;  2FYU K;  1EXI A;  1AVO A;  3CC4 P;  4ASW A;  2NRG A;  3B5N A;  2R5B A;  2M0B A;  1SQX K;  5B5E E;  2OGU A;  1OZH A;  3CCJ P;  2C9N Y;  1OW7 A;  2WPR A;  3F89 A;  3L74 J;  4OWF A;  4UB6 E;  1L4A C;  2E42 A;  2KS1 B;  2KNC A;  2H88 C;  1BCC D;  2WSS H;  2ZJS E;  3A0H H;  2JZA A;  1KIL E;  1M56 D;  2N9B A;  3BCC E;  3B5N B;  3MP7 B;  1OXZ A;  2W83 C;  1QVG O;  1Z56 A;  1JY3 N;  4HM4 A;  4Y99 B;  3HD7 A;  3H1L E;  1P84 E;  3U59 A;  5AVT B;  1IFM A;  3TF5 A;  2KNC B;  2PRR A;  3M0D A;  4U3F D;  1NTK J;  2P58 A;  1IFJ A;  2B88 A;  3CCQ P;  1SQP D;  3FWN A;  1URQ A;  1NTK K;  2E74 B;  2WPV B;  4HM1 A;  5B5E H;  1PPJ D;  1S72 P;  2HYN A;  1R5L A;  4UB6 H;  1ZR4 A;  3HD7 B;  2JKV A;  2HG5 D;  4QDD A;  1XTC C;  5KLV K;  2E5T A;  2Q6Q A;  1D7M A;  4N6J A;  2Z4E A;  2I8D A;  4PJ0 H;  1L4A A;  4K35 A;  4XA4 A;  2IFM A;  1P84 I;  3CL3 D;  3L35 A;  1YJW P;  1URQ B;  2OTL P;  3D71 A;  1VQ5 P;  1MKM A;  2C0X A;  3AEE C;  4NBB D;  4NPE A;  1KZU B;  1P84 H;  2XSH A;  4QUQ A;  1IJD B;  1S3J A;  4GT1 A;  2FYU D;  2DE6 D;  1X79 B;  2QJY B;  4EMJ B;  5CMZ A;  1L4A B;  1SQQ G;  3CI9 A;  3RK3 C;  2WT7 A;  1SQX D;  5AW5 B;  2V7Q J;  3P7K A;  3LW5 H;  3D6Y A;  5AW0 B;  1Y9B A;  1Q90 D;  1H89 A;  3L74 D;  2KZI A;  3AE9 C;  3JC2 2;  3H1K E;  3LIE A;  1KV4 A;  1PP9 J;  4NB8 D;  2WT7 B;  4HM8 A;  2GBX A;  3AE1 C;  2I7F A;  1OFC X;  3GHG C;  2D2C C;  4H13 C;  4WBA A;  1N2D C;  4QDF A;  1QLE D;  1S4X A;  3OA7 A;  1BE3 E;  1FZE A;  2K1A A;  4C7N A;  1VQK P;  1LTT C;  1NTK D;  2XNX A;  4N78 D;  1VL2 A;  1L0N G;  3KPE A;  4AAY B;  2NPS D;  3BCC J;  3QWO C;  1N7L A;  3L75 E;  4BWN A;  2L5G B;  3BRT B;  1G1J A;  1LTJ C;  3Q5R A;  5KLV D;  3AZC A;  1AFO A;  3RL0 C;  1ZME C;  2WQY C;  1SQB E;  5CCG C;  4QDF B;  3VP9 A;  3AEA C;  1K04 A;  3H1J E;  5AW3 B;  2CPB A;  1NOH A;  3GF3 A;  1RHZ B;  5GTI E;  3AE2 C;  1Q81 Q;  1O7G A;  1SQV E;  4WY4 C;  3CCS P;  3WMM 0;  3CX5 E;  2QRX A;  1NVO A;  4HM2 A;  1NKN A;  2NUK A;  3RK3 B;  4NBH D;  1NTZ G;  3GHG A;  1GW3 A;  2KSE A;  2BEQ D;  2YMY A;  1FBM A;  1VM9 A;  4ZKU A;  1G2C A;  3IN6 A;  3P32 A;  4QCK A;  3AEG C;  1M1K Q;  2PAJ A;  1IFP A;  1IK9 A;  2E76 D;  3W68 A;  3KQG A;  3WUV A;  3M91 A;  1LTB C;  2GBW A;  1LTJ A;  3GHG B;  5HL4 A;  2BCC G;  2Q9I A;  2B87 A;  4H13 B;  4EOT A;  3CX5 I;  1G2C B;  2ZT9 D;  2WZ7 A;  3FGA D;  1IFN A;  1NHL A;  3VMA A;  5L8R J;  3H1I E;  1FJP A;  3EFF K;  4JPZ B;  5KJ7 C;  3CX5 H;  1NU1 E;  1KFM A;  3A5T A;  3HUS A;  2FFD B;  1SFC C;  1NKZ B;  1QVF O;  4WY4 A;  3PH0 A;  3BRV B;  1A02 J;  3MHV A;  4L74 A;  4H44 B;  3E7K A;  3H1K J;  4AIV A;  2B87 B;  3RL0 B;  4OGQ C;  1KTM A;  2KP8 A;  1OVU A;  1KIL D;  3V2N A;  1VQM P;  1LTG C;  3BCC D;  4PV1 B;  2HMM A;  5KTB A;  2IBZ E;  3GMA A;  1H8A A;  2HMK A;  3VYI A;  3H1L D;  1P84 D;  3HUS B;  1BE3 J;  2HR3 A;  4WY4 B;  4DZO A;  3H1H J;  4IL6 X;  1HUC A;  1JEK A;  3UIA A;  4DT0 A;  3GCE A;  1VQ6 P;  3M06 A;  2QPZ A;  1RQU A;  2I1J A;  3L75 J;  2OYI C;  3TGU G;  3CLQ A;  1NTM G;  2M3B A;  4L76 A;  2K9Y A;  4UB8 E;  1LT9 A;  3VMY A;  3MZW B;  1DEE G;  5KJ7 A;  3H1J J;  4RJT A;  1SFC A;  3L71 E;  1EC5 A;  1SQB K;  3GKE A;  1S9K E;  4C46 A;  1VQO P;  5CJ4 A;  1PP9 G;  2W90 A;  5BU5 A;  1M1J C;  3GB4 A;  3RGU A;  4W80 A;  1AJY A;  3FXD A;  3TDK A;  1SQV K;  4HYT B;  1LT9 B;  1UIX A;  3OAK A;  2DE7 D;  5K5G B;  2QEX P;  1JY3 O;  2M5A A;  1EZV E;  3OJA B;  1GW4 A;  1SVF A;  3CMA P;  4IFM A;  1JOC A;  1T6A A;  3GZY A;  3AEB C;  1JM0 A;  4HH2 A;  1USE A;  1L0L G;  3O6Q A;  2BMO A;  2JP3 A;  3SWK A;  1FS0 E;  1W2B O;  3AEC C;  1T2K D;  4UB8 H;  2J5U A;  4U3F J;  1KYO I;  1AA0 A;  3B5N C;  1KB9 E;  3P8C E;  1GTW A;  4QMA A;  5AEW A;  4Y99 C;  3H1K D;  2K3R A;  1Q7Y Q;  1J2J B;  1Q90 C;  3L70 E;  1O7N A;  4NBG D;  3L73 E;  4KJM A;  2E4Q A;  1IO4 A;  3H1I J;  2FXO A;  4YTP C;  2WSE J;  3PLN A;  1EZV I;  3O6Q B;  2W27 A;  1NH4 A;  2POH A;  1BE3 D;  3GG2 A;  1NU1 K;  2O1K A;  1SS1 A;  4W7Z A;  1X9V A;  2BMQ A;  1JM1 A;  1RE4 C;  3H32 B;  1ZLL A;  5AW2 B;  1PZQ A;  3HE5 B;  1JCC A;  3N0Q A;  3L75 D;  4MN4 C;  1KB9 I;  3V2Q A;  5H2F E;  1OIP A;  3L72 G;  2FYU J;  1SQB D;  1PGJ A;  1URQ C;  5AVR B;  3VMI D;  1KB9 H;  2QM8 A;  3C9I A;  1SQX J;  3RK2 B;  3H1J D;  3B8E B;  5CBN A;  1NGM B;  2O01 H;  3I56 P;  3TNU B;  4H0L D;  4TT3 H;  3GL0 A;  1VQ4 P;  1ULI A;  4I7Z B;  4AUW A;  5CXM A;  4YXW H;  2OYH C;  1RFS A;  2YKQ A;  1L2P A;  1SQV D;  2QJY C;  3CX5 D;  4WVZ A;  3Q5P A;  1K8A Q;  2Q1K A;  4IL6 E;  3KZI E;  3C8V A;  2XV5 A;  3VCA A;  1X8Y A;  3GF7 A;  2OAR A;  4PJ0 E;  1VDF A;  1RIE A;  4WB4 A;  3QH9 A;  4JQ0 D;  2W6A A;  3CWB G;  2PFX A;  3V4W A;  2NWF A;  1RF1 B;  1RE4 A;  4IFF A;  3PTZ A;  2W8Z A;  2M8R A;  1HJB A;  5H2F H;  1HH0 A;  1JY2 O;  2WTY A;  3A0B E;  3II6 A;  1KQS O;  4GIF A;  4EYY Q;  2E76 C;  4HJL A;  2LXC B;  3RBZ A;  2NPS A;  3H1H G;  1BGY G;  1SP4 A;  2KI7 B;  5KLV J;  3L4F A;  2WSF J;  3H1I D;  1RE3 C;  1OW6 A;  5APV A;  1AVY A;  2WSC J;  2YO3 A;  3BVH A;  1NU1 D;  2YO2 A;  4HJG H;  5KLI B;  2C9L Y;  4IL6 H;  2OYH A;  3KZI H;  1RF0 C;  1HVV A;  3RK2 D;  2ZT9 C;  3E1I A;  3NTN A;  2R44 A;  3EQQ A;  2FXM A;  3NMD A;  2OYO A;  1ZN5 A;  1DH3 A;  1GMJ A;  1AQT A;  2NPS B;  2GUV A;  4QUP A;  1FZG A;  4U7J A;  5GTH E;  4N3Y B;  2RMZ A;  1M57 D;  2IBZ D;  2H7H A;  5E79 E;  3A0B H;  2OYH B;  1KIL C;  2QJP C;  4Z1M H;  3U1A A;  4DJG A;  4HM3 A;  1BCC G;  2WPS A;  3FX0 A;  5M1B A;  2AEJ A;  2O1J A;  1U57 A;  1U7M A;  3OW2 O;  2JO1 A;  2YFL A;  2M3E A;  3AE6 C;  1X0T A; 
#chains in the Genus database with same CATH homology
 3L72 E;  2Q3W A;  4QDF A;  4OGQ D;  4NB9 D;  3D89 A;  1G8K B;  1BE3 E;  1ULJ A;  4QDD A;  2GBW A;  5HL4 A;  1VCK A;  4H44 D;  3VMH D;  2YFJ A;  1FQT A;  3L71 E;  2B24 A;  2BMQ A;  1JM1 A;  4NBF D;  1SQQ E;  1NTK E;  4HJL A;  1EG9 A;  3GKE A;  2NUM A;  5KKZ C;  1UUW A;  2NVG A;  4HM6 A;  4AAY B;  2ZT9 D;  3GTE A;  3GOB A;  2XR8 A;  3FOU A;  1L0L E;  3L75 E;  3N0Q A;  3H1I E;  2YIU C;  2E4P A;  4PV1 D;  4NBB D;  5KLV E;  1NU1 E;  3VCP A;  3GB4 A;  3AZC A;  1NTZ E;  2E75 D;  4P1B H;  1SQB E;  5AEU A;  4PD4 E;  1UUV A;  2CKF A;  4QDF B;  1NDO A;  2XSH A;  1O7M A;  3GZX A;  4QUQ A;  2DE7 D;  1KYO E;  3GTS A;  3VMI D;  2FYN C;  4NBE D;  2YFI A;  1EZV E;  3EQQ A;  1BCC E;  3H1J E;  1WQL A;  2FYU E;  2DE6 D;  4HKV A;  4AIV A;  2A06 E;  5KLI C;  4EMJ B;  3CWB E;  4D6T E;  4HM5 A;  4H0L D;  3VMG D;  1SQX E;  2JZA A;  3GL0 A;  3GZY A;  1ULI A;  3CXH E;  5CXM A;  1O7G A;  3BCC E;  2QJK C;  2DE5 D;  4QUP A;  2ZYL A;  1O7W A;  3TGU E;  1RFS A;  1SQV E;  2HMM A;  4NBA D;  2BMO A;  1NTM E;  2BMR A;  2E74 D;  2QJY C;  3CX5 E;  4HM2 A;  3EN1 A;  2IBZ E;  2NUK A;  2HMK A;  4HM4 A;  4NBD D;  3H1L E;  1P84 E;  4NBH D;  2NVE A;  3L74 E;  1G8J B;  3VCA A;  3C0D A;  1VF5 D;  2XRX A;  4QDC A;  5BOK A;  1O7P A;  1KB9 E;  2QJP C;  2BCC E;  1RIE A;  1VM9 A;  4U3F E;  1ZRT E;  2HMN A;  2D2C D;  5AEW A;  2HMO A;  4H13 D;  4HM3 A;  4P1C H;  3H1K E;  1SJG A;  2HMJ A;  2YVJ B;  2HML A;  3DQY A;  1SQP E;  3GL2 A;  3H1H E;  3GCE A;  2JO6 A;  1L0N E;  1BGY E;  1Q90 C;  3L70 E;  1O7N A;  4NBG D;  2NWF A;  1NYK A;  4HM0 A;  4NB8 D;  4QCK A;  3L73 E;  2QPZ A;  1O7H A;  2E4Q A;  4HM8 A;  2GBX A;  2I7F A;  2XSO A;  1PP9 E;  4NBC D;  2YFL A;  2E76 D;  4HM1 A;  4QUR A;  2NVF A;  2B1X A;  1PPJ E;  4HM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...