1SQBE

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqbE02
4HM1A 1NYKA 3GZXA 4H44D 4NB8D 4QUPA 5BOKA 1P84E 5KLVE 4NBED 1ZRTE 2B24A 4HJLA 1VF5D 3L75E 4PD4E 3VCPA 4NBGD 4NBAD 5KKZC 2FYNC 2ZYLA 4NB9D 3H1IE 1KYOE 1NDOA 3BCCE 4NBDD 3GL2A 3GB4A 3GTEA 1RFSA 4NBBD 1Q90C 2YFLA 2QPZA 2BMRA 3VCAA 3GL0A 1PPJE 3GTSA 4HM8A 1ULIA 1SQPE 1O7PA 2Q3WA 2NVFA 5KLIC 2ZT9D 3GKEA 2NUMA 4QCKA 1PP9E 1O7WA 3CXHE 1UUVA 2NVGA 3L73E 3CX5E 2DE5D 4HM0A 2D2CD 2HMMA 3H1LE 4HM6A 2HMNA 4QUQA 1O7HA 4HM3A 4NBCD 4AAYB 2NUKA 4HM2A 2XSHA 2E75D 2NVEA 4H0LD 3CWBE 1JM1A 4P1BH 3VMGD 3L70E 1NTZE 2YVJB 4NBHD 3TGUE 1ULJA 2DE6D 2HMLA 1WQLA 4H13D 2E74D 1NU1E 3AZCA 3VMID 4QURA 2DE7D 1KB9E 2QJKC 1O7MA 3DQYA 4U3FE 2XR8A 5AEUA 2GBXA 4HM5A 2I7FA 2XSOA 1SQBE 3GOBA 2QJYC 1SQXE 3EQQA 2B1XA 4EMJB 4P1CH 2YFJA 2XRXA 3L71E 3L72E 1O7GA 3H1HE 1O7NA 4AIVA 1L0NE 3GCEA 1NTME 1VM9A 4NBFD 1FQTA 4QDFA 3GZYA 1G8JB 4HKVA 4HM7A 5HL4A 2YIUC 4D6TE 1BE3E 1RIEA 1EG9A 2FYUE 2YFIA 2GBWA 1L0LE 2E4PA 2HMOA 3H1KE 2HMJA 4QDCA 3L74E 2JZAA 4OGQD 3N0QA 2E4QA 1BGYE 4QDFB 2NWFA 3H1JE 1EZVE 2BCCE 2QJPC 2BMOA 1SJGA 5CXMA 2CKFA 2JO6A 1SQQE 3C0DA 4HM4A 3D89A 3FOUA 3VMHD 2IBZE 2E76D 2BMQA 4PV1D 1UUWA 2A06E 1BCCE 1SQVE 1VCKA 2HMKA 3EN1A 1NTKE 1G8KB 5AEWA 4QDDA
chains in the Genus database with same CATH superfamily
3IR9A 3GZXA 4NBED 1P84I 4HJLA 2A45I 2W6JH 3HTKA 1S5LH 4ZKPA 4XE5B 3H32A 2H8PD 2QSIA 1IK7A 2OYOA 3CCSP 2E42A 3BVHA 2KNCB 2KB7P 4WBAA 1T3UA 2KS1B 3L73E 3L37A 2A45G 3H1LE 3A2AA 3L75G 1CW5A 5E79E 3II6A 1N7SD 1SQPG 1RF0C 1FZCA 2WSCJ 1GL2D 1Z56A 1NTZE 2YVJB 1KYOH 1EXJA 5DJTB 1H0TB 1YQ3C 3EFGA 2OYHC 3KZIH 2I7FA 1HVVA 4H0LC 3L70D 4OGQB 3T97B 1RF1C 1O7NA 2KLVA 1NTME 1Y8AA 2NPSC 3R4YA 1YYCA 4HB1A 2V7QJ 5KJ7C 5B5EH 2JZAA 2N1TD 1H88A 1T2KD 2HYNA 3TF5A 1SFCD 1LTJA 5CXMA 1JY3N 3L35A 4A7PA 1W5CE 2XDJA 4PV1D 3B5NB 2RH0A 1G1JA 5GTHH 5AVTB 3CCUP 1SQXJ 3TGUG 2JR8A 1X8YA 5CMZA 2AEFA 3H1KG 2MKVA 1JMMA 3GTEA 2QA4P 5AVUB 4UB6H 3V2RA 1LWUC 1L2PA 3CXHD 3KYQA 2PAJA 1SQVG 3HTKB 1PZQA 4LGDE 1KQGB 3GKEA 4U3FJ 3CL3D 1SQQK 2HPCA 3H32B 3TDKA 4N78E 1KILA 3L72J 1ZR4A 1PPJD 4ASWA 5CCHA 3HD7D 2ZVNB 1VQ9P 1DD3A 4ASVA 3CCVP 1Q86Q 2W8ZA 1JM1A 2KLUA 1QVGO 3HUSA 5E79H 3TK1A 1PP9G 4Z1MH 2D2CC 1HUCA 1URQA 1FZCB 2B9BA 2UWJE 1FJPA 2Q7CA 1SQVK 1KB9I 1RH5B 1CI6A 2K9JA 3GOBA 2WMMA 1ZP0C 1AQ5A 1JCDA 1JMBA 1O7GA 2O01H 1WMKA 2K1AA 1M1JA 1W2EA 1FQTA 2M5AA 1S1CX 2JO1A 5AW7B 2E74C 2YNYA 1DD4A 2HMJA 3CCMP 1NU1G 2K3RA 1FAVA 4HM4A 2KZIA 1RE4C 2QIWA 3L74D 3K5BA 2B88A 2J5UA 2AEJA 5APYA 1EXIA 1RE3C 1A02J 3QWOC 3F89A 3PHLA 1BGYG 4XA4A 3AE9C 1N7SA 3AECC 1BCCG 5K5GB 1P84D 5B66H 2J58A 4EYYQ 1NTKG 4QCKA 3FGAD 2P1JA 2RKLA 1LT9C 1T6AA 1O7HA 2AXTE 3H1IG 3U1CA 1SQPD 5KLVK 1YITP 2IZ0A 1MFZA 1JO5A 1KILB 2W90A 3L75J 1HH0A 1JOCA 3L70E 1LTBC 1OWAA 2POHA 4AQRD 1SQPJ 2N1TA 3W67A 1NTKK 2RMZA 5AEUA 1SFCA 1N73B 1SQXE 1H8AA 1URQB 3C8VA 2XRXA 1S2EA 4AIVA 1CI6B 2FYNB 4ZNCA 2Z4EA 5CHXA 1SQQD 1NGMB 2ZT9B 1IK9A 1M1JB 4I6MC 2M5AB 3N7NA 3RK3C 3MIWA 4EOTA 3FXDA 4WY4B 2XNDH 1N86A 3SSUA 2P67A 2IBZE 5TISH 1K04A 3GHGA 3GG2A 3Q5RA 2O1KA 4NB9D 1VPCA 3HD7A 3GL2A 4ZMDA 1SQVD 2OGUA 3CPWO 2FYUK 1PPJE 3TGUJ 3H1KJ 1XTCC 2ZXEB 1KD1Q 1VQ7P 1K05A 1PV3A 2WSCH 3CCJP 3OW2O 5TJHA 2V4HA 4HM0A 3CX5I 1N7SB 2MJZA 3FX0A 1NHLA 3B5ND 1FZGA 2Z5HA 4HM2A 2W83C 2E75D 2KK7A 1AVYA 4JBZA 2H7HA 2BCCJ 1RQUA 1WQLA 3IAOA 2YO2A 5CCGC 1FOSF 3AZCA 2V7QH 2P2UA 1PGJA 5AW1B 1PP9J 3M06A 3AE4C 1IZNB 3RK3E 3MP7B 1NU1D 1SFCB 1EG9A 4PV1B 1LT1A 1FZEA 4JPZB 1NKNA 3SFDC 3L74E 1QGKB 2QM8A 2NWFA 1IFIA 2H89C 3FOUA 1CSBA 5AVXB 1R5SA 1VQ5P 3VP9A 4QDDA 1BGYD 1BDCA 3BCCD 3L70G 1P84E 2JDIH 2JKVA 1QEXA 2KUBA 4OGQC 4LC1A 3L75E 3GHGB 3U59A 4JF7A 2KXPB 1NDOA 3GB4A 1BCCD 1HGZA 3LIDA 1NTZJ 1NTKD 2WSFH 2VRSA 1SQPE 1IFMA 3CCRP 1BGYJ 3RL0D 1BSHA 3M9HA 2KYVA 4KT0J 1ZLLA 1U57A 1NVOA 4UB8H 3GF3A 3JC22 1GMJA 2KS1A 1HWTC 1L0LK 4P1BH 2PFXA 4PD4H 3H1IJ 3AE5C 2M8RA 4NPDA 1K73Q 3IN6A 1ULJA 1OFCX 1QVFO 2ZFCA 1NKZB 4IFDK 3PRJA 4IL6X 3F5HA 3B8EB 1PPJG 1RHZB 2OYIB 3KXDA 5KAFH 1H0TA 3ITKA 5L8RJ 4H13C 3HE5B 1M8OB 3H1KE 1JB0J 5CCHD 1CZQA 2LR2A 3H1HD 3G3ZA 2CKFA 1SQBG 1Q90D 3O8ZA 1FZCC 1SQVE 2HMKA 3WMM0 4JQ0D 5GTIE 4CPGA 2B87A 3EWKA 2FFDA 4JYCA 2AEMA 1VF5D 5KKZC 3OJAB 3A3YB 3MD0A 1RFSA 1LTAC 1NAFA 4AYCA 2R32A 2K37A 2WPRA 3O6QA 3AEAC 2A45H 2Q3WA 1E5WA 1MKMA 2ZT9D 3D6YA 1PP9E 1SQBK 4WY4D 2HMNA 1DX7A 3L74G 1LTJC 3CWBD 1DIPA 1WT6A 1AVOA 4U7JA 4W7ZA 3OA7A 4M3LA 1PGQA 4YPCA 3A7OA 1R8EA 3CX5D 2K88A 5APTA 3HE4A 1QLED 1DEBA 1NO4A 1NU1E 1AV1A 2CPBA 1KB9E 2WITA 1SVFA 2XKMA 1M1KQ 1KTMA 4OVNF 2OTKE 4BRYA 3H1JD 2ZYAA 4R4MA 1KILC 3PH0A 3GW6A 3Q5PA 4IL6E 1BGYE 3HRNA 1KQFB 3G6EP 3E1IA 5AVWB 1AA0A 1BCCE 3HUSC 3GF7A 3M0DA 1L0LD 1NTKE 4HM1A 5APWA 3AE8C 4QUPA 2KSJA 1URQC 2H88C 3I5CA 3VCPA 4NBAD 2FYNC 3H1IE 1KYOI 1X0TA 2B87B 5CJ0A 2WSEJ 1IFDA 2WT7A 2FFDB 3L70J 1SQQG 1KQSO 2IFNA 5BVZA 3Q5SA 1M1JC 1YJNP 4RO0A 2Y0CA 1AJYA 2Z5IA 1FC2C 3LIEA 1LNQA 1H89A 1J1DC 3AE1C 1JUNA 2QJYB 2E75B 3O6QB 1EQ7A 2ITAA 3NTNA 4WVZA 4EIJA 2GA1A 1D7MA 5AW6B 2Q3EA 2GM4A 2PGDA 4C46A 2W27A 2W6BA 4LLHA 5AVRB 5APXA 1YTZI 2WQYC 3RK2D 2E76B 2DE6D 2JP3A 1RY3A 1KV4A 2WTYA 3D71A 2QEXP 3QH9A 2O1JA 3G9RA 1UIIA 5KLIB 4KJMA 3HE4B 1VQNP 4H44B 4C7RA 3CMEP 2XZRA 1KILE 1N7SC 2WSFJ 3N4XA 3H1HE 1NAYA 1GL2C 2YMYA 1KB9H 4N6JA 1KMIZ 2P58A 1N73A 2YFIA 1SQBD 1JNMA 1X22A 1ZR2A 4BRYB 2I1JA 3SFEC 4W80A 1Q2NA 1SP4A 5CBNA 3L71G 1VCKA 4Y99B 5APUA 5BOKA 2Q1KA 2JEEA 2LKMA 2WPSA 4WY4A 3S4RA 2N1TC 1T2KC 3P32A 3RL0B 2G8YA 1SFCC 1AQTA 3L36A 2BEZF 3AE7C 4PV1C 2BMRA 3VCAA 4HM8A 5AVZB 2WT7B 2NUMA 1KFNA 1YTZT 2IFMA 5AW5B 3FXEA 1UUVA 5APSA 3CX5E 5KLVG 5C39A 4HM6A 1T8ZA 1VQOP 2Y9ZA 4AAYB 3BCCG 3MHVA 1RQVA 2Y0DA 3GMAA 3L74J 3I56P 2ZAEB 3CC7P 3P8CD 3H6PA 3HD7C 2ZJSE 2YXQB 2XR8A 4HM5A 3CMAP 4L74A 2I8DA 1YBKA 1GU4A 2B1XA 1LGHB 3E7KA 4C7NA 1FDIA 4DOJA 2YO3A 1G1IA 1EZVD 2C9NY 3D70A 1L0LE 2HMOA 4WWIA 2BMOA 2KSEA 4HH2A 1VL2A 4GKGA 2KI7B 1VF5B 1JEKA 1OMIA 2R3SA 1L0NG 1L4AD 2OYHB 1G8KB 5AEWA 3CLQA 4H0LB 4D6TG 1BE3G 2AXCA 2FYUG 3GLMA 3P8MC 1RF1B 1U7JA 1MV8A 2ZYLA 1NTMK 3USSA 4NBDD 4PJ0E 1IO4A 3H1HG 3ABVC 1JY2N 3MZWB 2IDBA 1KYOD 3CXHE 4I1LA 1SQQJ 2YXRB 1N2DC 2HMMA 4HKZH 1OVRA 1RE3A 1L0NK 2JWAA 2ZYGA 3C1LA 1HBWA 2BASA 5AW2B 1M90Q 1A02F 2HLOA 2CK3H 3PTZA 1X79B 2M3EA 1LWUB 2DE7D 1N7LA 1YHQP 2QJKC 1O7MA 1SQVJ 3NMDA 3MGNA 2GBXA 4BXLA 1SQBE 3PJSK 3UIAA 2L5GB 3AEBC 3CWBG 4OWFA 2AXTH 1K8AQ 4C7NB 1FS0E 1TU3F 2OYIA 3L71D 2WSEH 2R3CA 3C0DA 2E76D 3KQGA 3B4SA 1UUWA 3HE5A 2YMKA 3EN1A 2FYZA 2XU6A 4MN4C 2FBWC 2N9BA 1OW8A 4NB8D 4H44D 1GK4A 3V5BA 2NZ2A 1JTHB 3H1JG 5AVQB 3WU2E 2E74B 1JY3O 3GL0A 1NH4A 3GTSA 2E43A 3ZDMA 3Q3DA 1UIXA 3L73D 1NU1J 5KLVD 2NVFA 2IX7C 2B89A 3MUDA 1O7WA 5AW9B 1FDMA 4TLFA 3VP8A 3A0BE 3KDPB 2R44A 1L0LG 1VQ4P 2SPZA 3P8CE 4OH8B 3RK2B 1OIPA 3WUVA 3CXHH 3A5TA 3BCCJ 2QJPB 1JY3P 4QMAA 3VOPA 1SLQA 4QURA 2WPVB 2OQQA 3B5NC 1GK6A 4NPFX 1BCCJ 3CI9A 1NTKJ 1NTMD 3BRTB 2QJYC 2E75C 3EQQA 4EMJB 1IFPA 1G2CB 1PGOA 4DZOA 3V2QA 4QDFA 1L4AA 2HFED 1PL5A 2Q9IA 2LXBA 4HM7A 5HL4A 2YKQA 2E4PA 2K9YA 1OVUA 3AE2C 3SWKA 3VMXA 2KOGA 1GD2E 3D6ZA 3Q1MA 5BU5A 1L0ND 1SQQE 2HG5D 4I2LC 3G71P 3VYIA 4D6TD 1BE3D 1E79H 2FYUD 2M0BA 2KP8A 1SQXK 5AVSB 3E1RA 4K3AA 2DW3A 1HTLC 4PD4I 1KYOE 3LW5J 3M0AA 2YKPA 1OZHA 1MFTA 2XV5A 3B71A 3W68A 3KZIE 1KQLA 2WVRA 1EC5A 3IFMA 2DE5D 2IPPA 2Q3IA 5APQA 3H1HJ 5EFWB 4I7ZB 1R5LA 1VQ8P 2P7JA 2YIUB 4H0LD 3M0DC 5CBOA 1P84H 3A0BH 3RL0C 3RGUA 2JJLA 3M91A 2G3AA 2NPSD 1HF9A 5KJ7D 1S4XA 4Y28J 4HYTB 3R2PA 4WB4A 4P1CH 3L71E 4UB6E 4HKVA 1OVVA 4QDCA 3CWBJ 4QDFB 1L4AB 1OX3A 1EZVI 1N8RQ 3VMAA 1ZV8A 4DJGA 1LTTC 1KFMA 5KLVE 1YJWP 1J2JB 3AEFC 3BRVB 5CCHC 3BCCE 4N3YB 4DT0A 1EZVG 1Q90C 3V2NA 2JWDA 2A06G 3AE3C 2C0XA 3H1JJ 1OW6A 1JY2O 1N73C 1VF5C 3V6IA 1FBMA 2D2CD 1USDA 3RBXA 3AE6C 2QE7H 1U7MA 3CCLP 5GTIH 4EI2A 2NVEA 1IC2A 4L73A 1L0LJ 2ZT9C 1S72P 3U1AA 3BASA 4WY4C 2HODB 4R4LA 3CC2P 1M7LA 1SQPK 2E74D 1SQXD 1M56D 2J59M 1JY2P 1Q81Q 2C0WA 2QG4A 1L0NE 1VM9A 3RBZA 2N9YB 2WWWA 1G8JB 2WPQA 1VDFA 3AEDC 3TSIA 4D6TE 1BE3E 2FY8A 3PP5A 4U3FD 1VQKP 2O01N 2FYUE 2GBWA 5B66E 1S3JA 3CCQP 2IBZD 2E4QA 2FXOA 2FXPA 3L72D 3NXSA 1YIJP 2QVAA 3MTUE 1IJDB 2Y9YA 2ZVOB 1EDLA 3VTPC 4YTPC 1RF0A 1LJ2A 1Q82Q 1GW3A 2GUVA 1ZN5A 3CC4P 2BCCG 2OYHA 4H13B 2PRRA 3VN0A 2Q6QA 1S9KD 1ZRTD 1RF1A 4IL6H 4PD4D 1QL1A 1MUUA 2NPSA 1SQBJ 4EDFA 3TYYA 4YXDC 5KJ7A 4NBCD 4BWNA 4AUWA 2NUKA 4ZKUA 2XNXA 1Q7YQ 4XFJA 1J1EB 5KKZB 3CWBE 1LP1A 2Y0EA 2WSSH 3VMGD 4L75A 2Q5UA 4RJTA 3V4WA 5TISE 1T3JA 3L73G 1FJKA 1IFNA 3H1LG 5AVVB 3C9IA 3RK3D 2KIKA 3GHGC 1ZXGA 3AEEC 1W2BO 1LWUA 1LTJB 3RK2C 1ZOYC 3GZYA 1NTZG 1LTGC 2LXCB 1X9VA 3H1JE 2QJPC 3LW5H 1SJGA 3KPEA 1NU1K 2IYPA 4L76A 1GL2A 3L75D 1NTMG 3JCUE 1EDIA 3BATA 3WUUA 3TNUA 1NYKA 2QM7A 2RN0A 2KZJA 1HJ0A 2A06D 2HPCB 3S1KA 1NTZK 2YFLA 3AEGC 1ULIA 2E5YA 5KAIE 2OARA 5H2FE 1O7PA 2BEQD 2L91A 1JTHA 2NVGA 1GDTA 4IFFA 1HJBA 2P10A 1SS1A 1VQ6P 2OYIC 3HUSB 5AW0B 5CCGD 2WZ7A 5CJ4A 2YKOA 1FZAA 2NPSB 3V4QA 1FDOA 1RE4A 2K9JB 2CPSA 2IYOA 4GT1A 1DEEG 1LP1B 2W6AA 3SWYA 1EDKA 3A0HE 4U3FE 1EDJA 4NPEA 1J1DB 3H25A 5DJUB 5APVA 1VQPP 3L72E 3TGUD 3CX5H 3L4FA 3MUDC 3H1KD 3P7KA 5M1BA 4NBFD 1YQ4C 4I7ZC 1OXZA 2YIUC 1FE6A 1LTIC 1S5LX 3WUTA 4OGQD 1G2CA 3EFFK 1LT9A 3CD6P 4GOEA 3VMZA 1MZ9A 5AW4B 4UB8E 1QL2A 4GODA 2HR3A 2PP6A 3FWLA 1S9KE 1LTSC 1ZRTE 2BCCD 4PD4E 1OW7A 1GL2B 3TNUB 2O3JA 4NBBD 3JCUH 2QPZA 2D2CB 1PP9D 2ZXXA 1JCCA 1L4AC 3PLNA 1Y9BA 2FXMA 2I1KA 1GZLA 4GDOA 3JSVC 1IFJA 2E5TA 5KAFE 1FU1A 1WRGA 3L71J 4HM3A 5KAIH 1Y47A 5H2FH 1BSNA 1FZFA 3EQ2A 1AFOA 2N1TB 3H1LD 1KB9D 3OAKA 4H13D 2NRGA 4PJ0H 1GW4A 3VMID 2R5DA 5BU8B 1PIXA 1GTWA 2XSOA 4B86A 3L73J 1QX8A 5KLVJ 1NTZD 1ZW0A 3H1LJ 1PFIA 3GCEA 3KHUA 5AW3B 3VMYA 2GUSA 3A0HH 2FFDC 1FOSE 1RIEA 3G4SP 3V2PA 3N0QA 1JM0A 1EZVE 3M9QA 4YXWH 1NOHA 3VMHD 1SQXG 2C9LY 2IBZI 2BMQA 2A06E 2O01J 1LT9B 3HD7B 3NFQA 4W7YA 1S5LE 3SWFA 3H1ID 4KHXA 3CXHI 2B24A 4IOIH 2OTLP 4NBGD 5CCGA 3I55P 1NTMJ 3FWNA 2KNCA 3S9OA 4U3FG 2E76C 4K35A 5AW8B 1GU5A 4GOFA 2IBZG 1ZMEC 3L72G 5KLIC 4H44C 1KZUB 4O9BA 1PGPA 2M3BA 4QUQA 1YI2P 4TT3H 1NYHA 1L0NJ 4JYBA 2H43A 4RESB 4HJGH 3RL0g 1VQLP 2XSHA 1DH3A 3IF4A 4D6TJ 1BE3J 3Q2YA 2R5BA 2FYUJ 2OTJP 3RK3B 1KORA 1XTGB 4NBHD 4N78D 3TGUE 4GIFA 1BDDA 1NWQA 2HMLA 3WU2H 1HGVA 4RKUJ 1KILD 3T97A 4Y99C 3DQYA 1NJIQ 2IZ1A 2QRXA 5B5EE 2YFJA 2HODA 1M57D 1KN7A 1K9MQ 1J1EC 1URQD 5AVYB 1KC8Q 1VQMP 3B5NA 1YJ9P 3M9BA 3CCEP 2BCCE 5GTHE 2JO6A 4IFMA 3D89A 1USEA 2FKWB 2ZYDA 4DCKA 1FZBA 2QJKB 5KTBA
chains in the Genus database with same CATH topology
4HM1A 1NYKA 3GZXA 4H44D 4NB8D 4QUPA 5BOKA 1P84E 5KLVE 4NBED 1ZRTE 2B24A 4HJLA 1VF5D 3L75E 4PD4E 3VCPA 4NBGD 4NBAD 5KKZC 2FYNC 2ZYLA 4NB9D 3H1IE 1KYOE 1NDOA 3BCCE 4NBDD 3GL2A 3GB4A 3GTEA 1RFSA 4NBBD 1Q90C 2YFLA 2QPZA 2BMRA 3VCAA 3GL0A 1PPJE 3GTSA 4HM8A 1ULIA 1SQPE 1O7PA 2Q3WA 2NVFA 5KLIC 2ZT9D 3GKEA 2NUMA 4QCKA 1PP9E 1O7WA 3CXHE 1UUVA 2NVGA 3L73E 3CX5E 2DE5D 4HM0A 2D2CD 2HMMA 3H1LE 4HM6A 2HMNA 4QUQA 1O7HA 4HM3A 4NBCD 4AAYB 2NUKA 4HM2A 2XSHA 2E75D 2NVEA 4H0LD 3CWBE 1JM1A 4P1BH 3VMGD 3L70E 1NTZE 2YVJB 4NBHD 3TGUE 1ULJA 2DE6D 2HMLA 1WQLA 4H13D 2E74D 1NU1E 3AZCA 3VMID 4QURA 2DE7D 1KB9E 2QJKC 1O7MA 3DQYA 4U3FE 2XR8A 5AEUA 2GBXA 4HM5A 2I7FA 2XSOA 1SQBE 3GOBA 2QJYC 1SQXE 3EQQA 2B1XA 4EMJB 4P1CH 2YFJA 2XRXA 3L71E 3L72E 1O7GA 3H1HE 1O7NA 4AIVA 1L0NE 3GCEA 1NTME 1VM9A 4NBFD 1FQTA 4QDFA 3GZYA 1G8JB 4HKVA 4HM7A 5HL4A 2YIUC 4D6TE 1BE3E 1RIEA 1EG9A 2FYUE 2YFIA 2GBWA 1L0LE 2E4PA 2HMOA 3H1KE 2HMJA 4QDCA 3L74E 2JZAA 4OGQD 3N0QA 2E4QA 1BGYE 4QDFB 2NWFA 3H1JE 1EZVE 2BCCE 2QJPC 2BMOA 1SJGA 5CXMA 2CKFA 2JO6A 1SQQE 3C0DA 4HM4A 3D89A 3FOUA 3VMHD 2IBZE 2E76D 2BMQA 4PV1D 1UUWA 2A06E 1BCCE 1SQVE 1VCKA 2HMKA 3EN1A 1NTKE 1G8KB 5AEWA 4QDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM1 A;  1NYK A;  3GZX A;  4H44 D;  4NB8 D;  4QUP A;  5BOK A;  1P84 E;  5KLV E;  4NBE D;  1ZRT E;  2B24 A;  4HJL A;  1VF5 D;  3L75 E;  4PD4 E;  3VCP A;  4NBG D;  4NBA D;  5KKZ C;  2FYN C;  2ZYL A;  4NB9 D;  3H1I E;  1KYO E;  1NDO A;  3BCC E;  4NBD D;  3GL2 A;  3GB4 A;  3GTE A;  1RFS A;  4NBB D;  1Q90 C;  2YFL A;  2QPZ A;  2BMR A;  3VCA A;  3GL0 A;  1PPJ E;  3GTS A;  4HM8 A;  1ULI A;  1SQP E;  1O7P A;  2Q3W A;  2NVF A;  5KLI C;  2ZT9 D;  3GKE A;  2NUM A;  4QCK A;  1PP9 E;  1O7W A;  3CXH E;  1UUV A;  2NVG A;  3L73 E;  3CX5 E;  2DE5 D;  4HM0 A;  2D2C D;  2HMM A;  3H1L E;  4HM6 A;  2HMN A;  4QUQ A;  1O7H A;  4HM3 A;  4NBC D;  4AAY B;  2NUK A;  4HM2 A;  2XSH A;  2E75 D;  2NVE A;  4H0L D;  3CWB E;  1JM1 A;  4P1B H;  3VMG D;  3L70 E;  1NTZ E;  2YVJ B;  4NBH D;  3TGU E;  1ULJ A;  2DE6 D;  2HML A;  1WQL A;  4H13 D;  2E74 D;  1NU1 E;  3AZC A;  3VMI D;  4QUR A;  2DE7 D;  1KB9 E;  2QJK C;  1O7M A;  3DQY A;  4U3F E;  2XR8 A;  5AEU A;  2GBX A;  4HM5 A;  2I7F A;  2XSO A;  1SQB E;  3GOB A;  2QJY C;  1SQX E;  3EQQ A;  2B1X A;  4EMJ B;  4P1C H;  2YFJ A;  2XRX A;  3L71 E;  3L72 E;  1O7G A;  3H1H E;  1O7N A;  4AIV A;  1L0N E;  3GCE A;  1NTM E;  1VM9 A;  4NBF D;  1FQT A;  4QDF A;  3GZY A;  1G8J B;  4HKV A;  4HM7 A;  5HL4 A;  2YIU C;  4D6T E;  1BE3 E;  1RIE A;  1EG9 A;  2FYU E;  2YFI A;  2GBW A;  1L0L E;  2E4P A;  2HMO A;  3H1K E;  2HMJ A;  4QDC A;  3L74 E;  2JZA A;  4OGQ D;  3N0Q A;  2E4Q A;  1BGY E;  4QDF B;  2NWF A;  3H1J E;  1EZV E;  2BCC E;  2QJP C;  2BMO A;  1SJG A;  5CXM A;  2CKF A;  2JO6 A;  1SQQ E;  3C0D A;  4HM4 A;  3D89 A;  3FOU A;  3VMH D;  2IBZ E;  2E76 D;  2BMQ A;  4PV1 D;  1UUW A;  2A06 E;  1BCC E;  1SQV E;  1VCK A;  2HMK A;  3EN1 A;  1NTK E;  1G8K B;  5AEW A;  4QDD A; 
#chains in the Genus database with same CATH topology
 3IR9 A;  3GZX A;  4NBE D;  1P84 I;  4HJL A;  2A45 I;  2W6J H;  3HTK A;  1S5L H;  4ZKP A;  4XE5 B;  3H32 A;  2H8P D;  2QSI A;  1IK7 A;  2OYO A;  3CCS P;  2E42 A;  3BVH A;  2KNC B;  2KB7 P;  4WBA A;  1T3U A;  2KS1 B;  3L73 E;  3L37 A;  2A45 G;  3H1L E;  3A2A A;  3L75 G;  1CW5 A;  5E79 E;  3II6 A;  1N7S D;  1SQP G;  1RF0 C;  1FZC A;  2WSC J;  1GL2 D;  1Z56 A;  1NTZ E;  2YVJ B;  1KYO H;  1EXJ A;  5DJT B;  1H0T B;  1YQ3 C;  3EFG A;  2OYH C;  3KZI H;  2I7F A;  1HVV A;  4H0L C;  3L70 D;  4OGQ B;  3T97 B;  1RF1 C;  1O7N A;  2KLV A;  1NTM E;  1Y8A A;  2NPS C;  3R4Y A;  1YYC A;  4HB1 A;  2V7Q J;  5KJ7 C;  5B5E H;  2JZA A;  2N1T D;  1H88 A;  1T2K D;  2HYN A;  3TF5 A;  1SFC D;  1LTJ A;  5CXM A;  1JY3 N;  3L35 A;  4A7P A;  1W5C E;  2XDJ A;  4PV1 D;  3B5N B;  2RH0 A;  1G1J A;  5GTH H;  5AVT B;  3CCU P;  1SQX J;  3TGU G;  2JR8 A;  1X8Y A;  5CMZ A;  2AEF A;  3H1K G;  2MKV A;  1JMM A;  3GTE A;  2QA4 P;  5AVU B;  4UB6 H;  3V2R A;  1LWU C;  1L2P A;  3CXH D;  3KYQ A;  2PAJ A;  1SQV G;  3HTK B;  1PZQ A;  4LGD E;  1KQG B;  3GKE A;  4U3F J;  3CL3 D;  1SQQ K;  2HPC A;  3H32 B;  3TDK A;  4N78 E;  1KIL A;  3L72 J;  1ZR4 A;  1PPJ D;  4ASW A;  5CCH A;  3HD7 D;  2ZVN B;  1VQ9 P;  1DD3 A;  4ASV A;  3CCV P;  1Q86 Q;  2W8Z A;  1JM1 A;  2KLU A;  1QVG O;  3HUS A;  5E79 H;  3TK1 A;  1PP9 G;  4Z1M H;  2D2C C;  1HUC A;  1URQ A;  1FZC B;  2B9B A;  2UWJ E;  1FJP A;  2Q7C A;  1SQV K;  1KB9 I;  1RH5 B;  1CI6 A;  2K9J A;  3GOB A;  2WMM A;  1ZP0 C;  1AQ5 A;  1JCD A;  1JMB A;  1O7G A;  2O01 H;  1WMK A;  2K1A A;  1M1J A;  1W2E A;  1FQT A;  2M5A A;  1S1C X;  2JO1 A;  5AW7 B;  2E74 C;  2YNY A;  1DD4 A;  2HMJ A;  3CCM P;  1NU1 G;  2K3R A;  1FAV A;  4HM4 A;  2KZI A;  1RE4 C;  2QIW A;  3L74 D;  3K5B A;  2B88 A;  2J5U A;  2AEJ A;  5APY A;  1EXI A;  1RE3 C;  1A02 J;  3QWO C;  3F89 A;  3PHL A;  1BGY G;  4XA4 A;  3AE9 C;  1N7S A;  3AEC C;  1BCC G;  5K5G B;  1P84 D;  5B66 H;  2J58 A;  4EYY Q;  1NTK G;  4QCK A;  3FGA D;  2P1J A;  2RKL A;  1LT9 C;  1T6A A;  1O7H A;  2AXT E;  3H1I G;  3U1C A;  1SQP D;  5KLV K;  1YIT P;  2IZ0 A;  1MFZ A;  1JO5 A;  1KIL B;  2W90 A;  3L75 J;  1HH0 A;  1JOC A;  3L70 E;  1LTB C;  1OWA A;  2POH A;  4AQR D;  1SQP J;  2N1T A;  3W67 A;  1NTK K;  2RMZ A;  5AEU A;  1SFC A;  1N73 B;  1SQX E;  1H8A A;  1URQ B;  3C8V A;  2XRX A;  1S2E A;  4AIV A;  1CI6 B;  2FYN B;  4ZNC A;  2Z4E A;  5CHX A;  1SQQ D;  1NGM B;  2ZT9 B;  1IK9 A;  1M1J B;  4I6M C;  2M5A B;  3N7N A;  3RK3 C;  3MIW A;  4EOT A;  3FXD A;  4WY4 B;  2XND H;  1N86 A;  3SSU A;  2P67 A;  2IBZ E;  5TIS H;  1K04 A;  3GHG A;  3GG2 A;  3Q5R A;  2O1K A;  4NB9 D;  1VPC A;  3HD7 A;  3GL2 A;  4ZMD A;  1SQV D;  2OGU A;  3CPW O;  2FYU K;  1PPJ E;  3TGU J;  3H1K J;  1XTC C;  2ZXE B;  1KD1 Q;  1VQ7 P;  1K05 A;  1PV3 A;  2WSC H;  3CCJ P;  3OW2 O;  5TJH A;  2V4H A;  4HM0 A;  3CX5 I;  1N7S B;  2MJZ A;  3FX0 A;  1NHL A;  3B5N D;  1FZG A;  2Z5H A;  4HM2 A;  2W83 C;  2E75 D;  2KK7 A;  1AVY A;  4JBZ A;  2H7H A;  2BCC J;  1RQU A;  1WQL A;  3IAO A;  2YO2 A;  5CCG C;  1FOS F;  3AZC A;  2V7Q H;  2P2U A;  1PGJ A;  5AW1 B;  1PP9 J;  3M06 A;  3AE4 C;  1IZN B;  3RK3 E;  3MP7 B;  1NU1 D;  1SFC B;  1EG9 A;  4PV1 B;  1LT1 A;  1FZE A;  4JPZ B;  1NKN A;  3SFD C;  3L74 E;  1QGK B;  2QM8 A;  2NWF A;  1IFI A;  2H89 C;  3FOU A;  1CSB A;  5AVX B;  1R5S A;  1VQ5 P;  3VP9 A;  4QDD A;  1BGY D;  1BDC A;  3BCC D;  3L70 G;  1P84 E;  2JDI H;  2JKV A;  1QEX A;  2KUB A;  4OGQ C;  4LC1 A;  3L75 E;  3GHG B;  3U59 A;  4JF7 A;  2KXP B;  1NDO A;  3GB4 A;  1BCC D;  1HGZ A;  3LID A;  1NTZ J;  1NTK D;  2WSF H;  2VRS A;  1SQP E;  1IFM A;  3CCR P;  1BGY J;  3RL0 D;  1BSH A;  3M9H A;  2KYV A;  4KT0 J;  1ZLL A;  1U57 A;  1NVO A;  4UB8 H;  3GF3 A;  3JC2 2;  1GMJ A;  2KS1 A;  1HWT C;  1L0L K;  4P1B H;  2PFX A;  4PD4 H;  3H1I J;  3AE5 C;  2M8R A;  4NPD A;  1K73 Q;  3IN6 A;  1ULJ A;  1OFC X;  1QVF O;  2ZFC A;  1NKZ B;  4IFD K;  3PRJ A;  4IL6 X;  3F5H A;  3B8E B;  1PPJ G;  1RHZ B;  2OYI B;  3KXD A;  5KAF H;  1H0T A;  3ITK A;  5L8R J;  4H13 C;  3HE5 B;  1M8O B;  3H1K E;  1JB0 J;  5CCH D;  1CZQ A;  2LR2 A;  3H1H D;  3G3Z A;  2CKF A;  1SQB G;  1Q90 D;  3O8Z A;  1FZC C;  1SQV E;  2HMK A;  3WMM 0;  4JQ0 D;  5GTI E;  4CPG A;  2B87 A;  3EWK A;  2FFD A;  4JYC A;  2AEM A;  1VF5 D;  5KKZ C;  3OJA B;  3A3Y B;  3MD0 A;  1RFS A;  1LTA C;  1NAF A;  4AYC A;  2R32 A;  2K37 A;  2WPR A;  3O6Q A;  3AEA C;  2A45 H;  2Q3W A;  1E5W A;  1MKM A;  2ZT9 D;  3D6Y A;  1PP9 E;  1SQB K;  4WY4 D;  2HMN A;  1DX7 A;  3L74 G;  1LTJ C;  3CWB D;  1DIP A;  1WT6 A;  1AVO A;  4U7J A;  4W7Z A;  3OA7 A;  4M3L A;  1PGQ A;  4YPC A;  3A7O A;  1R8E A;  3CX5 D;  2K88 A;  5APT A;  3HE4 A;  1QLE D;  1DEB A;  1NO4 A;  1NU1 E;  1AV1 A;  2CPB A;  1KB9 E;  2WIT A;  1SVF A;  2XKM A;  1M1K Q;  1KTM A;  4OVN F;  2OTK E;  4BRY A;  3H1J D;  2ZYA A;  4R4M A;  1KIL C;  3PH0 A;  3GW6 A;  3Q5P A;  4IL6 E;  1BGY E;  3HRN A;  1KQF B;  3G6E P;  3E1I A;  5AVW B;  1AA0 A;  1BCC E;  3HUS C;  3GF7 A;  3M0D A;  1L0L D;  1NTK E;  4HM1 A;  5APW A;  3AE8 C;  4QUP A;  2KSJ A;  1URQ C;  2H88 C;  3I5C A;  3VCP A;  4NBA D;  2FYN C;  3H1I E;  1KYO I;  1X0T A;  2B87 B;  5CJ0 A;  2WSE J;  1IFD A;  2WT7 A;  2FFD B;  3L70 J;  1SQQ G;  1KQS O;  2IFN A;  5BVZ A;  3Q5S A;  1M1J C;  1YJN P;  4RO0 A;  2Y0C A;  1AJY A;  2Z5I A;  1FC2 C;  3LIE A;  1LNQ A;  1H89 A;  1J1D C;  3AE1 C;  1JUN A;  2QJY B;  2E75 B;  3O6Q B;  1EQ7 A;  2ITA A;  3NTN A;  4WVZ A;  4EIJ A;  2GA1 A;  1D7M A;  5AW6 B;  2Q3E A;  2GM4 A;  2PGD A;  4C46 A;  2W27 A;  2W6B A;  4LLH A;  5AVR B;  5APX A;  1YTZ I;  2WQY C;  3RK2 D;  2E76 B;  2DE6 D;  2JP3 A;  1RY3 A;  1KV4 A;  2WTY A;  3D71 A;  2QEX P;  3QH9 A;  2O1J A;  3G9R A;  1UII A;  5KLI B;  4KJM A;  3HE4 B;  1VQN P;  4H44 B;  4C7R A;  3CME P;  2XZR A;  1KIL E;  1N7S C;  2WSF J;  3N4X A;  3H1H E;  1NAY A;  1GL2 C;  2YMY A;  1KB9 H;  4N6J A;  1KMI Z;  2P58 A;  1N73 A;  2YFI A;  1SQB D;  1JNM A;  1X22 A;  1ZR2 A;  4BRY B;  2I1J A;  3SFE C;  4W80 A;  1Q2N A;  1SP4 A;  5CBN A;  3L71 G;  1VCK A;  4Y99 B;  5APU A;  5BOK A;  2Q1K A;  2JEE A;  2LKM A;  2WPS A;  4WY4 A;  3S4R A;  2N1T C;  1T2K C;  3P32 A;  3RL0 B;  2G8Y A;  1SFC C;  1AQT A;  3L36 A;  2BEZ F;  3AE7 C;  4PV1 C;  2BMR A;  3VCA A;  4HM8 A;  5AVZ B;  2WT7 B;  2NUM A;  1KFN A;  1YTZ T;  2IFM A;  5AW5 B;  3FXE A;  1UUV A;  5APS A;  3CX5 E;  5KLV G;  5C39 A;  4HM6 A;  1T8Z A;  1VQO P;  2Y9Z A;  4AAY B;  3BCC G;  3MHV A;  1RQV A;  2Y0D A;  3GMA A;  3L74 J;  3I56 P;  2ZAE B;  3CC7 P;  3P8C D;  3H6P A;  3HD7 C;  2ZJS E;  2YXQ B;  2XR8 A;  4HM5 A;  3CMA P;  4L74 A;  2I8D A;  1YBK A;  1GU4 A;  2B1X A;  1LGH B;  3E7K A;  4C7N A;  1FDI A;  4DOJ A;  2YO3 A;  1G1I A;  1EZV D;  2C9N Y;  3D70 A;  1L0L E;  2HMO A;  4WWI A;  2BMO A;  2KSE A;  4HH2 A;  1VL2 A;  4GKG A;  2KI7 B;  1VF5 B;  1JEK A;  1OMI A;  2R3S A;  1L0N G;  1L4A D;  2OYH B;  1G8K B;  5AEW A;  3CLQ A;  4H0L B;  4D6T G;  1BE3 G;  2AXC A;  2FYU G;  3GLM A;  3P8M C;  1RF1 B;  1U7J A;  1MV8 A;  2ZYL A;  1NTM K;  3USS A;  4NBD D;  4PJ0 E;  1IO4 A;  3H1H G;  3ABV C;  1JY2 N;  3MZW B;  2IDB A;  1KYO D;  3CXH E;  4I1L A;  1SQQ J;  2YXR B;  1N2D C;  2HMM A;  4HKZ H;  1OVR A;  1RE3 A;  1L0N K;  2JWA A;  2ZYG A;  3C1L A;  1HBW A;  2BAS A;  5AW2 B;  1M90 Q;  1A02 F;  2HLO A;  2CK3 H;  3PTZ A;  1X79 B;  2M3E A;  1LWU B;  2DE7 D;  1N7L A;  1YHQ P;  2QJK C;  1O7M A;  1SQV J;  3NMD A;  3MGN A;  2GBX A;  4BXL A;  1SQB E;  3PJS K;  3UIA A;  2L5G B;  3AEB C;  3CWB G;  4OWF A;  2AXT H;  1K8A Q;  4C7N B;  1FS0 E;  1TU3 F;  2OYI A;  3L71 D;  2WSE H;  2R3C A;  3C0D A;  2E76 D;  3KQG A;  3B4S A;  1UUW A;  3HE5 A;  2YMK A;  3EN1 A;  2FYZ A;  2XU6 A;  4MN4 C;  2FBW C;  2N9B A;  1OW8 A;  4NB8 D;  4H44 D;  1GK4 A;  3V5B A;  2NZ2 A;  1JTH B;  3H1J G;  5AVQ B;  3WU2 E;  2E74 B;  1JY3 O;  3GL0 A;  1NH4 A;  3GTS A;  2E43 A;  3ZDM A;  3Q3D A;  1UIX A;  3L73 D;  1NU1 J;  5KLV D;  2NVF A;  2IX7 C;  2B89 A;  3MUD A;  1O7W A;  5AW9 B;  1FDM A;  4TLF A;  3VP8 A;  3A0B E;  3KDP B;  2R44 A;  1L0L G;  1VQ4 P;  2SPZ A;  3P8C E;  4OH8 B;  3RK2 B;  1OIP A;  3WUV A;  3CXH H;  3A5T A;  3BCC J;  2QJP B;  1JY3 P;  4QMA A;  3VOP A;  1SLQ A;  4QUR A;  2WPV B;  2OQQ A;  3B5N C;  1GK6 A;  4NPF X;  1BCC J;  3CI9 A;  1NTK J;  1NTM D;  3BRT B;  2QJY C;  2E75 C;  3EQQ A;  4EMJ B;  1IFP A;  1G2C B;  1PGO A;  4DZO A;  3V2Q A;  4QDF A;  1L4A A;  2HFE D;  1PL5 A;  2Q9I A;  2LXB A;  4HM7 A;  5HL4 A;  2YKQ A;  2E4P A;  2K9Y A;  1OVU A;  3AE2 C;  3SWK A;  3VMX A;  2KOG A;  1GD2 E;  3D6Z A;  3Q1M A;  5BU5 A;  1L0N D;  1SQQ E;  2HG5 D;  4I2L C;  3G71 P;  3VYI A;  4D6T D;  1BE3 D;  1E79 H;  2FYU D;  2M0B A;  2KP8 A;  1SQX K;  5AVS B;  3E1R A;  4K3A A;  2DW3 A;  1HTL C;  4PD4 I;  1KYO E;  3LW5 J;  3M0A A;  2YKP A;  1OZH A;  1MFT A;  2XV5 A;  3B71 A;  3W68 A;  3KZI E;  1KQL A;  2WVR A;  1EC5 A;  3IFM A;  2DE5 D;  2IPP A;  2Q3I A;  5APQ A;  3H1H J;  5EFW B;  4I7Z B;  1R5L A;  1VQ8 P;  2P7J A;  2YIU B;  4H0L D;  3M0D C;  5CBO A;  1P84 H;  3A0B H;  3RL0 C;  3RGU A;  2JJL A;  3M91 A;  2G3A A;  2NPS D;  1HF9 A;  5KJ7 D;  1S4X A;  4Y28 J;  4HYT B;  3R2P A;  4WB4 A;  4P1C H;  3L71 E;  4UB6 E;  4HKV A;  1OVV A;  4QDC A;  3CWB J;  4QDF B;  1L4A B;  1OX3 A;  1EZV I;  1N8R Q;  3VMA A;  1ZV8 A;  4DJG A;  1LTT C;  1KFM A;  5KLV E;  1YJW P;  1J2J B;  3AEF C;  3BRV B;  5CCH C;  3BCC E;  4N3Y B;  4DT0 A;  1EZV G;  1Q90 C;  3V2N A;  2JWD A;  2A06 G;  3AE3 C;  2C0X A;  3H1J J;  1OW6 A;  1JY2 O;  1N73 C;  1VF5 C;  3V6I A;  1FBM A;  2D2C D;  1USD A;  3RBX A;  3AE6 C;  2QE7 H;  1U7M A;  3CCL P;  5GTI H;  4EI2 A;  2NVE A;  1IC2 A;  4L73 A;  1L0L J;  2ZT9 C;  1S72 P;  3U1A A;  3BAS A;  4WY4 C;  2HOD B;  4R4L A;  3CC2 P;  1M7L A;  1SQP K;  2E74 D;  1SQX D;  1M56 D;  2J59 M;  1JY2 P;  1Q81 Q;  2C0W A;  2QG4 A;  1L0N E;  1VM9 A;  3RBZ A;  2N9Y B;  2WWW A;  1G8J B;  2WPQ A;  1VDF A;  3AED C;  3TSI A;  4D6T E;  1BE3 E;  2FY8 A;  3PP5 A;  4U3F D;  1VQK P;  2O01 N;  2FYU E;  2GBW A;  5B66 E;  1S3J A;  3CCQ P;  2IBZ D;  2E4Q A;  2FXO A;  2FXP A;  3L72 D;  3NXS A;  1YIJ P;  2QVA A;  3MTU E;  1IJD B;  2Y9Y A;  2ZVO B;  1EDL A;  3VTP C;  4YTP C;  1RF0 A;  1LJ2 A;  1Q82 Q;  1GW3 A;  2GUV A;  1ZN5 A;  3CC4 P;  2BCC G;  2OYH A;  4H13 B;  2PRR A;  3VN0 A;  2Q6Q A;  1S9K D;  1ZRT D;  1RF1 A;  4IL6 H;  4PD4 D;  1QL1 A;  1MUU A;  2NPS A;  1SQB J;  4EDF A;  3TYY A;  4YXD C;  5KJ7 A;  4NBC D;  4BWN A;  4AUW A;  2NUK A;  4ZKU A;  2XNX A;  1Q7Y Q;  4XFJ A;  1J1E B;  5KKZ B;  3CWB E;  1LP1 A;  2Y0E A;  2WSS H;  3VMG D;  4L75 A;  2Q5U A;  4RJT A;  3V4W A;  5TIS E;  1T3J A;  3L73 G;  1FJK A;  1IFN A;  3H1L G;  5AVV B;  3C9I A;  3RK3 D;  2KIK A;  3GHG C;  1ZXG A;  3AEE C;  1W2B O;  1LWU A;  1LTJ B;  3RK2 C;  1ZOY C;  3GZY A;  1NTZ G;  1LTG C;  2LXC B;  1X9V A;  3H1J E;  2QJP C;  3LW5 H;  1SJG A;  3KPE A;  1NU1 K;  2IYP A;  4L76 A;  1GL2 A;  3L75 D;  1NTM G;  3JCU E;  1EDI A;  3BAT A;  3WUU A;  3TNU A;  1NYK A;  2QM7 A;  2RN0 A;  2KZJ A;  1HJ0 A;  2A06 D;  2HPC B;  3S1K A;  1NTZ K;  2YFL A;  3AEG C;  1ULI A;  2E5Y A;  5KAI E;  2OAR A;  5H2F E;  1O7P A;  2BEQ D;  2L91 A;  1JTH A;  2NVG A;  1GDT A;  4IFF A;  1HJB A;  2P10 A;  1SS1 A;  1VQ6 P;  2OYI C;  3HUS B;  5AW0 B;  5CCG D;  2WZ7 A;  5CJ4 A;  2YKO A;  1FZA A;  2NPS B;  3V4Q A;  1FDO A;  1RE4 A;  2K9J B;  2CPS A;  2IYO A;  4GT1 A;  1DEE G;  1LP1 B;  2W6A A;  3SWY A;  1EDK A;  3A0H E;  4U3F E;  1EDJ A;  4NPE A;  1J1D B;  3H25 A;  5DJU B;  5APV A;  1VQP P;  3L72 E;  3TGU D;  3CX5 H;  3L4F A;  3MUD C;  3H1K D;  3P7K A;  5M1B A;  4NBF D;  1YQ4 C;  4I7Z C;  1OXZ A;  2YIU C;  1FE6 A;  1LTI C;  1S5L X;  3WUT A;  4OGQ D;  1G2C A;  3EFF K;  1LT9 A;  3CD6 P;  4GOE A;  3VMZ A;  1MZ9 A;  5AW4 B;  4UB8 E;  1QL2 A;  4GOD A;  2HR3 A;  2PP6 A;  3FWL A;  1S9K E;  1LTS C;  1ZRT E;  2BCC D;  4PD4 E;  1OW7 A;  1GL2 B;  3TNU B;  2O3J A;  4NBB D;  3JCU H;  2QPZ A;  2D2C B;  1PP9 D;  2ZXX A;  1JCC A;  1L4A C;  3PLN A;  1Y9B A;  2FXM A;  2I1K A;  1GZL A;  4GDO A;  3JSV C;  1IFJ A;  2E5T A;  5KAF E;  1FU1 A;  1WRG A;  3L71 J;  4HM3 A;  5KAI H;  1Y47 A;  5H2F H;  1BSN A;  1FZF A;  3EQ2 A;  1AFO A;  2N1T B;  3H1L D;  1KB9 D;  3OAK A;  4H13 D;  2NRG A;  4PJ0 H;  1GW4 A;  3VMI D;  2R5D A;  5BU8 B;  1PIX A;  1GTW A;  2XSO A;  4B86 A;  3L73 J;  1QX8 A;  5KLV J;  1NTZ D;  1ZW0 A;  3H1L J;  1PFI A;  3GCE A;  3KHU A;  5AW3 B;  3VMY A;  2GUS A;  3A0H H;  2FFD C;  1FOS E;  1RIE A;  3G4S P;  3V2P A;  3N0Q A;  1JM0 A;  1EZV E;  3M9Q A;  4YXW H;  1NOH A;  3VMH D;  1SQX G;  2C9L Y;  2IBZ I;  2BMQ A;  2A06 E;  2O01 J;  1LT9 B;  3HD7 B;  3NFQ A;  4W7Y A;  1S5L E;  3SWF A;  3H1I D;  4KHX A;  3CXH I;  2B24 A;  4IOI H;  2OTL P;  4NBG D;  5CCG A;  3I55 P;  1NTM J;  3FWN A;  2KNC A;  3S9O A;  4U3F G;  2E76 C;  4K35 A;  5AW8 B;  1GU5 A;  4GOF A;  2IBZ G;  1ZME C;  3L72 G;  5KLI C;  4H44 C;  1KZU B;  4O9B A;  1PGP A;  2M3B A;  4QUQ A;  1YI2 P;  4TT3 H;  1NYH A;  1L0N J;  4JYB A;  2H43 A;  4RES B;  4HJG H;  3RL0 g;  1VQL P;  2XSH A;  1DH3 A;  3IF4 A;  4D6T J;  1BE3 J;  3Q2Y A;  2R5B A;  2FYU J;  2OTJ P;  3RK3 B;  1KOR A;  1XTG B;  4NBH D;  4N78 D;  3TGU E;  4GIF A;  1BDD A;  1NWQ A;  2HML A;  3WU2 H;  1HGV A;  4RKU J;  1KIL D;  3T97 A;  4Y99 C;  3DQY A;  1NJI Q;  2IZ1 A;  2QRX A;  5B5E E;  2YFJ A;  2HOD A;  1M57 D;  1KN7 A;  1K9M Q;  1J1E C;  1URQ D;  5AVY B;  1KC8 Q;  1VQM P;  3B5N A;  1YJ9 P;  3M9B A;  3CCE P;  2BCC E;  5GTH E;  2JO6 A;  4IFM A;  3D89 A;  1USE A;  2FKW B;  2ZYD A;  4DCK A;  1FZB A;  2QJK B;  5KTB A; 
#chains in the Genus database with same CATH homology
 4HM1 A;  1NYK A;  3GZX A;  4H44 D;  4NB8 D;  4QUP A;  5BOK A;  1P84 E;  5KLV E;  4NBE D;  1ZRT E;  2B24 A;  4HJL A;  1VF5 D;  3L75 E;  4PD4 E;  3VCP A;  4NBG D;  4NBA D;  5KKZ C;  2FYN C;  2ZYL A;  4NB9 D;  3H1I E;  1KYO E;  1NDO A;  3BCC E;  4NBD D;  3GL2 A;  3GB4 A;  3GTE A;  1RFS A;  4NBB D;  1Q90 C;  2YFL A;  2QPZ A;  2BMR A;  3VCA A;  3GL0 A;  1PPJ E;  3GTS A;  4HM8 A;  1ULI A;  1SQP E;  1O7P A;  2Q3W A;  2NVF A;  5KLI C;  2ZT9 D;  3GKE A;  2NUM A;  4QCK A;  1PP9 E;  1O7W A;  3CXH E;  1UUV A;  2NVG A;  3L73 E;  3CX5 E;  2DE5 D;  4HM0 A;  2D2C D;  2HMM A;  3H1L E;  4HM6 A;  2HMN A;  4QUQ A;  1O7H A;  4HM3 A;  4NBC D;  4AAY B;  2NUK A;  4HM2 A;  2XSH A;  2E75 D;  2NVE A;  4H0L D;  3CWB E;  1JM1 A;  4P1B H;  3VMG D;  3L70 E;  1NTZ E;  2YVJ B;  4NBH D;  3TGU E;  1ULJ A;  2DE6 D;  2HML A;  1WQL A;  4H13 D;  2E74 D;  1NU1 E;  3AZC A;  3VMI D;  4QUR A;  2DE7 D;  1KB9 E;  2QJK C;  1O7M A;  3DQY A;  4U3F E;  2XR8 A;  5AEU A;  2GBX A;  4HM5 A;  2I7F A;  2XSO A;  1SQB E;  3GOB A;  2QJY C;  1SQX E;  3EQQ A;  2B1X A;  4EMJ B;  4P1C H;  2YFJ A;  2XRX A;  3L71 E;  3L72 E;  1O7G A;  3H1H E;  1O7N A;  4AIV A;  1L0N E;  3GCE A;  1NTM E;  1VM9 A;  4NBF D;  1FQT A;  4QDF A;  3GZY A;  1G8J B;  4HKV A;  4HM7 A;  5HL4 A;  2YIU C;  4D6T E;  1BE3 E;  1RIE A;  1EG9 A;  2FYU E;  2YFI A;  2GBW A;  1L0L E;  2E4P A;  2HMO A;  3H1K E;  2HMJ A;  4QDC A;  3L74 E;  2JZA A;  4OGQ D;  3N0Q A;  2E4Q A;  1BGY E;  4QDF B;  2NWF A;  3H1J E;  1EZV E;  2BCC E;  2QJP C;  2BMO A;  1SJG A;  5CXM A;  2CKF A;  2JO6 A;  1SQQ E;  3C0D A;  4HM4 A;  3D89 A;  3FOU A;  3VMH D;  2IBZ E;  2E76 D;  2BMQ A;  4PV1 D;  1UUW A;  2A06 E;  1BCC E;  1SQV E;  1VCK A;  2HMK A;  3EN1 A;  1NTK E;  1G8K B;  5AEW A;  4QDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...