1SQBE

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqbE02
3DQYA 1NDOA 2HMJA 2FYUE 2DE5D 2I7FA 2DE7D 3VMGD 2CKFA 4AIVA 2YFIA 4HKVA 3H1KE 4HM1A 1NU1E 1KYOE 2YVJB 4NB9D 3D89A 2XR8A 1P84E 3C0DA 2D2CD 1PPJE 2E75D 4HM6A 3L72E 4QDFA 1SJGA 3L71E 3CXHE 1O7WA 2BMOA 2E74D 5KLVE 3H1IE 3TGUE 3GTSA 4NBCD 2A06E 4HM0A 3L73E 3EQQA 1SQXE 4PV1D 2QPZA 1NTME 1FQTA 1RIEA 3FOUA 3VCAA 2YFLA 2BMQA 2E4QA 3GB4A 4AAYB 2GBWA 4NB8D 1ULJA 4H0LD 4NBHD 1EZVE 2IBZE 1RFSA 3GTEA 3H1HE 4D6TE 1O7PA 4HM2A 4P1BH 1L0NE 1SQPE 3GKEA 2JZAA 3EN1A 3CWBE 1G8KB 2NUKA 2XSOA 1O7HA 2FYNC 2QJPC 2QJYC 4HM7A 4HM5A 1BE3E 1UUVA 1KB9E 4HM8A 4NBED 1JM1A 1WQLA 3H1JE 2GBXA 4NBGD 2ZT9D 2JO6A 3VMHD 2HMMA 4NBFD 4NBBD 2Q3WA 3BCCE 4QDFB 3CX5E 3H1LE 5HL4A 2B24A 2XRXA 1NTZE 1O7GA 4H13D 3L70E 4QCKA 1ZRTE 4NBDD 2NVFA 2NWFA 2YFJA 3L75E 5KLIC 4PD4E 2HMLA 4QURA 2HMKA 5CXMA 2NVGA 4HM3A 1L0LE 1VF5D 1BGYE 2BCCE 4QUPA 3VMID 5BOKA 4P1CH 2NVEA 5AEWA 4QUQA 1ULIA 1EG9A 3VCPA 1G8JB 2E4PA 5AEUA 2YIUC 3AZCA 1SQVE 2NUMA 3GL0A 4EMJB 1O7NA 2E76D 1NYKA 2DE6D 4OGQD 4HM4A 1SQQE 2HMOA 3GL2A 4HJLA 1UUWA 4U3FE 3GZYA 4QDDA 1VCKA 4NBAD 3GZXA 3N0QA 1O7MA 3L74E 1BCCE 2QJKC 2ZYLA 1NTKE 2BMRA 2HMNA 2XSHA 1SQBE 1VM9A 1PP9E 4QDCA 2B1XA 3GCEA 4H44D 1Q90C 5KKZC 3GOBA
chains in the Genus database with same CATH superfamily
2IFMA 2I7FA 4MN4C 5KLVJ 1LWUC 1BCCJ 1IO4A 1L0LD 2JKVA 2ZYAA 3L72E 4QDFA 1SJGA 1PGJA 1Q2NA 2FYUJ 1FZEA 3H1KD 1DX7A 3BRTB 2QA4P 2NRGA 4IFMA 3FOUA 5APSA 3VP9A 1AQTA 3HD7B 5AVWB 1D7MA 2AXTE 2K3RA 2HPCB 2E74C 5KAFH 1LTJB 1JM1A 2M0BA 1EDKA 2ZT9D 5AW7B 1JY2P 4NBFD 1LGHB 2HR3A 3W68A 2ITAA 1X22A 3K5BA 1OIPA 4H0LC 1QLED 2WSSH 5KLIC 1KILE 2R44A 4QUPA 3B8EB 1SQPK 3AE5C 4IFFA 1OZHA 3CX5H 4QUQA 1NTZJ 1WT6A 3HTKA 5CCGA 1NYKA 3L71G 2E5TA 3H1IG 2CPSA 2W6JH 3CLQA 1JEKA 4HB1A 1BCCE 2ZYLA 4GDOA 1OVVA 4ZKUA 2HMNA 1LTTC 1Q90C 2FYUE 1CZQA 2V4HA 1KN7A 4WVZA 2IX7C 2WZ7A 3E7KA 4Y99C 3VP8A 3D6ZA 5CCGC 1MFZA 2KB7P 3L73E 5AW2B 3CL3D 4R4MA 1SQVD 4QMAA 2WVRA 3WUVA 1J1EB 1EZVE 1X79B 1SQXD 5KAFE 1S9KE 1M1KQ 3FX0A 3R4YA 2KLVA 3N4XA 3RK3E 1N7SD 3HE5B 1NU1D 1HWTC 1BDDA 1HBWA 3B5NB 2KUBA 4NBGD 5KTBA 1SQPJ 3CWBJ 4AQRD 3CX5E 1NTZE 1GL2D 2NPSB 1NKNA 2QJYB 1RE4A 2YXRB 3P32A 1GU5A 5APXA 3FXDA 3O6QA 3M9HA 3JCUH 2H8PD 3S4RA 1KQFB 3CC4P 3T97A 3VCPA 1PZQA 2KSEA 3L75J 1YIJP 2HMOA 5K5GB 1JY3N 3GL2A 1SS1A 3RL0B 1VCKA 2QM8A 5KJ7D 1K04A 1RE4C 1DD4A 2B1XA 1SQQD 1DEBA 3P8CE 1U57A 1JY3O 2IPPA 1GW3A 3L74J 2XNDH 3CCUP 2M5AA 4R4LA 5BVZA 4OWFA 2A06G 2E5YA 1NWQA 2Q3IA 5GTHE 1FQTA 3V4QA 1NAFA 3FGAD 1PL5A 1NTKD 2FKWB 2FXOA 1JTHB 2YMKA 1SQPE 3GKEA 2JZAA 3CWBE 1H88A 1T2KC 1EZVI 5AW5B 1FE6A 3OA7A 4N3YB 3H1HJ 1SFCA 1YTZT 3JCUE 2K9JB 2P58A 2RN0A 2E75B 1Y9BA 1KB9H 1LNQA 1IK9A 1AV1A 3L75E 3SFDC 4EYYQ 1ZP0C 1U7MA 1HF9A 3CX5I 2HLOA 4TT3H 3VMZA 2YKPA 3KQGA 1SFCC 1YBKA 4JPZB 3SSUA 1L0LJ 4OH8B 4U7JA 3FWNA 2B9BA 1JY2O 3L74E 1HGVA 2A45G 5APYA 2KP8A 1AQ5A 4CPGA 4XA4A 1HTLC 1VF5C 2YVJB 1RF1A 4XFJA 1FDMA 3AE6C 3TK1A 1SQVK 4HM0A 3CCQP 1XTCC 3G3ZA 1FOSF 5DJUB 2JWAA 3L71D 3CXHD 3H1ID 4EDFA 1QVGO 4D6TG 1RF1C 2E76B 3H1HE 2MJZA 3EN1A 1NU1K 3V2RA 3AE3C 2FYNC 1GU4A 3M06A 2RMZA 1KB9E 3GHGB 1JCCA 2R32A 2WPVB 4C7NA 1KC8Q 5CMZA 3JC22 1SQBK 5AW9B 3F89A 1GDTA 2CK3H 1G2CB 2NWFA 4GOEA 2KNCB 4QURA 1L0LE 2R3SA 5BOKA 3EQ2A 3FXEA 3H32A 1EXIA 5AEUA 5CCHD 1O7NA 1Q82Q 1DEEG 1T3JA 3TNUA 2KYVA 5AW3B 2BASA 1VQ8P 4H13C 1N73A 3S1KA 3IN6A 1SQVJ 3AEFC 1NDOA 2YIUB 1OX3A 1L4AA 2WPSA 2W90A 1X9VA 3CC7P 2J59M 2D2CD 1PPJE 5KAIH 4HM6A 2C9NY 3RK2D 1EDLA 2K9YA 3RK3C 1H89A 1JMMA 1JOCA 4NBCD 1BE3G 1CW5A 1NU1J 4PV1D 1FBMA 1M57D 1NO4A 1LWUB 2BEZF 4W7ZA 2L91A 1URQD 3GLMA 1N73C 1Y47A 3VCAA 2E4QA 1UIIA 3Q5PA 1NTKK 2FXPA 1L4AC 3ITKA 5AVTB 3CCMP 1VQ9P 3V6IA 4P1BH 1NAYA 4GOFA 4BRYA 4YXWH 3VMYA 2QIWA 1P84D 2IZ0A 4KT0J 2Y0EA 1UUVA 5KLVK 2PGDA 2A06D 4QDFB 1LTGC 2B24A 1FS0E 5CJ4A 1KB9I 4NBDD 1K05A 1YQ3C 2E74B 1OVRA 4AYCA 2E42A 3IR9A 1OVUA 4ZMDA 1Q81Q 3MIWA 2OTKE 3IAOA 2J58A 5AW6B 4I1LA 1BSNA 1SQVE 1R5SA 3M9QA 4H0LB 4WY4D 1HUCA 5KLIB 3GZYA 2KIKA 3AE4C 4YPCA 3PRJA 1ZW0A 3BRVB 3M9BA 1JY3P 1YQ4C 5BU5A 5H2FH 2AEJA 1S5LX 4IL6H 1SVFA 4HKVA 3OJAB 4HM1A 3AECC 1NU1E 4I7ZC 2XR8A 1NTKJ 1PP9J 2IZ1A 2R5DA 5B5EH 2KZJA 4ZNCA 1IFDA 2WSEH 2WSEJ 3M0AA 4Y99B 1X0TA 5AVYB 4AAYB 5DJTB 2GBWA 3KZIH 2CPBA 3HTKB 3SWFA 5APUA 5APQA 3II6A 2FXMA 1VQNP 2N1TA 2HYNA 1NJIQ 4OVNF 4NBED 5AW4B 4K3AA 3BCCE 1J1DC 2K1AA 3MTUE 1VQPP 5CBOA 3CPWO 1BCCG 3RGUA 3OW2O 2BCCE 2ZJSE 2N1TC 3VMID 3Q3DA 1EQ7A 4D6TD 1JMBA 2ZVNB 5H2FE 1BGYD 4EMJB 2WPRA 2Z5HA 3HD7D 4IL6E 4HJLA 1UUWA 1IJDB 2Y9ZA 3L73G 4RJTA 1NTKE 1ZXGA 2IFNA 1PP9E 2K88A 5B5EE 2P67A 3L71J 2CKFA 3IF4A 3H1IJ 3C0DA 4RKUJ 1PGOA 2KS1A 1LT1A 1Q7YQ 3AEGC 3KZIE 3O6QB 3VOPA 5KLVE 3GTSA 4OGQC 2WSCH 2WSCJ 3FWLA 1ZR4A 1MZ9A 3AE1C 2O1JA 4N78D 3T97B 3HRNA 2AEMA 2YKOA 3LIDA 1EDJA 1ULJA 5CJ0A 4H44C 1FC2C 1LT9A 1NTZG 1FZAA 1L0NG 4W80A 2OTLP 2I8DA 4YXDC 1O7HA 1KYOD 3WUTA 3M91A 3H1JG 4IFDK 4AUWA 1R8EA 1TU3F 4GT1A 1XTGB 2PRRA 1BE3D 2VRSA 1LJ2A 5HL4A 2M5AB 1LT9C 4DCKA 1RHZB 3L37A 1RF0A 3C8VA 3WMM0 4BWNA 2KSJA 2QM7A 3CCVP 2ZFCA 4P1CH 1ULIA 3G71P 2N9BA 3N7NA 1OXZA 3AZCA 2W6BA 4HJGH 4JBZA 2ZT9C 3U1AA 5AW0B 4NBAD 3HE4A 1LP1A 3QWOC 3PTZA 1CI6A 1RF0C 2OYOA 3SWYA 3B5ND 5KKZC 2Q3EA 4HM3A 4DZOA 1FAVA 3CMEP 1SFCB 1HGZA 3EFFK 4YTPC 1SQPG 2NPSD 5TISH 3CWBG 3TYYA 3IFMA 2HODA 1KFNA 2OTJP 1P84H 1VF5B 1NGMB 1HJ0A 3PP5A 4KHXA 2YFLA 3CD6P 1LTAC 2ZYDA 3A0HH 1L0LK 3TGUJ 1T6AA 3U59A 4I2LC 3RL0D 3QH9A 2O01N 4HM2A 4C46A 1KQLA 3L75G 3PH0A 2G8YA 2QJPC 1N7SA 2W6AA 1LTSC 4N6JA 1KD1Q 1RF1B 1YYCA 1DIPA 3H1LG 2MKVA 1KILB 1GD2E 2WQYC 3VN0A 3L74G 3VYIA 2FYNB 1GL2A 1IFIA 2B89A 1N7SC 2GUVA 5CHXA 1KILD 3I56P 1QGKB 1PFIA 4RESB 1J1EC 2N9YB 3A0BH 1FOSE 4ZKPA 1YITP 1O7MA 1RQVA 2HFED 3D71A 5KJ7A 1BSHA 4UB8H 5TISE 1GL2C 3GOBA 3Q5RA 4C7NB 1IC2A 1BCCD 3AE2C 1P84E 3A5TA 1HH0A 2E75D 5AW1B 2A45H 3KHUA 4H13B 3TGUE 2P1JA 2XNXA 2A06E 2OYHA 1JNMA 3H1KJ 5KJ7C 5APWA 1X8YA 5AW8B 3WU2H 2W8ZA 3L73D 2IBZE 3RK3B 1FZBA 2OYIA 2Q6QA 3TNUB 2QJKB 3MD0A 3RL0C 3B4SA 4GKGA 1ZV8A 4C7RA 1N73B 1PGPA 2JEEA 1S9KD 2YMYA 2OYHC 3D6YA 1L4AB 4D6TJ 1Y8AA 1FDIA 1SQXK 3S9OA 2Q3WA 3V5BA 3L70G 3P8MC 1UIXA 2JO1A 1VQLP 2OYIC 1FU1A 1ZRTE 3B71A 1BGYG 4JYBA 2HMKA 4Z1MH 3OAKA 1KFMA 2BEQD 3CX5D 1S2EA 1KQSO 2LXCB 1NTZD 2NVEA 1M7LA 1L0ND 1OFCX 4UB8E 1PPJG 1VL2A 5L8RJ 3AE9C 2E76D 3G4SP 4U3FG 4BRYB 2IDBA 1ZN5A 3H1JD 5C39A 1SLQA 3GCEA 4JYCA 1NH4A 3H1KE 4NB9D 3JSVC 3P8CD 2KI7B 1NVOA 1JB0J 3NTNA 3TDKA 2WMMA 1NTMG 1P84I 1KYOH 2H89C 1H8AA 1SQQK 4I7ZB 1VQ7P 1W5CE 4NB8D 1OW8A 5APTA 2OGUA 2JP3A 2AXCA 5AVQB 1SQXJ 4D6TE 2QG4A 2RKLA 2FFDA 3E1RA 3NMDA 2IBZI 3C1LA 4HM5A 3F5HA 1SQPD 3KDPB 3CWBD 1N86A 4XE5B 4NPDA 1AVOA 4A7PA 2XRXA 4ASVA 1GTWA 3A3YB 2P2UA 3MGNA 2FFDC 2YO3A 2FYZA 4HKZH 3CCEP 1J1DB 3L75D 1VQOP 2J5UA 1QL2A 2I1JA 3H6PA 4N78E 5CCHA 5AVUB 1G1JA 3GZXA 2N1TB 1SQBG 1T3UA 3H1LD 2WT7A 3L35A 3DQYA 1SQQJ 3VMGD 2YFIA 3L74D 1KYOE 3P7KA 1IFPA 3L72G 3L36A 1DH3A 1IFMA 5AVXB 2P10A 5B66H 2POHA 4WB4A 2E74D 5CCHC 1MFTA 1S72P 5KAIE 1SQXE 1EDIA 1NYHA 1L2PA 2OQQA 3V2NA 1VQMP 3BCCG 1E79H 1URQA 4H0LD 2H43A 2YO2A 2O01H 2O01J 4BXLA 4OGQB 1S3JA 2D2CC 1KZUB 2BCCG 2R3CA 1FZCA 3RK2C 4HM7A 1YI2P 4H44B 1WQLA 3VMHD 4O9BA 4PV1C 1YHQP 2KS1B 1YJWP 3WUUA 2P7JA 1URQC 2JDIH 1QEXA 1KB9D 1LTBC 1M8OB 1Q90D 1PP9G 4WBAA 4NPEA 2ZAEB 4I6MC 1FZCC 1YJ9P 5AEWA 1USEA 1EG9A 3MUDA 3LW5H 3LW5J 1M1JA 5CCGD 1LT9B 2I1KA 2C0WA 1SQQE 5KLVG 4QDDA 4WY4A 1U7JA 1YTZI 4RO0A 3TSIA 2K37A 3BATA 2FYUG 3PLNA 4UB6H 5AVVB 5B66E 3Q1MA 3L70D 5GTIH 2DE5D 3A2AA 4Y28J 3GF3A 2GA1A 2ZT9B 3GG2A 4PD4D 3MUDC 3L73J 1M1JC 1H0TA 1KTMA 2KXPB 2Y0CA 2Y9YA 1O7WA 3GF7A 1A02J 1KYOI 4WY4C 5KKZB 1LTIC 3EQQA 1PPJD 2NZ2A 1YJNP 2B87A 4JQ0D 4U3FD 3HUSA 3CXHH 1EZVG 3AE8C 4EI2A 3V2PA 2R5BA 1AA0A 3HE4B 1VQ5P 1LP1B 1Q86Q 3G9RA 2XSOA 1CI6B 3W67A 1FZGA 1JM0A 2W27A 3O8ZA 1NHLA 2Z4EA 1E5WA 1S1CX 3MZWB 2M3BA 1L0NJ 1ZR2A 2SPZA 2PFXA 1VQ6P 3HUSC 1VQ4P 2FBWC 1NTMD 2M8RA 1O7GA 4IL6X 2QJPB 2HODB 2YFJA 1AFOA 1RE3A 3H1JJ 1NOHA 1KMIZ 2NVGA 5AVSB 5CBNA 4PJ0H 2JWDA 4WWIA 3M0DA 3U1CA 2HG5D 2LXBA 4GIFA 1DD3A 2QEXP 1BDCA 4UB6E 4HM4A 1FJKA 5GTIE 1WMKA 1GK4A 3HD7A 2ZYGA 3BVHA 1N7SB 1RE3C 4TLFA 4QDCA 1GK6A 3ABVC 2HPCA 1JCDA 2HMJA 1LTJA 3M0DC 3VMAA 1T2KD 1FZFA 3GW6A 5GTHH 3CCRP 3L71E 3CXHE 2QSIA 1GL2B 3H1IE 3HD7C 2O3JA 2Z5IA 4L75A 2QPZA 1CSBA 2WTYA 4EOTA 2M3EA 1LTJC 3PJSK 2GM4A 1RFSA 2KK7A 1SQBD 1M56D 1KORA 1O7PA 1L0NE 2ZXXA 2LR2A 1RH5B 1IFJA 3L4FA 2YKQA 1JO5A 1T8ZA 5E79H 4LGDE 1HJBA 2NUKA 2XV5A 4LC1A 1SFCD 2H88C 3L72D 4HM8A 3H1JE 2JO6A 3GMAA 5EFWB 2G3AA 4PJ0E 1FJPA 1EC5A 3NFQA 1A02F 3AE7C 1S4XA 1VDFA 2OYHB 3PHLA 1PV3A 1VQKP 3BCCD 1VF5D 1AVYA 3H1LJ 2XU6A 1M90Q 2OYIB 1VPCA 2DE6D 2BCCD 1AJYA 3TGUG 2Y0DA 3SFEC 3BASA 1N2DC 1PGQA 2BMRA 4LLHA 3HE5A 4ASWA 1NKZB 5M1BA 2JR8A 3B5NA 4IOIH 2IBZG 2Q7CA 1PP9D 3AEAC 2XDJA 2NPSA 2Q1KA 3D70A 2ZXEB 1OW7A 2PP6A 3RBXA 5E79E 3CXHI 3NXSA 5KLVD 3B5NC 1EXJA 3I55P 3GTEA 3H1HG 4L74A 3USSA 2GUSA 3VMXA 3E1IA 2V7QH 2V7QJ 5TJHA 3I5CA 2FYUD 3A0HE 2NPSC 3TF5A 2QJYC 1JY2N 1GW4A 2Q5UA 3H32B 4GODA 1W2BO 1QVFO 1NTMK 2AEFA 3H1LE 3R2PA 4H13D 4QCKA 2KLUA 2NVFA 2XKMA 3KPEA 3ZDMA 4HH2A 1L0LG 5CXMA 1EZVD 3MP7B 3MHVA 3V4WA 3H1KG 2LKMA 2YXQB 4L76A 3L70J 1G8JB 2UWJE 3RK3D 1QL1A 5BU8B 4PD4H 3GL0A 1KILA 3RBZA 1BGYJ 2O1KA 1R5LA 2WWWA 1JTHA 2FFDB 2PAJA 1K73Q 1G1IA 3A0BE 1L4AD 1MV8A 4NPFX 1KV4A 4U3FJ 3V2QA 1K8AQ 2K9JA 1USDA 1MUUA 1KQGB 1OW6A 3H25A 1J2JB 1KILC 3AEBC 1N7LA 1RIEA 1WRGA 3Q2YA 3UIAA 2BMQA 2E43A 1GZLA 4L73A 4JF7A 3EFGA 1NTMJ 3CMAP 1S5LH 3WU2E 1G8KB 2YNYA 2E75C 2XZRA 2WT7B 1OWAA 1MKMA 4DOJA 4HYTB 3SWKA 2OARA 2W83C 2HMMA 2JJLA 4NBBD 1N8RQ 3CI9A 2D2CB 1HVVA 3L70E 3RK2B 1BE3J 4PD4E 2HMLA 1BGYE 2QE7H 3EWKA 1RQUA 1GMJA 3KXDA 4PV1B 1PIXA 1OMIA 1URQB 1JUNA 2E4PA 1SQVG 2NUMA 2IYPA 1W2EA 4DJGA 4EIJA 1IK7A 4U3FE 2H7HA 1SQXG 3A7OA 2QJKC 1FZCB 3Q5SA 1K9MQ 2XSHA 1ZLLA 3GHGA 1NU1G 2DE7D 1ZMEC 4AIVA 2IYOA 3D89A 1IZNB 3VTPC 1SQBJ 2BMOA 2KOGA 1G2CA 2WPQA 2E76C 1QX8A 2C0XA 2B88A 2KNCA 4W7YA 3CC2P 5AVZB 1NTME 4M3LA 2Q9IA 4B86A 1S5LE 3L72J 1ZOYC 3GB4A 1M1JB 3C9IA 5AVRB 3TGUD 3AEEC 3GHGC 4NBHD 3RL0g 1SP4A 2FY8A 2FYUK 2A45I 2KZIA 4WY4B 2N1TD 2QVAA 1IFNA 2C9LY 2IBZD 3BCCJ 3LIEA 2DW3A 1BE3E 3CCJP 2GBXA 1Z56A 2AXTH 2RH0A 1SQQG 1H0TB 1FDOA 1RY3A 4KJMA 2BCCJ 3KYQA 4DT0A 3AEDC 2ZVOB 3G6EP 2B87B 2QRXA 3H1HD 3HUSB 1LWUA 1ZRTD 4PD4I 2YIUC 2L5GB 4OGQD 2WSFH 2WSFJ 2WITA 3N0QA 1NTKG 3CCLP 5APVA 4K35A 1SQBE 1VM9A 1NTZK 3CCSP 4H44D 1L0NK
chains in the Genus database with same CATH topology
3DQYA 1NDOA 2HMJA 2FYUE 2DE5D 2I7FA 2DE7D 3VMGD 2CKFA 4AIVA 2YFIA 4HKVA 3H1KE 4HM1A 1NU1E 1KYOE 2YVJB 4NB9D 3D89A 2XR8A 1P84E 3C0DA 2D2CD 1PPJE 2E75D 4HM6A 3L72E 4QDFA 1SJGA 3L71E 3CXHE 1O7WA 2BMOA 2E74D 5KLVE 3H1IE 3TGUE 3GTSA 4NBCD 2A06E 4HM0A 3L73E 3EQQA 1SQXE 4PV1D 2QPZA 1NTME 1FQTA 1RIEA 3FOUA 3VCAA 2YFLA 2BMQA 2E4QA 3GB4A 4AAYB 2GBWA 4NB8D 1ULJA 4H0LD 4NBHD 1EZVE 2IBZE 1RFSA 3GTEA 3H1HE 4D6TE 1O7PA 4HM2A 4P1BH 1L0NE 1SQPE 3GKEA 2JZAA 3EN1A 3CWBE 1G8KB 2NUKA 2XSOA 1O7HA 2FYNC 2QJPC 2QJYC 4HM7A 4HM5A 1BE3E 1UUVA 1KB9E 4HM8A 4NBED 1JM1A 1WQLA 3H1JE 2GBXA 4NBGD 2ZT9D 2JO6A 3VMHD 2HMMA 4NBFD 4NBBD 2Q3WA 3BCCE 4QDFB 3CX5E 3H1LE 5HL4A 2B24A 2XRXA 1NTZE 1O7GA 4H13D 3L70E 4QCKA 1ZRTE 4NBDD 2NVFA 2NWFA 2YFJA 3L75E 5KLIC 4PD4E 2HMLA 4QURA 2HMKA 5CXMA 2NVGA 4HM3A 1L0LE 1VF5D 1BGYE 2BCCE 4QUPA 3VMID 5BOKA 4P1CH 2NVEA 5AEWA 4QUQA 1ULIA 1EG9A 3VCPA 1G8JB 2E4PA 5AEUA 2YIUC 3AZCA 1SQVE 2NUMA 3GL0A 4EMJB 1O7NA 2E76D 1NYKA 2DE6D 4OGQD 4HM4A 1SQQE 2HMOA 3GL2A 4HJLA 1UUWA 4U3FE 3GZYA 4QDDA 1VCKA 4NBAD 3GZXA 3N0QA 1O7MA 3L74E 1BCCE 2QJKC 2ZYLA 1NTKE 2BMRA 2HMNA 2XSHA 1SQBE 1VM9A 1PP9E 4QDCA 2B1XA 3GCEA 4H44D 1Q90C 5KKZC 3GOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  1NDO A;  2HMJ A;  2FYU E;  2DE5 D;  2I7F A;  2DE7 D;  3VMG D;  2CKF A;  4AIV A;  2YFI A;  4HKV A;  3H1K E;  4HM1 A;  1NU1 E;  1KYO E;  2YVJ B;  4NB9 D;  3D89 A;  2XR8 A;  1P84 E;  3C0D A;  2D2C D;  1PPJ E;  2E75 D;  4HM6 A;  3L72 E;  4QDF A;  1SJG A;  3L71 E;  3CXH E;  1O7W A;  2BMO A;  2E74 D;  5KLV E;  3H1I E;  3TGU E;  3GTS A;  4NBC D;  2A06 E;  4HM0 A;  3L73 E;  3EQQ A;  1SQX E;  4PV1 D;  2QPZ A;  1NTM E;  1FQT A;  1RIE A;  3FOU A;  3VCA A;  2YFL A;  2BMQ A;  2E4Q A;  3GB4 A;  4AAY B;  2GBW A;  4NB8 D;  1ULJ A;  4H0L D;  4NBH D;  1EZV E;  2IBZ E;  1RFS A;  3GTE A;  3H1H E;  4D6T E;  1O7P A;  4HM2 A;  4P1B H;  1L0N E;  1SQP E;  3GKE A;  2JZA A;  3EN1 A;  3CWB E;  1G8K B;  2NUK A;  2XSO A;  1O7H A;  2FYN C;  2QJP C;  2QJY C;  4HM7 A;  4HM5 A;  1BE3 E;  1UUV A;  1KB9 E;  4HM8 A;  4NBE D;  1JM1 A;  1WQL A;  3H1J E;  2GBX A;  4NBG D;  2ZT9 D;  2JO6 A;  3VMH D;  2HMM A;  4NBF D;  4NBB D;  2Q3W A;  3BCC E;  4QDF B;  3CX5 E;  3H1L E;  5HL4 A;  2B24 A;  2XRX A;  1NTZ E;  1O7G A;  4H13 D;  3L70 E;  4QCK A;  1ZRT E;  4NBD D;  2NVF A;  2NWF A;  2YFJ A;  3L75 E;  5KLI C;  4PD4 E;  2HML A;  4QUR A;  2HMK A;  5CXM A;  2NVG A;  4HM3 A;  1L0L E;  1VF5 D;  1BGY E;  2BCC E;  4QUP A;  3VMI D;  5BOK A;  4P1C H;  2NVE A;  5AEW A;  4QUQ A;  1ULI A;  1EG9 A;  3VCP A;  1G8J B;  2E4P A;  5AEU A;  2YIU C;  3AZC A;  1SQV E;  2NUM A;  3GL0 A;  4EMJ B;  1O7N A;  2E76 D;  1NYK A;  2DE6 D;  4OGQ D;  4HM4 A;  1SQQ E;  2HMO A;  3GL2 A;  4HJL A;  1UUW A;  4U3F E;  3GZY A;  4QDD A;  1VCK A;  4NBA D;  3GZX A;  3N0Q A;  1O7M A;  3L74 E;  1BCC E;  2QJK C;  2ZYL A;  1NTK E;  2BMR A;  2HMN A;  2XSH A;  1SQB E;  1VM9 A;  1PP9 E;  4QDC A;  2B1X A;  3GCE A;  4H44 D;  1Q90 C;  5KKZ C;  3GOB A; 
#chains in the Genus database with same CATH topology
 2IFM A;  2I7F A;  4MN4 C;  5KLV J;  1LWU C;  1BCC J;  1IO4 A;  1L0L D;  2JKV A;  2ZYA A;  3L72 E;  4QDF A;  1SJG A;  1PGJ A;  1Q2N A;  2FYU J;  1FZE A;  3H1K D;  1DX7 A;  3BRT B;  2QA4 P;  2NRG A;  4IFM A;  3FOU A;  5APS A;  3VP9 A;  1AQT A;  3HD7 B;  5AVW B;  1D7M A;  2AXT E;  2K3R A;  2HPC B;  2E74 C;  5KAF H;  1LTJ B;  1JM1 A;  2M0B A;  1EDK A;  2ZT9 D;  5AW7 B;  1JY2 P;  4NBF D;  1LGH B;  2HR3 A;  3W68 A;  2ITA A;  1X22 A;  3K5B A;  1OIP A;  4H0L C;  1QLE D;  2WSS H;  5KLI C;  1KIL E;  2R44 A;  4QUP A;  3B8E B;  1SQP K;  3AE5 C;  4IFF A;  1OZH A;  3CX5 H;  4QUQ A;  1NTZ J;  1WT6 A;  3HTK A;  5CCG A;  1NYK A;  3L71 G;  2E5T A;  3H1I G;  2CPS A;  2W6J H;  3CLQ A;  1JEK A;  4HB1 A;  1BCC E;  2ZYL A;  4GDO A;  1OVV A;  4ZKU A;  2HMN A;  1LTT C;  1Q90 C;  2FYU E;  1CZQ A;  2V4H A;  1KN7 A;  4WVZ A;  2IX7 C;  2WZ7 A;  3E7K A;  4Y99 C;  3VP8 A;  3D6Z A;  5CCG C;  1MFZ A;  2KB7 P;  3L73 E;  5AW2 B;  3CL3 D;  4R4M A;  1SQV D;  4QMA A;  2WVR A;  3WUV A;  1J1E B;  1EZV E;  1X79 B;  1SQX D;  5KAF E;  1S9K E;  1M1K Q;  3FX0 A;  3R4Y A;  2KLV A;  3N4X A;  3RK3 E;  1N7S D;  3HE5 B;  1NU1 D;  1HWT C;  1BDD A;  1HBW A;  3B5N B;  2KUB A;  4NBG D;  5KTB A;  1SQP J;  3CWB J;  4AQR D;  3CX5 E;  1NTZ E;  1GL2 D;  2NPS B;  1NKN A;  2QJY B;  1RE4 A;  2YXR B;  3P32 A;  1GU5 A;  5APX A;  3FXD A;  3O6Q A;  3M9H A;  3JCU H;  2H8P D;  3S4R A;  1KQF B;  3CC4 P;  3T97 A;  3VCP A;  1PZQ A;  2KSE A;  3L75 J;  1YIJ P;  2HMO A;  5K5G B;  1JY3 N;  3GL2 A;  1SS1 A;  3RL0 B;  1VCK A;  2QM8 A;  5KJ7 D;  1K04 A;  1RE4 C;  1DD4 A;  2B1X A;  1SQQ D;  1DEB A;  3P8C E;  1U57 A;  1JY3 O;  2IPP A;  1GW3 A;  3L74 J;  2XND H;  3CCU P;  2M5A A;  4R4L A;  5BVZ A;  4OWF A;  2A06 G;  2E5Y A;  1NWQ A;  2Q3I A;  5GTH E;  1FQT A;  3V4Q A;  1NAF A;  3FGA D;  1PL5 A;  1NTK D;  2FKW B;  2FXO A;  1JTH B;  2YMK A;  1SQP E;  3GKE A;  2JZA A;  3CWB E;  1H88 A;  1T2K C;  1EZV I;  5AW5 B;  1FE6 A;  3OA7 A;  4N3Y B;  3H1H J;  1SFC A;  1YTZ T;  3JCU E;  2K9J B;  2P58 A;  2RN0 A;  2E75 B;  1Y9B A;  1KB9 H;  1LNQ A;  1IK9 A;  1AV1 A;  3L75 E;  3SFD C;  4EYY Q;  1ZP0 C;  1U7M A;  1HF9 A;  3CX5 I;  2HLO A;  4TT3 H;  3VMZ A;  2YKP A;  3KQG A;  1SFC C;  1YBK A;  4JPZ B;  3SSU A;  1L0L J;  4OH8 B;  4U7J A;  3FWN A;  2B9B A;  1JY2 O;  3L74 E;  1HGV A;  2A45 G;  5APY A;  2KP8 A;  1AQ5 A;  4CPG A;  4XA4 A;  1HTL C;  1VF5 C;  2YVJ B;  1RF1 A;  4XFJ A;  1FDM A;  3AE6 C;  3TK1 A;  1SQV K;  4HM0 A;  3CCQ P;  1XTC C;  3G3Z A;  1FOS F;  5DJU B;  2JWA A;  3L71 D;  3CXH D;  3H1I D;  4EDF A;  1QVG O;  4D6T G;  1RF1 C;  2E76 B;  3H1H E;  2MJZ A;  3EN1 A;  1NU1 K;  3V2R A;  3AE3 C;  2FYN C;  1GU4 A;  3M06 A;  2RMZ A;  1KB9 E;  3GHG B;  1JCC A;  2R32 A;  2WPV B;  4C7N A;  1KC8 Q;  5CMZ A;  3JC2 2;  1SQB K;  5AW9 B;  3F89 A;  1GDT A;  2CK3 H;  1G2C B;  2NWF A;  4GOE A;  2KNC B;  4QUR A;  1L0L E;  2R3S A;  5BOK A;  3EQ2 A;  3FXE A;  3H32 A;  1EXI A;  5AEU A;  5CCH D;  1O7N A;  1Q82 Q;  1DEE G;  1T3J A;  3TNU A;  2KYV A;  5AW3 B;  2BAS A;  1VQ8 P;  4H13 C;  1N73 A;  3S1K A;  3IN6 A;  1SQV J;  3AEF C;  1NDO A;  2YIU B;  1OX3 A;  1L4A A;  2WPS A;  2W90 A;  1X9V A;  3CC7 P;  2J59 M;  2D2C D;  1PPJ E;  5KAI H;  4HM6 A;  2C9N Y;  3RK2 D;  1EDL A;  2K9Y A;  3RK3 C;  1H89 A;  1JMM A;  1JOC A;  4NBC D;  1BE3 G;  1CW5 A;  1NU1 J;  4PV1 D;  1FBM A;  1M57 D;  1NO4 A;  1LWU B;  2BEZ F;  4W7Z A;  2L91 A;  1URQ D;  3GLM A;  1N73 C;  1Y47 A;  3VCA A;  2E4Q A;  1UII A;  3Q5P A;  1NTK K;  2FXP A;  1L4A C;  3ITK A;  5AVT B;  3CCM P;  1VQ9 P;  3V6I A;  4P1B H;  1NAY A;  4GOF A;  4BRY A;  4YXW H;  3VMY A;  2QIW A;  1P84 D;  2IZ0 A;  4KT0 J;  2Y0E A;  1UUV A;  5KLV K;  2PGD A;  2A06 D;  4QDF B;  1LTG C;  2B24 A;  1FS0 E;  5CJ4 A;  1KB9 I;  4NBD D;  1K05 A;  1YQ3 C;  2E74 B;  1OVR A;  4AYC A;  2E42 A;  3IR9 A;  1OVU A;  4ZMD A;  1Q81 Q;  3MIW A;  2OTK E;  3IAO A;  2J58 A;  5AW6 B;  4I1L A;  1BSN A;  1SQV E;  1R5S A;  3M9Q A;  4H0L B;  4WY4 D;  1HUC A;  5KLI B;  3GZY A;  2KIK A;  3AE4 C;  4YPC A;  3PRJ A;  1ZW0 A;  3BRV B;  3M9B A;  1JY3 P;  1YQ4 C;  5BU5 A;  5H2F H;  2AEJ A;  1S5L X;  4IL6 H;  1SVF A;  4HKV A;  3OJA B;  4HM1 A;  3AEC C;  1NU1 E;  4I7Z C;  2XR8 A;  1NTK J;  1PP9 J;  2IZ1 A;  2R5D A;  5B5E H;  2KZJ A;  4ZNC A;  1IFD A;  2WSE H;  2WSE J;  3M0A A;  4Y99 B;  1X0T A;  5AVY B;  4AAY B;  5DJT B;  2GBW A;  3KZI H;  2CPB A;  3HTK B;  3SWF A;  5APU A;  5APQ A;  3II6 A;  2FXM A;  1VQN P;  2N1T A;  2HYN A;  1NJI Q;  4OVN F;  4NBE D;  5AW4 B;  4K3A A;  3BCC E;  1J1D C;  2K1A A;  3MTU E;  1VQP P;  5CBO A;  3CPW O;  1BCC G;  3RGU A;  3OW2 O;  2BCC E;  2ZJS E;  2N1T C;  3VMI D;  3Q3D A;  1EQ7 A;  4D6T D;  1JMB A;  2ZVN B;  5H2F E;  1BGY D;  4EMJ B;  2WPR A;  2Z5H A;  3HD7 D;  4IL6 E;  4HJL A;  1UUW A;  1IJD B;  2Y9Z A;  3L73 G;  4RJT A;  1NTK E;  1ZXG A;  2IFN A;  1PP9 E;  2K88 A;  5B5E E;  2P67 A;  3L71 J;  2CKF A;  3IF4 A;  3H1I J;  3C0D A;  4RKU J;  1PGO A;  2KS1 A;  1LT1 A;  1Q7Y Q;  3AEG C;  3KZI E;  3O6Q B;  3VOP A;  5KLV E;  3GTS A;  4OGQ C;  2WSC H;  2WSC J;  3FWL A;  1ZR4 A;  1MZ9 A;  3AE1 C;  2O1J A;  4N78 D;  3T97 B;  3HRN A;  2AEM A;  2YKO A;  3LID A;  1EDJ A;  1ULJ A;  5CJ0 A;  4H44 C;  1FC2 C;  1LT9 A;  1NTZ G;  1FZA A;  1L0N G;  4W80 A;  2OTL P;  2I8D A;  4YXD C;  1O7H A;  1KYO D;  3WUT A;  3M91 A;  3H1J G;  4IFD K;  4AUW A;  1R8E A;  1TU3 F;  4GT1 A;  1XTG B;  2PRR A;  1BE3 D;  2VRS A;  1LJ2 A;  5HL4 A;  2M5A B;  1LT9 C;  4DCK A;  1RHZ B;  3L37 A;  1RF0 A;  3C8V A;  3WMM 0;  4BWN A;  2KSJ A;  2QM7 A;  3CCV P;  2ZFC A;  4P1C H;  1ULI A;  3G71 P;  2N9B A;  3N7N A;  1OXZ A;  3AZC A;  2W6B A;  4HJG H;  4JBZ A;  2ZT9 C;  3U1A A;  5AW0 B;  4NBA D;  3HE4 A;  1LP1 A;  3QWO C;  3PTZ A;  1CI6 A;  1RF0 C;  2OYO A;  3SWY A;  3B5N D;  5KKZ C;  2Q3E A;  4HM3 A;  4DZO A;  1FAV A;  3CME P;  1SFC B;  1HGZ A;  3EFF K;  4YTP C;  1SQP G;  2NPS D;  5TIS H;  3CWB G;  3TYY A;  3IFM A;  2HOD A;  1KFN A;  2OTJ P;  1P84 H;  1VF5 B;  1NGM B;  1HJ0 A;  3PP5 A;  4KHX A;  2YFL A;  3CD6 P;  1LTA C;  2ZYD A;  3A0H H;  1L0L K;  3TGU J;  1T6A A;  3U59 A;  4I2L C;  3RL0 D;  3QH9 A;  2O01 N;  4HM2 A;  4C46 A;  1KQL A;  3L75 G;  3PH0 A;  2G8Y A;  2QJP C;  1N7S A;  2W6A A;  1LTS C;  4N6J A;  1KD1 Q;  1RF1 B;  1YYC A;  1DIP A;  3H1L G;  2MKV A;  1KIL B;  1GD2 E;  2WQY C;  3VN0 A;  3L74 G;  3VYI A;  2FYN B;  1GL2 A;  1IFI A;  2B89 A;  1N7S C;  2GUV A;  5CHX A;  1KIL D;  3I56 P;  1QGK B;  1PFI A;  4RES B;  1J1E C;  2N9Y B;  3A0B H;  1FOS E;  4ZKP A;  1YIT P;  1O7M A;  1RQV A;  2HFE D;  3D71 A;  5KJ7 A;  1BSH A;  4UB8 H;  5TIS E;  1GL2 C;  3GOB A;  3Q5R A;  4C7N B;  1IC2 A;  1BCC D;  3AE2 C;  1P84 E;  3A5T A;  1HH0 A;  2E75 D;  5AW1 B;  2A45 H;  3KHU A;  4H13 B;  3TGU E;  2P1J A;  2XNX A;  2A06 E;  2OYH A;  1JNM A;  3H1K J;  5KJ7 C;  5APW A;  1X8Y A;  5AW8 B;  3WU2 H;  2W8Z A;  3L73 D;  2IBZ E;  3RK3 B;  1FZB A;  2OYI A;  2Q6Q A;  3TNU B;  2QJK B;  3MD0 A;  3RL0 C;  3B4S A;  4GKG A;  1ZV8 A;  4C7R A;  1N73 B;  1PGP A;  2JEE A;  1S9K D;  2YMY A;  2OYH C;  3D6Y A;  1L4A B;  4D6T J;  1Y8A A;  1FDI A;  1SQX K;  3S9O A;  2Q3W A;  3V5B A;  3L70 G;  3P8M C;  1UIX A;  2JO1 A;  1VQL P;  2OYI C;  1FU1 A;  1ZRT E;  3B71 A;  1BGY G;  4JYB A;  2HMK A;  4Z1M H;  3OAK A;  1KFM A;  2BEQ D;  3CX5 D;  1S2E A;  1KQS O;  2LXC B;  1NTZ D;  2NVE A;  1M7L A;  1L0N D;  1OFC X;  4UB8 E;  1PPJ G;  1VL2 A;  5L8R J;  3AE9 C;  2E76 D;  3G4S P;  4U3F G;  4BRY B;  2IDB A;  1ZN5 A;  3H1J D;  5C39 A;  1SLQ A;  3GCE A;  4JYC A;  1NH4 A;  3H1K E;  4NB9 D;  3JSV C;  3P8C D;  2KI7 B;  1NVO A;  1JB0 J;  3NTN A;  3TDK A;  2WMM A;  1NTM G;  1P84 I;  1KYO H;  2H89 C;  1H8A A;  1SQQ K;  4I7Z B;  1VQ7 P;  1W5C E;  4NB8 D;  1OW8 A;  5APT A;  2OGU A;  2JP3 A;  2AXC A;  5AVQ B;  1SQX J;  4D6T E;  2QG4 A;  2RKL A;  2FFD A;  3E1R A;  3NMD A;  2IBZ I;  3C1L A;  4HM5 A;  3F5H A;  1SQP D;  3KDP B;  3CWB D;  1N86 A;  4XE5 B;  4NPD A;  1AVO A;  4A7P A;  2XRX A;  4ASV A;  1GTW A;  3A3Y B;  2P2U A;  3MGN A;  2FFD C;  2YO3 A;  2FYZ A;  4HKZ H;  3CCE P;  1J1D B;  3L75 D;  1VQO P;  2J5U A;  1QL2 A;  2I1J A;  3H6P A;  4N78 E;  5CCH A;  5AVU B;  1G1J A;  3GZX A;  2N1T B;  1SQB G;  1T3U A;  3H1L D;  2WT7 A;  3L35 A;  3DQY A;  1SQQ J;  3VMG D;  2YFI A;  3L74 D;  1KYO E;  3P7K A;  1IFP A;  3L72 G;  3L36 A;  1DH3 A;  1IFM A;  5AVX B;  2P10 A;  5B66 H;  2POH A;  4WB4 A;  2E74 D;  5CCH C;  1MFT A;  1S72 P;  5KAI E;  1SQX E;  1EDI A;  1NYH A;  1L2P A;  2OQQ A;  3V2N A;  1VQM P;  3BCC G;  1E79 H;  1URQ A;  4H0L D;  2H43 A;  2YO2 A;  2O01 H;  2O01 J;  4BXL A;  4OGQ B;  1S3J A;  2D2C C;  1KZU B;  2BCC G;  2R3C A;  1FZC A;  3RK2 C;  4HM7 A;  1YI2 P;  4H44 B;  1WQL A;  3VMH D;  4O9B A;  4PV1 C;  1YHQ P;  2KS1 B;  1YJW P;  3WUU A;  2P7J A;  1URQ C;  2JDI H;  1QEX A;  1KB9 D;  1LTB C;  1M8O B;  1Q90 D;  1PP9 G;  4WBA A;  4NPE A;  2ZAE B;  4I6M C;  1FZC C;  1YJ9 P;  5AEW A;  1USE A;  1EG9 A;  3MUD A;  3LW5 H;  3LW5 J;  1M1J A;  5CCG D;  1LT9 B;  2I1K A;  2C0W A;  1SQQ E;  5KLV G;  4QDD A;  4WY4 A;  1U7J A;  1YTZ I;  4RO0 A;  3TSI A;  2K37 A;  3BAT A;  2FYU G;  3PLN A;  4UB6 H;  5AVV B;  5B66 E;  3Q1M A;  3L70 D;  5GTI H;  2DE5 D;  3A2A A;  4Y28 J;  3GF3 A;  2GA1 A;  2ZT9 B;  3GG2 A;  4PD4 D;  3MUD C;  3L73 J;  1M1J C;  1H0T A;  1KTM A;  2KXP B;  2Y0C A;  2Y9Y A;  1O7W A;  3GF7 A;  1A02 J;  1KYO I;  4WY4 C;  5KKZ B;  1LTI C;  3EQQ A;  1PPJ D;  2NZ2 A;  1YJN P;  2B87 A;  4JQ0 D;  4U3F D;  3HUS A;  3CXH H;  1EZV G;  3AE8 C;  4EI2 A;  3V2P A;  2R5B A;  1AA0 A;  3HE4 B;  1VQ5 P;  1LP1 B;  1Q86 Q;  3G9R A;  2XSO A;  1CI6 B;  3W67 A;  1FZG A;  1JM0 A;  2W27 A;  3O8Z A;  1NHL A;  2Z4E A;  1E5W A;  1S1C X;  3MZW B;  2M3B A;  1L0N J;  1ZR2 A;  2SPZ A;  2PFX A;  1VQ6 P;  3HUS C;  1VQ4 P;  2FBW C;  1NTM D;  2M8R A;  1O7G A;  4IL6 X;  2QJP B;  2HOD B;  2YFJ A;  1AFO A;  1RE3 A;  3H1J J;  1NOH A;  1KMI Z;  2NVG A;  5AVS B;  5CBN A;  4PJ0 H;  2JWD A;  4WWI A;  3M0D A;  3U1C A;  2HG5 D;  2LXB A;  4GIF A;  1DD3 A;  2QEX P;  1BDC A;  4UB6 E;  4HM4 A;  1FJK A;  5GTI E;  1WMK A;  1GK4 A;  3HD7 A;  2ZYG A;  3BVH A;  1N7S B;  1RE3 C;  4TLF A;  4QDC A;  1GK6 A;  3ABV C;  2HPC A;  1JCD A;  2HMJ A;  1LTJ A;  3M0D C;  3VMA A;  1T2K D;  1FZF A;  3GW6 A;  5GTH H;  3CCR P;  3L71 E;  3CXH E;  2QSI A;  1GL2 B;  3H1I E;  3HD7 C;  2O3J A;  2Z5I A;  4L75 A;  2QPZ A;  1CSB A;  2WTY A;  4EOT A;  2M3E A;  1LTJ C;  3PJS K;  2GM4 A;  1RFS A;  2KK7 A;  1SQB D;  1M56 D;  1KOR A;  1O7P A;  1L0N E;  2ZXX A;  2LR2 A;  1RH5 B;  1IFJ A;  3L4F A;  2YKQ A;  1JO5 A;  1T8Z A;  5E79 H;  4LGD E;  1HJB A;  2NUK A;  2XV5 A;  4LC1 A;  1SFC D;  2H88 C;  3L72 D;  4HM8 A;  3H1J E;  2JO6 A;  3GMA A;  5EFW B;  2G3A A;  4PJ0 E;  1FJP A;  1EC5 A;  3NFQ A;  1A02 F;  3AE7 C;  1S4X A;  1VDF A;  2OYH B;  3PHL A;  1PV3 A;  1VQK P;  3BCC D;  1VF5 D;  1AVY A;  3H1L J;  2XU6 A;  1M90 Q;  2OYI B;  1VPC A;  2DE6 D;  2BCC D;  1AJY A;  3TGU G;  2Y0D A;  3SFE C;  3BAS A;  1N2D C;  1PGQ A;  2BMR A;  4LLH A;  3HE5 A;  4ASW A;  1NKZ B;  5M1B A;  2JR8 A;  3B5N A;  4IOI H;  2IBZ G;  2Q7C A;  1PP9 D;  3AEA C;  2XDJ A;  2NPS A;  2Q1K A;  3D70 A;  2ZXE B;  1OW7 A;  2PP6 A;  3RBX A;  5E79 E;  3CXH I;  3NXS A;  5KLV D;  3B5N C;  1EXJ A;  3I55 P;  3GTE A;  3H1H G;  4L74 A;  3USS A;  2GUS A;  3VMX A;  3E1I A;  2V7Q H;  2V7Q J;  5TJH A;  3I5C A;  2FYU D;  3A0H E;  2NPS C;  3TF5 A;  2QJY C;  1JY2 N;  1GW4 A;  2Q5U A;  3H32 B;  4GOD A;  1W2B O;  1QVF O;  1NTM K;  2AEF A;  3H1L E;  3R2P A;  4H13 D;  4QCK A;  2KLU A;  2NVF A;  2XKM A;  3KPE A;  3ZDM A;  4HH2 A;  1L0L G;  5CXM A;  1EZV D;  3MP7 B;  3MHV A;  3V4W A;  3H1K G;  2LKM A;  2YXQ B;  4L76 A;  3L70 J;  1G8J B;  2UWJ E;  3RK3 D;  1QL1 A;  5BU8 B;  4PD4 H;  3GL0 A;  1KIL A;  3RBZ A;  1BGY J;  2O1K A;  1R5L A;  2WWW A;  1JTH A;  2FFD B;  2PAJ A;  1K73 Q;  1G1I A;  3A0B E;  1L4A D;  1MV8 A;  4NPF X;  1KV4 A;  4U3F J;  3V2Q A;  1K8A Q;  2K9J A;  1USD A;  1MUU A;  1KQG B;  1OW6 A;  3H25 A;  1J2J B;  1KIL C;  3AEB C;  1N7L A;  1RIE A;  1WRG A;  3Q2Y A;  3UIA A;  2BMQ A;  2E43 A;  1GZL A;  4L73 A;  4JF7 A;  3EFG A;  1NTM J;  3CMA P;  1S5L H;  3WU2 E;  1G8K B;  2YNY A;  2E75 C;  2XZR A;  2WT7 B;  1OWA A;  1MKM A;  4DOJ A;  4HYT B;  3SWK A;  2OAR A;  2W83 C;  2HMM A;  2JJL A;  4NBB D;  1N8R Q;  3CI9 A;  2D2C B;  1HVV A;  3L70 E;  3RK2 B;  1BE3 J;  4PD4 E;  2HML A;  1BGY E;  2QE7 H;  3EWK A;  1RQU A;  1GMJ A;  3KXD A;  4PV1 B;  1PIX A;  1OMI A;  1URQ B;  1JUN A;  2E4P A;  1SQV G;  2NUM A;  2IYP A;  1W2E A;  4DJG A;  4EIJ A;  1IK7 A;  4U3F E;  2H7H A;  1SQX G;  3A7O A;  2QJK C;  1FZC B;  3Q5S A;  1K9M Q;  2XSH A;  1ZLL A;  3GHG A;  1NU1 G;  2DE7 D;  1ZME C;  4AIV A;  2IYO A;  3D89 A;  1IZN B;  3VTP C;  1SQB J;  2BMO A;  2KOG A;  1G2C A;  2WPQ A;  2E76 C;  1QX8 A;  2C0X A;  2B88 A;  2KNC A;  4W7Y A;  3CC2 P;  5AVZ B;  1NTM E;  4M3L A;  2Q9I A;  4B86 A;  1S5L E;  3L72 J;  1ZOY C;  3GB4 A;  1M1J B;  3C9I A;  5AVR B;  3TGU D;  3AEE C;  3GHG C;  4NBH D;  3RL0 g;  1SP4 A;  2FY8 A;  2FYU K;  2A45 I;  2KZI A;  4WY4 B;  2N1T D;  2QVA A;  1IFN A;  2C9L Y;  2IBZ D;  3BCC J;  3LIE A;  2DW3 A;  1BE3 E;  3CCJ P;  2GBX A;  1Z56 A;  2AXT H;  2RH0 A;  1SQQ G;  1H0T B;  1FDO A;  1RY3 A;  4KJM A;  2BCC J;  3KYQ A;  4DT0 A;  3AED C;  2ZVO B;  3G6E P;  2B87 B;  2QRX A;  3H1H D;  3HUS B;  1LWU A;  1ZRT D;  4PD4 I;  2YIU C;  2L5G B;  4OGQ D;  2WSF H;  2WSF J;  2WIT A;  3N0Q A;  1NTK G;  3CCL P;  5APV A;  4K35 A;  1SQB E;  1VM9 A;  1NTZ K;  3CCS P;  4H44 D;  1L0N K; 
#chains in the Genus database with same CATH homology
 3DQY A;  1NDO A;  2HMJ A;  2FYU E;  2DE5 D;  2I7F A;  2DE7 D;  3VMG D;  2CKF A;  4AIV A;  2YFI A;  4HKV A;  3H1K E;  4HM1 A;  1NU1 E;  1KYO E;  2YVJ B;  4NB9 D;  3D89 A;  2XR8 A;  1P84 E;  3C0D A;  2D2C D;  1PPJ E;  2E75 D;  4HM6 A;  3L72 E;  4QDF A;  1SJG A;  3L71 E;  3CXH E;  1O7W A;  2BMO A;  2E74 D;  5KLV E;  3H1I E;  3TGU E;  3GTS A;  4NBC D;  2A06 E;  4HM0 A;  3L73 E;  3EQQ A;  1SQX E;  4PV1 D;  2QPZ A;  1NTM E;  1FQT A;  1RIE A;  3FOU A;  3VCA A;  2YFL A;  2BMQ A;  2E4Q A;  3GB4 A;  4AAY B;  2GBW A;  4NB8 D;  1ULJ A;  4H0L D;  4NBH D;  1EZV E;  2IBZ E;  1RFS A;  3GTE A;  3H1H E;  4D6T E;  1O7P A;  4HM2 A;  4P1B H;  1L0N E;  1SQP E;  3GKE A;  2JZA A;  3EN1 A;  3CWB E;  1G8K B;  2NUK A;  2XSO A;  1O7H A;  2FYN C;  2QJP C;  2QJY C;  4HM7 A;  4HM5 A;  1BE3 E;  1UUV A;  1KB9 E;  4HM8 A;  4NBE D;  1JM1 A;  1WQL A;  3H1J E;  2GBX A;  4NBG D;  2ZT9 D;  2JO6 A;  3VMH D;  2HMM A;  4NBF D;  4NBB D;  2Q3W A;  3BCC E;  4QDF B;  3CX5 E;  3H1L E;  5HL4 A;  2B24 A;  2XRX A;  1NTZ E;  1O7G A;  4H13 D;  3L70 E;  4QCK A;  1ZRT E;  4NBD D;  2NVF A;  2NWF A;  2YFJ A;  3L75 E;  5KLI C;  4PD4 E;  2HML A;  4QUR A;  2HMK A;  5CXM A;  2NVG A;  4HM3 A;  1L0L E;  1VF5 D;  1BGY E;  2BCC E;  4QUP A;  3VMI D;  5BOK A;  4P1C H;  2NVE A;  5AEW A;  4QUQ A;  1ULI A;  1EG9 A;  3VCP A;  1G8J B;  2E4P A;  5AEU A;  2YIU C;  3AZC A;  1SQV E;  2NUM A;  3GL0 A;  4EMJ B;  1O7N A;  2E76 D;  1NYK A;  2DE6 D;  4OGQ D;  4HM4 A;  1SQQ E;  2HMO A;  3GL2 A;  4HJL A;  1UUW A;  4U3F E;  3GZY A;  4QDD A;  1VCK A;  4NBA D;  3GZX A;  3N0Q A;  1O7M A;  3L74 E;  1BCC E;  2QJK C;  2ZYL A;  1NTK E;  2BMR A;  2HMN A;  2XSH A;  1SQB E;  1VM9 A;  1PP9 E;  4QDC A;  2B1X A;  3GCE A;  4H44 D;  1Q90 C;  5KKZ C;  3GOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...