1SQBE

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1sqbE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1sqbE02
3H1HE 4QURA 1SQVE 4QCKA 3GTEA 2B24A 4AIVA 2ZT9D 2QJPC 5AEUA 3EN1A 2XR8A 4HM0A 2BMQA 3AZCA 2DE6D 2XSOA 2NVGA 4P1CH 5KLVE 3H1IE 2HMNA 1O7GA 1G8KB 3GL2A 4H0LD 3BCCE 2GBXA 4HM6A 2XRXA 2BCCE 4NBAD 1BE3E 3H1JE 2FYUE 2DE5D 2HMKA 4NB9D 4NBDD 5BOKA 1SQQE 4PV1D 1NYKA 2FYNC 2A06E 1NTKE 2QJKC 3N0QA 2NVFA 4H13D 4NBHD 4NBED 4OGQD 4NBBD 5KLIC 4NBCD 4QDFB 4HM4A 3L75E 4HKVA 2YFIA 1BCCE 1O7MA 3GB4A 4QDFA 1O7HA 2NUKA 4EMJB 4HJLA 1L0NE 2YVJB 3GCEA 1G8JB 2BMRA 1ZRTE 2HMLA 3C0DA 3DQYA 2I7FA 1NTME 2NWFA 2E74D 2NVEA 1EZVE 4HM8A 1WQLA 1PPJE 3H1LE 2GBWA 4QUQA 1Q90C 4HM2A 1SQXE 1P84E 3GL0A 4D6TE 1PP9E 1EG9A 1NTZE 1SQPE 1RFSA 3CXHE 2E75D 2YIUC 3GZYA 1UUWA 1RIEA 1NDOA 3GKEA 3L74E 1O7NA 3VCAA 3TGUE 1VF5D 2CKFA 1ULJA 2E4PA 1KB9E 1FQTA 1SJGA 3H1KE 3VCPA 1BGYE 4HM5A 1NU1E 4NBFD 5AEWA 2HMOA 3L71E 1VM9A 2IBZE 3FOUA 4QUPA 2HMJA 3L70E 2E4QA 2JO6A 1JM1A 4NBGD 3VMGD 1O7PA 1SQBE 4NB8D 4P1BH 1KYOE 2XSHA 2YFJA 1L0LE 3L73E 3GOBA 2HMMA 5KKZC 4QDCA 1ULIA 1O7WA 3VMID 2YFLA 3GTSA 2JZAA 4H44D 5CXMA 4HM1A 2QPZA 4QDDA 2ZYLA 3GZXA 2BMOA 4PD4E 2NUMA 4HM7A 2D2CD 3D89A 4U3FE 2DE7D 4HM3A 5HL4A 2B1XA 1VCKA 3EQQA 3L72E 1UUVA 2Q3WA 3CX5E 3VMHD 4AAYB 2E76D 2QJYC 3CWBE
chains in the Genus database with same CATH superfamily
2OYOA 4AIVA 4HKZH 1NTMG 4ZMDA 4GODA 4EYYQ 3S1KA 3RBZA 1VQ8P 3CCLP 3F89A 1L0NG 3SWKA 1SQVD 3A3YB 2QIWA 3F5HA 3AE6C 1AQ5A 3OJAB 1OW7A 3CX5I 2KZIA 3M9HA 1E79H 1R5SA 1ZRTE 1SFCA 4I6MC 1KQFB 2M3EA 3WU2E 1PPJE 5GTIE 2HFED 2M3BA 1LTJC 2FYZA 1KILE 1PP9E 3RL0B 2BASA 3A0BH 1Q81Q 2WSCJ 3GG2A 2AEFA 1O7NA 1ZP0C 1M1KQ 1GD2E 1SQQG 2QSIA 2Q9IA 1BGYG 1VQOP 2B9BA 1OWAA 1RF0A 1M1JC 3KXDA 3GF3A 3P8CE 3H1HD 1VQMP 2JO6A 1H0TB 1RE4A 1Y47A 2HMMA 2Q6QA 3PRJA 1LWUC 2FYUJ 3L36A 5B66E 1KYOH 3B5NA 4PD4E 2MKVA 2MJZA 4NPEA 2FXMA 1PFIA 5KAIH 1JEKA 1L4AD 2E74C 4H0LB 3RL0g 2YO2A 3L72E 2LR2A 1DH3A 2DW3A 3H1LD 1KMIZ 2W6JH 2KOGA 2HMNA 3JSVC 1N73B 3PH0A 1W2BO 1FZAA 5KTBA 1WRGA 3V2NA 1N7SC 1IFNA 1S9KD 1NYKA 5KAFH 3AE4C 4KHXA 5AVZB 4WWIA 4JYCA 2WPQA 2HMLA 3JCUE 3C0DA 2IBZD 2IFNA 1IK9A 3H1LE 1N2DC 4JPZB 1KB9D 1DD3A 3GHGB 3ITKA 2V7QH 4ZNCA 1LTIC 3GF7A 2CK3H 2Q3EA 3CC7P 3L74E 2BEZF 3FWNA 1FC2C 3CC4P 1VF5D 2M5AA 1RE3C 5KAFE 2N9YB 1RF1A 1JY2O 1BCCJ 1TU3F 2IBZE 1QVGO 5CCGC 1CI6B 4P1BH 1KYOE 2FXPA 2YFJA 3GOBA 3L72J 1RF1C 1JM0A 3VMID 1RE3A 3P8CD 4QDDA 2D2CD 2R5BA 5H2FE 3CWBJ 3CPWO 1D7MA 1OZHA 2C9NY 3WUVA 2OTLP 2Q3WA 1SQXG 1NTZD 4YPCA 1T3UA 1PGOA 1SQVE 1QL2A 5AW5B 4HM0A 1OVUA 2V7QJ 1KC8Q 5AW2B 1QL1A 4UB8E 3CXHH 4LLHA 4HM6A 5KJ7A 1NU1J 2B89A 5CHXA 4NB9D 1LT9C 3IR9A 2WPSA 3Q5RA 1HBWA 4NBHD 3PLNA 2IYPA 1XTCC 3L75E 1GU5A 4HKVA 1URQC 1UIXA 4QDFA 3PJSK 3H1KG 1JMBA 2XZRA 2K3RA 3RK2D 4Z1MH 2E74D 4OGQB 3UIAA 3CCMP 1VQ5P 1KB9I 1SQVK 1U57A 3VMZA 3ZDMA 1BSNA 3S9OA 3VTPC 2IBZI 3H1IG 2ZJSE 2KK7A 2YXQB 3TNUA 1P84H 3D6ZA 2E4PA 5KAIE 4OH8B 1BGYE 4HM5A 3FGAD 3L71E 1IFMA 2W83C 4PD4H 2WSCH 1FZCC 3V2RA 1GZLA 2CPSA 1KYOD 2E4QA 5CJ0A 3VMGD 1M1JA 2K9JA 1G2CA 1SQQK 1NTKK 2KSJA 3HE5B 4U7JA 1J1EB 5APYA 2M8RA 5KLVD 2Y9ZA 3CXHD 2Y0DA 2C9LY 4I2LC 3FX0A 1ZRTD 4UB6H 3CMAP 3H6PA 3NXSA 3U59A 3Q5SA 1SS1A 2CPBA 5CCGD 1O7GA 1L4AB 3M9QA 2QE7H 2POHA 1SQQE 2Y0EA 1KFNA 4OGQD 2NVFA 1S5LH 5CMZA 3AEDC 3KZIE 4C7NA 4IFDK 3R4YA 4U3FJ 1GK4A 4HJLA 5CCGA 3C8VA 1L4AA 3OA7A 3L74D 3G3ZA 3USSA 2N1TC 2OYHB 4W7ZA 2XDJA 1H89A 1OW8A 2QJYB 1FZEA 4WY4C 1RFSA 1SQQD 1NDOA 1N7SB 5B5EE 1H88A 2J5UA 1IO4A 1HJ0A 2RN0A 3VMYA 3CCSP 5KLVK 1X0TA 1LP1B 3CWBD 3HRNA 1X79B 1JM1A 1FBMA 2H8PD 1GW3A 4A7PA 1H0TA 1S4XA 1N7SD 2GUVA 4PV1C 2YFLA 1S5LE 1EXJA 2WSEJ 2BMOA 3L72G 4U3FE 2A45I 1EDIA 1FJKA 5APUA 3B71A 3B8EB 3AEAC 1VQKP 2IZ0A 2KXPB 5E79H 2B24A 3VP8A 1SQPJ 4C7RA 5AEUA 1EDJA 1GL2A 1OFCX 4P1CH 5KLVE 2C0XA 1CW5A 3BCCJ 2Q7CA 2XRXA 4TLFA 3CCJP 3L73D 3Q3DA 2PAJA 1NTZK 5GTHE 4OVNF 5APQA 4YTPC 1OMIA 3L70G 1GL2C 1NGMB 1LJ2A 5AVVB 3H1JG 1KTMA 2WZ7A 1P84E 3A5TA 2QEXP 2HODA 2QRXA 4U3FG 2JDIH 3MZWB 2YIUC 3MD0A 1NYHA 1FU1A 3H1ID 1AJYA 4GOEA 4I7ZC 3E1RA 3KYQA 3LW5J 2KI7B 1URQA 1W5CE 3H1HJ 3PTZA 3P8MC 3C9IA 1SFCC 3BCCD 1M8OB 4H44B 1NJIQ 5EFWB 4NBGD 1KORA 1P84D 3MHVA 4RO0A 2XSHA 1RH5B 2PRRA 1NKNA 1SQPG 1ZN5A 2V4HA 3IF4A 5BU5A 2A45H 3RL0C 3HD7C 2G8YA 3LIDA 2H88C 3H32A 3VOPA 3N7NA 4IL6H 3RK2C 1CI6A 1UUVA 1KFMA 1ZXGA 1JY3O 3MUDA 1YIJP 3CWBE 4XA4A 1NTKD 3EN1A 1MFTA 1HUCA 1OXZA 3AEBC 4YXDC 1J1EC 2I1JA 1GL2B 1VQLP 1RQUA 3AEGC 4NBAD 1EDKA 4PV1D 2QJKC 2R3SA 4H13D 4NBBD 2OYIC 2ZYGA 1FOSF 2YIUB 1VPCA 1M7LA 3DQYA 2KLVA 3WUTA 1BE3D 1WQLA 1T8ZA 1Q86Q 3BCCG 1AQTA 4D6TE 4H13B 1G1IA 1SQPE 2WPVB 2I1KA 1M1JB 1IFJA 3L35A 2K37A 3M0DC 5CJ4A 3VCPA 2WTYA 2HLOA 2NPSB 1IK7A 3N4XA 2WITA 3KQGA 2XU6A 3FOUA 1DX7A 5AVXB 4DJGA 3K5BA 2WSEH 1USEA 2W90A 1YHQP 1DIPA 4PD4D 1S72P 1JB0J 1PPJG 2OQQA 3L71J 3V2PA 2NUMA 5KLVJ 3MP7B 1VQ7P 3L72D 1VQNP 2P58A 2GA1A 5KKZB 3M0DA 3EQQA 1Q7YQ 1K04A 1IJDB 2KYVA 3WUUA 1MUUA 2Q3IA 2KS1A 1MKMA 3HE5A 2Y0CA 3ABVC 4GKGA 1SFCD 2AXTE 2R44A 2NVGA 2H43A 1S3JA 5KJ7D 2UWJE 2BCCE 4DOJA 2FYUE 3VP9A 2WSFH 1EZVG 1X22A 1JTHA 2YVJB 4WBAA 3H1JD 1ZLLA 4CPGA 2GBWA 1R5LA 5C39A 3VMAA 1SQXE 2ZT9C 1W2EA 1HGZA 5AVYB 3EFFK 1NHLA 5CCHC 3GKEA 1KILA 2H7HA 3JCUH 4N78D 2QJPB 3TNUB 3M9BA 2QM8A 4RESB 3H1LJ 2NPSA 2JEEA 4W7YA 3L70E 1FDIA 1LP1A 1PGJA 2FFDC 1O7PA 3IN6A 1OX3A 3P32A 3D6YA 2YMKA 1G2CB 1ULIA 3L37A 2NZ2A 2IYOA 3P7KA 2W6BA 2BCCG 4PJ0H 3GZXA 1RY3A 2OGUA 1LT1A 3VYIA 2Y9YA 1HF9A 3O6QB 5B66H 1S9KE 4QCKA 3A7OA 3JC22 1K8AQ 2YO3A 2K1AA 2JO1A 4AYCA 1EDLA 3TGUJ 3L75D 1GK6A 1KB9H 1AV1A 3SFEC 1O7MA 4Y99B 2D2CC 2XNXA 3FXEA 2BMRA 2ITAA 2SPZA 1BCCG 2IBZG 1WMKA 3V6IA 4GIFA 4HM8A 1T3JA 1N7LA 2J59M 4EI2A 4NPFX 2IZ1A 1EG9A 1NTZE 1JY3N 3L73G 5AVSB 4BRYB 2YKOA 3L70J 3M06A 3A0HH 1N8RQ 1YTZI 1LWUA 1G1JA 1KQSO 2FYNB 4N3YB 2P1JA 2OTJP 2H89C 3CCUP 4MN4C 2QM7A 1SQBE 4NB8D 1L0LE 3GMAA 1RF1B 4H13C 3G4SP 4WB4A 1Q2NA 2NPSC 1IZNB 1N86A 5CCHD 2DE7D 4IOIH 2B1XA 1VCKA 4AAYB 2HPCB 4LGDE 2QJYC 1VQ9P 2FXOA 3KHUA 1EZVI 5AVRB 3SFDC 1ZW0A 5DJUB 1NH4A 1G8KB 3H1JE 2ZYDA 3GW6A 2ZXEB 3Q5PA 3N0QA 3D71A 1ZOYC 2WWWA 1OVVA 5AVWB 2O01H 1FS0E 3CCRP 2E42A 1G8JB 4C46A 3CL3D 4ASVA 1NAYA 2JWDA 3M91A 3FXDA 3GL0A 2WPRA 1FJPA 1FDOA 3V4WA 3CC2P 4H0LC 3H1HG 3L71G 3VCAA 3SWYA 2WSFJ 2N9BA 1A02J 2PP6A 1VM9A 4WVZA 2P67A 1LWUB 1FZFA 3GHGA 2K9YA 4Y99C 4XFJA 2HMJA 2KIKA 2N1TD 4EIJA 2ZT9B 4D6TJ 2AXTH 2W8ZA 1KQLA 3CI9A 3TGUD 4HM7A 3KDPB 4JF7A 5TISE 4XE5B 3O6QA 5APSA 3HUSC 2IX7C 2O1JA 1WT6A 4QURA 1YJNP 1PIXA 4C7NB 1YJ9P 1FZBA 3RK3C 1JTHB 2KNCB 1LNQA 2JKVA 1S5LX 2GBXA 2WQYC 2HMKA 5APWA 1NTKG 1Z56A 2QVAA 4NBED 3L75J 4H44C 3GHGC 1EQ7A 4AQRD 1YJWP 3RGUA 1L0NE 1QX8A 1X8YA 2I7FA 3CX5H 3BATA 4M3LA 2FYUK 1YQ3C 1Q90C 1ZR2A 3RK2B 2XNDH 3CXHE 1LTJA 1EZVD 1LTJB 3BRVB 2HG5D 3H1KJ 4JBZA 1N73C 2N1TA 1LTTC 3AE9C 2BEQD 5AW1B 4QUPA 2W6AA 4RKUJ 4RJTA 3AEFC 2G3AA 1J1DC 2R5DA 2A06D 4UB8H 5BU8B 2K9JB 3AECC 4KJMA 1E5WA 4ASWA 5APVA 1L0NJ 2LXBA 3T97A 4IFFA 2L91A 1N73A 5AW4B 3AE2C 1SQXK 3NTNA 2KUBA 1LT9B 2L5GB 1NTMD 2J58A 3H25A 5H2FH 5AVTB 2BMQA 1HJBA 1JY2N 4HB1A 1KQGB 1JY3P 3M0AA 1Y8AA 5BOKA 5L8RJ 1SQQJ 3LIEA 3AE1C 3RL0D 5M1BA 2HODB 3U1CA 4QMAA 2E75B 1BCCE 1FZGA 1JY2P 2P2UA 2RH0A 3OAKA 2XKMA 1NTME 2NWFA 1KD1Q 1FDMA 1DD4A 3QH9A 2Z5IA 3E7KA 3C1LA 2K88A 4U3FD 2NPSD 1JNMA 3GZYA 4EDFA 5K5GB 1U7JA 1AVOA 4JQ0D 1ULJA 3L71D 2HR3A 2ZXXA 3CWBG 2PGDA 3R2PA 2AXCA 4L75A 4TT3H 5CBOA 4HJGH 1SQXD 1LGHB 1NTMK 3CCEP 2HPCA 5KKZC 1Q90D 1NTZJ 1FZCB 3NMDA 1IFPA 3TGUG 5CXMA 2IFMA 5AW9B 3QWOC 3G6EP 4N78E 4L76A 5AW3B 4HM3A 3U1AA 5HL4A 3HTKB 1VF5C 4L73A 1GL2D 3CX5E 4BWNA 3CLQA 4K3AA 4IL6E 4KT0J 5KLVG 3GLMA 3H1IE 3BCCE 1J1DB 4B86A 1YQ4C 1BE3E 2WT7B 1CSBA 3MTUE 3RBXA 1J2JB 1RQVA 3I5CA 2WT7A 4QDFB 4HM4A 2YFIA 4D6TD 3TK1A 3GB4A 2NUKA 4IFMA 1SQBK 3GCEA 1NTMJ 5AVUB 1EZVE 3L75G 1CZQA 1KILC 1SP4A 3KZIH 4W80A 4LC1A 4HM2A 4WY4A 4DT0A 3TYYA 3TDKA 2IDBA 1AA0A 3A0BE 2E75D 2I8DA 4BRYA 1FAVA 3TGUE 1MV8A 1L4AC 3AE7C 5AEWA 2M5AB 4HYTB 2ZAEB 2FYUD 1U7MA 3RK3D 3HD7B 2FKWB 1DEBA 1MZ9A 2YNYA 4N6JA 1DEEG 3SWFA 1T2KD 1BSHA 2B88A 2KS1B 5BVZA 1GU4A 4DZOA 1O7WA 1BGYJ 3I55P 1FZCA 3VN0A 2WSSH 3H1IJ 1K73Q 3HE4B 1JUNA 1LTAC 1BE3J 1SQPD 4IL6X 3AE3C 1SQBD 3AZCA 2XSOA 1BCCD 4YXWH 4PJ0E 3IAOA 4I7ZB 1AVYA 3GL2A 4EOTA 2VRSA 3L70D 2NRGA 1KV4A 2DE5D 4NBDD 1QGKB 3B5ND 4EMJB 2KZJA 3SSUA 1GDTA 1S1CX 4K35A 3IFMA 2JJLA 1JMMA 1RF0C 4L74A 3V5BA 4DCKA 5TJHA 3CMEP 2RKLA 4GDOA 2E76C 2Z5HA 2JR8A 1SQVJ 4QUQA 1USDA 5GTIH 1AFOA 1FOSE 5AW6B 2B87A 1Q82Q 3TSIA 5APXA 3BVHA 4R4LA 1UIIA 2PFXA 1PP9G 2N1TB 2OYHC 1NWQA 1SJGA 3H1KE 3S4RA 2HMOA 3WU2H 4UB6E 1BDCA 1ZMEC 2D2CB 2ZVOB 3L74J 2GUSA 1L2PA 2XV5A 2FFDB 2KP8A 3D70A 2QJKB 1BGYD 1KILB 1M90Q 5KJ7C 2E43A 1QVFO 4BXLA 1YBKA 3FWLA 1ZV8A 3GTSA 3AE8C 2JZAA 1K05A 4HM1A 1L0NK 4WY4D 3T97B 2KLUA 3Q1MA 3BASA 3D89A 3RK3B 1SQBJ 2AEJA 3EFGA 1JO5A 1NOHA 1NTZG 1IFDA 3VMHD 2BCCJ 3MUDC 2O3JA 2ZT9D 2XR8A 1OIPA 1JOCA 5APTA 1OW6A 1SQBG 3L73J 1NU1K 1KZUB 1HWTC 1PGQA 5CBNA 3EWKA 4Y28J 1HTLC 3L74G 1N7SA 2R32A 3II6A 5DJTB 2WVRA 5GTHH 3TF5A 1HGVA 1JCDA 2OYHA 3V2QA 4HH2A 4O9BA 4JYBA 1GTWA 2JWAA 2YKQA 2HYNA 3LW5H 4ZKUA 2KB7P 3HUSA 1M57D 2R3CA 1FQTA 1NU1E 4NBFD 2FYUG 3PHLA 1PP9D 2WMMA 3B5NC 1YTZT 3CCQP 1SLQA 2O1KA 4GT1A 1PPJD 2FY8A 4OWFA 1RE4C 2O01N 3HUSB 1VQPP 3OW2O 3H1LG 1A02F 4PV1B 4OGQC 3B5NB 3G71P 2ZYLA 2ZFCA 2Q5UA 1VDFA 1NU1D 2LKMA 1QEXA 1EC5A 3KPEA 3AEEC 3HTKA 1KILD 4PD4I 3H1HE 1IC2A 1JCCA 1LTGC 1Y9BA 4I1LA 3BRTB 2DE6D 3MIWA 1NO4A 2E75C 3H32B 2M0BA 3RK3E 2Q1KA 1M56D 3W68A 1S2EA 1NVOA 1RHZB 1HVVA 1L0LD 1HH0A 1SQVG 1LT9A 1SQXJ 2OYIB 2FBWC 2OYIA 1O7HA 1SQPK 2QG4A 1OVRA 1T2KC 1L0LJ 5TISH 1URQB 1BDDA 5CCHA 3L4FA 5AVQB 2CKFA 1FE6A 3PP5A 2OARA 4R4MA 2O01J 3CXHI 3O8ZA 3B4SA 4GOFA 4WY4B 3HD7A 1YI2P 1YYCA 1PGPA 1T6AA 1PL5A 2ZVNB 1NKZB 3EQ2A 3L73E 4QDCA 1YITP 1PP9J 1X9VA 2QPZA 2KNCA 5AW7B 1KYOI 3Q2YA 1LTBC 3CX5D 2YMYA 1L0LK 2KSEA 3A2AA 2E76D 3H1JJ 3CCVP 1NTKJ 3H1KD 3GTEA 2QJPC 2Z4EA 5B5EH 1SVFA 1P84I 1L0ND 4H0LD 3HE4A 1QLED 2YKPA 2A45G 2FYNC 2A06E 1NTKE 5KLIC 4NBCD 2P7JA 1MFZA 1H8AA 2AEMA 1L0LG 3AE5C 1SFCB 1ZR4A 1R8EA 2IPPA 2NVEA 3MGNA 1BE3G 1VQ4P 5AW8B 2B87B 4D6TG 1GMJA 2RMZA 5KLIB 3HD7D 3VMXA 3A0HE 4AUWA 2P10A 1K9MQ 1UUWA 1XTGB 1RIEA 3G9RA 3NFQA 3W67A 1PV3A 5AW0B 2E74B 1KB9E 2E76B 2BCCD 1PZQA 2ZYAA 2JP3A 1VL2A 1URQD 2QA4P 2YXRB 2GM4A 1IFIA 4NPDA 3V4QA 1GW4A 3I56P 1VQ6P 2C0WA 5E79E 2FFDA 1VF5B 2A06G 1LTSC 2E5YA 2E5TA 4H44D 1KN7A 2LXCB 1NU1G 3WMM0 1NAFA 2W27A 2OTKE 4ZKPA 3CD6P 3E1IA 1EXIA
chains in the Genus database with same CATH topology
3H1HE 4QURA 1SQVE 4QCKA 3GTEA 2B24A 4AIVA 2ZT9D 2QJPC 5AEUA 3EN1A 2XR8A 4HM0A 2BMQA 3AZCA 2DE6D 2XSOA 2NVGA 4P1CH 5KLVE 3H1IE 2HMNA 1O7GA 1G8KB 3GL2A 4H0LD 3BCCE 2GBXA 4HM6A 2XRXA 2BCCE 4NBAD 1BE3E 3H1JE 2FYUE 2DE5D 2HMKA 4NB9D 4NBDD 5BOKA 1SQQE 4PV1D 1NYKA 2FYNC 2A06E 1NTKE 2QJKC 3N0QA 2NVFA 4H13D 4NBHD 4NBED 4OGQD 4NBBD 5KLIC 4NBCD 4QDFB 4HM4A 3L75E 4HKVA 2YFIA 1BCCE 1O7MA 3GB4A 4QDFA 1O7HA 2NUKA 4EMJB 4HJLA 1L0NE 2YVJB 3GCEA 1G8JB 2BMRA 1ZRTE 2HMLA 3C0DA 3DQYA 2I7FA 1NTME 2NWFA 2E74D 2NVEA 1EZVE 4HM8A 1WQLA 1PPJE 3H1LE 2GBWA 4QUQA 1Q90C 4HM2A 1SQXE 1P84E 3GL0A 4D6TE 1PP9E 1EG9A 1NTZE 1SQPE 1RFSA 3CXHE 2E75D 2YIUC 3GZYA 1UUWA 1RIEA 1NDOA 3GKEA 3L74E 1O7NA 3VCAA 3TGUE 1VF5D 2CKFA 1ULJA 2E4PA 1KB9E 1FQTA 1SJGA 3H1KE 3VCPA 1BGYE 4HM5A 1NU1E 4NBFD 5AEWA 2HMOA 3L71E 1VM9A 2IBZE 3FOUA 4QUPA 2HMJA 3L70E 2E4QA 2JO6A 1JM1A 4NBGD 3VMGD 1O7PA 1SQBE 4NB8D 4P1BH 1KYOE 2XSHA 2YFJA 1L0LE 3L73E 3GOBA 2HMMA 5KKZC 4QDCA 1ULIA 1O7WA 3VMID 2YFLA 3GTSA 2JZAA 4H44D 5CXMA 4HM1A 2QPZA 4QDDA 2ZYLA 3GZXA 2BMOA 4PD4E 2NUMA 4HM7A 2D2CD 3D89A 4U3FE 2DE7D 4HM3A 5HL4A 2B1XA 1VCKA 3EQQA 3L72E 1UUVA 2Q3WA 3CX5E 3VMHD 4AAYB 2E76D 2QJYC 3CWBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H E;  4QUR A;  1SQV E;  4QCK A;  3GTE A;  2B24 A;  4AIV A;  2ZT9 D;  2QJP C;  5AEU A;  3EN1 A;  2XR8 A;  4HM0 A;  2BMQ A;  3AZC A;  2DE6 D;  2XSO A;  2NVG A;  4P1C H;  5KLV E;  3H1I E;  2HMN A;  1O7G A;  1G8K B;  3GL2 A;  4H0L D;  3BCC E;  2GBX A;  4HM6 A;  2XRX A;  2BCC E;  4NBA D;  1BE3 E;  3H1J E;  2FYU E;  2DE5 D;  2HMK A;  4NB9 D;  4NBD D;  5BOK A;  1SQQ E;  4PV1 D;  1NYK A;  2FYN C;  2A06 E;  1NTK E;  2QJK C;  3N0Q A;  2NVF A;  4H13 D;  4NBH D;  4NBE D;  4OGQ D;  4NBB D;  5KLI C;  4NBC D;  4QDF B;  4HM4 A;  3L75 E;  4HKV A;  2YFI A;  1BCC E;  1O7M A;  3GB4 A;  4QDF A;  1O7H A;  2NUK A;  4EMJ B;  4HJL A;  1L0N E;  2YVJ B;  3GCE A;  1G8J B;  2BMR A;  1ZRT E;  2HML A;  3C0D A;  3DQY A;  2I7F A;  1NTM E;  2NWF A;  2E74 D;  2NVE A;  1EZV E;  4HM8 A;  1WQL A;  1PPJ E;  3H1L E;  2GBW A;  4QUQ A;  1Q90 C;  4HM2 A;  1SQX E;  1P84 E;  3GL0 A;  4D6T E;  1PP9 E;  1EG9 A;  1NTZ E;  1SQP E;  1RFS A;  3CXH E;  2E75 D;  2YIU C;  3GZY A;  1UUW A;  1RIE A;  1NDO A;  3GKE A;  3L74 E;  1O7N A;  3VCA A;  3TGU E;  1VF5 D;  2CKF A;  1ULJ A;  2E4P A;  1KB9 E;  1FQT A;  1SJG A;  3H1K E;  3VCP A;  1BGY E;  4HM5 A;  1NU1 E;  4NBF D;  5AEW A;  2HMO A;  3L71 E;  1VM9 A;  2IBZ E;  3FOU A;  4QUP A;  2HMJ A;  3L70 E;  2E4Q A;  2JO6 A;  1JM1 A;  4NBG D;  3VMG D;  1O7P A;  1SQB E;  4NB8 D;  4P1B H;  1KYO E;  2XSH A;  2YFJ A;  1L0L E;  3L73 E;  3GOB A;  2HMM A;  5KKZ C;  4QDC A;  1ULI A;  1O7W A;  3VMI D;  2YFL A;  3GTS A;  2JZA A;  4H44 D;  5CXM A;  4HM1 A;  2QPZ A;  4QDD A;  2ZYL A;  3GZX A;  2BMO A;  4PD4 E;  2NUM A;  4HM7 A;  2D2C D;  3D89 A;  4U3F E;  2DE7 D;  4HM3 A;  5HL4 A;  2B1X A;  1VCK A;  3EQQ A;  3L72 E;  1UUV A;  2Q3W A;  3CX5 E;  3VMH D;  4AAY B;  2E76 D;  2QJY C;  3CWB E; 
#chains in the Genus database with same CATH topology
 2OYO A;  4AIV A;  4HKZ H;  1NTM G;  4ZMD A;  4GOD A;  4EYY Q;  3S1K A;  3RBZ A;  1VQ8 P;  3CCL P;  3F89 A;  1L0N G;  3SWK A;  1SQV D;  3A3Y B;  2QIW A;  3F5H A;  3AE6 C;  1AQ5 A;  3OJA B;  1OW7 A;  3CX5 I;  2KZI A;  3M9H A;  1E79 H;  1R5S A;  1ZRT E;  1SFC A;  4I6M C;  1KQF B;  2M3E A;  3WU2 E;  1PPJ E;  5GTI E;  2HFE D;  2M3B A;  1LTJ C;  2FYZ A;  1KIL E;  1PP9 E;  3RL0 B;  2BAS A;  3A0B H;  1Q81 Q;  2WSC J;  3GG2 A;  2AEF A;  1O7N A;  1ZP0 C;  1M1K Q;  1GD2 E;  1SQQ G;  2QSI A;  2Q9I A;  1BGY G;  1VQO P;  2B9B A;  1OWA A;  1RF0 A;  1M1J C;  3KXD A;  3GF3 A;  3P8C E;  3H1H D;  1VQM P;  2JO6 A;  1H0T B;  1RE4 A;  1Y47 A;  2HMM A;  2Q6Q A;  3PRJ A;  1LWU C;  2FYU J;  3L36 A;  5B66 E;  1KYO H;  3B5N A;  4PD4 E;  2MKV A;  2MJZ A;  4NPE A;  2FXM A;  1PFI A;  5KAI H;  1JEK A;  1L4A D;  2E74 C;  4H0L B;  3RL0 g;  2YO2 A;  3L72 E;  2LR2 A;  1DH3 A;  2DW3 A;  3H1L D;  1KMI Z;  2W6J H;  2KOG A;  2HMN A;  3JSV C;  1N73 B;  3PH0 A;  1W2B O;  1FZA A;  5KTB A;  1WRG A;  3V2N A;  1N7S C;  1IFN A;  1S9K D;  1NYK A;  5KAF H;  3AE4 C;  4KHX A;  5AVZ B;  4WWI A;  4JYC A;  2WPQ A;  2HML A;  3JCU E;  3C0D A;  2IBZ D;  2IFN A;  1IK9 A;  3H1L E;  1N2D C;  4JPZ B;  1KB9 D;  1DD3 A;  3GHG B;  3ITK A;  2V7Q H;  4ZNC A;  1LTI C;  3GF7 A;  2CK3 H;  2Q3E A;  3CC7 P;  3L74 E;  2BEZ F;  3FWN A;  1FC2 C;  3CC4 P;  1VF5 D;  2M5A A;  1RE3 C;  5KAF E;  2N9Y B;  1RF1 A;  1JY2 O;  1BCC J;  1TU3 F;  2IBZ E;  1QVG O;  5CCG C;  1CI6 B;  4P1B H;  1KYO E;  2FXP A;  2YFJ A;  3GOB A;  3L72 J;  1RF1 C;  1JM0 A;  3VMI D;  1RE3 A;  3P8C D;  4QDD A;  2D2C D;  2R5B A;  5H2F E;  3CWB J;  3CPW O;  1D7M A;  1OZH A;  2C9N Y;  3WUV A;  2OTL P;  2Q3W A;  1SQX G;  1NTZ D;  4YPC A;  1T3U A;  1PGO A;  1SQV E;  1QL2 A;  5AW5 B;  4HM0 A;  1OVU A;  2V7Q J;  1KC8 Q;  5AW2 B;  1QL1 A;  4UB8 E;  3CXH H;  4LLH A;  4HM6 A;  5KJ7 A;  1NU1 J;  2B89 A;  5CHX A;  4NB9 D;  1LT9 C;  3IR9 A;  2WPS A;  3Q5R A;  1HBW A;  4NBH D;  3PLN A;  2IYP A;  1XTC C;  3L75 E;  1GU5 A;  4HKV A;  1URQ C;  1UIX A;  4QDF A;  3PJS K;  3H1K G;  1JMB A;  2XZR A;  2K3R A;  3RK2 D;  4Z1M H;  2E74 D;  4OGQ B;  3UIA A;  3CCM P;  1VQ5 P;  1KB9 I;  1SQV K;  1U57 A;  3VMZ A;  3ZDM A;  1BSN A;  3S9O A;  3VTP C;  2IBZ I;  3H1I G;  2ZJS E;  2KK7 A;  2YXQ B;  3TNU A;  1P84 H;  3D6Z A;  2E4P A;  5KAI E;  4OH8 B;  1BGY E;  4HM5 A;  3FGA D;  3L71 E;  1IFM A;  2W83 C;  4PD4 H;  2WSC H;  1FZC C;  3V2R A;  1GZL A;  2CPS A;  1KYO D;  2E4Q A;  5CJ0 A;  3VMG D;  1M1J A;  2K9J A;  1G2C A;  1SQQ K;  1NTK K;  2KSJ A;  3HE5 B;  4U7J A;  1J1E B;  5APY A;  2M8R A;  5KLV D;  2Y9Z A;  3CXH D;  2Y0D A;  2C9L Y;  4I2L C;  3FX0 A;  1ZRT D;  4UB6 H;  3CMA P;  3H6P A;  3NXS A;  3U59 A;  3Q5S A;  1SS1 A;  2CPB A;  5CCG D;  1O7G A;  1L4A B;  3M9Q A;  2QE7 H;  2POH A;  1SQQ E;  2Y0E A;  1KFN A;  4OGQ D;  2NVF A;  1S5L H;  5CMZ A;  3AED C;  3KZI E;  4C7N A;  4IFD K;  3R4Y A;  4U3F J;  1GK4 A;  4HJL A;  5CCG A;  3C8V A;  1L4A A;  3OA7 A;  3L74 D;  3G3Z A;  3USS A;  2N1T C;  2OYH B;  4W7Z A;  2XDJ A;  1H89 A;  1OW8 A;  2QJY B;  1FZE A;  4WY4 C;  1RFS A;  1SQQ D;  1NDO A;  1N7S B;  5B5E E;  1H88 A;  2J5U A;  1IO4 A;  1HJ0 A;  2RN0 A;  3VMY A;  3CCS P;  5KLV K;  1X0T A;  1LP1 B;  3CWB D;  3HRN A;  1X79 B;  1JM1 A;  1FBM A;  2H8P D;  1GW3 A;  4A7P A;  1H0T A;  1S4X A;  1N7S D;  2GUV A;  4PV1 C;  2YFL A;  1S5L E;  1EXJ A;  2WSE J;  2BMO A;  3L72 G;  4U3F E;  2A45 I;  1EDI A;  1FJK A;  5APU A;  3B71 A;  3B8E B;  3AEA C;  1VQK P;  2IZ0 A;  2KXP B;  5E79 H;  2B24 A;  3VP8 A;  1SQP J;  4C7R A;  5AEU A;  1EDJ A;  1GL2 A;  1OFC X;  4P1C H;  5KLV E;  2C0X A;  1CW5 A;  3BCC J;  2Q7C A;  2XRX A;  4TLF A;  3CCJ P;  3L73 D;  3Q3D A;  2PAJ A;  1NTZ K;  5GTH E;  4OVN F;  5APQ A;  4YTP C;  1OMI A;  3L70 G;  1GL2 C;  1NGM B;  1LJ2 A;  5AVV B;  3H1J G;  1KTM A;  2WZ7 A;  1P84 E;  3A5T A;  2QEX P;  2HOD A;  2QRX A;  4U3F G;  2JDI H;  3MZW B;  2YIU C;  3MD0 A;  1NYH A;  1FU1 A;  3H1I D;  1AJY A;  4GOE A;  4I7Z C;  3E1R A;  3KYQ A;  3LW5 J;  2KI7 B;  1URQ A;  1W5C E;  3H1H J;  3PTZ A;  3P8M C;  3C9I A;  1SFC C;  3BCC D;  1M8O B;  4H44 B;  1NJI Q;  5EFW B;  4NBG D;  1KOR A;  1P84 D;  3MHV A;  4RO0 A;  2XSH A;  1RH5 B;  2PRR A;  1NKN A;  1SQP G;  1ZN5 A;  2V4H A;  3IF4 A;  5BU5 A;  2A45 H;  3RL0 C;  3HD7 C;  2G8Y A;  3LID A;  2H88 C;  3H32 A;  3VOP A;  3N7N A;  4IL6 H;  3RK2 C;  1CI6 A;  1UUV A;  1KFM A;  1ZXG A;  1JY3 O;  3MUD A;  1YIJ P;  3CWB E;  4XA4 A;  1NTK D;  3EN1 A;  1MFT A;  1HUC A;  1OXZ A;  3AEB C;  4YXD C;  1J1E C;  2I1J A;  1GL2 B;  1VQL P;  1RQU A;  3AEG C;  4NBA D;  1EDK A;  4PV1 D;  2QJK C;  2R3S A;  4H13 D;  4NBB D;  2OYI C;  2ZYG A;  1FOS F;  2YIU B;  1VPC A;  1M7L A;  3DQY A;  2KLV A;  3WUT A;  1BE3 D;  1WQL A;  1T8Z A;  1Q86 Q;  3BCC G;  1AQT A;  4D6T E;  4H13 B;  1G1I A;  1SQP E;  2WPV B;  2I1K A;  1M1J B;  1IFJ A;  3L35 A;  2K37 A;  3M0D C;  5CJ4 A;  3VCP A;  2WTY A;  2HLO A;  2NPS B;  1IK7 A;  3N4X A;  2WIT A;  3KQG A;  2XU6 A;  3FOU A;  1DX7 A;  5AVX B;  4DJG A;  3K5B A;  2WSE H;  1USE A;  2W90 A;  1YHQ P;  1DIP A;  4PD4 D;  1S72 P;  1JB0 J;  1PPJ G;  2OQQ A;  3L71 J;  3V2P A;  2NUM A;  5KLV J;  3MP7 B;  1VQ7 P;  3L72 D;  1VQN P;  2P58 A;  2GA1 A;  5KKZ B;  3M0D A;  3EQQ A;  1Q7Y Q;  1K04 A;  1IJD B;  2KYV A;  3WUU A;  1MUU A;  2Q3I A;  2KS1 A;  1MKM A;  3HE5 A;  2Y0C A;  3ABV C;  4GKG A;  1SFC D;  2AXT E;  2R44 A;  2NVG A;  2H43 A;  1S3J A;  5KJ7 D;  2UWJ E;  2BCC E;  4DOJ A;  2FYU E;  3VP9 A;  2WSF H;  1EZV G;  1X22 A;  1JTH A;  2YVJ B;  4WBA A;  3H1J D;  1ZLL A;  4CPG A;  2GBW A;  1R5L A;  5C39 A;  3VMA A;  1SQX E;  2ZT9 C;  1W2E A;  1HGZ A;  5AVY B;  3EFF K;  1NHL A;  5CCH C;  3GKE A;  1KIL A;  2H7H A;  3JCU H;  4N78 D;  2QJP B;  3TNU B;  3M9B A;  2QM8 A;  4RES B;  3H1L J;  2NPS A;  2JEE A;  4W7Y A;  3L70 E;  1FDI A;  1LP1 A;  1PGJ A;  2FFD C;  1O7P A;  3IN6 A;  1OX3 A;  3P32 A;  3D6Y A;  2YMK A;  1G2C B;  1ULI A;  3L37 A;  2NZ2 A;  2IYO A;  3P7K A;  2W6B A;  2BCC G;  4PJ0 H;  3GZX A;  1RY3 A;  2OGU A;  1LT1 A;  3VYI A;  2Y9Y A;  1HF9 A;  3O6Q B;  5B66 H;  1S9K E;  4QCK A;  3A7O A;  3JC2 2;  1K8A Q;  2YO3 A;  2K1A A;  2JO1 A;  4AYC A;  1EDL A;  3TGU J;  3L75 D;  1GK6 A;  1KB9 H;  1AV1 A;  3SFE C;  1O7M A;  4Y99 B;  2D2C C;  2XNX A;  3FXE A;  2BMR A;  2ITA A;  2SPZ A;  1BCC G;  2IBZ G;  1WMK A;  3V6I A;  4GIF A;  4HM8 A;  1T3J A;  1N7L A;  2J59 M;  4EI2 A;  4NPF X;  2IZ1 A;  1EG9 A;  1NTZ E;  1JY3 N;  3L73 G;  5AVS B;  4BRY B;  2YKO A;  3L70 J;  3M06 A;  3A0H H;  1N8R Q;  1YTZ I;  1LWU A;  1G1J A;  1KQS O;  2FYN B;  4N3Y B;  2P1J A;  2OTJ P;  2H89 C;  3CCU P;  4MN4 C;  2QM7 A;  1SQB E;  4NB8 D;  1L0L E;  3GMA A;  1RF1 B;  4H13 C;  3G4S P;  4WB4 A;  1Q2N A;  2NPS C;  1IZN B;  1N86 A;  5CCH D;  2DE7 D;  4IOI H;  2B1X A;  1VCK A;  4AAY B;  2HPC B;  4LGD E;  2QJY C;  1VQ9 P;  2FXO A;  3KHU A;  1EZV I;  5AVR B;  3SFD C;  1ZW0 A;  5DJU B;  1NH4 A;  1G8K B;  3H1J E;  2ZYD A;  3GW6 A;  2ZXE B;  3Q5P A;  3N0Q A;  3D71 A;  1ZOY C;  2WWW A;  1OVV A;  5AVW B;  2O01 H;  1FS0 E;  3CCR P;  2E42 A;  1G8J B;  4C46 A;  3CL3 D;  4ASV A;  1NAY A;  2JWD A;  3M91 A;  3FXD A;  3GL0 A;  2WPR A;  1FJP A;  1FDO A;  3V4W A;  3CC2 P;  4H0L C;  3H1H G;  3L71 G;  3VCA A;  3SWY A;  2WSF J;  2N9B A;  1A02 J;  2PP6 A;  1VM9 A;  4WVZ A;  2P67 A;  1LWU B;  1FZF A;  3GHG A;  2K9Y A;  4Y99 C;  4XFJ A;  2HMJ A;  2KIK A;  2N1T D;  4EIJ A;  2ZT9 B;  4D6T J;  2AXT H;  2W8Z A;  1KQL A;  3CI9 A;  3TGU D;  4HM7 A;  3KDP B;  4JF7 A;  5TIS E;  4XE5 B;  3O6Q A;  5APS A;  3HUS C;  2IX7 C;  2O1J A;  1WT6 A;  4QUR A;  1YJN P;  1PIX A;  4C7N B;  1YJ9 P;  1FZB A;  3RK3 C;  1JTH B;  2KNC B;  1LNQ A;  2JKV A;  1S5L X;  2GBX A;  2WQY C;  2HMK A;  5APW A;  1NTK G;  1Z56 A;  2QVA A;  4NBE D;  3L75 J;  4H44 C;  3GHG C;  1EQ7 A;  4AQR D;  1YJW P;  3RGU A;  1L0N E;  1QX8 A;  1X8Y A;  2I7F A;  3CX5 H;  3BAT A;  4M3L A;  2FYU K;  1YQ3 C;  1Q90 C;  1ZR2 A;  3RK2 B;  2XND H;  3CXH E;  1LTJ A;  1EZV D;  1LTJ B;  3BRV B;  2HG5 D;  3H1K J;  4JBZ A;  1N73 C;  2N1T A;  1LTT C;  3AE9 C;  2BEQ D;  5AW1 B;  4QUP A;  2W6A A;  4RKU J;  4RJT A;  3AEF C;  2G3A A;  1J1D C;  2R5D A;  2A06 D;  4UB8 H;  5BU8 B;  2K9J B;  3AEC C;  4KJM A;  1E5W A;  4ASW A;  5APV A;  1L0N J;  2LXB A;  3T97 A;  4IFF A;  2L91 A;  1N73 A;  5AW4 B;  3AE2 C;  1SQX K;  3NTN A;  2KUB A;  1LT9 B;  2L5G B;  1NTM D;  2J58 A;  3H25 A;  5H2F H;  5AVT B;  2BMQ A;  1HJB A;  1JY2 N;  4HB1 A;  1KQG B;  1JY3 P;  3M0A A;  1Y8A A;  5BOK A;  5L8R J;  1SQQ J;  3LIE A;  3AE1 C;  3RL0 D;  5M1B A;  2HOD B;  3U1C A;  4QMA A;  2E75 B;  1BCC E;  1FZG A;  1JY2 P;  2P2U A;  2RH0 A;  3OAK A;  2XKM A;  1NTM E;  2NWF A;  1KD1 Q;  1FDM A;  1DD4 A;  3QH9 A;  2Z5I A;  3E7K A;  3C1L A;  2K88 A;  4U3F D;  2NPS D;  1JNM A;  3GZY A;  4EDF A;  5K5G B;  1U7J A;  1AVO A;  4JQ0 D;  1ULJ A;  3L71 D;  2HR3 A;  2ZXX A;  3CWB G;  2PGD A;  3R2P A;  2AXC A;  4L75 A;  4TT3 H;  5CBO A;  4HJG H;  1SQX D;  1LGH B;  1NTM K;  3CCE P;  2HPC A;  5KKZ C;  1Q90 D;  1NTZ J;  1FZC B;  3NMD A;  1IFP A;  3TGU G;  5CXM A;  2IFM A;  5AW9 B;  3QWO C;  3G6E P;  4N78 E;  4L76 A;  5AW3 B;  4HM3 A;  3U1A A;  5HL4 A;  3HTK B;  1VF5 C;  4L73 A;  1GL2 D;  3CX5 E;  4BWN A;  3CLQ A;  4K3A A;  4IL6 E;  4KT0 J;  5KLV G;  3GLM A;  3H1I E;  3BCC E;  1J1D B;  4B86 A;  1YQ4 C;  1BE3 E;  2WT7 B;  1CSB A;  3MTU E;  3RBX A;  1J2J B;  1RQV A;  3I5C A;  2WT7 A;  4QDF B;  4HM4 A;  2YFI A;  4D6T D;  3TK1 A;  3GB4 A;  2NUK A;  4IFM A;  1SQB K;  3GCE A;  1NTM J;  5AVU B;  1EZV E;  3L75 G;  1CZQ A;  1KIL C;  1SP4 A;  3KZI H;  4W80 A;  4LC1 A;  4HM2 A;  4WY4 A;  4DT0 A;  3TYY A;  3TDK A;  2IDB A;  1AA0 A;  3A0B E;  2E75 D;  2I8D A;  4BRY A;  1FAV A;  3TGU E;  1MV8 A;  1L4A C;  3AE7 C;  5AEW A;  2M5A B;  4HYT B;  2ZAE B;  2FYU D;  1U7M A;  3RK3 D;  3HD7 B;  2FKW B;  1DEB A;  1MZ9 A;  2YNY A;  4N6J A;  1DEE G;  3SWF A;  1T2K D;  1BSH A;  2B88 A;  2KS1 B;  5BVZ A;  1GU4 A;  4DZO A;  1O7W A;  1BGY J;  3I55 P;  1FZC A;  3VN0 A;  2WSS H;  3H1I J;  1K73 Q;  3HE4 B;  1JUN A;  1LTA C;  1BE3 J;  1SQP D;  4IL6 X;  3AE3 C;  1SQB D;  3AZC A;  2XSO A;  1BCC D;  4YXW H;  4PJ0 E;  3IAO A;  4I7Z B;  1AVY A;  3GL2 A;  4EOT A;  2VRS A;  3L70 D;  2NRG A;  1KV4 A;  2DE5 D;  4NBD D;  1QGK B;  3B5N D;  4EMJ B;  2KZJ A;  3SSU A;  1GDT A;  1S1C X;  4K35 A;  3IFM A;  2JJL A;  1JMM A;  1RF0 C;  4L74 A;  3V5B A;  4DCK A;  5TJH A;  3CME P;  2RKL A;  4GDO A;  2E76 C;  2Z5H A;  2JR8 A;  1SQV J;  4QUQ A;  1USD A;  5GTI H;  1AFO A;  1FOS E;  5AW6 B;  2B87 A;  1Q82 Q;  3TSI A;  5APX A;  3BVH A;  4R4L A;  1UII A;  2PFX A;  1PP9 G;  2N1T B;  2OYH C;  1NWQ A;  1SJG A;  3H1K E;  3S4R A;  2HMO A;  3WU2 H;  4UB6 E;  1BDC A;  1ZME C;  2D2C B;  2ZVO B;  3L74 J;  2GUS A;  1L2P A;  2XV5 A;  2FFD B;  2KP8 A;  3D70 A;  2QJK B;  1BGY D;  1KIL B;  1M90 Q;  5KJ7 C;  2E43 A;  1QVF O;  4BXL A;  1YBK A;  3FWL A;  1ZV8 A;  3GTS A;  3AE8 C;  2JZA A;  1K05 A;  4HM1 A;  1L0N K;  4WY4 D;  3T97 B;  2KLU A;  3Q1M A;  3BAS A;  3D89 A;  3RK3 B;  1SQB J;  2AEJ A;  3EFG A;  1JO5 A;  1NOH A;  1NTZ G;  1IFD A;  3VMH D;  2BCC J;  3MUD C;  2O3J A;  2ZT9 D;  2XR8 A;  1OIP A;  1JOC A;  5APT A;  1OW6 A;  1SQB G;  3L73 J;  1NU1 K;  1KZU B;  1HWT C;  1PGQ A;  5CBN A;  3EWK A;  4Y28 J;  1HTL C;  3L74 G;  1N7S A;  2R32 A;  3II6 A;  5DJT B;  2WVR A;  5GTH H;  3TF5 A;  1HGV A;  1JCD A;  2OYH A;  3V2Q A;  4HH2 A;  4O9B A;  4JYB A;  1GTW A;  2JWA A;  2YKQ A;  2HYN A;  3LW5 H;  4ZKU A;  2KB7 P;  3HUS A;  1M57 D;  2R3C A;  1FQT A;  1NU1 E;  4NBF D;  2FYU G;  3PHL A;  1PP9 D;  2WMM A;  3B5N C;  1YTZ T;  3CCQ P;  1SLQ A;  2O1K A;  4GT1 A;  1PPJ D;  2FY8 A;  4OWF A;  1RE4 C;  2O01 N;  3HUS B;  1VQP P;  3OW2 O;  3H1L G;  1A02 F;  4PV1 B;  4OGQ C;  3B5N B;  3G71 P;  2ZYL A;  2ZFC A;  2Q5U A;  1VDF A;  1NU1 D;  2LKM A;  1QEX A;  1EC5 A;  3KPE A;  3AEE C;  3HTK A;  1KIL D;  4PD4 I;  3H1H E;  1IC2 A;  1JCC A;  1LTG C;  1Y9B A;  4I1L A;  3BRT B;  2DE6 D;  3MIW A;  1NO4 A;  2E75 C;  3H32 B;  2M0B A;  3RK3 E;  2Q1K A;  1M56 D;  3W68 A;  1S2E A;  1NVO A;  1RHZ B;  1HVV A;  1L0L D;  1HH0 A;  1SQV G;  1LT9 A;  1SQX J;  2OYI B;  2FBW C;  2OYI A;  1O7H A;  1SQP K;  2QG4 A;  1OVR A;  1T2K C;  1L0L J;  5TIS H;  1URQ B;  1BDD A;  5CCH A;  3L4F A;  5AVQ B;  2CKF A;  1FE6 A;  3PP5 A;  2OAR A;  4R4M A;  2O01 J;  3CXH I;  3O8Z A;  3B4S A;  4GOF A;  4WY4 B;  3HD7 A;  1YI2 P;  1YYC A;  1PGP A;  1T6A A;  1PL5 A;  2ZVN B;  1NKZ B;  3EQ2 A;  3L73 E;  4QDC A;  1YIT P;  1PP9 J;  1X9V A;  2QPZ A;  2KNC A;  5AW7 B;  1KYO I;  3Q2Y A;  1LTB C;  3CX5 D;  2YMY A;  1L0L K;  2KSE A;  3A2A A;  2E76 D;  3H1J J;  3CCV P;  1NTK J;  3H1K D;  3GTE A;  2QJP C;  2Z4E A;  5B5E H;  1SVF A;  1P84 I;  1L0N D;  4H0L D;  3HE4 A;  1QLE D;  2YKP A;  2A45 G;  2FYN C;  2A06 E;  1NTK E;  5KLI C;  4NBC D;  2P7J A;  1MFZ A;  1H8A A;  2AEM A;  1L0L G;  3AE5 C;  1SFC B;  1ZR4 A;  1R8E A;  2IPP A;  2NVE A;  3MGN A;  1BE3 G;  1VQ4 P;  5AW8 B;  2B87 B;  4D6T G;  1GMJ A;  2RMZ A;  5KLI B;  3HD7 D;  3VMX A;  3A0H E;  4AUW A;  2P10 A;  1K9M Q;  1UUW A;  1XTG B;  1RIE A;  3G9R A;  3NFQ A;  3W67 A;  1PV3 A;  5AW0 B;  2E74 B;  1KB9 E;  2E76 B;  2BCC D;  1PZQ A;  2ZYA A;  2JP3 A;  1VL2 A;  1URQ D;  2QA4 P;  2YXR B;  2GM4 A;  1IFI A;  4NPD A;  3V4Q A;  1GW4 A;  3I56 P;  1VQ6 P;  2C0W A;  5E79 E;  2FFD A;  1VF5 B;  2A06 G;  1LTS C;  2E5Y A;  2E5T A;  4H44 D;  1KN7 A;  2LXC B;  1NU1 G;  3WMM 0;  1NAF A;  2W27 A;  2OTK E;  4ZKP A;  3CD6 P;  3E1I A;  1EXI A; 
#chains in the Genus database with same CATH homology
 3H1H E;  4QUR A;  1SQV E;  4QCK A;  3GTE A;  2B24 A;  4AIV A;  2ZT9 D;  2QJP C;  5AEU A;  3EN1 A;  2XR8 A;  4HM0 A;  2BMQ A;  3AZC A;  2DE6 D;  2XSO A;  2NVG A;  4P1C H;  5KLV E;  3H1I E;  2HMN A;  1O7G A;  1G8K B;  3GL2 A;  4H0L D;  3BCC E;  2GBX A;  4HM6 A;  2XRX A;  2BCC E;  4NBA D;  1BE3 E;  3H1J E;  2FYU E;  2DE5 D;  2HMK A;  4NB9 D;  4NBD D;  5BOK A;  1SQQ E;  4PV1 D;  1NYK A;  2FYN C;  2A06 E;  1NTK E;  2QJK C;  3N0Q A;  2NVF A;  4H13 D;  4NBH D;  4NBE D;  4OGQ D;  4NBB D;  5KLI C;  4NBC D;  4QDF B;  4HM4 A;  3L75 E;  4HKV A;  2YFI A;  1BCC E;  1O7M A;  3GB4 A;  4QDF A;  1O7H A;  2NUK A;  4EMJ B;  4HJL A;  1L0N E;  2YVJ B;  3GCE A;  1G8J B;  2BMR A;  1ZRT E;  2HML A;  3C0D A;  3DQY A;  2I7F A;  1NTM E;  2NWF A;  2E74 D;  2NVE A;  1EZV E;  4HM8 A;  1WQL A;  1PPJ E;  3H1L E;  2GBW A;  4QUQ A;  1Q90 C;  4HM2 A;  1SQX E;  1P84 E;  3GL0 A;  4D6T E;  1PP9 E;  1EG9 A;  1NTZ E;  1SQP E;  1RFS A;  3CXH E;  2E75 D;  2YIU C;  3GZY A;  1UUW A;  1RIE A;  1NDO A;  3GKE A;  3L74 E;  1O7N A;  3VCA A;  3TGU E;  1VF5 D;  2CKF A;  1ULJ A;  2E4P A;  1KB9 E;  1FQT A;  1SJG A;  3H1K E;  3VCP A;  1BGY E;  4HM5 A;  1NU1 E;  4NBF D;  5AEW A;  2HMO A;  3L71 E;  1VM9 A;  2IBZ E;  3FOU A;  4QUP A;  2HMJ A;  3L70 E;  2E4Q A;  2JO6 A;  1JM1 A;  4NBG D;  3VMG D;  1O7P A;  1SQB E;  4NB8 D;  4P1B H;  1KYO E;  2XSH A;  2YFJ A;  1L0L E;  3L73 E;  3GOB A;  2HMM A;  5KKZ C;  4QDC A;  1ULI A;  1O7W A;  3VMI D;  2YFL A;  3GTS A;  2JZA A;  4H44 D;  5CXM A;  4HM1 A;  2QPZ A;  4QDD A;  2ZYL A;  3GZX A;  2BMO A;  4PD4 E;  2NUM A;  4HM7 A;  2D2C D;  3D89 A;  4U3F E;  2DE7 D;  4HM3 A;  5HL4 A;  2B1X A;  1VCK A;  3EQQ A;  3L72 E;  1UUV A;  2Q3W A;  3CX5 E;  3VMH D;  4AAY B;  2E76 D;  2QJY C;  3CWB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...