1NTKE

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 50
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntkE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntkE02
2HMNA 1BE3E 2NVGA 2YFIA 3VMGD 2NUKA 1VF5D 3L71E 2XRXA 1SQBE 4NBAD 1G8JB 1PP9E 4QURA 4NBHD 2BMRA 2B1XA 1KB9E 1NDOA 4AIVA 4HM4A 3AZCA 1VM9A 4NBCD 3GTEA 1O7WA 3N0QA 2YVJB 3FOUA 3H1LE 4H44D 3BCCE 4HM2A 2BMQA 2QPZA 1FQTA 3L72E 4QDDA 1L0LE 1O7GA 2Q3WA 3H1JE 1JM1A 1NTKE 3GZYA 2NVFA 2YFJA 2QJPC 4HKVA 1SJGA 2HMLA 4HM0A 4HM5A 4NBBD 1SQXE 4QCKA 3VCPA 4NBGD 1L0NE 2HMKA 3VCAA 4H13D 2BMOA 4PV1D 3GB4A 2HMOA 5BOKA 2YFLA 2I7FA 4HM6A 1NTZE 2CKFA 4AAYB 3L75E 2B24A 3C0DA 2D2CD 1NU1E 3GTSA 4EMJB 4HM7A 1O7NA 4PD4E 2HMMA 2JO6A 4P1CH 5CXMA 3CWBE 1O7MA 2HMJA 2E4PA 2QJKC 2GBWA 4HM1A 2XSOA 3H1HE 3L73E 3H1IE 1ULJA 1UUWA 3CX5E 4QUQA 4NBFD 1BGYE 3L74E 3GKEA 4QUPA 1EG9A 3DQYA 5KKZC 4NBDD 1VCKA 4D6TE 2DE6D 5AEWA 2JZAA 4HM8A 2E76D 3GL0A 1SQVE 1SQQE 2IBZE 5KLVE 2ZYLA 1ULIA 2E75D 3GL2A 4NB8D 2NVEA 4HJLA 3TGUE 4P1BH 2ZT9D 1O7HA 1KYOE 2FYUE 2DE5D 5KLIC 1RFSA 1NYKA 3H1KE 3GOBA 1SQPE 3VMHD 2NUMA 3GZXA 3EN1A 2GBXA 4QDCA 1PPJE 1EZVE 3VMID 2QJYC 3GCEA 1RIEA 5HL4A 1P84E 1ZRTE 1UUVA 4NBED 2E4QA 2A06E 2BCCE 4QDFB 3EQQA 2FYNC 2XR8A 3CXHE 4H0LD 1O7PA 1WQLA 2NWFA 4NB9D 2DE7D 3D89A 4OGQD 1NTME 1BCCE 3L70E 1G8KB 4QDFA 5AEUA 1Q90C 2YIUC 2XSHA 4U3FE 4HM3A 2E74D
chains in the Genus database with same CATH superfamily
4D6TJ 1VQPP 2NVGA 1M1JA 4Y99C 3D70A 5APXA 1XTCC 3VP8A 4NBAD 5AW1B 5C39A 1IFMA 1GW3A 1ZOYC 3GTEA 1BDCA 4ASVA 2KS1A 1J1EB 3Q3DA 4IL6X 2KSJA 3BCCE 4I1LA 1BE3D 2FXOA 2IZ1A 4N78E 2R5BA 1JM1A 1BCCG 2KLVA 2FYUK 1X9VA 4HM0A 3FXDA 1USDA 3TF5A 5AVWB 4NBGD 2HMOA 5BOKA 3BVHA 2DW3A 3C0DA 1EXIA 4DT0A 5GTIH 5KTBA 1AQ5A 4W80A 1OW7A 2QSIA 1PP9J 2YNYA 1T2KC 1JNMA 1HWTC 3UIAA 1L0LK 4QUQA 1QEXA 1QVFO 5KJ7C 1LT9C 5AW0B 3TDKA 5CMZA 2E75D 4NB8D 1YTZT 3CCJP 2PFXA 2OYHA 4C7RA 1JMMA 1URQD 2IZ0A 3M0DA 2QA4P 2XNXA 1RIEA 3IFMA 5KLVD 3EFGA 3WUTA 5EFWB 1W5CE 2O3JA 2B87A 2KI7B 3LIDA 3CWBJ 1NWQA 2R44A 3KPEA 3Q1MA 3L70E 2CPBA 2AXTE 4HM3A 2M8RA 3KHUA 1SQBE 1G8JB 3MP7B 1JUNA 1OWAA 1UIIA 1KYOI 3H1KJ 3AEEC 1OW6A 2QVAA 3G3ZA 3A0HE 1NTMG 4NBBD 4U3FG 1FS0E 4QCKA 1MZ9A 3FX0A 3MHVA 4BRYA 3II6A 1ZXGA 3H32B 2RKLA 4HYTB 1FZEA 1S9KD 1LJ2A 5KJ7D 1USEA 3V2PA 3B71A 3M9BA 2YMYA 3TNUB 1G2CA 3L72G 1YJWP 3L36A 1H0TB 1KQLA 1NU1D 2YKPA 1LT9B 3QH9A 4WWIA 5E79H 3M9HA 1KYOE 1NKNA 1K8AQ 4W7ZA 1KILA 5TJHA 4PV1C 1R5LA 2FBWC 1GL2D 3L73G 2YO2A 3CCLP 1OIPA 1BCCD 1RF1C 1KC8Q 3N4XA 5AVVB 2KYVA 1BCCE 1JOCA 2P58A 2KZJA 2HMNA 4C7NA 2QRXA 2BCCD 3WMM0 1SQPG 3IF4A 1HBWA 3RK2D 4NPFX 1VQ7P 3V6IA 3FOUA 3KZIH 2H8PD 5KAFH 4IFDK 5CBNA 2ZFCA 2OQQA 2OYIB 4QDDA 1JCCA 2QIWA 1SJGA 4I6MC 3GB4A 3SSUA 2AXCA 3USSA 4MN4C 1NGMB 2SPZA 3RGUA 1JM0A 1M57D 2FYZA 2WT7B 3CCVP 4I2LC 1IFPA 1GU5A 3HD7C 1NTKG 1YJNP 2OYOA 1RQVA 2N1TD 2Q1KA 4RO0A 2QM7A 1IFDA 2ZT9D 5APUA 3B5NC 3SFEC 1FJPA 3A0BH 3L75G 2DE5D 3CX5I 1N8RQ 1N73C 1XTGB 4PD4H 4M3LA 4GIFA 3GZXA 1L0NJ 2GBXA 4PV1B 1G1JA 3M0AA 1NTZJ 1SQVD 1SQQD 2IBZD 3H1IG 1QVGO 3GF7A 3L74G 3GMAA 1LWUA 4N6JA 4BXLA 4D6TG 2P1JA 4NB9D 4U3FD 4R4MA 5KLVK 5KAIE 2XNDH 3H1HJ 1NTME 1FZAA 1EZVI 4U3FE 1AVYA 3HRNA 1FZCA 5CCHA 3GF3A 1UIXA 2NPSB 3RK3D 1SFCC 5CJ0A 5B66H 3S4RA 2OGUA 1YITP 1NOHA 3RK3E 4HM4A 4GOFA 3CCRP 3L72D 2KSEA 1KQSO 5BVZA 2Z4EA 1FBMA 3P7KA 3L72E 1NAYA 1W2BO 2KIKA 1IFJA 5AVZB 3CMAP 1MKMA 3GLMA 3VCAA 4H13D 1G1IA 2I8DA 1OVRA 2B89A 1X79B 3VMZA 3AEDC 1PP9G 2B24A 3CC7P 5APWA 2O01N 3L73D 1PFIA 3CCQP 2NZ2A 2RN0A 1LTJB 3L73E 3H32A 1CSBA 4NBDD 1LTSC 4UB8E 1JY3N 3TNUA 5GTHH 3MIWA 2POHA 2Q5UA 1BDDA 1SQPD 3B5NB 1H0TA 1NU1K 3WU2E 2IDBA 1LT9A 1SQXJ 1SQPE 1N73B 4DJGA 2NUMA 3CWBG 3W68A 3CX5H 2C0WA 3RL0C 1FDIA 1SS1A 2HG5D 3JCUE 4H44B 1Z56A 5TISE 1JY3P 3GG2A 1EDKA 1P84I 4WY4B 2NUKA 1RH5B 3H1KG 3CXHI 4UB6E 2BEZF 4QURA 3TGUJ 4WB4A 3G4SP 2HPCB 4ZMDA 2P10A 2YVJB 3HTKA 2M3EA 2HODB 2YXRB 1FAVA 2FFDC 1NTKE 2J58A 3L71D 3CL3D 1YI2P 2OYIA 2HMKA 5BU8B 1YBKA 1S5LH 5K5GB 2M5AA 3L75E 3U1AA 2CPSA 3GTSA 2FYUJ 1PGPA 2QJKC 2GBWA 2JWAA 3R2PA 3H1IE 4BRYB 3L74E 2C9NY 2KOGA 1EG9A 3FWLA 5KKZC 4D6TE 1JCDA 2WT7A 2Q7CA 1IC2A 1FC2C 1N7LA 1L0LJ 2L5GB 3H1JJ 4LC1A 1IFNA 1JO5A 1HVVA 1ZRTD 4B86A 3I56P 4EI2A 4L75A 2O01H 5AW3B 2OARA 1ZRTE 2RMZA 2AEJA 1MFZA 1UUVA 5AVYB 1WQLA 3AE3C 1SQVK 1SQQK 1KILD 1VQ9P 1ZW0A 1N7SB 1KILE 3P32A 1K9MQ 2AEFA 1RF1A 3O8ZA 3G71P 2E75C 2PP6A 1PP9E 2ZYGA 1P84H 1URQC 2YKQA 5GTIE 1GMJA 4L76A 2NPSA 1DEEG 1N2DC 3CXHH 4C7NB 1HJBA 1GD2E 2I1JA 3V5BA 1M90Q 1A02J 3CC4P 1K04A 1LTIC 1EDJA 3HE4A 4W7YA 1LGHB 2D2CD 3CCEP 3BCCD 3P8CE 1KB9H 4N78D 1DIPA 1Q81Q 2HMMA 3CWBE 1ULJA 3FGAD 1Q90D 1Y47A 4NPEA 1VCKA 3A3YB 4H0LB 1FZFA 2H89C 2LKMA 2G3AA 1LTJA 3H1LJ 1KORA 1FDMA 3E1IA 4HJLA 1L0NG 4OGQB 1R5SA 1NTZG 2K37A 1RFSA 1NYKA 3H1KE 3MTUE 2C0XA 1H8AA 3B5NA 1VL2A 3H1HG 2ZXXA 2HFED 3NFQA 3VMXA 1N73A 2FYNC 3OA7A 2DE7D 1J1DC 1NAFA 3E7KA 5AEUA 4BWNA 4CPGA 2E74D 2WZ7A 5KLIB 1LWUB 2YFIA 2WPRA 2PRRA 3SWYA 1OX3A 1T3JA 2E75B 2QJYB 3P8MC 1JY3O 4WY4A 5AVQB 1OW8A 1E5WA 2XKMA 3L70D 1FZCB 3GHGB 2Y9ZA 3TSIA 1SFCA 2HPCA 1GL2C 3GZYA 2YIUB 3NXSA 1SQBD 2HODA 4GT1A 3CC2P 4HM5A 4Y99B 3A7OA 1M7LA 5E79E 2ZVNB 2YFLA 5B5EH 3CCUP 4A7PA 1BE3J 5AVUB 3MUDC 1NKZB 1QL1A 3EWKA 2GM4A 5AVXB 3DQYA 3RK2C 3SFDC 5AEWA 3VOPA 1SQXG 1FDOA 4DZOA 1ULIA 1Q82Q 3F5HA 3A5TA 2H43A 1PPJD 2K3RA 3A2AA 2Q3EA 1PPJE 1CI6B 1T8ZA 1NO4A 2WSFH 5HL4A 1RF0C 1Q2NA 3KZIE 3EQQA 5KAFE 3G9RA 4PD4I 5AW2B 1KYOD 1OZHA 2WSFJ 2KK7A 3OW2O 3TGUG 1BGYJ 3AZCA 3SWKA 3PP5A 1PL5A 2N1TC 5KLVJ 1GK6A 2ZT9C 1N7SA 1EZVG 1GW4A 1TU3F 3BRTB 2QEXP 2PGDA 2WWWA 5DJUB 2R5DA 2Q3WA 2QJPC 1L4AD 2FYUG 3K5BA 3O6QB 3HTKB 1L0NE 3I55P 3AEAC 3JSVC 1X0TA 1RY3A 3A0BE 2I7FA 1NTZE 2J59M 5AW5B 1O7NA 4PD4E 4LGDE 5CCGD 2JO6A 5CXMA 2KZIA 2G8YA 1LTBC 3RK3C 4K3AA 3H1HE 1LT1A 3Q5RA 2M5AB 1L0LG 5AW4B 3H1JG 1VQLP 3C8VA 2E76D 4K35A 5AW6B 1T3UA 1O7HA 1AQTA 1KTMA 3VYIA 1U57A 1VPCA 5B66E 4H13C 3IAOA 2KB7P 2IBZI 2JR8A 4EDFA 1NU1J 2E4QA 5AW7B 2E43A 2XR8A 1S72P 4Y28J 2JJLA 5M1BA 3D89A 2Q6QA 2ZJSE 4O9BA 3D6ZA 2N1TB 1PGJA 3PLNA 1DD3A 3ITKA 2GUVA 1K73Q 3U59A 1FOSE 2K88A 3H25A 3VN0A 3N0QA 1NTMD 2A06G 3GW6A 1RF1B 3IN6A 3B4SA 2JP3A 3WUVA 1VQNP 2MJZA 1URQA 1M8OB 2UWJE 3GHGA 3VMYA 2QJPB 2BCCJ 1MFTA 1SQXE 1K05A 2BMOA 1SQBK 2JDIH 3D6YA 1J2JB 2YKOA 2P2UA 1HGVA 2Q9IA 4KHXA 1EDLA 2E4PA 3T97B 1HUCA 3H1LG 4EYYQ 2FKWB 2Y0CA 1UUWA 1IO4A 3CX5E 1JEKA 3HE4B 3R4YA 4ZKPA 2XDJA 3TGUD 1A02F 2ZYLA 1VQOP 2NVEA 4LLHA 3TGUE 1KQGB 3AE5C 2A45I 2LR2A 1EZVD 4N3YB 2W83C 5AVTB 3EN1A 4H13B 5APTA 1EZVE 3IR9A 2Q3IA 3VTPC 1IZNB 3HD7B 1KV4A 2ZVOB 1AJYA 4YXDC 1CI6A 4DCKA 4IFMA 3M91A 2FYUE 5KJ7A 1YQ3C 3AE9C 3VMGD 1RHZB 3C1LA 1SQVJ 1SQQJ 4RJTA 2W27A 1NDOA 2ZYAA 4U3FJ 1L0LD 3H1JD 1EQ7A 1U7MA 4H44D 2QE7H 2Z5HA 1L0LE 1SVFA 2KLUA 1LTAC 3H1JE 3CD6P 2BASA 1VQ8P 1YQ4C 4OWFA 3VMAA 3PTZA 1BE3G 2K1AA 2IX7C 1SFCB 1DX7A 1KILC 3N7NA 4HM6A 4AAYB 3O6QA 4EMJB 1U7JA 4HM7A 4L73A 1NTKD 1M1KQ 1EXJA 1WMKA 1CZQA 5AVSB 2E5YA 1OXZA 1YYCA 2WPSA 2LXCB 1KB9I 2DE6D 4I7ZC 5H2FH 3L75D 1YHQP 2H88C 2P67A 3OJAB 3H1ID 3L74D 5APVA 1P84D 5L8RJ 2OTLP 1KQFB 4D6TD 1ZR2A 1E79H 1P84E 2JKVA 1CW5A 2D2CC 3AEGC 2A45H 3HUSC 1BGYG 2A06E 3G6EP 1GTWA 3CXHE 3WUUA 2W90A 1O7PA 1HGZA 1Q86Q 5KLVG 1G8KB 1Q90C 2W6AA 4PJ0H 3S9OA 3MD0A 4AUWA 1VF5D 1DH3A 1KB9E 3RL0B 5APQA 2N1TA 3KDPB 3CLQA 3H1LE 4OH8B 3FXEA 3AECC 3AEBC 3EQ2A 2WITA 4IL6H 1NTMK 5CHXA 2YFJA 1PP9D 1N7SD 5AW8B 3BRVB 2AEMA 2CKFA 3PH0A 2YMKA 2IYOA 2E74C 2XZRA 1QL2A 1PIXA 3FWNA 1X22A 1O7MA 3L71J 2FFDB 2WPVB 3AE6C 1IK9A 2R3SA 2QG4A 1X8YA 4I7ZB 3T97A 3P8CD 2YO3A 4YPCA 1HH0A 3CWBD 2OTKE 4HKZH 1GK4A 1NU1G 1S2EA 4QMAA 2QJKB 5KKZB 2D2CB 2KUBA 2W8ZA 3HUSB 4H0LD 1YJ9P 2FXMA 4GKGA 1LTTC 2I1KA 2WSEH 1DEBA 3HD7A 3H1KD 1S1CX 1LP1B 4OGQD 1YIJP 1NVOA 2XSHA 1Y8AA 4JQ0D 1BE3E 1SLQA 1AVOA 2WSEJ 1SQPK 2O1KA 4GDOA 5B5EE 2BMRA 2NRGA 2B1XA 5CBOA 3CCSP 2BCCG 1Y9BA 3S1KA 2HR3A 2QPZA 1ZR4A 1LTGC 2NVFA 4HKVA 2HMLA 3VCPA 2B88A 2L91A 3JC22 1WRGA 3V4WA 2JWDA 1URQB 1FZBA 2E74B 1EDIA 1OVVA 1BGYD 5CCHD 2CK3H 3PHLA 3AE7C 2OTJP 4NBFD 1BGYE 3OAKA 1NTKK 4HJGH 3NMDA 4XE5B 2YXQB 2JO1A 1EC5A 1QX8A 2JZAA 4ASWA 1OMIA 5KLVE 4Z1MH 2ITAA 3BCCJ 4WVZA 1IJDB 4P1BH 1FE6A 1L4AC 4YTPC 3GOBA 3Q5SA 2WTYA 1GZLA 1RE4C 1M56D 4QDFB 2O1JA 5CCGC 3RBZA 3AE4C 2NWFA 2FY8A 2OYIC 4YXWH 1SQVG 1SQQG 2IBZG 4ZNCA 1JY2N 1KMIZ 3CCMP 2E76C 1VQ6P 5AW9B 1ZMEC 1GU4A 2XRXA 1KD1Q 4XFJA 1T2KD 3PRJA 4AIVA 1FOSF 1OVUA 1KFNA 3CI9A 3Q5PA 4U7JA 1O7WA 4JPZB 2FYNB 2QM8A 2W6BA 4EOTA 1J1DB 1S9KE 3KQGA 2KP8A 4AYCA 1ZN5A 2JEEA 2AXTH 4DOJA 1JY2P 2Y0DA 3M06A 3L70J 1NU1E 1S4XA 3KXDA 2M0BA 4TLFA 4P1CH 3LW5H 3V2QA 1RE3C 1SQBJ 1VQ4P 4GOEA 1R8EA 3V4QA 2PAJA 1GL2B 1L0ND 3A0HH 2W6JH 1NTZD 1ZP0C 3LW5J 3KYQA 3PJSK 1S3JA 2FFDA 4PD4D 3GL2A 1AFOA 1NYHA 3MZWB 3H1HD 3CPWO 1L4AB 3I5CA 2WVRA 3RL0g 4EIJA 2BEQD 4JBZA 2NPSC 3VMID 3D71A 2A45G 1VQ5P 3RK2B 1PGOA 3H6PA 2BCCE 2B9BA 2V7QH 2M3BA 4HB1A 3EFFK 1M1JC 4NPDA 1JTHB 1L2PA 3HUSA 1T6AA 2V7QJ 3VP9A 5AVRB 1KYOH 2R32A 2E76B 1LP1A 4KT0J 2V4HA 4R4LA 1VM9A 1ZV8A 2IYPA 1PV3A 1Q7YQ 3AE2C 2WQYC 2BMQA 1FQTA 1O7GA 1LTJC 4JYCA 2WSCH 1QLED 4IOIH 3V2NA 2K9YA 2Y0EA 2GA1A 5APYA 4PV1D 2R3CA 4ZKUA 1VQMP 2WSCJ 1NH4A 3L71G 2K9JB 2ZT9B 1BCCJ 1NJIQ 4RESB 2Y9YA 1SQXD 2XSOA 1YTZI 2VRSA 4JYBA 1HTLC 2XV5A 1DD4A 2OYHC 5GTHE 1NHLA 4HM8A 2NPSD 3M0DC 1SQVE 1SQQE 2IBZE 4H44C 1RQUA 2WSSH 1PGQA 2KNCB 2J5UA 3C9IA 1OFCX 3CX5D 1FJKA 4WY4C 3L37A 4QDCA 3RK3B 3HE5B 3GCEA 1VQKP 3AE1C 1HF9A 1ZLLA 3TYYA 1M1JB 1AA0A 3L4FA 4QDFA 1D7MA 1FZGA 3ABVC 1GDTA 3M9QA 2KS1B 2IFNA 4NBHD 2IPPA 2HYNA 2ZXEB 2IFMA 3HD7D 1FU1A 4NBCD 2FYUD 3ZDMA 3RBXA 5DJTB 2E5TA 4OVNF 3B5ND 3BATA 5KAIH 5H2FE 3U1CA 5BU5A 1JB0J 1S5LE 1NTMJ 3BASA 1H89A 3Q2YA 4XA4A 3V2RA 1MV8A 1MUUA 2HLOA 2HMJA 1VF5C 4HM1A 2P7JA 1BSHA 1JY2O 3BCCG 2LXBA 5CJ4A 2WMMA 1LNQA 3MGNA 4WY4D 1KFMA 2OYHB 1KZUB 1L0NK 4L74A 1GL2A 1SFCD 3L35A 3L72J 1NTZK 4PJ0E 1N7SC 4HH2A 2FXPA 2B87B 3TK1A 1HJ0A 4WBAA 2KXPB 4RKUJ 2XU6A 3CMEP 1L4AA 1SP4A 4NBED 3MUDA 2ZYDA 3B8EB 4UB8H 1RE4A 1H88A 4JF7A 4IL6E 3L73J 3LIEA 5CCGA 3WU2H 3AEFC 1JTHA 2A06D 3L71E 3CXHD 1QGKB 2GUSA 2RH0A 2H7HA 1IFIA 1J1EC 1AV1A 3NTNA 1SQPJ 5APSA 4HM2A 1RF0A 3JCUH 5TISH 3L70G 4H0LC 1KB9D 4KJMA 4OGQC 1SQBG 3H1LD 4UB6H 1W2EA 1G2CB 1PZQA 2E42A 3RL0D 3F89A 2MKVA 3E1RA 2K9JA 1WT6A 1VF5B 3W67A 4C46A 4GODA 3GKEA 4QUPA 1BSNA 1S5LX 1SQXK 4IFFA 3GL0A 1RE3A 1KILB 2Z5IA 2O01J 1NTKJ 5KLIC 2N9YB 1JMBA 2WPQA 1LWUC 3VMHD 3AE8C 2ZAEB 2KNCA 2QJYC 3L75J 1KN7A 1PPJG 2N9BA 3QWOC 1FZCC 3GHGC 3HE5A 1VDFA 4AQRD 5CCHC 3SWFA 4TT3H 3H1IJ 3L74J 2C9LY 2YIUC 1N86A 1IK7A
chains in the Genus database with same CATH topology
2HMNA 1BE3E 2NVGA 2YFIA 3VMGD 2NUKA 1VF5D 3L71E 2XRXA 1SQBE 4NBAD 1G8JB 1PP9E 4QURA 4NBHD 2BMRA 2B1XA 1KB9E 1NDOA 4AIVA 4HM4A 3AZCA 1VM9A 4NBCD 3GTEA 1O7WA 3N0QA 2YVJB 3FOUA 3H1LE 4H44D 3BCCE 4HM2A 2BMQA 2QPZA 1FQTA 3L72E 4QDDA 1L0LE 1O7GA 2Q3WA 3H1JE 1JM1A 1NTKE 3GZYA 2NVFA 2YFJA 2QJPC 4HKVA 1SJGA 2HMLA 4HM0A 4HM5A 4NBBD 1SQXE 4QCKA 3VCPA 4NBGD 1L0NE 2HMKA 3VCAA 4H13D 2BMOA 4PV1D 3GB4A 2HMOA 5BOKA 2YFLA 2I7FA 4HM6A 1NTZE 2CKFA 4AAYB 3L75E 2B24A 3C0DA 2D2CD 1NU1E 3GTSA 4EMJB 4HM7A 1O7NA 4PD4E 2HMMA 2JO6A 4P1CH 5CXMA 3CWBE 1O7MA 2HMJA 2E4PA 2QJKC 2GBWA 4HM1A 2XSOA 3H1HE 3L73E 3H1IE 1ULJA 1UUWA 3CX5E 4QUQA 4NBFD 1BGYE 3L74E 3GKEA 4QUPA 1EG9A 3DQYA 5KKZC 4NBDD 1VCKA 4D6TE 2DE6D 5AEWA 2JZAA 4HM8A 2E76D 3GL0A 1SQVE 1SQQE 2IBZE 5KLVE 2ZYLA 1ULIA 2E75D 3GL2A 4NB8D 2NVEA 4HJLA 3TGUE 4P1BH 2ZT9D 1O7HA 1KYOE 2FYUE 2DE5D 5KLIC 1RFSA 1NYKA 3H1KE 3GOBA 1SQPE 3VMHD 2NUMA 3GZXA 3EN1A 2GBXA 4QDCA 1PPJE 1EZVE 3VMID 2QJYC 3GCEA 1RIEA 5HL4A 1P84E 1ZRTE 1UUVA 4NBED 2E4QA 2A06E 2BCCE 4QDFB 3EQQA 2FYNC 2XR8A 3CXHE 4H0LD 1O7PA 1WQLA 2NWFA 4NB9D 2DE7D 3D89A 4OGQD 1NTME 1BCCE 3L70E 1G8KB 4QDFA 5AEUA 1Q90C 2YIUC 2XSHA 4U3FE 4HM3A 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN A;  1BE3 E;  2NVG A;  2YFI A;  3VMG D;  2NUK A;  1VF5 D;  3L71 E;  2XRX A;  1SQB E;  4NBA D;  1G8J B;  1PP9 E;  4QUR A;  4NBH D;  2BMR A;  2B1X A;  1KB9 E;  1NDO A;  4AIV A;  4HM4 A;  3AZC A;  1VM9 A;  4NBC D;  3GTE A;  1O7W A;  3N0Q A;  2YVJ B;  3FOU A;  3H1L E;  4H44 D;  3BCC E;  4HM2 A;  2BMQ A;  2QPZ A;  1FQT A;  3L72 E;  4QDD A;  1L0L E;  1O7G A;  2Q3W A;  3H1J E;  1JM1 A;  1NTK E;  3GZY A;  2NVF A;  2YFJ A;  2QJP C;  4HKV A;  1SJG A;  2HML A;  4HM0 A;  4HM5 A;  4NBB D;  1SQX E;  4QCK A;  3VCP A;  4NBG D;  1L0N E;  2HMK A;  3VCA A;  4H13 D;  2BMO A;  4PV1 D;  3GB4 A;  2HMO A;  5BOK A;  2YFL A;  2I7F A;  4HM6 A;  1NTZ E;  2CKF A;  4AAY B;  3L75 E;  2B24 A;  3C0D A;  2D2C D;  1NU1 E;  3GTS A;  4EMJ B;  4HM7 A;  1O7N A;  4PD4 E;  2HMM A;  2JO6 A;  4P1C H;  5CXM A;  3CWB E;  1O7M A;  2HMJ A;  2E4P A;  2QJK C;  2GBW A;  4HM1 A;  2XSO A;  3H1H E;  3L73 E;  3H1I E;  1ULJ A;  1UUW A;  3CX5 E;  4QUQ A;  4NBF D;  1BGY E;  3L74 E;  3GKE A;  4QUP A;  1EG9 A;  3DQY A;  5KKZ C;  4NBD D;  1VCK A;  4D6T E;  2DE6 D;  5AEW A;  2JZA A;  4HM8 A;  2E76 D;  3GL0 A;  1SQV E;  1SQQ E;  2IBZ E;  5KLV E;  2ZYL A;  1ULI A;  2E75 D;  3GL2 A;  4NB8 D;  2NVE A;  4HJL A;  3TGU E;  4P1B H;  2ZT9 D;  1O7H A;  1KYO E;  2FYU E;  2DE5 D;  5KLI C;  1RFS A;  1NYK A;  3H1K E;  3GOB A;  1SQP E;  3VMH D;  2NUM A;  3GZX A;  3EN1 A;  2GBX A;  4QDC A;  1PPJ E;  1EZV E;  3VMI D;  2QJY C;  3GCE A;  1RIE A;  5HL4 A;  1P84 E;  1ZRT E;  1UUV A;  4NBE D;  2E4Q A;  2A06 E;  2BCC E;  4QDF B;  3EQQ A;  2FYN C;  2XR8 A;  3CXH E;  4H0L D;  1O7P A;  1WQL A;  2NWF A;  4NB9 D;  2DE7 D;  3D89 A;  4OGQ D;  1NTM E;  1BCC E;  3L70 E;  1G8K B;  4QDF A;  5AEU A;  1Q90 C;  2YIU C;  2XSH A;  4U3F E;  4HM3 A;  2E74 D; 
#chains in the Genus database with same CATH topology
 4D6T J;  1VQP P;  2NVG A;  1M1J A;  4Y99 C;  3D70 A;  5APX A;  1XTC C;  3VP8 A;  4NBA D;  5AW1 B;  5C39 A;  1IFM A;  1GW3 A;  1ZOY C;  3GTE A;  1BDC A;  4ASV A;  2KS1 A;  1J1E B;  3Q3D A;  4IL6 X;  2KSJ A;  3BCC E;  4I1L A;  1BE3 D;  2FXO A;  2IZ1 A;  4N78 E;  2R5B A;  1JM1 A;  1BCC G;  2KLV A;  2FYU K;  1X9V A;  4HM0 A;  3FXD A;  1USD A;  3TF5 A;  5AVW B;  4NBG D;  2HMO A;  5BOK A;  3BVH A;  2DW3 A;  3C0D A;  1EXI A;  4DT0 A;  5GTI H;  5KTB A;  1AQ5 A;  4W80 A;  1OW7 A;  2QSI A;  1PP9 J;  2YNY A;  1T2K C;  1JNM A;  1HWT C;  3UIA A;  1L0L K;  4QUQ A;  1QEX A;  1QVF O;  5KJ7 C;  1LT9 C;  5AW0 B;  3TDK A;  5CMZ A;  2E75 D;  4NB8 D;  1YTZ T;  3CCJ P;  2PFX A;  2OYH A;  4C7R A;  1JMM A;  1URQ D;  2IZ0 A;  3M0D A;  2QA4 P;  2XNX A;  1RIE A;  3IFM A;  5KLV D;  3EFG A;  3WUT A;  5EFW B;  1W5C E;  2O3J A;  2B87 A;  2KI7 B;  3LID A;  3CWB J;  1NWQ A;  2R44 A;  3KPE A;  3Q1M A;  3L70 E;  2CPB A;  2AXT E;  4HM3 A;  2M8R A;  3KHU A;  1SQB E;  1G8J B;  3MP7 B;  1JUN A;  1OWA A;  1UII A;  1KYO I;  3H1K J;  3AEE C;  1OW6 A;  2QVA A;  3G3Z A;  3A0H E;  1NTM G;  4NBB D;  4U3F G;  1FS0 E;  4QCK A;  1MZ9 A;  3FX0 A;  3MHV A;  4BRY A;  3II6 A;  1ZXG A;  3H32 B;  2RKL A;  4HYT B;  1FZE A;  1S9K D;  1LJ2 A;  5KJ7 D;  1USE A;  3V2P A;  3B71 A;  3M9B A;  2YMY A;  3TNU B;  1G2C A;  3L72 G;  1YJW P;  3L36 A;  1H0T B;  1KQL A;  1NU1 D;  2YKP A;  1LT9 B;  3QH9 A;  4WWI A;  5E79 H;  3M9H A;  1KYO E;  1NKN A;  1K8A Q;  4W7Z A;  1KIL A;  5TJH A;  4PV1 C;  1R5L A;  2FBW C;  1GL2 D;  3L73 G;  2YO2 A;  3CCL P;  1OIP A;  1BCC D;  1RF1 C;  1KC8 Q;  3N4X A;  5AVV B;  2KYV A;  1BCC E;  1JOC A;  2P58 A;  2KZJ A;  2HMN A;  4C7N A;  2QRX A;  2BCC D;  3WMM 0;  1SQP G;  3IF4 A;  1HBW A;  3RK2 D;  4NPF X;  1VQ7 P;  3V6I A;  3FOU A;  3KZI H;  2H8P D;  5KAF H;  4IFD K;  5CBN A;  2ZFC A;  2OQQ A;  2OYI B;  4QDD A;  1JCC A;  2QIW A;  1SJG A;  4I6M C;  3GB4 A;  3SSU A;  2AXC A;  3USS A;  4MN4 C;  1NGM B;  2SPZ A;  3RGU A;  1JM0 A;  1M57 D;  2FYZ A;  2WT7 B;  3CCV P;  4I2L C;  1IFP A;  1GU5 A;  3HD7 C;  1NTK G;  1YJN P;  2OYO A;  1RQV A;  2N1T D;  2Q1K A;  4RO0 A;  2QM7 A;  1IFD A;  2ZT9 D;  5APU A;  3B5N C;  3SFE C;  1FJP A;  3A0B H;  3L75 G;  2DE5 D;  3CX5 I;  1N8R Q;  1N73 C;  1XTG B;  4PD4 H;  4M3L A;  4GIF A;  3GZX A;  1L0N J;  2GBX A;  4PV1 B;  1G1J A;  3M0A A;  1NTZ J;  1SQV D;  1SQQ D;  2IBZ D;  3H1I G;  1QVG O;  3GF7 A;  3L74 G;  3GMA A;  1LWU A;  4N6J A;  4BXL A;  4D6T G;  2P1J A;  4NB9 D;  4U3F D;  4R4M A;  5KLV K;  5KAI E;  2XND H;  3H1H J;  1NTM E;  1FZA A;  1EZV I;  4U3F E;  1AVY A;  3HRN A;  1FZC A;  5CCH A;  3GF3 A;  1UIX A;  2NPS B;  3RK3 D;  1SFC C;  5CJ0 A;  5B66 H;  3S4R A;  2OGU A;  1YIT P;  1NOH A;  3RK3 E;  4HM4 A;  4GOF A;  3CCR P;  3L72 D;  2KSE A;  1KQS O;  5BVZ A;  2Z4E A;  1FBM A;  3P7K A;  3L72 E;  1NAY A;  1W2B O;  2KIK A;  1IFJ A;  5AVZ B;  3CMA P;  1MKM A;  3GLM A;  3VCA A;  4H13 D;  1G1I A;  2I8D A;  1OVR A;  2B89 A;  1X79 B;  3VMZ A;  3AED C;  1PP9 G;  2B24 A;  3CC7 P;  5APW A;  2O01 N;  3L73 D;  1PFI A;  3CCQ P;  2NZ2 A;  2RN0 A;  1LTJ B;  3L73 E;  3H32 A;  1CSB A;  4NBD D;  1LTS C;  4UB8 E;  1JY3 N;  3TNU A;  5GTH H;  3MIW A;  2POH A;  2Q5U A;  1BDD A;  1SQP D;  3B5N B;  1H0T A;  1NU1 K;  3WU2 E;  2IDB A;  1LT9 A;  1SQX J;  1SQP E;  1N73 B;  4DJG A;  2NUM A;  3CWB G;  3W68 A;  3CX5 H;  2C0W A;  3RL0 C;  1FDI A;  1SS1 A;  2HG5 D;  3JCU E;  4H44 B;  1Z56 A;  5TIS E;  1JY3 P;  3GG2 A;  1EDK A;  1P84 I;  4WY4 B;  2NUK A;  1RH5 B;  3H1K G;  3CXH I;  4UB6 E;  2BEZ F;  4QUR A;  3TGU J;  4WB4 A;  3G4S P;  2HPC B;  4ZMD A;  2P10 A;  2YVJ B;  3HTK A;  2M3E A;  2HOD B;  2YXR B;  1FAV A;  2FFD C;  1NTK E;  2J58 A;  3L71 D;  3CL3 D;  1YI2 P;  2OYI A;  2HMK A;  5BU8 B;  1YBK A;  1S5L H;  5K5G B;  2M5A A;  3L75 E;  3U1A A;  2CPS A;  3GTS A;  2FYU J;  1PGP A;  2QJK C;  2GBW A;  2JWA A;  3R2P A;  3H1I E;  4BRY B;  3L74 E;  2C9N Y;  2KOG A;  1EG9 A;  3FWL A;  5KKZ C;  4D6T E;  1JCD A;  2WT7 A;  2Q7C A;  1IC2 A;  1FC2 C;  1N7L A;  1L0L J;  2L5G B;  3H1J J;  4LC1 A;  1IFN A;  1JO5 A;  1HVV A;  1ZRT D;  4B86 A;  3I56 P;  4EI2 A;  4L75 A;  2O01 H;  5AW3 B;  2OAR A;  1ZRT E;  2RMZ A;  2AEJ A;  1MFZ A;  1UUV A;  5AVY B;  1WQL A;  3AE3 C;  1SQV K;  1SQQ K;  1KIL D;  1VQ9 P;  1ZW0 A;  1N7S B;  1KIL E;  3P32 A;  1K9M Q;  2AEF A;  1RF1 A;  3O8Z A;  3G71 P;  2E75 C;  2PP6 A;  1PP9 E;  2ZYG A;  1P84 H;  1URQ C;  2YKQ A;  5GTI E;  1GMJ A;  4L76 A;  2NPS A;  1DEE G;  1N2D C;  3CXH H;  4C7N B;  1HJB A;  1GD2 E;  2I1J A;  3V5B A;  1M90 Q;  1A02 J;  3CC4 P;  1K04 A;  1LTI C;  1EDJ A;  3HE4 A;  4W7Y A;  1LGH B;  2D2C D;  3CCE P;  3BCC D;  3P8C E;  1KB9 H;  4N78 D;  1DIP A;  1Q81 Q;  2HMM A;  3CWB E;  1ULJ A;  3FGA D;  1Q90 D;  1Y47 A;  4NPE A;  1VCK A;  3A3Y B;  4H0L B;  1FZF A;  2H89 C;  2LKM A;  2G3A A;  1LTJ A;  3H1L J;  1KOR A;  1FDM A;  3E1I A;  4HJL A;  1L0N G;  4OGQ B;  1R5S A;  1NTZ G;  2K37 A;  1RFS A;  1NYK A;  3H1K E;  3MTU E;  2C0X A;  1H8A A;  3B5N A;  1VL2 A;  3H1H G;  2ZXX A;  2HFE D;  3NFQ A;  3VMX A;  1N73 A;  2FYN C;  3OA7 A;  2DE7 D;  1J1D C;  1NAF A;  3E7K A;  5AEU A;  4BWN A;  4CPG A;  2E74 D;  2WZ7 A;  5KLI B;  1LWU B;  2YFI A;  2WPR A;  2PRR A;  3SWY A;  1OX3 A;  1T3J A;  2E75 B;  2QJY B;  3P8M C;  1JY3 O;  4WY4 A;  5AVQ B;  1OW8 A;  1E5W A;  2XKM A;  3L70 D;  1FZC B;  3GHG B;  2Y9Z A;  3TSI A;  1SFC A;  2HPC A;  1GL2 C;  3GZY A;  2YIU B;  3NXS A;  1SQB D;  2HOD A;  4GT1 A;  3CC2 P;  4HM5 A;  4Y99 B;  3A7O A;  1M7L A;  5E79 E;  2ZVN B;  2YFL A;  5B5E H;  3CCU P;  4A7P A;  1BE3 J;  5AVU B;  3MUD C;  1NKZ B;  1QL1 A;  3EWK A;  2GM4 A;  5AVX B;  3DQY A;  3RK2 C;  3SFD C;  5AEW A;  3VOP A;  1SQX G;  1FDO A;  4DZO A;  1ULI A;  1Q82 Q;  3F5H A;  3A5T A;  2H43 A;  1PPJ D;  2K3R A;  3A2A A;  2Q3E A;  1PPJ E;  1CI6 B;  1T8Z A;  1NO4 A;  2WSF H;  5HL4 A;  1RF0 C;  1Q2N A;  3KZI E;  3EQQ A;  5KAF E;  3G9R A;  4PD4 I;  5AW2 B;  1KYO D;  1OZH A;  2WSF J;  2KK7 A;  3OW2 O;  3TGU G;  1BGY J;  3AZC A;  3SWK A;  3PP5 A;  1PL5 A;  2N1T C;  5KLV J;  1GK6 A;  2ZT9 C;  1N7S A;  1EZV G;  1GW4 A;  1TU3 F;  3BRT B;  2QEX P;  2PGD A;  2WWW A;  5DJU B;  2R5D A;  2Q3W A;  2QJP C;  1L4A D;  2FYU G;  3K5B A;  3O6Q B;  3HTK B;  1L0N E;  3I55 P;  3AEA C;  3JSV C;  1X0T A;  1RY3 A;  3A0B E;  2I7F A;  1NTZ E;  2J59 M;  5AW5 B;  1O7N A;  4PD4 E;  4LGD E;  5CCG D;  2JO6 A;  5CXM A;  2KZI A;  2G8Y A;  1LTB C;  3RK3 C;  4K3A A;  3H1H E;  1LT1 A;  3Q5R A;  2M5A B;  1L0L G;  5AW4 B;  3H1J G;  1VQL P;  3C8V A;  2E76 D;  4K35 A;  5AW6 B;  1T3U A;  1O7H A;  1AQT A;  1KTM A;  3VYI A;  1U57 A;  1VPC A;  5B66 E;  4H13 C;  3IAO A;  2KB7 P;  2IBZ I;  2JR8 A;  4EDF A;  1NU1 J;  2E4Q A;  5AW7 B;  2E43 A;  2XR8 A;  1S72 P;  4Y28 J;  2JJL A;  5M1B A;  3D89 A;  2Q6Q A;  2ZJS E;  4O9B A;  3D6Z A;  2N1T B;  1PGJ A;  3PLN A;  1DD3 A;  3ITK A;  2GUV A;  1K73 Q;  3U59 A;  1FOS E;  2K88 A;  3H25 A;  3VN0 A;  3N0Q A;  1NTM D;  2A06 G;  3GW6 A;  1RF1 B;  3IN6 A;  3B4S A;  2JP3 A;  3WUV A;  1VQN P;  2MJZ A;  1URQ A;  1M8O B;  2UWJ E;  3GHG A;  3VMY A;  2QJP B;  2BCC J;  1MFT A;  1SQX E;  1K05 A;  2BMO A;  1SQB K;  2JDI H;  3D6Y A;  1J2J B;  2YKO A;  2P2U A;  1HGV A;  2Q9I A;  4KHX A;  1EDL A;  2E4P A;  3T97 B;  1HUC A;  3H1L G;  4EYY Q;  2FKW B;  2Y0C A;  1UUW A;  1IO4 A;  3CX5 E;  1JEK A;  3HE4 B;  3R4Y A;  4ZKP A;  2XDJ A;  3TGU D;  1A02 F;  2ZYL A;  1VQO P;  2NVE A;  4LLH A;  3TGU E;  1KQG B;  3AE5 C;  2A45 I;  2LR2 A;  1EZV D;  4N3Y B;  2W83 C;  5AVT B;  3EN1 A;  4H13 B;  5APT A;  1EZV E;  3IR9 A;  2Q3I A;  3VTP C;  1IZN B;  3HD7 B;  1KV4 A;  2ZVO B;  1AJY A;  4YXD C;  1CI6 A;  4DCK A;  4IFM A;  3M91 A;  2FYU E;  5KJ7 A;  1YQ3 C;  3AE9 C;  3VMG D;  1RHZ B;  3C1L A;  1SQV J;  1SQQ J;  4RJT A;  2W27 A;  1NDO A;  2ZYA A;  4U3F J;  1L0L D;  3H1J D;  1EQ7 A;  1U7M A;  4H44 D;  2QE7 H;  2Z5H A;  1L0L E;  1SVF A;  2KLU A;  1LTA C;  3H1J E;  3CD6 P;  2BAS A;  1VQ8 P;  1YQ4 C;  4OWF A;  3VMA A;  3PTZ A;  1BE3 G;  2K1A A;  2IX7 C;  1SFC B;  1DX7 A;  1KIL C;  3N7N A;  4HM6 A;  4AAY B;  3O6Q A;  4EMJ B;  1U7J A;  4HM7 A;  4L73 A;  1NTK D;  1M1K Q;  1EXJ A;  1WMK A;  1CZQ A;  5AVS B;  2E5Y A;  1OXZ A;  1YYC A;  2WPS A;  2LXC B;  1KB9 I;  2DE6 D;  4I7Z C;  5H2F H;  3L75 D;  1YHQ P;  2H88 C;  2P67 A;  3OJA B;  3H1I D;  3L74 D;  5APV A;  1P84 D;  5L8R J;  2OTL P;  1KQF B;  4D6T D;  1ZR2 A;  1E79 H;  1P84 E;  2JKV A;  1CW5 A;  2D2C C;  3AEG C;  2A45 H;  3HUS C;  1BGY G;  2A06 E;  3G6E P;  1GTW A;  3CXH E;  3WUU A;  2W90 A;  1O7P A;  1HGZ A;  1Q86 Q;  5KLV G;  1G8K B;  1Q90 C;  2W6A A;  4PJ0 H;  3S9O A;  3MD0 A;  4AUW A;  1VF5 D;  1DH3 A;  1KB9 E;  3RL0 B;  5APQ A;  2N1T A;  3KDP B;  3CLQ A;  3H1L E;  4OH8 B;  3FXE A;  3AEC C;  3AEB C;  3EQ2 A;  2WIT A;  4IL6 H;  1NTM K;  5CHX A;  2YFJ A;  1PP9 D;  1N7S D;  5AW8 B;  3BRV B;  2AEM A;  2CKF A;  3PH0 A;  2YMK A;  2IYO A;  2E74 C;  2XZR A;  1QL2 A;  1PIX A;  3FWN A;  1X22 A;  1O7M A;  3L71 J;  2FFD B;  2WPV B;  3AE6 C;  1IK9 A;  2R3S A;  2QG4 A;  1X8Y A;  4I7Z B;  3T97 A;  3P8C D;  2YO3 A;  4YPC A;  1HH0 A;  3CWB D;  2OTK E;  4HKZ H;  1GK4 A;  1NU1 G;  1S2E A;  4QMA A;  2QJK B;  5KKZ B;  2D2C B;  2KUB A;  2W8Z A;  3HUS B;  4H0L D;  1YJ9 P;  2FXM A;  4GKG A;  1LTT C;  2I1K A;  2WSE H;  1DEB A;  3HD7 A;  3H1K D;  1S1C X;  1LP1 B;  4OGQ D;  1YIJ P;  1NVO A;  2XSH A;  1Y8A A;  4JQ0 D;  1BE3 E;  1SLQ A;  1AVO A;  2WSE J;  1SQP K;  2O1K A;  4GDO A;  5B5E E;  2BMR A;  2NRG A;  2B1X A;  5CBO A;  3CCS P;  2BCC G;  1Y9B A;  3S1K A;  2HR3 A;  2QPZ A;  1ZR4 A;  1LTG C;  2NVF A;  4HKV A;  2HML A;  3VCP A;  2B88 A;  2L91 A;  3JC2 2;  1WRG A;  3V4W A;  2JWD A;  1URQ B;  1FZB A;  2E74 B;  1EDI A;  1OVV A;  1BGY D;  5CCH D;  2CK3 H;  3PHL A;  3AE7 C;  2OTJ P;  4NBF D;  1BGY E;  3OAK A;  1NTK K;  4HJG H;  3NMD A;  4XE5 B;  2YXQ B;  2JO1 A;  1EC5 A;  1QX8 A;  2JZA A;  4ASW A;  1OMI A;  5KLV E;  4Z1M H;  2ITA A;  3BCC J;  4WVZ A;  1IJD B;  4P1B H;  1FE6 A;  1L4A C;  4YTP C;  3GOB A;  3Q5S A;  2WTY A;  1GZL A;  1RE4 C;  1M56 D;  4QDF B;  2O1J A;  5CCG C;  3RBZ A;  3AE4 C;  2NWF A;  2FY8 A;  2OYI C;  4YXW H;  1SQV G;  1SQQ G;  2IBZ G;  4ZNC A;  1JY2 N;  1KMI Z;  3CCM P;  2E76 C;  1VQ6 P;  5AW9 B;  1ZME C;  1GU4 A;  2XRX A;  1KD1 Q;  4XFJ A;  1T2K D;  3PRJ A;  4AIV A;  1FOS F;  1OVU A;  1KFN A;  3CI9 A;  3Q5P A;  4U7J A;  1O7W A;  4JPZ B;  2FYN B;  2QM8 A;  2W6B A;  4EOT A;  1J1D B;  1S9K E;  3KQG A;  2KP8 A;  4AYC A;  1ZN5 A;  2JEE A;  2AXT H;  4DOJ A;  1JY2 P;  2Y0D A;  3M06 A;  3L70 J;  1NU1 E;  1S4X A;  3KXD A;  2M0B A;  4TLF A;  4P1C H;  3LW5 H;  3V2Q A;  1RE3 C;  1SQB J;  1VQ4 P;  4GOE A;  1R8E A;  3V4Q A;  2PAJ A;  1GL2 B;  1L0N D;  3A0H H;  2W6J H;  1NTZ D;  1ZP0 C;  3LW5 J;  3KYQ A;  3PJS K;  1S3J A;  2FFD A;  4PD4 D;  3GL2 A;  1AFO A;  1NYH A;  3MZW B;  3H1H D;  3CPW O;  1L4A B;  3I5C A;  2WVR A;  3RL0 g;  4EIJ A;  2BEQ D;  4JBZ A;  2NPS C;  3VMI D;  3D71 A;  2A45 G;  1VQ5 P;  3RK2 B;  1PGO A;  3H6P A;  2BCC E;  2B9B A;  2V7Q H;  2M3B A;  4HB1 A;  3EFF K;  1M1J C;  4NPD A;  1JTH B;  1L2P A;  3HUS A;  1T6A A;  2V7Q J;  3VP9 A;  5AVR B;  1KYO H;  2R32 A;  2E76 B;  1LP1 A;  4KT0 J;  2V4H A;  4R4L A;  1VM9 A;  1ZV8 A;  2IYP A;  1PV3 A;  1Q7Y Q;  3AE2 C;  2WQY C;  2BMQ A;  1FQT A;  1O7G A;  1LTJ C;  4JYC A;  2WSC H;  1QLE D;  4IOI H;  3V2N A;  2K9Y A;  2Y0E A;  2GA1 A;  5APY A;  4PV1 D;  2R3C A;  4ZKU A;  1VQM P;  2WSC J;  1NH4 A;  3L71 G;  2K9J B;  2ZT9 B;  1BCC J;  1NJI Q;  4RES B;  2Y9Y A;  1SQX D;  2XSO A;  1YTZ I;  2VRS A;  4JYB A;  1HTL C;  2XV5 A;  1DD4 A;  2OYH C;  5GTH E;  1NHL A;  4HM8 A;  2NPS D;  3M0D C;  1SQV E;  1SQQ E;  2IBZ E;  4H44 C;  1RQU A;  2WSS H;  1PGQ A;  2KNC B;  2J5U A;  3C9I A;  1OFC X;  3CX5 D;  1FJK A;  4WY4 C;  3L37 A;  4QDC A;  3RK3 B;  3HE5 B;  3GCE A;  1VQK P;  3AE1 C;  1HF9 A;  1ZLL A;  3TYY A;  1M1J B;  1AA0 A;  3L4F A;  4QDF A;  1D7M A;  1FZG A;  3ABV C;  1GDT A;  3M9Q A;  2KS1 B;  2IFN A;  4NBH D;  2IPP A;  2HYN A;  2ZXE B;  2IFM A;  3HD7 D;  1FU1 A;  4NBC D;  2FYU D;  3ZDM A;  3RBX A;  5DJT B;  2E5T A;  4OVN F;  3B5N D;  3BAT A;  5KAI H;  5H2F E;  3U1C A;  5BU5 A;  1JB0 J;  1S5L E;  1NTM J;  3BAS A;  1H89 A;  3Q2Y A;  4XA4 A;  3V2R A;  1MV8 A;  1MUU A;  2HLO A;  2HMJ A;  1VF5 C;  4HM1 A;  2P7J A;  1BSH A;  1JY2 O;  3BCC G;  2LXB A;  5CJ4 A;  2WMM A;  1LNQ A;  3MGN A;  4WY4 D;  1KFM A;  2OYH B;  1KZU B;  1L0N K;  4L74 A;  1GL2 A;  1SFC D;  3L35 A;  3L72 J;  1NTZ K;  4PJ0 E;  1N7S C;  4HH2 A;  2FXP A;  2B87 B;  3TK1 A;  1HJ0 A;  4WBA A;  2KXP B;  4RKU J;  2XU6 A;  3CME P;  1L4A A;  1SP4 A;  4NBE D;  3MUD A;  2ZYD A;  3B8E B;  4UB8 H;  1RE4 A;  1H88 A;  4JF7 A;  4IL6 E;  3L73 J;  3LIE A;  5CCG A;  3WU2 H;  3AEF C;  1JTH A;  2A06 D;  3L71 E;  3CXH D;  1QGK B;  2GUS A;  2RH0 A;  2H7H A;  1IFI A;  1J1E C;  1AV1 A;  3NTN A;  1SQP J;  5APS A;  4HM2 A;  1RF0 A;  3JCU H;  5TIS H;  3L70 G;  4H0L C;  1KB9 D;  4KJM A;  4OGQ C;  1SQB G;  3H1L D;  4UB6 H;  1W2E A;  1G2C B;  1PZQ A;  2E42 A;  3RL0 D;  3F89 A;  2MKV A;  3E1R A;  2K9J A;  1WT6 A;  1VF5 B;  3W67 A;  4C46 A;  4GOD A;  3GKE A;  4QUP A;  1BSN A;  1S5L X;  1SQX K;  4IFF A;  3GL0 A;  1RE3 A;  1KIL B;  2Z5I A;  2O01 J;  1NTK J;  5KLI C;  2N9Y B;  1JMB A;  2WPQ A;  1LWU C;  3VMH D;  3AE8 C;  2ZAE B;  2KNC A;  2QJY C;  3L75 J;  1KN7 A;  1PPJ G;  2N9B A;  3QWO C;  1FZC C;  3GHG C;  3HE5 A;  1VDF A;  4AQR D;  5CCH C;  3SWF A;  4TT3 H;  3H1I J;  3L74 J;  2C9L Y;  2YIU C;  1N86 A;  1IK7 A; 
#chains in the Genus database with same CATH homology
 2HMN A;  1BE3 E;  2NVG A;  2YFI A;  3VMG D;  2NUK A;  1VF5 D;  3L71 E;  2XRX A;  1SQB E;  4NBA D;  1G8J B;  1PP9 E;  4QUR A;  4NBH D;  2BMR A;  2B1X A;  1KB9 E;  1NDO A;  4AIV A;  4HM4 A;  3AZC A;  1VM9 A;  4NBC D;  3GTE A;  1O7W A;  3N0Q A;  2YVJ B;  3FOU A;  3H1L E;  4H44 D;  3BCC E;  4HM2 A;  2BMQ A;  2QPZ A;  1FQT A;  3L72 E;  4QDD A;  1L0L E;  1O7G A;  2Q3W A;  3H1J E;  1JM1 A;  1NTK E;  3GZY A;  2NVF A;  2YFJ A;  2QJP C;  4HKV A;  1SJG A;  2HML A;  4HM0 A;  4HM5 A;  4NBB D;  1SQX E;  4QCK A;  3VCP A;  4NBG D;  1L0N E;  2HMK A;  3VCA A;  4H13 D;  2BMO A;  4PV1 D;  3GB4 A;  2HMO A;  5BOK A;  2YFL A;  2I7F A;  4HM6 A;  1NTZ E;  2CKF A;  4AAY B;  3L75 E;  2B24 A;  3C0D A;  2D2C D;  1NU1 E;  3GTS A;  4EMJ B;  4HM7 A;  1O7N A;  4PD4 E;  2HMM A;  2JO6 A;  4P1C H;  5CXM A;  3CWB E;  1O7M A;  2HMJ A;  2E4P A;  2QJK C;  2GBW A;  4HM1 A;  2XSO A;  3H1H E;  3L73 E;  3H1I E;  1ULJ A;  1UUW A;  3CX5 E;  4QUQ A;  4NBF D;  1BGY E;  3L74 E;  3GKE A;  4QUP A;  1EG9 A;  3DQY A;  5KKZ C;  4NBD D;  1VCK A;  4D6T E;  2DE6 D;  5AEW A;  2JZA A;  4HM8 A;  2E76 D;  3GL0 A;  1SQV E;  1SQQ E;  2IBZ E;  5KLV E;  2ZYL A;  1ULI A;  2E75 D;  3GL2 A;  4NB8 D;  2NVE A;  4HJL A;  3TGU E;  4P1B H;  2ZT9 D;  1O7H A;  1KYO E;  2FYU E;  2DE5 D;  5KLI C;  1RFS A;  1NYK A;  3H1K E;  3GOB A;  1SQP E;  3VMH D;  2NUM A;  3GZX A;  3EN1 A;  2GBX A;  4QDC A;  1PPJ E;  1EZV E;  3VMI D;  2QJY C;  3GCE A;  1RIE A;  5HL4 A;  1P84 E;  1ZRT E;  1UUV A;  4NBE D;  2E4Q A;  2A06 E;  2BCC E;  4QDF B;  3EQQ A;  2FYN C;  2XR8 A;  3CXH E;  4H0L D;  1O7P A;  1WQL A;  2NWF A;  4NB9 D;  2DE7 D;  3D89 A;  4OGQ D;  1NTM E;  1BCC E;  3L70 E;  1G8K B;  4QDF A;  5AEU A;  1Q90 C;  2YIU C;  2XSH A;  4U3F E;  4HM3 A;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...