1NTKE

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 50
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntkE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntkE02
4HM8A 2JO6A 1PP9E 5AEUA 1BE3E 2ZYLA 2XSHA 4QDCA 1BCCE 1ULJA 2QJPC 3EQQA 3VMID 4HM6A 1FQTA 3AZCA 3L70E 1NDOA 3EN1A 2HMJA 1G8JB 1NTZE 2DE5D 4H13D 4NBBD 3TGUE 3CX5E 2E4PA 2XR8A 3L72E 4OGQD 3DQYA 1PPJE 1BGYE 4P1CH 3H1LE 4NBFD 1SQVE 1WQLA 1O7MA 4QUQA 4HM1A 4NBAD 4NBCD 2E75D 5KLIC 4EMJB 2CKFA 2DE6D 3GL0A 3GKEA 4HKVA 3L74E 2HMKA 2QJYC 3N0QA 2FYNC 3GZYA 1O7GA 4HJLA 4QUPA 2YFLA 2E4QA 4U3FE 4QCKA 3GL2A 2QJKC 2XSOA 4NBED 2A06E 2E76D 4QDFB 2HMOA 1SQXE 1VF5D 2YVJB 2E74D 4P1BH 3BCCE 2NVEA 3GTSA 5CXMA 1JM1A 2Q3WA 2FYUE 1UUWA 4HM0A 4HM3A 1RFSA 2BMOA 3GB4A 4HM2A 4AIVA 4NB8D 1O7NA 2GBWA 3L73E 4HM4A 1VM9A 5KLVE 1EZVE 2BCCE 3L71E 4NBDD 3H1KE 2B1XA 4PV1D 5BOKA 2QPZA 3VMHD 4NBHD 2GBXA 1KB9E 1O7HA 2D2CD 3CWBE 4NB9D 1NYKA 4QDDA 3H1HE 1VCKA 1RIEA 2I7FA 2HMNA 1EG9A 2NUMA 3GZXA 3C0DA 1L0LE 1L0NE 1O7WA 1NTME 4D6TE 2HMMA 2NVGA 4QURA 5HL4A 1G8KB 1ZRTE 3GOBA 2NWFA 2BMRA 2YFIA 4PD4E 2HMLA 2JZAA 1O7PA 1SQBE 4H0LD 1NTKE 2YFJA 3CXHE 4HM5A 4QDFA 1NU1E 5AEWA 2BMQA 5KKZC 3H1IE 4H44D 2DE7D 2YIUC 2NVFA 1SJGA 3GCEA 1P84E 2ZT9D 1Q90C 4NBGD 3FOUA 1SQQE 4HM7A 3L75E 3GTEA 3VCPA 2XRXA 3VCAA 3VMGD 2IBZE 1UUVA 2NUKA 3H1JE 2B24A 1SQPE 1ULIA 4AAYB 1KYOE 3D89A
chains in the Genus database with same CATH superfamily
4HM8A 1SQXD 3B5NC 4UB6E 3VMAA 1USDA 1T3UA 2FYUG 3U59A 4N3YB 5AW5B 4XE5B 3RK2B 2PAJA 1FAVA 2IX7C 3H1KD 2IPPA 2OQQA 2QRXA 4P1CH 2ZYAA 2N1TC 3H1HG 1VQLP 3OW2O 3GL0A 2BEZF 2BASA 1NTMG 1FBMA 1AQTA 2A45H 4HKZH 2PRRA 3AE7C 1N2DC 3C8VA 3BCCE 2Y0CA 1YBKA 2WMMA 4HM3A 3HE4A 2WPSA 2PP6A 1SQQG 2JO1A 5AW9B 1KORA 2WSSH 1NJIQ 1DD3A 2AXCA 1NYKA 1JUNA 4EIJA 1PGJA 1Q7YQ 1P84H 3CX5D 5KLIB 1LTAC 3AE8C 1G2CA 1VQ9P 1BGYD 3NFQA 2K9YA 3V5BA 3VN0A 1SQXJ 2YMYA 5E79H 5H2FH 3TK1A 1SVFA 3II6A 1FC2C 1SQPE 3H1KJ 2L5GB 2J59M 2A06G 1D7MA 2ZVOB 3AZCA 3L70E 1SQVD 4I7ZC 3EN1A 4R4LA 4UB6H 2FYUK 3L74D 1CW5A 3GW6A 1PFIA 4AUWA 1MKMA 2W90A 3H1LE 3O6QA 1WQLA 4IL6E 1NU1J 3MD0A 2E75D 3AE6C 3NXSA 1URQC 1L0NG 1N7SC 1FZFA 3HE5B 4RJTA 1NTMK 3IF4A 3L4FA 2XNXA 2KS1A 2IYPA 2HMOA 1BSHA 4P1BH 2KI7B 3SFDC 3F5HA 5GTHE 2XDJA 1P84D 2M8RA 5CCGA 2POHA 5BU8B 2OYHA 1YHQP 4NBDD 1KTMA 1RF0C 1KILD 5KAIE 3VYIA 2XKMA 3VMHD 2Q3IA 3CWBE 3UIAA 1T3JA 1BGYJ 3N4XA 1BCCG 1R8EA 3A2AA 2AEJA 3D6YA 5BVZA 2E76B 3H1ID 2HFED 2HMMA 1S9KE 5HL4A 3M06A 2V4HA 3G6EP 3BASA 3W67A 2NWFA 2R5BA 1O7PA 3ABVC 2KUBA 3Q5SA 1NWQA 3RK3C 2LKMA 3PLNA 2NPSC 3TF5A 5APXA 1LGHB 4B86A 4H44C 1VPCA 1PP9G 2WITA 1SQVJ 3L74G 4Y28J 5BU5A 4U3FD 1AQ5A 1MFTA 2FBWC 1GW4A 3PTZA 3CCRP 1LP1A 3HE4B 4UB8E 2A45I 1NTZE 3L71D 2E5TA 3AE9C 2CPBA 1YIJP 1GTWA 1LTSC 3KHUA 1ZOYC 4QUQA 4NBCD 1K04A 3AE2C 2FYNC 3BCCD 4IL6H 4N6JA 3S1KA 1L0NK 1OW8A 2XSOA 1EQ7A 4LGDE 4ZKUA 1JM1A 3WMM0 2GA1A 2OYOA 3L75D 4YTPC 3H1IJ 5KLVE 5GTHH 1NHLA 5GTIE 3H1JG 1ZR2A 1O7HA 3HUSA 3WUVA 1FZBA 1FJKA 3B5NA 4H13B 5APWA 1O7WA 3C9IA 3CCSP 1WRGA 1IFDA 1JEKA 3Q2YA 1K73Q 1T8ZA 4U3FJ 2OGUA 1IO4A 1PPJD 3CXHE 1VQNP 3A3YB 3O6QB 1N86A 2YMKA 5AW7B 2N1TA 2W6BA 5C39A 4DOJA 2OTJP 3L71J 2KS1B 3D89A 2JO6A 3AE5C 2RH0A 1KN7A 5B66E 3H1LD 3AE3C 1VQ5P 1YTZT 2OYHB 1GZLA 3IFMA 4UB8H 3DQYA 4KJMA 1U7JA 3CC7P 1XTGB 2ITAA 4BRYA 3GKEA 4IFDK 2E75C 3L75J 2PGDA 2RMZA 3GL2A 2R32A 3G9RA 5APVA 1UIXA 3HD7A 1SQXE 1S2EA 3C1LA 5CXMA 1YQ3C 4GODA 3CWBD 4TLFA 2XZRA 1FJPA 2IBZD 3P8MC 4L73A 3H1KE 1S9KD 1KYOD 1YYCA 4PV1D 1SQPG 1EDKA 2Y0EA 2LXBA 1KILC 1VCKA 1HGVA 5GTIH 5APSA 3WUTA 1RH5B 2MJZA 1LP1B 3L70G 4AQRD 3LIEA 2NVGA 5AVYB 2KK7A 2N9BA 3HRNA 3V2QA 1LT9C 1ZP0C 2YFIA 2FFDC 4QDFA 1NU1E 5KKZC 2Q5UA 1Q90D 3H1LG 2IFNA 2KXPB 1IFNA 1GL2D 1KQLA 1URQA 1N7SA 1EXIA 1FZAA 1VF5B 3WU2E 4WBAA 2J5UA 1ZLLA 2O01J 2UWJE 2P7JA 3G71P 1L0LJ 1NAYA 3V2RA 1KFMA 1WT6A 3CX5E 1VQPP 1HH0A 1SFCA 1BGYE 3MP7B 2VRSA 3IR9A 3SWFA 2E43A 2R3CA 2QM7A 4JQ0D 2YFLA 3CCMP 1VQKP 1LTJB 1NKZB 3B8EB 3VOPA 2BCCG 2E74D 1FDOA 2H89C 1LTTC 2NVEA 2OARA 2Q3WA 4HM0A 2SPZA 2NPSA 4NB8D 2AEFA 3FWLA 1JY3P 1JB0J 3A0BE 3RK2D 4PD4H 1AA0A 5TISE 4NB9D 1HWTC 4K3AA 1SQPK 2NUMA 2JDIH 3USSA 1YTZI 4HJGH 2NZ2A 4IFMA 1KB9I 1YJ9P 3W68A 1NTZG 3OAKA 1HJBA 2BMRA 4NPDA 3L72D 1KQGB 2JP3A 3E1IA 1X8YA 3D6ZA 4BRYB 3GCEA 1JCDA 1P84E 4AAYB 2YO3A 2M0BA 3HTKB 3HD7B 3TGUG 3GHGB 2WSEJ 2QJPC 1M1KQ 5AW1B 3WU2H 3I56P 1ZXGA 2O1KA 1NYHA 2Q1KA 1U57A 3VMYA 5KLVG 2D2CB 2I8DA 3M9HA 2WPVB 3KYQA 1IK7A 1J2JB 1X9VA 4U3FE 4H0LB 3VMXA 3M0AA 4XFJA 4PD4D 2QIWA 4QDFB 1FOSE 2YVJB 1RF1B 5CCHD 4I1LA 2BMOA 3MGNA 4Y99B 1QEXA 3KXDA 3MUDC 3L71E 5AW4B 3G3ZA 3L72J 1J1EC 1JY3N 2OYIB 1FE6A 4QDDA 3A0BH 4PV1C 2HMNA 3CXHI 1NU1D 5TISH 4HB1A 2M5AA 2B88A 3ITKA 3CCEP 1LWUC 1SFCB 2J58A 1NTZK 1RHZB 2IYOA 4WY4C 3RL0g 1Q90C 3L75E 1PGPA 4W7ZA 2Q3EA 1GL2C 1NKNA 5AVWB 2W27A 1OW6A 3EFGA 1SQXG 3RK3B 1OVVA 3TNUA 2FXPA 3AECC 4NPFX 3GLMA 2ZJSE 2JJLA 3G4SP 5DJTB 3SWKA 2C9NY 2W6AA 3H1KG 3CMEP 1PPJE 2KYVA 2P1JA 5KLVK 2E42A 5CBNA 5KJ7D 2Z4EA 1KILA 2BEQD 4QUPA 4DCKA 1FS0E 3E7KA 2P2UA 3D70A 2RN0A 1NTKD 1NU1G 1N73C 2E74C 2WPRA 4I6MC 2FYNB 3L73E 1QVFO 4HM4A 2P58A 2MKVA 1NO4A 3B4SA 2B1XA 3FXEA 5BOKA 2XV5A 3I55P 1BE3D 1QL2A 2KLUA 3RK2C 3GF7A 1M7LA 1J1DB 1DIPA 1L0LE 4D6TE 3NTNA 5AVSB 1EDLA 4OGQB 4OVNF 3GOBA 2WTYA 5AEWA 2ZAEB 3RBZA 1BGYG 1HJ0A 2YXQB 1SQQK 1JY3O 1SJGA 1FDMA 1M56D 5AVUB 3VCPA 1KFNA 3Q5PA 2XRXA 2IBZE 1W2EA 3IAOA 2B24A 2ZYGA 2HODA 1KYOE 3CX5I 1NGMB 3E1RA 2W83C 1X79B 3FXDA 3D71A 4EOTA 2I1JA 1PGOA 2HMJA 1SQVG 1SQXK 2Y9ZA 1KQSO 1DEBA 4H13D 1HVVA 3M0DC 2A45G 1EZVD 2K37A 3EQ2A 1NAFA 2WWWA 1NTKJ 3H32A 5KLIC 1K05A 2KSJA 2Q6QA 1JCCA 1YQ4C 5CMZA 1ZRTD 2H43A 1VQMP 3GMAA 1H88A 2G3AA 2ZT9B 1BE3J 1U7MA 2W8ZA 4L76A 5CCHC 2GBWA 1VM9A 1OWAA 3RL0B 4RESB 1KZUB 2XNDH 2Y0DA 3RGUA 1HUCA 3S4RA 3V4WA 5B5EE 1G2CB 3TNUB 4YXDC 2O01H 1UIIA 3H1IG 3GF3A 1P84I 3PH0A 2KP8A 4YPCA 3Q3DA 1GDTA 2BMQA 4BWNA 1KILB 2JR8A 1YITP 1GMJA 3PRJA 4YXWH 1QGKB 2HPCA 1W5CE 3I5CA 4I2LC 4U3FG 2PFXA 1OXZA 1S5LX 2NRGA 1AVYA 3EQQA 4HM6A 1KYOH 2FYZA 1G1JA 1OZHA 4HYTB 3LW5H 2H7HA 3MUDA 3AEBC 1SQVK 3L71G 1GK4A 3L72E 2YNYA 2QG4A 4L75A 1PIXA 1VQ4P 1O7MA 1VQ6P 1ZMEC 1HF9A 1OX3A 2CKFA 2KB7P 2JWDA 5KJ7C 3BCCG 2YIUB 1VL2A 4MN4C 1HTLC 1SQBD 3L73D 4EI2A 2LXCB 2R5DA 1VF5D 1LWUA 3R4YA 1VQ8P 1RFSA 1RE4C 4IOIH 5AW2B 2C0WA 3L75G 1L0LD 4D6TD 3V4QA 1OVRA 2AEMA 1GL2A 1Z56A 1QLED 1CZQA 2GUSA 4GKGA 5APTA 2KNCA 3V2PA 2WSEH 5APQA 4C7NA 1H0TA 3GG2A 4JBZA 5B5EH 1L4AD 1PGQA 3PP5A 4PD4E 1E5WA 4TT3H 1KV4A 1IC2A 2QJYB 1PPJG 3H32B 2QJKB 5APYA 1OFCX 1FDIA 1JTHA 3VCAA 3VMGD 1AV1A 3F89A 1WMKA 3CC2P 3FGAD 1JNMA 3MHVA 4WY4D 4JF7A 1H89A 2M3EA 4NPEA 2XR8A 4H13C 4DJGA 1SQBJ 2QEXP 3L73J 1ZR4A 4NBAD 1EDIA 1USEA 1CI6A 1IFJA 2C9LY 4D6TJ 3AEDC 4JYCA 1TU3F 2AXTH 3VTPC 2XU6A 1RF0A 3HD7D 2Z5IA 3HUSB 1YJWP 5APUA 3CWBG 3EFFK 5AVTB 3B5NB 2HPCB 2IBZG 3MZWB 3P7KA 2IFMA 3JC22 4NBHD 2D2CD 3PJSK 2OYHC 4LC1A 1VQOP 2Z5HA 2H8PD 3FWNA 3LW5J 2N1TB 1IZNB 3CPWO 3M0DA 2HMLA 4H0LD 1NTKE 2IBZI 2WSFH 3MTUE 2KSEA 2ZFCA 1KYOI 3FOUA 3OJAB 2IZ1A 1IFIA 4GT1A 1ULIA 1PP9E 5AEUA 1BE3E 1S72P 3BRVB 1GD2E 2FYUD 5DJUB 4BXLA 5K5GB 1R5LA 3A5TA 2W6JH 2Y9YA 2E4PA 2R44A 1SFCD 3H1HD 3KZIE 1KQFB 2I1KA 2KNCB 1H0TB 1NTMD 1VDFA 2WT7A 3M91A 2JKVA 4C46A 5KTBA 3M9QA 1L2PA 1UUWA 3A7OA 1VF5C 3GB4A 1CSBA 3AEFC 1SQQD 4AIVA 1O7NA 1EZVE 4I7ZB 2FXOA 1M8OB 3N7NA 2KZJA 1BDDA 4PJ0E 1RQUA 5AW6B 1EG9A 4JPZB 5EFWB 3L35A 3H6PA 1ZRTE 1URQB 3L72G 1N7SB 1Q86Q 1L4AC 1HGZA 1N7LA 1PV3A 4ZNCA 2DE7D 1LTJC 1SS1A 1N8RQ 2FYUJ 3T97A 4XA4A 1AFOA 5AVVB 5KJ7A 2ZXXA 1NOHA 1CI6B 3KPEA 1ZV8A 2A06D 1A02F 4WB4A 4HH2A 1Y9BA 4QDCA 2P67A 3H1HJ 4W80A 2WSCJ 3ZDMA 2K9JA 1NTMJ 1RE4A 2GUVA 3MIWA 4OGQD 2JWAA 3KDPB 3CI9A 1IJDB 3Q5RA 1GK6A 1L0ND 1M1JC 1K9MQ 2DE6D 1OIPA 4IL6X 4M3LA 1SQQJ 3KZIH 3SFEC 1Y47A 1SP4A 1FZCC 2NPSB 3JSVC 3CCQP 1BSNA 4NBED 2E76D 4H44B 2WSFJ 1IFPA 3K5BA 4ASVA 3O8ZA 3VP8A 1XTCC 3HD7C 3GHGC 1JMMA 1W2BO 2GBXA 3KQGA 1KMIZ 4PD4I 1BCCD 1LT9A 1X0TA 2QA4P 3GZXA 2D2CC 2FFDA 1MZ9A 1LTGC 2GM4A 2YO2A 4PJ0H 3AE1C 1KC8Q 3CCUP 2K88A 1LNQA 3NMDA 1SQBE 4A7PA 4H0LC 3CCLP 2Q9IA 2ZT9D 1PP9D 2WT7B 2P10A 3SSUA 5CBOA 2B89A 2ZYDA 1RF1C 1AJYA 4N78E 1JOCA 3FX0A 1EDJA 4Y99C 1RY3A 3RL0D 4GOEA 1K8AQ 3U1AA 3M9BA 1DH3A 2KIKA 1L0NJ 5CJ4A 2OYIC 4NBBD 5KAFE 4ASWA 5M1BA 3A0HE 2OTKE 3P8CD 1PL5A 3PHLA 2YKPA 1DX7A 2QSIA 1G1IA 2HMKA 1SFCC 4HKVA 4WWIA 1EXJA 1GU5A 1T2KD 3AE4C 1NTKG 3AEAC 3S9OA 4LLHA 1BCCJ 3T97B 2BCCE 2C0XA 3H1JD 1DEEG 2HLOA 1PZQA 2M5AB 2O3JA 3AEGC 2QPZA 1KB9E 4Z1MH 3R2PA 1BE3G 2WZ7A 1JMBA 2K9JB 1PP9J 3L74J 1Q82Q 1MFZA 1NU1K 2G8YA 1JY2P 1FZEA 3BATA 4R4MA 5CCGD 2E75B 1YJNP 2NVFA 5CJ0A 2B87A 2QE7H 5AVRB 3CMAP 1QX8A 2WPQA 1NDOA 2B9BA 1NVOA 3B71A 2V7QH 2DE5D 3TGUE 3AEEC 1EZVG 1GW3A 1J1DC 4IFFA 1Q81Q 2ZVNB 4NBFD 3TYYA 2HYNA 5AVXB 3V6IA 5KAFH 4OGQC 1FU1A 1LT9B 3A0HH 1YI2P 1IFMA 2FFDB 3GZYA 1OVUA 5KKZB 4DZOA 2JEEA 1RE3C 4DT0A 2OTLP 4ZKPA 1Y8AA 5KAIH 1LJ2A 3H1JJ 1EZVI 3TSIA 1L4AA 3QWOC 3GTSA 2E76C 1S3JA 2FYUE 1NTKK 5AW8B 3BRTB 4C7RA 1LT1A 1LTJA 2KZIA 4O9BA 1ZW0A 1IK9A 1SQPD 1M90Q 1SLQA 2AXTE 1MUUA 3H1HE 3L70D 2HG5D 4GIFA 4GOFA 1KB9H 1NTME 4QURA 1QVGO 3CCJP 1M57D 4WY4A 4K35A 3Q1MA 2E5YA 3RBXA 4HM5A 2KLVA 2K1AA 5L8RJ 1JY2N 4N78D 2CPSA 2HODB 3BCCJ 1SQQE 3RK3E 4HM7A 3JCUE 1M1JA 2ZT9C 1S5LE 2NUKA 2O1JA 3B5ND 1VQ7P 4QMAA 1FZCA 1NH4A 2ZYLA 1ULJA 3VMID 3CLQA 2WVRA 3RL0C 2FXMA 1LTBC 2YKOA 2IDBA 3EWKA 5TJHA 2M3BA 3HTKA 3GHGA 1OMIA 1MV8A 2DW3A 3H25A 2N1TD 1H8AA 4WVZA 4HJLA 3N0QA 1O7GA 4GDOA 2QM8A 1Q2NA 2QVAA 4QCKA 1N73A 4ZMDA 2A06E 1E79H 1SQBG 1SQPJ 2BCCD 2YXRB 3L73G 5AW3B 1T2KC 2RKLA 1S4XA 1KB9D 3CC4P 2H88C 3L70J 3IN6A 3CD6P 2QJPB 1L0LG 2B87B 2CK3H 1OW7A 4D6TG 1RF1A 3WUUA 2HR3A 3CXHH 3H1LJ 1RIEA 2I7FA 3LIDA 1FZGA 3CCVP 3C0DA 1EC5A 1L0NE 2FY8A 2V7QJ 2Q7CA 1G8KB 1NTZD 2WSCH 1BDCA 1JO5A 4KHXA 2OYIA 3SWYA 1X22A 2JZAA 2YIUC 5B66H 5CCGC 1JM0A 4OH8B 4NBGD 1A02J 3P32A 3GTEA 1FOSF 3JCUH 4W7YA 2LR2A 3TGUD 3U1CA 2R3SA 1S5LH 1R5SA 2XSHA 5AVQB 1BCCE 1L4AB 1JY2O 3CWBJ 1FQTA 1ZN5A 2FKWB 1G8JB 1J1EB 1S1CX 5KLVD 4PV1B 2KOGA 1SQVE 1HBWA 1URQD 3OA7A 3BVHA 1N7SD 2BCCJ 4HM1A 4EMJB 1AVOA 5CHXA 1LWUB 3L74E 2QJYC 5AVZB 4RO0A 4EYYQ 2E4QA 1GU4A 2K3RA 4WY4B 2ZXEB 1T6AA 2QJKC 3L37A 3CXHD 5CCHA 1GL2B 4L74A 4U7JA 3VMZA 1SQBK 4JYBA 1KD1Q 4HM2A 1M1JB 4C7NB 1RQVA 4RKUJ 1NTZJ 1QL1A 2YKQA 1FZCB 2WQYC 3P8CE 3TDKA 1L0LK 3VP9A 4CPGA 5AW0B 1KILE 2IZ0A 1LTIC 3HE5A 1DD4A 3QH9A 3RK3D 5E79E 5H2FE 1JTHB 2YFJA 2NPSD 4AYCA 2O01N 3TGUJ 3H1IE 4H44D 3CL3D 3V2NA 3L36A 4OWFA 2L91A 2N9YB 4EDFA 1UUVA 3CX5H 3H1JE 1RE3A 5KLVJ 1N73B 3HUSC 2E74B 4KT0J
chains in the Genus database with same CATH topology
4HM8A 2JO6A 1PP9E 5AEUA 1BE3E 2ZYLA 2XSHA 4QDCA 1BCCE 1ULJA 2QJPC 3EQQA 3VMID 4HM6A 1FQTA 3AZCA 3L70E 1NDOA 3EN1A 2HMJA 1G8JB 1NTZE 2DE5D 4H13D 4NBBD 3TGUE 3CX5E 2E4PA 2XR8A 3L72E 4OGQD 3DQYA 1PPJE 1BGYE 4P1CH 3H1LE 4NBFD 1SQVE 1WQLA 1O7MA 4QUQA 4HM1A 4NBAD 4NBCD 2E75D 5KLIC 4EMJB 2CKFA 2DE6D 3GL0A 3GKEA 4HKVA 3L74E 2HMKA 2QJYC 3N0QA 2FYNC 3GZYA 1O7GA 4HJLA 4QUPA 2YFLA 2E4QA 4U3FE 4QCKA 3GL2A 2QJKC 2XSOA 4NBED 2A06E 2E76D 4QDFB 2HMOA 1SQXE 1VF5D 2YVJB 2E74D 4P1BH 3BCCE 2NVEA 3GTSA 5CXMA 1JM1A 2Q3WA 2FYUE 1UUWA 4HM0A 4HM3A 1RFSA 2BMOA 3GB4A 4HM2A 4AIVA 4NB8D 1O7NA 2GBWA 3L73E 4HM4A 1VM9A 5KLVE 1EZVE 2BCCE 3L71E 4NBDD 3H1KE 2B1XA 4PV1D 5BOKA 2QPZA 3VMHD 4NBHD 2GBXA 1KB9E 1O7HA 2D2CD 3CWBE 4NB9D 1NYKA 4QDDA 3H1HE 1VCKA 1RIEA 2I7FA 2HMNA 1EG9A 2NUMA 3GZXA 3C0DA 1L0LE 1L0NE 1O7WA 1NTME 4D6TE 2HMMA 2NVGA 4QURA 5HL4A 1G8KB 1ZRTE 3GOBA 2NWFA 2BMRA 2YFIA 4PD4E 2HMLA 2JZAA 1O7PA 1SQBE 4H0LD 1NTKE 2YFJA 3CXHE 4HM5A 4QDFA 1NU1E 5AEWA 2BMQA 5KKZC 3H1IE 4H44D 2DE7D 2YIUC 2NVFA 1SJGA 3GCEA 1P84E 2ZT9D 1Q90C 4NBGD 3FOUA 1SQQE 4HM7A 3L75E 3GTEA 3VCPA 2XRXA 3VCAA 3VMGD 2IBZE 1UUVA 2NUKA 3H1JE 2B24A 1SQPE 1ULIA 4AAYB 1KYOE 3D89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM8 A;  2JO6 A;  1PP9 E;  5AEU A;  1BE3 E;  2ZYL A;  2XSH A;  4QDC A;  1BCC E;  1ULJ A;  2QJP C;  3EQQ A;  3VMI D;  4HM6 A;  1FQT A;  3AZC A;  3L70 E;  1NDO A;  3EN1 A;  2HMJ A;  1G8J B;  1NTZ E;  2DE5 D;  4H13 D;  4NBB D;  3TGU E;  3CX5 E;  2E4P A;  2XR8 A;  3L72 E;  4OGQ D;  3DQY A;  1PPJ E;  1BGY E;  4P1C H;  3H1L E;  4NBF D;  1SQV E;  1WQL A;  1O7M A;  4QUQ A;  4HM1 A;  4NBA D;  4NBC D;  2E75 D;  5KLI C;  4EMJ B;  2CKF A;  2DE6 D;  3GL0 A;  3GKE A;  4HKV A;  3L74 E;  2HMK A;  2QJY C;  3N0Q A;  2FYN C;  3GZY A;  1O7G A;  4HJL A;  4QUP A;  2YFL A;  2E4Q A;  4U3F E;  4QCK A;  3GL2 A;  2QJK C;  2XSO A;  4NBE D;  2A06 E;  2E76 D;  4QDF B;  2HMO A;  1SQX E;  1VF5 D;  2YVJ B;  2E74 D;  4P1B H;  3BCC E;  2NVE A;  3GTS A;  5CXM A;  1JM1 A;  2Q3W A;  2FYU E;  1UUW A;  4HM0 A;  4HM3 A;  1RFS A;  2BMO A;  3GB4 A;  4HM2 A;  4AIV A;  4NB8 D;  1O7N A;  2GBW A;  3L73 E;  4HM4 A;  1VM9 A;  5KLV E;  1EZV E;  2BCC E;  3L71 E;  4NBD D;  3H1K E;  2B1X A;  4PV1 D;  5BOK A;  2QPZ A;  3VMH D;  4NBH D;  2GBX A;  1KB9 E;  1O7H A;  2D2C D;  3CWB E;  4NB9 D;  1NYK A;  4QDD A;  3H1H E;  1VCK A;  1RIE A;  2I7F A;  2HMN A;  1EG9 A;  2NUM A;  3GZX A;  3C0D A;  1L0L E;  1L0N E;  1O7W A;  1NTM E;  4D6T E;  2HMM A;  2NVG A;  4QUR A;  5HL4 A;  1G8K B;  1ZRT E;  3GOB A;  2NWF A;  2BMR A;  2YFI A;  4PD4 E;  2HML A;  2JZA A;  1O7P A;  1SQB E;  4H0L D;  1NTK E;  2YFJ A;  3CXH E;  4HM5 A;  4QDF A;  1NU1 E;  5AEW A;  2BMQ A;  5KKZ C;  3H1I E;  4H44 D;  2DE7 D;  2YIU C;  2NVF A;  1SJG A;  3GCE A;  1P84 E;  2ZT9 D;  1Q90 C;  4NBG D;  3FOU A;  1SQQ E;  4HM7 A;  3L75 E;  3GTE A;  3VCP A;  2XRX A;  3VCA A;  3VMG D;  2IBZ E;  1UUV A;  2NUK A;  3H1J E;  2B24 A;  1SQP E;  1ULI A;  4AAY B;  1KYO E;  3D89 A; 
#chains in the Genus database with same CATH topology
 4HM8 A;  1SQX D;  3B5N C;  4UB6 E;  3VMA A;  1USD A;  1T3U A;  2FYU G;  3U59 A;  4N3Y B;  5AW5 B;  4XE5 B;  3RK2 B;  2PAJ A;  1FAV A;  2IX7 C;  3H1K D;  2IPP A;  2OQQ A;  2QRX A;  4P1C H;  2ZYA A;  2N1T C;  3H1H G;  1VQL P;  3OW2 O;  3GL0 A;  2BEZ F;  2BAS A;  1NTM G;  1FBM A;  1AQT A;  2A45 H;  4HKZ H;  2PRR A;  3AE7 C;  1N2D C;  3C8V A;  3BCC E;  2Y0C A;  1YBK A;  2WMM A;  4HM3 A;  3HE4 A;  2WPS A;  2PP6 A;  1SQQ G;  2JO1 A;  5AW9 B;  1KOR A;  2WSS H;  1NJI Q;  1DD3 A;  2AXC A;  1NYK A;  1JUN A;  4EIJ A;  1PGJ A;  1Q7Y Q;  1P84 H;  3CX5 D;  5KLI B;  1LTA C;  3AE8 C;  1G2C A;  1VQ9 P;  1BGY D;  3NFQ A;  2K9Y A;  3V5B A;  3VN0 A;  1SQX J;  2YMY A;  5E79 H;  5H2F H;  3TK1 A;  1SVF A;  3II6 A;  1FC2 C;  1SQP E;  3H1K J;  2L5G B;  2J59 M;  2A06 G;  1D7M A;  2ZVO B;  3AZC A;  3L70 E;  1SQV D;  4I7Z C;  3EN1 A;  4R4L A;  4UB6 H;  2FYU K;  3L74 D;  1CW5 A;  3GW6 A;  1PFI A;  4AUW A;  1MKM A;  2W90 A;  3H1L E;  3O6Q A;  1WQL A;  4IL6 E;  1NU1 J;  3MD0 A;  2E75 D;  3AE6 C;  3NXS A;  1URQ C;  1L0N G;  1N7S C;  1FZF A;  3HE5 B;  4RJT A;  1NTM K;  3IF4 A;  3L4F A;  2XNX A;  2KS1 A;  2IYP A;  2HMO A;  1BSH A;  4P1B H;  2KI7 B;  3SFD C;  3F5H A;  5GTH E;  2XDJ A;  1P84 D;  2M8R A;  5CCG A;  2POH A;  5BU8 B;  2OYH A;  1YHQ P;  4NBD D;  1KTM A;  1RF0 C;  1KIL D;  5KAI E;  3VYI A;  2XKM A;  3VMH D;  2Q3I A;  3CWB E;  3UIA A;  1T3J A;  1BGY J;  3N4X A;  1BCC G;  1R8E A;  3A2A A;  2AEJ A;  3D6Y A;  5BVZ A;  2E76 B;  3H1I D;  2HFE D;  2HMM A;  1S9K E;  5HL4 A;  3M06 A;  2V4H A;  3G6E P;  3BAS A;  3W67 A;  2NWF A;  2R5B A;  1O7P A;  3ABV C;  2KUB A;  3Q5S A;  1NWQ A;  3RK3 C;  2LKM A;  3PLN A;  2NPS C;  3TF5 A;  5APX A;  1LGH B;  4B86 A;  4H44 C;  1VPC A;  1PP9 G;  2WIT A;  1SQV J;  3L74 G;  4Y28 J;  5BU5 A;  4U3F D;  1AQ5 A;  1MFT A;  2FBW C;  1GW4 A;  3PTZ A;  3CCR P;  1LP1 A;  3HE4 B;  4UB8 E;  2A45 I;  1NTZ E;  3L71 D;  2E5T A;  3AE9 C;  2CPB A;  1YIJ P;  1GTW A;  1LTS C;  3KHU A;  1ZOY C;  4QUQ A;  4NBC D;  1K04 A;  3AE2 C;  2FYN C;  3BCC D;  4IL6 H;  4N6J A;  3S1K A;  1L0N K;  1OW8 A;  2XSO A;  1EQ7 A;  4LGD E;  4ZKU A;  1JM1 A;  3WMM 0;  2GA1 A;  2OYO A;  3L75 D;  4YTP C;  3H1I J;  5KLV E;  5GTH H;  1NHL A;  5GTI E;  3H1J G;  1ZR2 A;  1O7H A;  3HUS A;  3WUV A;  1FZB A;  1FJK A;  3B5N A;  4H13 B;  5APW A;  1O7W A;  3C9I A;  3CCS P;  1WRG A;  1IFD A;  1JEK A;  3Q2Y A;  1K73 Q;  1T8Z A;  4U3F J;  2OGU A;  1IO4 A;  1PPJ D;  3CXH E;  1VQN P;  3A3Y B;  3O6Q B;  1N86 A;  2YMK A;  5AW7 B;  2N1T A;  2W6B A;  5C39 A;  4DOJ A;  2OTJ P;  3L71 J;  2KS1 B;  3D89 A;  2JO6 A;  3AE5 C;  2RH0 A;  1KN7 A;  5B66 E;  3H1L D;  3AE3 C;  1VQ5 P;  1YTZ T;  2OYH B;  1GZL A;  3IFM A;  4UB8 H;  3DQY A;  4KJM A;  1U7J A;  3CC7 P;  1XTG B;  2ITA A;  4BRY A;  3GKE A;  4IFD K;  2E75 C;  3L75 J;  2PGD A;  2RMZ A;  3GL2 A;  2R32 A;  3G9R A;  5APV A;  1UIX A;  3HD7 A;  1SQX E;  1S2E A;  3C1L A;  5CXM A;  1YQ3 C;  4GOD A;  3CWB D;  4TLF A;  2XZR A;  1FJP A;  2IBZ D;  3P8M C;  4L73 A;  3H1K E;  1S9K D;  1KYO D;  1YYC A;  4PV1 D;  1SQP G;  1EDK A;  2Y0E A;  2LXB A;  1KIL C;  1VCK A;  1HGV A;  5GTI H;  5APS A;  3WUT A;  1RH5 B;  2MJZ A;  1LP1 B;  3L70 G;  4AQR D;  3LIE A;  2NVG A;  5AVY B;  2KK7 A;  2N9B A;  3HRN A;  3V2Q A;  1LT9 C;  1ZP0 C;  2YFI A;  2FFD C;  4QDF A;  1NU1 E;  5KKZ C;  2Q5U A;  1Q90 D;  3H1L G;  2IFN A;  2KXP B;  1IFN A;  1GL2 D;  1KQL A;  1URQ A;  1N7S A;  1EXI A;  1FZA A;  1VF5 B;  3WU2 E;  4WBA A;  2J5U A;  1ZLL A;  2O01 J;  2UWJ E;  2P7J A;  3G71 P;  1L0L J;  1NAY A;  3V2R A;  1KFM A;  1WT6 A;  3CX5 E;  1VQP P;  1HH0 A;  1SFC A;  1BGY E;  3MP7 B;  2VRS A;  3IR9 A;  3SWF A;  2E43 A;  2R3C A;  2QM7 A;  4JQ0 D;  2YFL A;  3CCM P;  1VQK P;  1LTJ B;  1NKZ B;  3B8E B;  3VOP A;  2BCC G;  2E74 D;  1FDO A;  2H89 C;  1LTT C;  2NVE A;  2OAR A;  2Q3W A;  4HM0 A;  2SPZ A;  2NPS A;  4NB8 D;  2AEF A;  3FWL A;  1JY3 P;  1JB0 J;  3A0B E;  3RK2 D;  4PD4 H;  1AA0 A;  5TIS E;  4NB9 D;  1HWT C;  4K3A A;  1SQP K;  2NUM A;  2JDI H;  3USS A;  1YTZ I;  4HJG H;  2NZ2 A;  4IFM A;  1KB9 I;  1YJ9 P;  3W68 A;  1NTZ G;  3OAK A;  1HJB A;  2BMR A;  4NPD A;  3L72 D;  1KQG B;  2JP3 A;  3E1I A;  1X8Y A;  3D6Z A;  4BRY B;  3GCE A;  1JCD A;  1P84 E;  4AAY B;  2YO3 A;  2M0B A;  3HTK B;  3HD7 B;  3TGU G;  3GHG B;  2WSE J;  2QJP C;  1M1K Q;  5AW1 B;  3WU2 H;  3I56 P;  1ZXG A;  2O1K A;  1NYH A;  2Q1K A;  1U57 A;  3VMY A;  5KLV G;  2D2C B;  2I8D A;  3M9H A;  2WPV B;  3KYQ A;  1IK7 A;  1J2J B;  1X9V A;  4U3F E;  4H0L B;  3VMX A;  3M0A A;  4XFJ A;  4PD4 D;  2QIW A;  4QDF B;  1FOS E;  2YVJ B;  1RF1 B;  5CCH D;  4I1L A;  2BMO A;  3MGN A;  4Y99 B;  1QEX A;  3KXD A;  3MUD C;  3L71 E;  5AW4 B;  3G3Z A;  3L72 J;  1J1E C;  1JY3 N;  2OYI B;  1FE6 A;  4QDD A;  3A0B H;  4PV1 C;  2HMN A;  3CXH I;  1NU1 D;  5TIS H;  4HB1 A;  2M5A A;  2B88 A;  3ITK A;  3CCE P;  1LWU C;  1SFC B;  2J58 A;  1NTZ K;  1RHZ B;  2IYO A;  4WY4 C;  3RL0 g;  1Q90 C;  3L75 E;  1PGP A;  4W7Z A;  2Q3E A;  1GL2 C;  1NKN A;  5AVW B;  2W27 A;  1OW6 A;  3EFG A;  1SQX G;  3RK3 B;  1OVV A;  3TNU A;  2FXP A;  3AEC C;  4NPF X;  3GLM A;  2ZJS E;  2JJL A;  3G4S P;  5DJT B;  3SWK A;  2C9N Y;  2W6A A;  3H1K G;  3CME P;  1PPJ E;  2KYV A;  2P1J A;  5KLV K;  2E42 A;  5CBN A;  5KJ7 D;  2Z4E A;  1KIL A;  2BEQ D;  4QUP A;  4DCK A;  1FS0 E;  3E7K A;  2P2U A;  3D70 A;  2RN0 A;  1NTK D;  1NU1 G;  1N73 C;  2E74 C;  2WPR A;  4I6M C;  2FYN B;  3L73 E;  1QVF O;  4HM4 A;  2P58 A;  2MKV A;  1NO4 A;  3B4S A;  2B1X A;  3FXE A;  5BOK A;  2XV5 A;  3I55 P;  1BE3 D;  1QL2 A;  2KLU A;  3RK2 C;  3GF7 A;  1M7L A;  1J1D B;  1DIP A;  1L0L E;  4D6T E;  3NTN A;  5AVS B;  1EDL A;  4OGQ B;  4OVN F;  3GOB A;  2WTY A;  5AEW A;  2ZAE B;  3RBZ A;  1BGY G;  1HJ0 A;  2YXQ B;  1SQQ K;  1JY3 O;  1SJG A;  1FDM A;  1M56 D;  5AVU B;  3VCP A;  1KFN A;  3Q5P A;  2XRX A;  2IBZ E;  1W2E A;  3IAO A;  2B24 A;  2ZYG A;  2HOD A;  1KYO E;  3CX5 I;  1NGM B;  3E1R A;  2W83 C;  1X79 B;  3FXD A;  3D71 A;  4EOT A;  2I1J A;  1PGO A;  2HMJ A;  1SQV G;  1SQX K;  2Y9Z A;  1KQS O;  1DEB A;  4H13 D;  1HVV A;  3M0D C;  2A45 G;  1EZV D;  2K37 A;  3EQ2 A;  1NAF A;  2WWW A;  1NTK J;  3H32 A;  5KLI C;  1K05 A;  2KSJ A;  2Q6Q A;  1JCC A;  1YQ4 C;  5CMZ A;  1ZRT D;  2H43 A;  1VQM P;  3GMA A;  1H88 A;  2G3A A;  2ZT9 B;  1BE3 J;  1U7M A;  2W8Z A;  4L76 A;  5CCH C;  2GBW A;  1VM9 A;  1OWA A;  3RL0 B;  4RES B;  1KZU B;  2XND H;  2Y0D A;  3RGU A;  1HUC A;  3S4R A;  3V4W A;  5B5E E;  1G2C B;  3TNU B;  4YXD C;  2O01 H;  1UII A;  3H1I G;  3GF3 A;  1P84 I;  3PH0 A;  2KP8 A;  4YPC A;  3Q3D A;  1GDT A;  2BMQ A;  4BWN A;  1KIL B;  2JR8 A;  1YIT P;  1GMJ A;  3PRJ A;  4YXW H;  1QGK B;  2HPC A;  1W5C E;  3I5C A;  4I2L C;  4U3F G;  2PFX A;  1OXZ A;  1S5L X;  2NRG A;  1AVY A;  3EQQ A;  4HM6 A;  1KYO H;  2FYZ A;  1G1J A;  1OZH A;  4HYT B;  3LW5 H;  2H7H A;  3MUD A;  3AEB C;  1SQV K;  3L71 G;  1GK4 A;  3L72 E;  2YNY A;  2QG4 A;  4L75 A;  1PIX A;  1VQ4 P;  1O7M A;  1VQ6 P;  1ZME C;  1HF9 A;  1OX3 A;  2CKF A;  2KB7 P;  2JWD A;  5KJ7 C;  3BCC G;  2YIU B;  1VL2 A;  4MN4 C;  1HTL C;  1SQB D;  3L73 D;  4EI2 A;  2LXC B;  2R5D A;  1VF5 D;  1LWU A;  3R4Y A;  1VQ8 P;  1RFS A;  1RE4 C;  4IOI H;  5AW2 B;  2C0W A;  3L75 G;  1L0L D;  4D6T D;  3V4Q A;  1OVR A;  2AEM A;  1GL2 A;  1Z56 A;  1QLE D;  1CZQ A;  2GUS A;  4GKG A;  5APT A;  2KNC A;  3V2P A;  2WSE H;  5APQ A;  4C7N A;  1H0T A;  3GG2 A;  4JBZ A;  5B5E H;  1L4A D;  1PGQ A;  3PP5 A;  4PD4 E;  1E5W A;  4TT3 H;  1KV4 A;  1IC2 A;  2QJY B;  1PPJ G;  3H32 B;  2QJK B;  5APY A;  1OFC X;  1FDI A;  1JTH A;  3VCA A;  3VMG D;  1AV1 A;  3F89 A;  1WMK A;  3CC2 P;  3FGA D;  1JNM A;  3MHV A;  4WY4 D;  4JF7 A;  1H89 A;  2M3E A;  4NPE A;  2XR8 A;  4H13 C;  4DJG A;  1SQB J;  2QEX P;  3L73 J;  1ZR4 A;  4NBA D;  1EDI A;  1USE A;  1CI6 A;  1IFJ A;  2C9L Y;  4D6T J;  3AED C;  4JYC A;  1TU3 F;  2AXT H;  3VTP C;  2XU6 A;  1RF0 A;  3HD7 D;  2Z5I A;  3HUS B;  1YJW P;  5APU A;  3CWB G;  3EFF K;  5AVT B;  3B5N B;  2HPC B;  2IBZ G;  3MZW B;  3P7K A;  2IFM A;  3JC2 2;  4NBH D;  2D2C D;  3PJS K;  2OYH C;  4LC1 A;  1VQO P;  2Z5H A;  2H8P D;  3FWN A;  3LW5 J;  2N1T B;  1IZN B;  3CPW O;  3M0D A;  2HML A;  4H0L D;  1NTK E;  2IBZ I;  2WSF H;  3MTU E;  2KSE A;  2ZFC A;  1KYO I;  3FOU A;  3OJA B;  2IZ1 A;  1IFI A;  4GT1 A;  1ULI A;  1PP9 E;  5AEU A;  1BE3 E;  1S72 P;  3BRV B;  1GD2 E;  2FYU D;  5DJU B;  4BXL A;  5K5G B;  1R5L A;  3A5T A;  2W6J H;  2Y9Y A;  2E4P A;  2R44 A;  1SFC D;  3H1H D;  3KZI E;  1KQF B;  2I1K A;  2KNC B;  1H0T B;  1NTM D;  1VDF A;  2WT7 A;  3M91 A;  2JKV A;  4C46 A;  5KTB A;  3M9Q A;  1L2P A;  1UUW A;  3A7O A;  1VF5 C;  3GB4 A;  1CSB A;  3AEF C;  1SQQ D;  4AIV A;  1O7N A;  1EZV E;  4I7Z B;  2FXO A;  1M8O B;  3N7N A;  2KZJ A;  1BDD A;  4PJ0 E;  1RQU A;  5AW6 B;  1EG9 A;  4JPZ B;  5EFW B;  3L35 A;  3H6P A;  1ZRT E;  1URQ B;  3L72 G;  1N7S B;  1Q86 Q;  1L4A C;  1HGZ A;  1N7L A;  1PV3 A;  4ZNC A;  2DE7 D;  1LTJ C;  1SS1 A;  1N8R Q;  2FYU J;  3T97 A;  4XA4 A;  1AFO A;  5AVV B;  5KJ7 A;  2ZXX A;  1NOH A;  1CI6 B;  3KPE A;  1ZV8 A;  2A06 D;  1A02 F;  4WB4 A;  4HH2 A;  1Y9B A;  4QDC A;  2P67 A;  3H1H J;  4W80 A;  2WSC J;  3ZDM A;  2K9J A;  1NTM J;  1RE4 A;  2GUV A;  3MIW A;  4OGQ D;  2JWA A;  3KDP B;  3CI9 A;  1IJD B;  3Q5R A;  1GK6 A;  1L0N D;  1M1J C;  1K9M Q;  2DE6 D;  1OIP A;  4IL6 X;  4M3L A;  1SQQ J;  3KZI H;  3SFE C;  1Y47 A;  1SP4 A;  1FZC C;  2NPS B;  3JSV C;  3CCQ P;  1BSN A;  4NBE D;  2E76 D;  4H44 B;  2WSF J;  1IFP A;  3K5B A;  4ASV A;  3O8Z A;  3VP8 A;  1XTC C;  3HD7 C;  3GHG C;  1JMM A;  1W2B O;  2GBX A;  3KQG A;  1KMI Z;  4PD4 I;  1BCC D;  1LT9 A;  1X0T A;  2QA4 P;  3GZX A;  2D2C C;  2FFD A;  1MZ9 A;  1LTG C;  2GM4 A;  2YO2 A;  4PJ0 H;  3AE1 C;  1KC8 Q;  3CCU P;  2K88 A;  1LNQ A;  3NMD A;  1SQB E;  4A7P A;  4H0L C;  3CCL P;  2Q9I A;  2ZT9 D;  1PP9 D;  2WT7 B;  2P10 A;  3SSU A;  5CBO A;  2B89 A;  2ZYD A;  1RF1 C;  1AJY A;  4N78 E;  1JOC A;  3FX0 A;  1EDJ A;  4Y99 C;  1RY3 A;  3RL0 D;  4GOE A;  1K8A Q;  3U1A A;  3M9B A;  1DH3 A;  2KIK A;  1L0N J;  5CJ4 A;  2OYI C;  4NBB D;  5KAF E;  4ASW A;  5M1B A;  3A0H E;  2OTK E;  3P8C D;  1PL5 A;  3PHL A;  2YKP A;  1DX7 A;  2QSI A;  1G1I A;  2HMK A;  1SFC C;  4HKV A;  4WWI A;  1EXJ A;  1GU5 A;  1T2K D;  3AE4 C;  1NTK G;  3AEA C;  3S9O A;  4LLH A;  1BCC J;  3T97 B;  2BCC E;  2C0X A;  3H1J D;  1DEE G;  2HLO A;  1PZQ A;  2M5A B;  2O3J A;  3AEG C;  2QPZ A;  1KB9 E;  4Z1M H;  3R2P A;  1BE3 G;  2WZ7 A;  1JMB A;  2K9J B;  1PP9 J;  3L74 J;  1Q82 Q;  1MFZ A;  1NU1 K;  2G8Y A;  1JY2 P;  1FZE A;  3BAT A;  4R4M A;  5CCG D;  2E75 B;  1YJN P;  2NVF A;  5CJ0 A;  2B87 A;  2QE7 H;  5AVR B;  3CMA P;  1QX8 A;  2WPQ A;  1NDO A;  2B9B A;  1NVO A;  3B71 A;  2V7Q H;  2DE5 D;  3TGU E;  3AEE C;  1EZV G;  1GW3 A;  1J1D C;  4IFF A;  1Q81 Q;  2ZVN B;  4NBF D;  3TYY A;  2HYN A;  5AVX B;  3V6I A;  5KAF H;  4OGQ C;  1FU1 A;  1LT9 B;  3A0H H;  1YI2 P;  1IFM A;  2FFD B;  3GZY A;  1OVU A;  5KKZ B;  4DZO A;  2JEE A;  1RE3 C;  4DT0 A;  2OTL P;  4ZKP A;  1Y8A A;  5KAI H;  1LJ2 A;  3H1J J;  1EZV I;  3TSI A;  1L4A A;  3QWO C;  3GTS A;  2E76 C;  1S3J A;  2FYU E;  1NTK K;  5AW8 B;  3BRT B;  4C7R A;  1LT1 A;  1LTJ A;  2KZI A;  4O9B A;  1ZW0 A;  1IK9 A;  1SQP D;  1M90 Q;  1SLQ A;  2AXT E;  1MUU A;  3H1H E;  3L70 D;  2HG5 D;  4GIF A;  4GOF A;  1KB9 H;  1NTM E;  4QUR A;  1QVG O;  3CCJ P;  1M57 D;  4WY4 A;  4K35 A;  3Q1M A;  2E5Y A;  3RBX A;  4HM5 A;  2KLV A;  2K1A A;  5L8R J;  1JY2 N;  4N78 D;  2CPS A;  2HOD B;  3BCC J;  1SQQ E;  3RK3 E;  4HM7 A;  3JCU E;  1M1J A;  2ZT9 C;  1S5L E;  2NUK A;  2O1J A;  3B5N D;  1VQ7 P;  4QMA A;  1FZC A;  1NH4 A;  2ZYL A;  1ULJ A;  3VMI D;  3CLQ A;  2WVR A;  3RL0 C;  2FXM A;  1LTB C;  2YKO A;  2IDB A;  3EWK A;  5TJH A;  2M3B A;  3HTK A;  3GHG A;  1OMI A;  1MV8 A;  2DW3 A;  3H25 A;  2N1T D;  1H8A A;  4WVZ A;  4HJL A;  3N0Q A;  1O7G A;  4GDO A;  2QM8 A;  1Q2N A;  2QVA A;  4QCK A;  1N73 A;  4ZMD A;  2A06 E;  1E79 H;  1SQB G;  1SQP J;  2BCC D;  2YXR B;  3L73 G;  5AW3 B;  1T2K C;  2RKL A;  1S4X A;  1KB9 D;  3CC4 P;  2H88 C;  3L70 J;  3IN6 A;  3CD6 P;  2QJP B;  1L0L G;  2B87 B;  2CK3 H;  1OW7 A;  4D6T G;  1RF1 A;  3WUU A;  2HR3 A;  3CXH H;  3H1L J;  1RIE A;  2I7F A;  3LID A;  1FZG A;  3CCV P;  3C0D A;  1EC5 A;  1L0N E;  2FY8 A;  2V7Q J;  2Q7C A;  1G8K B;  1NTZ D;  2WSC H;  1BDC A;  1JO5 A;  4KHX A;  2OYI A;  3SWY A;  1X22 A;  2JZA A;  2YIU C;  5B66 H;  5CCG C;  1JM0 A;  4OH8 B;  4NBG D;  1A02 J;  3P32 A;  3GTE A;  1FOS F;  3JCU H;  4W7Y A;  2LR2 A;  3TGU D;  3U1C A;  2R3S A;  1S5L H;  1R5S A;  2XSH A;  5AVQ B;  1BCC E;  1L4A B;  1JY2 O;  3CWB J;  1FQT A;  1ZN5 A;  2FKW B;  1G8J B;  1J1E B;  1S1C X;  5KLV D;  4PV1 B;  2KOG A;  1SQV E;  1HBW A;  1URQ D;  3OA7 A;  3BVH A;  1N7S D;  2BCC J;  4HM1 A;  4EMJ B;  1AVO A;  5CHX A;  1LWU B;  3L74 E;  2QJY C;  5AVZ B;  4RO0 A;  4EYY Q;  2E4Q A;  1GU4 A;  2K3R A;  4WY4 B;  2ZXE B;  1T6A A;  2QJK C;  3L37 A;  3CXH D;  5CCH A;  1GL2 B;  4L74 A;  4U7J A;  3VMZ A;  1SQB K;  4JYB A;  1KD1 Q;  4HM2 A;  1M1J B;  4C7N B;  1RQV A;  4RKU J;  1NTZ J;  1QL1 A;  2YKQ A;  1FZC B;  2WQY C;  3P8C E;  3TDK A;  1L0L K;  3VP9 A;  4CPG A;  5AW0 B;  1KIL E;  2IZ0 A;  1LTI C;  3HE5 A;  1DD4 A;  3QH9 A;  3RK3 D;  5E79 E;  5H2F E;  1JTH B;  2YFJ A;  2NPS D;  4AYC A;  2O01 N;  3TGU J;  3H1I E;  4H44 D;  3CL3 D;  3V2N A;  3L36 A;  4OWF A;  2L91 A;  2N9Y B;  4EDF A;  1UUV A;  3CX5 H;  3H1J E;  1RE3 A;  5KLV J;  1N73 B;  3HUS C;  2E74 B;  4KT0 J; 
#chains in the Genus database with same CATH homology
 4HM8 A;  2JO6 A;  1PP9 E;  5AEU A;  1BE3 E;  2ZYL A;  2XSH A;  4QDC A;  1BCC E;  1ULJ A;  2QJP C;  3EQQ A;  3VMI D;  4HM6 A;  1FQT A;  3AZC A;  3L70 E;  1NDO A;  3EN1 A;  2HMJ A;  1G8J B;  1NTZ E;  2DE5 D;  4H13 D;  4NBB D;  3TGU E;  3CX5 E;  2E4P A;  2XR8 A;  3L72 E;  4OGQ D;  3DQY A;  1PPJ E;  1BGY E;  4P1C H;  3H1L E;  4NBF D;  1SQV E;  1WQL A;  1O7M A;  4QUQ A;  4HM1 A;  4NBA D;  4NBC D;  2E75 D;  5KLI C;  4EMJ B;  2CKF A;  2DE6 D;  3GL0 A;  3GKE A;  4HKV A;  3L74 E;  2HMK A;  2QJY C;  3N0Q A;  2FYN C;  3GZY A;  1O7G A;  4HJL A;  4QUP A;  2YFL A;  2E4Q A;  4U3F E;  4QCK A;  3GL2 A;  2QJK C;  2XSO A;  4NBE D;  2A06 E;  2E76 D;  4QDF B;  2HMO A;  1SQX E;  1VF5 D;  2YVJ B;  2E74 D;  4P1B H;  3BCC E;  2NVE A;  3GTS A;  5CXM A;  1JM1 A;  2Q3W A;  2FYU E;  1UUW A;  4HM0 A;  4HM3 A;  1RFS A;  2BMO A;  3GB4 A;  4HM2 A;  4AIV A;  4NB8 D;  1O7N A;  2GBW A;  3L73 E;  4HM4 A;  1VM9 A;  5KLV E;  1EZV E;  2BCC E;  3L71 E;  4NBD D;  3H1K E;  2B1X A;  4PV1 D;  5BOK A;  2QPZ A;  3VMH D;  4NBH D;  2GBX A;  1KB9 E;  1O7H A;  2D2C D;  3CWB E;  4NB9 D;  1NYK A;  4QDD A;  3H1H E;  1VCK A;  1RIE A;  2I7F A;  2HMN A;  1EG9 A;  2NUM A;  3GZX A;  3C0D A;  1L0L E;  1L0N E;  1O7W A;  1NTM E;  4D6T E;  2HMM A;  2NVG A;  4QUR A;  5HL4 A;  1G8K B;  1ZRT E;  3GOB A;  2NWF A;  2BMR A;  2YFI A;  4PD4 E;  2HML A;  2JZA A;  1O7P A;  1SQB E;  4H0L D;  1NTK E;  2YFJ A;  3CXH E;  4HM5 A;  4QDF A;  1NU1 E;  5AEW A;  2BMQ A;  5KKZ C;  3H1I E;  4H44 D;  2DE7 D;  2YIU C;  2NVF A;  1SJG A;  3GCE A;  1P84 E;  2ZT9 D;  1Q90 C;  4NBG D;  3FOU A;  1SQQ E;  4HM7 A;  3L75 E;  3GTE A;  3VCP A;  2XRX A;  3VCA A;  3VMG D;  2IBZ E;  1UUV A;  2NUK A;  3H1J E;  2B24 A;  1SQP E;  1ULI A;  4AAY B;  1KYO E;  3D89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...