1NTKE

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 50
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntkE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntkE02
4NB9D 5AEUA 1SQPE 2IBZE 1NDOA 1SJGA 4EMJB 2NUMA 2BMOA 3EQQA 5BOKA 2NUKA 2HMLA 4D6TE 4HM6A 3H1JE 4H44D 1L0NE 4NBAD 1RFSA 3CX5E 1ULIA 3N0QA 2HMOA 4QDDA 3GZYA 1NYKA 2ZT9D 4HM1A 2NVGA 2BCCE 2B1XA 3L75E 1ZRTE 3L72E 2YIUC 4NB8D 3FOUA 4HM0A 2QJYC 3H1KE 4HJLA 4NBGD 3L73E 2QJKC 3D89A 4NBFD 4QUPA 3VMHD 4QDFB 2E4PA 2XSHA 1WQLA 2BMRA 1BE3E 1L0LE 1ULJA 2HMMA 4U3FE 1VCKA 5KKZC 1O7NA 3TGUE 2YFJA 3DQYA 1NTME 2A06E 1KYOE 4H0LD 2JO6A 2DE5D 1Q90C 2GBXA 2DE7D 5KLIC 3L71E 2XRXA 3GTSA 1G8KB 2NVEA 4OGQD 3H1LE 1SQQE 1O7HA 2HMKA 2QPZA 3GL2A 4P1BH 1O7MA 1UUVA 1PP9E 3GL0A 4QDFA 4NBED 4HM3A 1O7WA 2E74D 2FYUE 4HM2A 1FQTA 4HM8A 4QUQA 2HMNA 3CXHE 2I7FA 3GCEA 4HM4A 3GTEA 2E76D 1BCCE 2ZYLA 5CXMA 5HL4A 3H1HE 1EZVE 3EN1A 1SQBE 3VCPA 4AIVA 2GBWA 2YFIA 1VM9A 1KB9E 2XR8A 3VMID 3BCCE 4NBBD 4NBDD 2NVFA 1NU1E 3AZCA 3L70E 1G8JB 4P1CH 2E75D 2JZAA 3VCAA 2XSOA 2CKFA 1EG9A 3GOBA 1VF5D 2NWFA 4QDCA 3GZXA 1O7PA 2YFLA 2HMJA 1BGYE 3CWBE 1PPJE 2BMQA 1UUWA 3GKEA 1O7GA 1SQVE 4QURA 2YVJB 4PD4E 1JM1A 3GB4A 1NTKE 3C0DA 2D2CD 4H13D 3H1IE 4HM7A 1SQXE 4HKVA 2E4QA 4NBCD 4QCKA 1P84E 5KLVE 2B24A 1RIEA 5AEWA 3L74E 3VMGD 4PV1D 2QJPC 2FYNC 2Q3WA 4HM5A 4NBHD 1NTZE 2DE6D 4AAYB
chains in the Genus database with same CATH superfamily
3EFGA 4MN4C 5BOKA 1SQBG 4K35A 1VPCA 3CXHH 2K9JB 2Y9YA 2N1TC 1BE3J 1E5WA 2FYUJ 2E4PA 1BE3E 2OARA 4U3FE 2AEJA 3CX5H 2OYHA 2R44A 2GBXA 3L73D 1FC2C 3ITKA 3HD7C 1UUVA 5CCGA 4EYYQ 4NBED 1L0NJ 1R5LA 1LWUB 4NPEA 1U7JA 1NTMD 3FX0A 2BCCD 4DOJA 2NPSB 1OZHA 1JOCA 1PP9D 5AVQB 2MKVA 1NTKD 3VYIA 3V4WA 3FGAD 1YQ4C 2NPSA 2WPRA 5GTIE 2JEEA 3CWBE 3G9RA 2YXRB 1J2JB 1E79H 2BASA 1AQTA 3PJSK 5CJ4A 1YITP 3O6QA 3B71A 1P84E 3QH9A 1PPJD 2E74C 1CZQA 3KZIH 4ZKPA 3N4XA 4EMJB 2NUKA 3P8MC 3HTKB 3BASA 2KLVA 5AW8B 1VQNP 3N0QA 1FOSF 3MD0A 1ZXGA 2YIUC 5L8RJ 3RL0B 1GD2E 1M1JB 3HE5B 2OYHB 2XSHA 2K37A 1NTKG 4GOFA 3M0DC 1O7NA 1KYOE 4IL6E 3L75J 1N86A 2B9BA 4U3FJ 1FOSE 1EDJA 2AXTE 4H0LC 3D71A 4IFFA 3Q1MA 1LNQA 1H0TA 2GBWA 5GTHE 2AXCA 2XV5A 3GHGA 5E79H 3RBZA 1Z56A 2WPSA 3GOBA 4HKZH 2NWFA 1Q2NA 1KV4A 2RKLA 1X8YA 1G2CB 3OW2O 2FFDB 4R4MA 2O1JA 1LTIC 1JM1A 2POHA 3RL0g 1NTMG 4WBAA 2M3EA 3JCUE 5KLVJ 5AW2B 1NTMK 2KP8A 2YIUB 3VMGD 2OYIC 1RHZB 2E75B 2K3RA 4I6MC 2QIWA 2JJLA 1BGYJ 2KSJA 5AVZB 1A02F 1VQ4P 4H44D 3IFMA 3F5HA 3RK3D 3BRVB 3PHLA 2N9BA 3EQ2A 1AVYA 2CPSA 5CBOA 3CMEP 1L0LJ 4H0LB 1R8EA 4QUPA 1VCKA 1PP9J 2P10A 5APSA 1Q90C 3H1LE 5KLVG 2YKQA 2P58A 1O7HA 1NTMJ 1N7SB 1FDMA 5CMZA 4XA4A 1YTZI 1J1DB 1HTLC 3AEAC 3JC22 2KYVA 5APVA 4D6TG 2PRRA 4NPDA 4AUWA 1Q86Q 1S5LH 2Y0CA 4NBBD 3NMDA 2Q6QA 1LP1B 3MHVA 4H44C 1G8JB 2Y0DA 2KOGA 1H8AA 1GL2A 1EG9A 5APTA 3B5NB 2LKMA 4GDOA 3GKEA 2JWAA 5AW1B 2JP3A 5KAFE 3HUSC 3AE4C 1HUCA 4JYBA 4B86A 4H13D 1N73C 3CC4P 2A06G 2IFMA 4HKVA 1DIPA 1OIPA 2KZJA 1RQUA 1KFMA 2JR8A 2WSEH 4TLFA 2H89C 4GIFA 5CJ0A 1FZFA 2HPCA 1IJDB 1HGZA 3Q5SA 1A02J 2W6JH 3VP8A 1L0NE 1NHLA 1VQ6P 1PFIA 5APUA 3BCCG 1OVVA 1NYKA 1G2CA 2FFDA 3B5NA 3R4YA 2KI7B 1USEA 1FE6A 1OW7A 2OTLP 3AE3C 1DEBA 1LP1A 3CX5I 1VL2A 4GODA 1ZN5A 2GA1A 1K73Q 2QJKB 3BATA 3DQYA 2DE7D 2UWJE 3L71E 2XRXA 4CPGA 1P84H 4PD4D 2Y9ZA 1RH5B 1CI6A 3TSIA 1JY2O 3L73G 4HM3A 1NU1D 1O7WA 5AW6B 1S5LX 5APWA 1K04A 3MUDA 3RK2D 1BCCE 2K9JA 3EN1A 1YQ3C 5AVXB 1GTWA 1PGPA 3HE5A 2YMKA 3KXDA 4ZMDA 3CCMP 1LT1A 2L5GB 2OYIB 1AV1A 3O6QB 1OMIA 1N73A 1SQVE 3H1KD 1VQ7P 2KB7P 1L0LK 2WSEJ 1AFOA 3L70J 1IK9A 1JTHA 2FXOA 3HRNA 3GF3A 4YXWH 1FZCB 4PD4H 1ZR2A 3PTZA 4GT1A 1Q90D 1Y47A 2HPCB 1LTGC 5CBNA 1LWUA 5C39A 4HM1A 2ZT9D 1L4AA 1IFNA 3L72E 1W5CE 2FYNB 4NBGD 1NTZG 2D2CB 1JY2N 4ZKUA 1GW4A 3RL0D 4QDFB 3TNUA 1J1DC 2MJZA 5B66E 2KZIA 4HH2A 1NJIQ 2G3AA 3WUUA 5KLIC 4PV1B 1PL5A 3M0DA 2N1TB 2QPZA 5AW5B 1O7MA 1HVVA 1K9MQ 1KYOD 1N2DC 3QWOC 2YO2A 1K05A 1ZRTD 1S3JA 2M5AB 5KLVK 1ZR4A 3HUSB 3PP5A 2PGDA 2AEFA 2J59M 3GW6A 2XSOA 2HR3A 1NKNA 3AEGC 3CPWO 1GK4A 2WITA 2IBZG 3B4SA 1T2KC 4AQRD 2Q3EA 3C0DA 1UIXA 4XE5B 3L74J 3PH0A 3WUVA 1RE4A 4PV1D 2Q3WA 4JBZA 2RH0A 3H1HG 3TGUG 2PAJA 3L4FA 1S4XA 3AE9C 1S5LE 1QGKB 3B5ND 1N7SD 4NB8D 2E42A 3IN6A 3CI9A 2HODB 1GZLA 2Q3IA 2KNCA 1WQLA 3TGUE 1FJPA 4N78D 3RL0C 4H0LD 1KILD 1IZNB 2BCCJ 4W7ZA 2QE7H 2VRSA 3OA7A 3GL0A 3AEBC 2ZAEB 2QA4P 5AVRB 2E74D 1PZQA 1EDKA 3GCEA 4QMAA 3AE5C 1SQPJ 1NAYA 3L73J 4BRYA 1NTZD 1EXJA 2OYIA 1W2EA 1LT9B 5CCHC 3AEFC 2W8ZA 3WU2H 2M8RA 4L74A 1JY2P 3S4RA 3MIWA 1SQXK 3MGNA 2JO1A 3GB4A 1M57D 2D2CD 1RF1C 1QVFO 3SWKA 4HM7A 4JF7A 1FZBA 2A45G 3BCCJ 3KZIE 3AE1C 2W90A 1JY3P 1SS1A 5AVTB 3HTKA 4A7PA 1KN7A 3JSVC 3H1LD 4DT0A 3FWNA 5TISH 2W27A 1FZGA 3V2QA 2E75C 2IZ1A 4JYCA 1HGVA 1L0LD 2BCCE 1VF5B 2LXBA 1AA0A 1M90Q 1RY3A 2QJYC 5B5EE 2WSCH 3SFEC 2YXQB 3ZDMA 1BGYG 5APYA 2W6BA 3UIAA 1L0NK 3GTSA 2NVEA 3AEDC 4P1BH 5AW9B 3CCLP 1JCDA 5AVYB 1PGOA 1QL2A 1MFTA 3VCPA 2KK7A 2FY8A 1SQQD 3A0HH 3VOPA 1N7SC 1NO4A 1RE3A 1GK6A 1VF5D 2IDBA 3KHUA 5AVSB 1Q82Q 2IYPA 4KHXA 2BMQA 3HE4B 4OVNF 2YVJB 2N1TD 3JCUH 3CCEP 2IBZD 2WSFJ 1RQVA 1WRGA 2E4QA 2E43A 3CCSP 1VF5C 2QJPC 2A06D 4WY4B 4NBHD 1JO5A 5AEUA 4HM6A 5BU5A 1ULIA 3L71G 1K8AQ 3AEEC 1W2BO 3HE4A 1BDCA 1KB9D 1LWUC 3L73E 3H1HJ 2KSEA 1IK7A 5KKZB 2KS1A 1IFIA 4AYCA 3FXEA 2YFJA 3M9BA 1NTME 2W83C 1SQXG 1YIJP 3P7KA 3VMYA 2ZYGA 1H0TB 2LXCB 4BRYB 1YHQP 3GL2A 1PP9E 4D6TD 3EFFK 4WY4D 1GW3A 2HMNA 3CXHE 3GF7A 1KD1Q 5CXMA 1NOHA 1M8OB 1SQBE 2YFIA 1SFCC 3CWBD 2OQQA 1IFJA 1URQB 4I2LC 1JMBA 4GKGA 4OH8B 3CX5D 3VTPC 3TDKA 3TGUD 1NTKJ 4EI2A 3GZXA 5KTBA 5AW3B 3KDPB 1UUWA 1SQVJ 4PD4E 1JY3O 5DJUB 1X22A 4W7YA 4RO0A 4PJ0E 4WY4A 2M0BA 3LIDA 2WSFH 1X79B 4QCKA 3T97A 5KLVE 5AVWB 1L0ND 2O01H 2QM7A 1SP4A 3C9IA 1NTZE 4AAYB 2IBZE 1RF0A 3S9OA 1ZW0A 3D6YA 2JWDA 3V2PA 3MZWB 4U7JA 2I1KA 3KQGA 4UB8H 2IYOA 1ZRTE 3D6ZA 1SFCA 4DZOA 4HJLA 3U1AA 1D7MA 2BMRA 3A7OA 4C7NB 2D2CC 3N7NA 4N3YB 1ZOYC 2V4HA 4OGQC 2HLOA 2HG5D 1IO4A 4YPCA 1SQPK 1L0NG 1KTMA 3WMM0 1T3UA 2E75D 1OFCX 3H1JJ 1GL2D 1EZVD 4QDCA 2H7HA 1O7PA 2ZT9B 1L4AC 2QJPB 1URQA 3WUTA 1EDIA 1IFPA 2FKWB 1YI2P 4DJGA 3Q5RA 1KB9I 3TYYA 1EZVI 3V2NA 2FYZA 1RIEA 2Q1KA 1RF1B 3H1LG 2OTKE 1JB0J 1H88A 2E74B 1JM0A 2DE6D 1SQBJ 1LTJB 3M91A 3L72D 2IX7C 5AW4B 2FXPA 4WVZA 1OVRA 3H1JE 1BDDA 2XNXA 2WSSH 3L70G 3V4QA 1BSHA 2YKPA 1OX3A 2GUSA 3V2RA 1HH0A 2XDJA 1SQVK 1BCCJ 4NBFD 1FBMA 1L0LE 3P8CE 2SPZA 2C0WA 1IFMA 4EIJA 2B87B 3RK2B 1SQQJ 1T2KD 5CCHA 1AQ5A 3E7KA 1NU1G 4H44B 4HYTB 3H32A 4NPFX 1G8KB 4OGQD 3A2AA 3U59A 1L4AD 4WWIA 1YJWP 3BCCD 2ZT9C 2C0XA 1FDOA 2WPVB 2FYUE 1RE4C 1WMKA 3E1RA 3I55P 3HD7B 4GOEA 1RF1A 3Q3DA 2P67A 2P1JA 1SLQA 1KQGB 3A0BE 1KB9E 1QVGO 2NPSC 3AZCA 1KZUB 4OWFA 4TT3H 4ZNCA 2ZYAA 1SQXJ 2IFNA 3GMAA 1PV3A 3H1IJ 1JCCA 1SVFA 3IF4A 3M9QA 4I1LA 2O3JA 2IBZI 4HB1A 2QG4A 3H1IE 2C9LY 1VQ5P 5KJ7A 1EC5A 2B24A 2Q7CA 3TK1A 2H88C 1OWAA 5AW7B 3Q2YA 3I56P 4IL6H 1SQBD 1DEEG 3I5CA 5AVUB 3NXSA 2RN0A 1SJGA 1M7LA 1Y9BA 4R4LA 1N8RQ 2NUMA 5DJTB 3VN0A 1FAVA 1L0LG 2V7QH 1VQOP 3VMXA 3CX5E 1XTGB 3L75E 4N78E 3HUSA 2H43A 1JMMA 3H1JD 2M5AA 1HBWA 2QJKC 4N6JA 5KAIE 3AE7C 2XZRA 1G1IA 3A5TA 5KKZC 3CCRP 1CSBA 3S1KA 2W6AA 1LJ2A 1M1JC 2Z5IA 2FXMA 2ZFCA 3M0AA 1XTCC 2CK3H 1JNMA 5GTIH 1DX7A 4L76A 3LIEA 2YKOA 1SQVD 1OW8A 3BCCE 2NVFA 3USSA 1PP9G 1KB9H 1GU4A 2YFLA 1ZP0C 1Q7YQ 1VQ8P 2BEQD 3W68A 3G71P 1M1JA 1JEKA 1O7GA 3CWBJ 3TF5A 4DCKA 1NU1K 4U3FG 2FFDC 3AECC 1SQBK 3L75G 2NZ2A 4Y99B 2WZ7A 2FYNC 1M1KQ 2WMMA 4HM5A 2GM4A 1KILE 3T97B 1YJ9P 4NB9D 2E5YA 2DW3A 3FWLA 3PLNA 2GUVA 3L74D 5H2FE 4PV1C 3GZYA 1WT6A 3ABVC 2IPPA 3H1HD 3VP9A 3V6IA 1X9VA 2B89A 1NKZB 3TGUJ 1T3JA 3D89A 1GL2C 1JY3N 2HMMA 1U57A 2WPQA 2A06E 1AJYA 3RK2C 2P7JA 2JO6A 4I7ZC 2JDIH 1MV8A 4H13C 1VDFA 4RESB 1SQQE 3O8ZA 2HMKA 3F89A 3G6EP 2JKVA 3PRJA 3IAOA 4HM2A 1FQTA 1N7SA 2ZYLA 3CL3D 4AIVA 1RE3C 3SSUA 4M3LA 2XR8A 1LTJA 1S1CX 1VQLP 4NBDD 4UB6H 2K1AA 3VCAA 2O1KA 1SQQG 4RKUJ 1SQXD 1YTZT 1HWTC 3SWYA 4YXDC 2XNDH 1QEXA 1EXIA 1PIXA 1L4AB 1NTKE 1HJBA 3MUDC 1PGQA 2Q5UA 2QSIA 1EQ7A 1H89A 1ZV8A 2ITAA 1VQ9P 3SFDC 2E5TA 1QL1A 1NDOA 1N7LA 2R32A 1P84D 4IOIH 1M56D 1UIIA 3A0BH 4LGDE 2OYOA 3SWFA 2KS1B 3L74G 2FBWC 4HM0A 5AVVB 3CMAP 3H1ID 1CW5A 3MP7B 3VMHD 1YYCA 4LC1A 4IFMA 1DH3A 5KLIB 1KYOH 3E1IA 1FU1A 1Q81Q 2IZ0A 3U1CA 3TNUB 4QDFA 1USDA 3CCUP 3H32B 1S9KD 5BU8B 4Z1MH 3KPEA 5HL4A 2AXTH 1ZMEC 4HJGH 4ASVA 1GMJA 2V7QJ 3A3YB 4BWNA 2B88A 1NU1E 5BVZA 5KAFH 2QVAA 3L70E 1J1EB 1BE3D 5E79E 1VQKP 2KUBA 4RJTA 2E76B 2WSCJ 4UB6E 2FYUG 1BE3G 1LGHB 1NTZJ 3R2PA 1VQPP 2FYUK 1KILC 1OVUA 3C8VA 1SQPD 2N1TA 1T6AA 1FJKA 2ZXEB 3FXDA 2YNYA 3LW5J 3P8CD 2QJYB 2N9YB 1GU5A 4BXLA 2O01J 2HFED 4C7RA 4C46A 1IFDA 4D6TE 1FZCC 1OXZA 4NBAD 1RFSA 3AE2C 4UB8E 2ZVOB 1U7MA 3K5BA 3M9HA 3NFQA 2R3SA 3CXHD 1DD3A 4L75A 3L71J 3RK3B 2R5BA 1FDIA 4I7ZB 1SQQK 3L37A 1YBKA 1SQVG 1CI6B 3RBXA 1FZAA 1GL2B 3CXHI 1JTHB 3H6PA 3H25A 1BGYD 1R5SA 3AE6C 5AW0B 5CCHD 3LW5H 2NPSD 2A45H 2E76C 3KYQA 2WTYA 4YTPC 4C7NA 1VQMP 2C9NY 2A45I 3CWBG 3GG2A 4QUQA 5KLVD 1QLED 4ASWA 3H1HE 3OAKA 1PGJA 1VM9A 2WQYC 1TU3F 1FS0E 2Q9IA 1KQFB 5B5EH 1MUUA 1NTKK 2XKMA 1S9KE 3L72G 2CKFA 4L73A 1KILA 1P84I 2HMJA 2YMYA 1T8ZA 3CD6P 1PPJE 3CC7P 4QURA 5CHXA 5GTHH 3CC2P 4Y28J 1KC8Q 1HF9A 1MZ9A 4U3FD 2L91A 2I8DA 3GHGC 1LTTC 4Y99C 1SQPE 5TJHA 3A0HE 1PPJG 2OGUA 2OTJP 5KAIH 1S72P 1NH4A 1OW6A 1DD4A 3IR9A 5EFWB 4QDDA 3AE8C 2RMZA 1GDTA 3FOUA 3H1KE 3II6A 1KFNA 5B66H 1S2EA 5CCGC 2NRGA 4KJMA 2P2UA 1SFCB 4JPZB 1QX8A 4WB4A 1KQSO 2DE5D 4W80A 3H1KG 5KJ7C 1YJNP 4H13B 1J1EC 2XU6A 4D6TJ 4HM8A 2Z4EA 3G4SP 3RK3E 2E76D 1G1JA 1KORA 3GTEA 4K3AA 3L75D 2KLUA 3B5NC 1KYOI 3H1KJ 1URQC 1KILB 1AVOA 1MKMA 2K88A 2Z5HA 2WT7A 2JZAA 1N73B 1FZEA 2Y0EA 2J5UA 1SQPG 3HD7D 2O01N 4O9BA 2M3BA 3OJAB 3G3ZA 4IL6X 1SQXE 4LLHA 1FZCA 2ZJSE 4NBCD 5H2FH 5AEWA 1NU1J 1NTZK 2AEMA 3GLMA 3EWKA 1LT9C 4WY4C 2G8YA 2B87A 1KQLA 2YO3A 3NTNA 3L70D 2BMOA 3CCVP 1JUNA 3EQQA 2HMLA 4KT0J 4EOTA 3VMZA 3B8EB 2KNCB 1IC2A 2HODA 2HMOA 5K5GB 1NAFA 2FYUD 2QEXP 5KJ7D 2NVGA 1BCCD 2B1XA 3BVHA 2PFXA 5APXA 3CCQP 3P32A 3RK3C 4OGQB 1LTAC 1LT9A 1NWQA 1BSNA 4PJ0H 1NGMB 1SFCD 2CPBA 3CCJP 1ULJA 2HYNA 2QRXA 3CLQA 3L35A 2PP6A 2ZVNB 5CCGD 3H1IG 3D70A 3H1LJ 1NVOA 3L72J 2R3CA 1RF0C 3VMAA 2OYHC 3V5BA 2LR2A 2R5DA 2WWWA 3L36A 3WU2E 1KMIZ 2I7FA 4HM4A 1ZLLA 1L2PA 1MFZA 1LTBC 1Y8AA 1EZVE 1LTSC 4PD4I 3H1JG 2WT7B 4IFDK 3VMID 2BCCG 3Q5PA 1URQD 1EDLA 2KIKA 4P1CH 2ZYDA 3W67A 3RGUA 2QM8A 2BEZF 4JQ0D 2WVRA 1BGYE 3C1LA 2I1JA 3L71D 3MTUE 4XFJA 1BCCG 1EZVG 1X0TA 3BRTB 5TISE 3HD7A 2H8PD 1NYHA 4EDFA 2J58A 1LTJC 3L74E 3M06A 5M1BA 2K9YA 1HJ0A 5APQA 2ZXXA 3GHGB 2KXPB
chains in the Genus database with same CATH topology
4NB9D 5AEUA 1SQPE 2IBZE 1NDOA 1SJGA 4EMJB 2NUMA 2BMOA 3EQQA 5BOKA 2NUKA 2HMLA 4D6TE 4HM6A 3H1JE 4H44D 1L0NE 4NBAD 1RFSA 3CX5E 1ULIA 3N0QA 2HMOA 4QDDA 3GZYA 1NYKA 2ZT9D 4HM1A 2NVGA 2BCCE 2B1XA 3L75E 1ZRTE 3L72E 2YIUC 4NB8D 3FOUA 4HM0A 2QJYC 3H1KE 4HJLA 4NBGD 3L73E 2QJKC 3D89A 4NBFD 4QUPA 3VMHD 4QDFB 2E4PA 2XSHA 1WQLA 2BMRA 1BE3E 1L0LE 1ULJA 2HMMA 4U3FE 1VCKA 5KKZC 1O7NA 3TGUE 2YFJA 3DQYA 1NTME 2A06E 1KYOE 4H0LD 2JO6A 2DE5D 1Q90C 2GBXA 2DE7D 5KLIC 3L71E 2XRXA 3GTSA 1G8KB 2NVEA 4OGQD 3H1LE 1SQQE 1O7HA 2HMKA 2QPZA 3GL2A 4P1BH 1O7MA 1UUVA 1PP9E 3GL0A 4QDFA 4NBED 4HM3A 1O7WA 2E74D 2FYUE 4HM2A 1FQTA 4HM8A 4QUQA 2HMNA 3CXHE 2I7FA 3GCEA 4HM4A 3GTEA 2E76D 1BCCE 2ZYLA 5CXMA 5HL4A 3H1HE 1EZVE 3EN1A 1SQBE 3VCPA 4AIVA 2GBWA 2YFIA 1VM9A 1KB9E 2XR8A 3VMID 3BCCE 4NBBD 4NBDD 2NVFA 1NU1E 3AZCA 3L70E 1G8JB 4P1CH 2E75D 2JZAA 3VCAA 2XSOA 2CKFA 1EG9A 3GOBA 1VF5D 2NWFA 4QDCA 3GZXA 1O7PA 2YFLA 2HMJA 1BGYE 3CWBE 1PPJE 2BMQA 1UUWA 3GKEA 1O7GA 1SQVE 4QURA 2YVJB 4PD4E 1JM1A 3GB4A 1NTKE 3C0DA 2D2CD 4H13D 3H1IE 4HM7A 1SQXE 4HKVA 2E4QA 4NBCD 4QCKA 1P84E 5KLVE 2B24A 1RIEA 5AEWA 3L74E 3VMGD 4PV1D 2QJPC 2FYNC 2Q3WA 4HM5A 4NBHD 1NTZE 2DE6D 4AAYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB9 D;  5AEU A;  1SQP E;  2IBZ E;  1NDO A;  1SJG A;  4EMJ B;  2NUM A;  2BMO A;  3EQQ A;  5BOK A;  2NUK A;  2HML A;  4D6T E;  4HM6 A;  3H1J E;  4H44 D;  1L0N E;  4NBA D;  1RFS A;  3CX5 E;  1ULI A;  3N0Q A;  2HMO A;  4QDD A;  3GZY A;  1NYK A;  2ZT9 D;  4HM1 A;  2NVG A;  2BCC E;  2B1X A;  3L75 E;  1ZRT E;  3L72 E;  2YIU C;  4NB8 D;  3FOU A;  4HM0 A;  2QJY C;  3H1K E;  4HJL A;  4NBG D;  3L73 E;  2QJK C;  3D89 A;  4NBF D;  4QUP A;  3VMH D;  4QDF B;  2E4P A;  2XSH A;  1WQL A;  2BMR A;  1BE3 E;  1L0L E;  1ULJ A;  2HMM A;  4U3F E;  1VCK A;  5KKZ C;  1O7N A;  3TGU E;  2YFJ A;  3DQY A;  1NTM E;  2A06 E;  1KYO E;  4H0L D;  2JO6 A;  2DE5 D;  1Q90 C;  2GBX A;  2DE7 D;  5KLI C;  3L71 E;  2XRX A;  3GTS A;  1G8K B;  2NVE A;  4OGQ D;  3H1L E;  1SQQ E;  1O7H A;  2HMK A;  2QPZ A;  3GL2 A;  4P1B H;  1O7M A;  1UUV A;  1PP9 E;  3GL0 A;  4QDF A;  4NBE D;  4HM3 A;  1O7W A;  2E74 D;  2FYU E;  4HM2 A;  1FQT A;  4HM8 A;  4QUQ A;  2HMN A;  3CXH E;  2I7F A;  3GCE A;  4HM4 A;  3GTE A;  2E76 D;  1BCC E;  2ZYL A;  5CXM A;  5HL4 A;  3H1H E;  1EZV E;  3EN1 A;  1SQB E;  3VCP A;  4AIV A;  2GBW A;  2YFI A;  1VM9 A;  1KB9 E;  2XR8 A;  3VMI D;  3BCC E;  4NBB D;  4NBD D;  2NVF A;  1NU1 E;  3AZC A;  3L70 E;  1G8J B;  4P1C H;  2E75 D;  2JZA A;  3VCA A;  2XSO A;  2CKF A;  1EG9 A;  3GOB A;  1VF5 D;  2NWF A;  4QDC A;  3GZX A;  1O7P A;  2YFL A;  2HMJ A;  1BGY E;  3CWB E;  1PPJ E;  2BMQ A;  1UUW A;  3GKE A;  1O7G A;  1SQV E;  4QUR A;  2YVJ B;  4PD4 E;  1JM1 A;  3GB4 A;  1NTK E;  3C0D A;  2D2C D;  4H13 D;  3H1I E;  4HM7 A;  1SQX E;  4HKV A;  2E4Q A;  4NBC D;  4QCK A;  1P84 E;  5KLV E;  2B24 A;  1RIE A;  5AEW A;  3L74 E;  3VMG D;  4PV1 D;  2QJP C;  2FYN C;  2Q3W A;  4HM5 A;  4NBH D;  1NTZ E;  2DE6 D;  4AAY B; 
#chains in the Genus database with same CATH topology
 3EFG A;  4MN4 C;  5BOK A;  1SQB G;  4K35 A;  1VPC A;  3CXH H;  2K9J B;  2Y9Y A;  2N1T C;  1BE3 J;  1E5W A;  2FYU J;  2E4P A;  1BE3 E;  2OAR A;  4U3F E;  2AEJ A;  3CX5 H;  2OYH A;  2R44 A;  2GBX A;  3L73 D;  1FC2 C;  3ITK A;  3HD7 C;  1UUV A;  5CCG A;  4EYY Q;  4NBE D;  1L0N J;  1R5L A;  1LWU B;  4NPE A;  1U7J A;  1NTM D;  3FX0 A;  2BCC D;  4DOJ A;  2NPS B;  1OZH A;  1JOC A;  1PP9 D;  5AVQ B;  2MKV A;  1NTK D;  3VYI A;  3V4W A;  3FGA D;  1YQ4 C;  2NPS A;  2WPR A;  5GTI E;  2JEE A;  3CWB E;  3G9R A;  2YXR B;  1J2J B;  1E79 H;  2BAS A;  1AQT A;  3PJS K;  5CJ4 A;  1YIT P;  3O6Q A;  3B71 A;  1P84 E;  3QH9 A;  1PPJ D;  2E74 C;  1CZQ A;  3KZI H;  4ZKP A;  3N4X A;  4EMJ B;  2NUK A;  3P8M C;  3HTK B;  3BAS A;  2KLV A;  5AW8 B;  1VQN P;  3N0Q A;  1FOS F;  3MD0 A;  1ZXG A;  2YIU C;  5L8R J;  3RL0 B;  1GD2 E;  1M1J B;  3HE5 B;  2OYH B;  2XSH A;  2K37 A;  1NTK G;  4GOF A;  3M0D C;  1O7N A;  1KYO E;  4IL6 E;  3L75 J;  1N86 A;  2B9B A;  4U3F J;  1FOS E;  1EDJ A;  2AXT E;  4H0L C;  3D71 A;  4IFF A;  3Q1M A;  1LNQ A;  1H0T A;  2GBW A;  5GTH E;  2AXC A;  2XV5 A;  3GHG A;  5E79 H;  3RBZ A;  1Z56 A;  2WPS A;  3GOB A;  4HKZ H;  2NWF A;  1Q2N A;  1KV4 A;  2RKL A;  1X8Y A;  1G2C B;  3OW2 O;  2FFD B;  4R4M A;  2O1J A;  1LTI C;  1JM1 A;  2POH A;  3RL0 g;  1NTM G;  4WBA A;  2M3E A;  3JCU E;  5KLV J;  5AW2 B;  1NTM K;  2KP8 A;  2YIU B;  3VMG D;  2OYI C;  1RHZ B;  2E75 B;  2K3R A;  4I6M C;  2QIW A;  2JJL A;  1BGY J;  2KSJ A;  5AVZ B;  1A02 F;  1VQ4 P;  4H44 D;  3IFM A;  3F5H A;  3RK3 D;  3BRV B;  3PHL A;  2N9B A;  3EQ2 A;  1AVY A;  2CPS A;  5CBO A;  3CME P;  1L0L J;  4H0L B;  1R8E A;  4QUP A;  1VCK A;  1PP9 J;  2P10 A;  5APS A;  1Q90 C;  3H1L E;  5KLV G;  2YKQ A;  2P58 A;  1O7H A;  1NTM J;  1N7S B;  1FDM A;  5CMZ A;  4XA4 A;  1YTZ I;  1J1D B;  1HTL C;  3AEA C;  3JC2 2;  2KYV A;  5APV A;  4D6T G;  2PRR A;  4NPD A;  4AUW A;  1Q86 Q;  1S5L H;  2Y0C A;  4NBB D;  3NMD A;  2Q6Q A;  1LP1 B;  3MHV A;  4H44 C;  1G8J B;  2Y0D A;  2KOG A;  1H8A A;  1GL2 A;  1EG9 A;  5APT A;  3B5N B;  2LKM A;  4GDO A;  3GKE A;  2JWA A;  5AW1 B;  2JP3 A;  5KAF E;  3HUS C;  3AE4 C;  1HUC A;  4JYB A;  4B86 A;  4H13 D;  1N73 C;  3CC4 P;  2A06 G;  2IFM A;  4HKV A;  1DIP A;  1OIP A;  2KZJ A;  1RQU A;  1KFM A;  2JR8 A;  2WSE H;  4TLF A;  2H89 C;  4GIF A;  5CJ0 A;  1FZF A;  2HPC A;  1IJD B;  1HGZ A;  3Q5S A;  1A02 J;  2W6J H;  3VP8 A;  1L0N E;  1NHL A;  1VQ6 P;  1PFI A;  5APU A;  3BCC G;  1OVV A;  1NYK A;  1G2C A;  2FFD A;  3B5N A;  3R4Y A;  2KI7 B;  1USE A;  1FE6 A;  1OW7 A;  2OTL P;  3AE3 C;  1DEB A;  1LP1 A;  3CX5 I;  1VL2 A;  4GOD A;  1ZN5 A;  2GA1 A;  1K73 Q;  2QJK B;  3BAT A;  3DQY A;  2DE7 D;  2UWJ E;  3L71 E;  2XRX A;  4CPG A;  1P84 H;  4PD4 D;  2Y9Z A;  1RH5 B;  1CI6 A;  3TSI A;  1JY2 O;  3L73 G;  4HM3 A;  1NU1 D;  1O7W A;  5AW6 B;  1S5L X;  5APW A;  1K04 A;  3MUD A;  3RK2 D;  1BCC E;  2K9J A;  3EN1 A;  1YQ3 C;  5AVX B;  1GTW A;  1PGP A;  3HE5 A;  2YMK A;  3KXD A;  4ZMD A;  3CCM P;  1LT1 A;  2L5G B;  2OYI B;  1AV1 A;  3O6Q B;  1OMI A;  1N73 A;  1SQV E;  3H1K D;  1VQ7 P;  2KB7 P;  1L0L K;  2WSE J;  1AFO A;  3L70 J;  1IK9 A;  1JTH A;  2FXO A;  3HRN A;  3GF3 A;  4YXW H;  1FZC B;  4PD4 H;  1ZR2 A;  3PTZ A;  4GT1 A;  1Q90 D;  1Y47 A;  2HPC B;  1LTG C;  5CBN A;  1LWU A;  5C39 A;  4HM1 A;  2ZT9 D;  1L4A A;  1IFN A;  3L72 E;  1W5C E;  2FYN B;  4NBG D;  1NTZ G;  2D2C B;  1JY2 N;  4ZKU A;  1GW4 A;  3RL0 D;  4QDF B;  3TNU A;  1J1D C;  2MJZ A;  5B66 E;  2KZI A;  4HH2 A;  1NJI Q;  2G3A A;  3WUU A;  5KLI C;  4PV1 B;  1PL5 A;  3M0D A;  2N1T B;  2QPZ A;  5AW5 B;  1O7M A;  1HVV A;  1K9M Q;  1KYO D;  1N2D C;  3QWO C;  2YO2 A;  1K05 A;  1ZRT D;  1S3J A;  2M5A B;  5KLV K;  1ZR4 A;  3HUS B;  3PP5 A;  2PGD A;  2AEF A;  2J59 M;  3GW6 A;  2XSO A;  2HR3 A;  1NKN A;  3AEG C;  3CPW O;  1GK4 A;  2WIT A;  2IBZ G;  3B4S A;  1T2K C;  4AQR D;  2Q3E A;  3C0D A;  1UIX A;  4XE5 B;  3L74 J;  3PH0 A;  3WUV A;  1RE4 A;  4PV1 D;  2Q3W A;  4JBZ A;  2RH0 A;  3H1H G;  3TGU G;  2PAJ A;  3L4F A;  1S4X A;  3AE9 C;  1S5L E;  1QGK B;  3B5N D;  1N7S D;  4NB8 D;  2E42 A;  3IN6 A;  3CI9 A;  2HOD B;  1GZL A;  2Q3I A;  2KNC A;  1WQL A;  3TGU E;  1FJP A;  4N78 D;  3RL0 C;  4H0L D;  1KIL D;  1IZN B;  2BCC J;  4W7Z A;  2QE7 H;  2VRS A;  3OA7 A;  3GL0 A;  3AEB C;  2ZAE B;  2QA4 P;  5AVR B;  2E74 D;  1PZQ A;  1EDK A;  3GCE A;  4QMA A;  3AE5 C;  1SQP J;  1NAY A;  3L73 J;  4BRY A;  1NTZ D;  1EXJ A;  2OYI A;  1W2E A;  1LT9 B;  5CCH C;  3AEF C;  2W8Z A;  3WU2 H;  2M8R A;  4L74 A;  1JY2 P;  3S4R A;  3MIW A;  1SQX K;  3MGN A;  2JO1 A;  3GB4 A;  1M57 D;  2D2C D;  1RF1 C;  1QVF O;  3SWK A;  4HM7 A;  4JF7 A;  1FZB A;  2A45 G;  3BCC J;  3KZI E;  3AE1 C;  2W90 A;  1JY3 P;  1SS1 A;  5AVT B;  3HTK A;  4A7P A;  1KN7 A;  3JSV C;  3H1L D;  4DT0 A;  3FWN A;  5TIS H;  2W27 A;  1FZG A;  3V2Q A;  2E75 C;  2IZ1 A;  4JYC A;  1HGV A;  1L0L D;  2BCC E;  1VF5 B;  2LXB A;  1AA0 A;  1M90 Q;  1RY3 A;  2QJY C;  5B5E E;  2WSC H;  3SFE C;  2YXQ B;  3ZDM A;  1BGY G;  5APY A;  2W6B A;  3UIA A;  1L0N K;  3GTS A;  2NVE A;  3AED C;  4P1B H;  5AW9 B;  3CCL P;  1JCD A;  5AVY B;  1PGO A;  1QL2 A;  1MFT A;  3VCP A;  2KK7 A;  2FY8 A;  1SQQ D;  3A0H H;  3VOP A;  1N7S C;  1NO4 A;  1RE3 A;  1GK6 A;  1VF5 D;  2IDB A;  3KHU A;  5AVS B;  1Q82 Q;  2IYP A;  4KHX A;  2BMQ A;  3HE4 B;  4OVN F;  2YVJ B;  2N1T D;  3JCU H;  3CCE P;  2IBZ D;  2WSF J;  1RQV A;  1WRG A;  2E4Q A;  2E43 A;  3CCS P;  1VF5 C;  2QJP C;  2A06 D;  4WY4 B;  4NBH D;  1JO5 A;  5AEU A;  4HM6 A;  5BU5 A;  1ULI A;  3L71 G;  1K8A Q;  3AEE C;  1W2B O;  3HE4 A;  1BDC A;  1KB9 D;  1LWU C;  3L73 E;  3H1H J;  2KSE A;  1IK7 A;  5KKZ B;  2KS1 A;  1IFI A;  4AYC A;  3FXE A;  2YFJ A;  3M9B A;  1NTM E;  2W83 C;  1SQX G;  1YIJ P;  3P7K A;  3VMY A;  2ZYG A;  1H0T B;  2LXC B;  4BRY B;  1YHQ P;  3GL2 A;  1PP9 E;  4D6T D;  3EFF K;  4WY4 D;  1GW3 A;  2HMN A;  3CXH E;  3GF7 A;  1KD1 Q;  5CXM A;  1NOH A;  1M8O B;  1SQB E;  2YFI A;  1SFC C;  3CWB D;  2OQQ A;  1IFJ A;  1URQ B;  4I2L C;  1JMB A;  4GKG A;  4OH8 B;  3CX5 D;  3VTP C;  3TDK A;  3TGU D;  1NTK J;  4EI2 A;  3GZX A;  5KTB A;  5AW3 B;  3KDP B;  1UUW A;  1SQV J;  4PD4 E;  1JY3 O;  5DJU B;  1X22 A;  4W7Y A;  4RO0 A;  4PJ0 E;  4WY4 A;  2M0B A;  3LID A;  2WSF H;  1X79 B;  4QCK A;  3T97 A;  5KLV E;  5AVW B;  1L0N D;  2O01 H;  2QM7 A;  1SP4 A;  3C9I A;  1NTZ E;  4AAY B;  2IBZ E;  1RF0 A;  3S9O A;  1ZW0 A;  3D6Y A;  2JWD A;  3V2P A;  3MZW B;  4U7J A;  2I1K A;  3KQG A;  4UB8 H;  2IYO A;  1ZRT E;  3D6Z A;  1SFC A;  4DZO A;  4HJL A;  3U1A A;  1D7M A;  2BMR A;  3A7O A;  4C7N B;  2D2C C;  3N7N A;  4N3Y B;  1ZOY C;  2V4H A;  4OGQ C;  2HLO A;  2HG5 D;  1IO4 A;  4YPC A;  1SQP K;  1L0N G;  1KTM A;  3WMM 0;  1T3U A;  2E75 D;  1OFC X;  3H1J J;  1GL2 D;  1EZV D;  4QDC A;  2H7H A;  1O7P A;  2ZT9 B;  1L4A C;  2QJP B;  1URQ A;  3WUT A;  1EDI A;  1IFP A;  2FKW B;  1YI2 P;  4DJG A;  3Q5R A;  1KB9 I;  3TYY A;  1EZV I;  3V2N A;  2FYZ A;  1RIE A;  2Q1K A;  1RF1 B;  3H1L G;  2OTK E;  1JB0 J;  1H88 A;  2E74 B;  1JM0 A;  2DE6 D;  1SQB J;  1LTJ B;  3M91 A;  3L72 D;  2IX7 C;  5AW4 B;  2FXP A;  4WVZ A;  1OVR A;  3H1J E;  1BDD A;  2XNX A;  2WSS H;  3L70 G;  3V4Q A;  1BSH A;  2YKP A;  1OX3 A;  2GUS A;  3V2R A;  1HH0 A;  2XDJ A;  1SQV K;  1BCC J;  4NBF D;  1FBM A;  1L0L E;  3P8C E;  2SPZ A;  2C0W A;  1IFM A;  4EIJ A;  2B87 B;  3RK2 B;  1SQQ J;  1T2K D;  5CCH A;  1AQ5 A;  3E7K A;  1NU1 G;  4H44 B;  4HYT B;  3H32 A;  4NPF X;  1G8K B;  4OGQ D;  3A2A A;  3U59 A;  1L4A D;  4WWI A;  1YJW P;  3BCC D;  2ZT9 C;  2C0X A;  1FDO A;  2WPV B;  2FYU E;  1RE4 C;  1WMK A;  3E1R A;  3I55 P;  3HD7 B;  4GOE A;  1RF1 A;  3Q3D A;  2P67 A;  2P1J A;  1SLQ A;  1KQG B;  3A0B E;  1KB9 E;  1QVG O;  2NPS C;  3AZC A;  1KZU B;  4OWF A;  4TT3 H;  4ZNC A;  2ZYA A;  1SQX J;  2IFN A;  3GMA A;  1PV3 A;  3H1I J;  1JCC A;  1SVF A;  3IF4 A;  3M9Q A;  4I1L A;  2O3J A;  2IBZ I;  4HB1 A;  2QG4 A;  3H1I E;  2C9L Y;  1VQ5 P;  5KJ7 A;  1EC5 A;  2B24 A;  2Q7C A;  3TK1 A;  2H88 C;  1OWA A;  5AW7 B;  3Q2Y A;  3I56 P;  4IL6 H;  1SQB D;  1DEE G;  3I5C A;  5AVU B;  3NXS A;  2RN0 A;  1SJG A;  1M7L A;  1Y9B A;  4R4L A;  1N8R Q;  2NUM A;  5DJT B;  3VN0 A;  1FAV A;  1L0L G;  2V7Q H;  1VQO P;  3VMX A;  3CX5 E;  1XTG B;  3L75 E;  4N78 E;  3HUS A;  2H43 A;  1JMM A;  3H1J D;  2M5A A;  1HBW A;  2QJK C;  4N6J A;  5KAI E;  3AE7 C;  2XZR A;  1G1I A;  3A5T A;  5KKZ C;  3CCR P;  1CSB A;  3S1K A;  2W6A A;  1LJ2 A;  1M1J C;  2Z5I A;  2FXM A;  2ZFC A;  3M0A A;  1XTC C;  2CK3 H;  1JNM A;  5GTI H;  1DX7 A;  4L76 A;  3LIE A;  2YKO A;  1SQV D;  1OW8 A;  3BCC E;  2NVF A;  3USS A;  1PP9 G;  1KB9 H;  1GU4 A;  2YFL A;  1ZP0 C;  1Q7Y Q;  1VQ8 P;  2BEQ D;  3W68 A;  3G71 P;  1M1J A;  1JEK A;  1O7G A;  3CWB J;  3TF5 A;  4DCK A;  1NU1 K;  4U3F G;  2FFD C;  3AEC C;  1SQB K;  3L75 G;  2NZ2 A;  4Y99 B;  2WZ7 A;  2FYN C;  1M1K Q;  2WMM A;  4HM5 A;  2GM4 A;  1KIL E;  3T97 B;  1YJ9 P;  4NB9 D;  2E5Y A;  2DW3 A;  3FWL A;  3PLN A;  2GUV A;  3L74 D;  5H2F E;  4PV1 C;  3GZY A;  1WT6 A;  3ABV C;  2IPP A;  3H1H D;  3VP9 A;  3V6I A;  1X9V A;  2B89 A;  1NKZ B;  3TGU J;  1T3J A;  3D89 A;  1GL2 C;  1JY3 N;  2HMM A;  1U57 A;  2WPQ A;  2A06 E;  1AJY A;  3RK2 C;  2P7J A;  2JO6 A;  4I7Z C;  2JDI H;  1MV8 A;  4H13 C;  1VDF A;  4RES B;  1SQQ E;  3O8Z A;  2HMK A;  3F89 A;  3G6E P;  2JKV A;  3PRJ A;  3IAO A;  4HM2 A;  1FQT A;  1N7S A;  2ZYL A;  3CL3 D;  4AIV A;  1RE3 C;  3SSU A;  4M3L A;  2XR8 A;  1LTJ A;  1S1C X;  1VQL P;  4NBD D;  4UB6 H;  2K1A A;  3VCA A;  2O1K A;  1SQQ G;  4RKU J;  1SQX D;  1YTZ T;  1HWT C;  3SWY A;  4YXD C;  2XND H;  1QEX A;  1EXI A;  1PIX A;  1L4A B;  1NTK E;  1HJB A;  3MUD C;  1PGQ A;  2Q5U A;  2QSI A;  1EQ7 A;  1H89 A;  1ZV8 A;  2ITA A;  1VQ9 P;  3SFD C;  2E5T A;  1QL1 A;  1NDO A;  1N7L A;  2R32 A;  1P84 D;  4IOI H;  1M56 D;  1UII A;  3A0B H;  4LGD E;  2OYO A;  3SWF A;  2KS1 B;  3L74 G;  2FBW C;  4HM0 A;  5AVV B;  3CMA P;  3H1I D;  1CW5 A;  3MP7 B;  3VMH D;  1YYC A;  4LC1 A;  4IFM A;  1DH3 A;  5KLI B;  1KYO H;  3E1I A;  1FU1 A;  1Q81 Q;  2IZ0 A;  3U1C A;  3TNU B;  4QDF A;  1USD A;  3CCU P;  3H32 B;  1S9K D;  5BU8 B;  4Z1M H;  3KPE A;  5HL4 A;  2AXT H;  1ZME C;  4HJG H;  4ASV A;  1GMJ A;  2V7Q J;  3A3Y B;  4BWN A;  2B88 A;  1NU1 E;  5BVZ A;  5KAF H;  2QVA A;  3L70 E;  1J1E B;  1BE3 D;  5E79 E;  1VQK P;  2KUB A;  4RJT A;  2E76 B;  2WSC J;  4UB6 E;  2FYU G;  1BE3 G;  1LGH B;  1NTZ J;  3R2P A;  1VQP P;  2FYU K;  1KIL C;  1OVU A;  3C8V A;  1SQP D;  2N1T A;  1T6A A;  1FJK A;  2ZXE B;  3FXD A;  2YNY A;  3LW5 J;  3P8C D;  2QJY B;  2N9Y B;  1GU5 A;  4BXL A;  2O01 J;  2HFE D;  4C7R A;  4C46 A;  1IFD A;  4D6T E;  1FZC C;  1OXZ A;  4NBA D;  1RFS A;  3AE2 C;  4UB8 E;  2ZVO B;  1U7M A;  3K5B A;  3M9H A;  3NFQ A;  2R3S A;  3CXH D;  1DD3 A;  4L75 A;  3L71 J;  3RK3 B;  2R5B A;  1FDI A;  4I7Z B;  1SQQ K;  3L37 A;  1YBK A;  1SQV G;  1CI6 B;  3RBX A;  1FZA A;  1GL2 B;  3CXH I;  1JTH B;  3H6P A;  3H25 A;  1BGY D;  1R5S A;  3AE6 C;  5AW0 B;  5CCH D;  3LW5 H;  2NPS D;  2A45 H;  2E76 C;  3KYQ A;  2WTY A;  4YTP C;  4C7N A;  1VQM P;  2C9N Y;  2A45 I;  3CWB G;  3GG2 A;  4QUQ A;  5KLV D;  1QLE D;  4ASW A;  3H1H E;  3OAK A;  1PGJ A;  1VM9 A;  2WQY C;  1TU3 F;  1FS0 E;  2Q9I A;  1KQF B;  5B5E H;  1MUU A;  1NTK K;  2XKM A;  1S9K E;  3L72 G;  2CKF A;  4L73 A;  1KIL A;  1P84 I;  2HMJ A;  2YMY A;  1T8Z A;  3CD6 P;  1PPJ E;  3CC7 P;  4QUR A;  5CHX A;  5GTH H;  3CC2 P;  4Y28 J;  1KC8 Q;  1HF9 A;  1MZ9 A;  4U3F D;  2L91 A;  2I8D A;  3GHG C;  1LTT C;  4Y99 C;  1SQP E;  5TJH A;  3A0H E;  1PPJ G;  2OGU A;  2OTJ P;  5KAI H;  1S72 P;  1NH4 A;  1OW6 A;  1DD4 A;  3IR9 A;  5EFW B;  4QDD A;  3AE8 C;  2RMZ A;  1GDT A;  3FOU A;  3H1K E;  3II6 A;  1KFN A;  5B66 H;  1S2E A;  5CCG C;  2NRG A;  4KJM A;  2P2U A;  1SFC B;  4JPZ B;  1QX8 A;  4WB4 A;  1KQS O;  2DE5 D;  4W80 A;  3H1K G;  5KJ7 C;  1YJN P;  4H13 B;  1J1E C;  2XU6 A;  4D6T J;  4HM8 A;  2Z4E A;  3G4S P;  3RK3 E;  2E76 D;  1G1J A;  1KOR A;  3GTE A;  4K3A A;  3L75 D;  2KLU A;  3B5N C;  1KYO I;  3H1K J;  1URQ C;  1KIL B;  1AVO A;  1MKM A;  2K88 A;  2Z5H A;  2WT7 A;  2JZA A;  1N73 B;  1FZE A;  2Y0E A;  2J5U A;  1SQP G;  3HD7 D;  2O01 N;  4O9B A;  2M3B A;  3OJA B;  3G3Z A;  4IL6 X;  1SQX E;  4LLH A;  1FZC A;  2ZJS E;  4NBC D;  5H2F H;  5AEW A;  1NU1 J;  1NTZ K;  2AEM A;  3GLM A;  3EWK A;  1LT9 C;  4WY4 C;  2G8Y A;  2B87 A;  1KQL A;  2YO3 A;  3NTN A;  3L70 D;  2BMO A;  3CCV P;  1JUN A;  3EQQ A;  2HML A;  4KT0 J;  4EOT A;  3VMZ A;  3B8E B;  2KNC B;  1IC2 A;  2HOD A;  2HMO A;  5K5G B;  1NAF A;  2FYU D;  2QEX P;  5KJ7 D;  2NVG A;  1BCC D;  2B1X A;  3BVH A;  2PFX A;  5APX A;  3CCQ P;  3P32 A;  3RK3 C;  4OGQ B;  1LTA C;  1LT9 A;  1NWQ A;  1BSN A;  4PJ0 H;  1NGM B;  1SFC D;  2CPB A;  3CCJ P;  1ULJ A;  2HYN A;  2QRX A;  3CLQ A;  3L35 A;  2PP6 A;  2ZVN B;  5CCG D;  3H1I G;  3D70 A;  3H1L J;  1NVO A;  3L72 J;  2R3C A;  1RF0 C;  3VMA A;  2OYH C;  3V5B A;  2LR2 A;  2R5D A;  2WWW A;  3L36 A;  3WU2 E;  1KMI Z;  2I7F A;  4HM4 A;  1ZLL A;  1L2P A;  1MFZ A;  1LTB C;  1Y8A A;  1EZV E;  1LTS C;  4PD4 I;  3H1J G;  2WT7 B;  4IFD K;  3VMI D;  2BCC G;  3Q5P A;  1URQ D;  1EDL A;  2KIK A;  4P1C H;  2ZYD A;  3W67 A;  3RGU A;  2QM8 A;  2BEZ F;  4JQ0 D;  2WVR A;  1BGY E;  3C1L A;  2I1J A;  3L71 D;  3MTU E;  4XFJ A;  1BCC G;  1EZV G;  1X0T A;  3BRT B;  5TIS E;  3HD7 A;  2H8P D;  1NYH A;  4EDF A;  2J58 A;  1LTJ C;  3L74 E;  3M06 A;  5M1B A;  2K9Y A;  1HJ0 A;  5APQ A;  2ZXX A;  3GHG B;  2KXP B; 
#chains in the Genus database with same CATH homology
 4NB9 D;  5AEU A;  1SQP E;  2IBZ E;  1NDO A;  1SJG A;  4EMJ B;  2NUM A;  2BMO A;  3EQQ A;  5BOK A;  2NUK A;  2HML A;  4D6T E;  4HM6 A;  3H1J E;  4H44 D;  1L0N E;  4NBA D;  1RFS A;  3CX5 E;  1ULI A;  3N0Q A;  2HMO A;  4QDD A;  3GZY A;  1NYK A;  2ZT9 D;  4HM1 A;  2NVG A;  2BCC E;  2B1X A;  3L75 E;  1ZRT E;  3L72 E;  2YIU C;  4NB8 D;  3FOU A;  4HM0 A;  2QJY C;  3H1K E;  4HJL A;  4NBG D;  3L73 E;  2QJK C;  3D89 A;  4NBF D;  4QUP A;  3VMH D;  4QDF B;  2E4P A;  2XSH A;  1WQL A;  2BMR A;  1BE3 E;  1L0L E;  1ULJ A;  2HMM A;  4U3F E;  1VCK A;  5KKZ C;  1O7N A;  3TGU E;  2YFJ A;  3DQY A;  1NTM E;  2A06 E;  1KYO E;  4H0L D;  2JO6 A;  2DE5 D;  1Q90 C;  2GBX A;  2DE7 D;  5KLI C;  3L71 E;  2XRX A;  3GTS A;  1G8K B;  2NVE A;  4OGQ D;  3H1L E;  1SQQ E;  1O7H A;  2HMK A;  2QPZ A;  3GL2 A;  4P1B H;  1O7M A;  1UUV A;  1PP9 E;  3GL0 A;  4QDF A;  4NBE D;  4HM3 A;  1O7W A;  2E74 D;  2FYU E;  4HM2 A;  1FQT A;  4HM8 A;  4QUQ A;  2HMN A;  3CXH E;  2I7F A;  3GCE A;  4HM4 A;  3GTE A;  2E76 D;  1BCC E;  2ZYL A;  5CXM A;  5HL4 A;  3H1H E;  1EZV E;  3EN1 A;  1SQB E;  3VCP A;  4AIV A;  2GBW A;  2YFI A;  1VM9 A;  1KB9 E;  2XR8 A;  3VMI D;  3BCC E;  4NBB D;  4NBD D;  2NVF A;  1NU1 E;  3AZC A;  3L70 E;  1G8J B;  4P1C H;  2E75 D;  2JZA A;  3VCA A;  2XSO A;  2CKF A;  1EG9 A;  3GOB A;  1VF5 D;  2NWF A;  4QDC A;  3GZX A;  1O7P A;  2YFL A;  2HMJ A;  1BGY E;  3CWB E;  1PPJ E;  2BMQ A;  1UUW A;  3GKE A;  1O7G A;  1SQV E;  4QUR A;  2YVJ B;  4PD4 E;  1JM1 A;  3GB4 A;  1NTK E;  3C0D A;  2D2C D;  4H13 D;  3H1I E;  4HM7 A;  1SQX E;  4HKV A;  2E4Q A;  4NBC D;  4QCK A;  1P84 E;  5KLV E;  2B24 A;  1RIE A;  5AEW A;  3L74 E;  3VMG D;  4PV1 D;  2QJP C;  2FYN C;  2Q3W A;  4HM5 A;  4NBH D;  1NTZ E;  2DE6 D;  4AAY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...