4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
2HMOA 2YIUC 3H1LE 3L71E 1O7NA 3TGUE 4QCKA 3EN1A 4NBBD 4HM8A 3CXHE 3L70E 4HKVA 1NTME 1VCKA 2YFJA 4AAYB 4HM1A 2DE5D 1WQLA 1ZRTE 2QPZA 4HJLA 2D2CC 1L0LE 4QDFA 5CXMA 4EMJB 4HM3A 2QJPC 4QURA 2GBWA 1P84E 3L73E 1UUWA 5KLIC 2HMMA 1ULJA 2NVFA 2XSOA 2XR8A 4NBDD 2GBXA 1VM9A 2NWFA 3GL2A 2NVGA 2NUMA 2JO6A 2Q3WA 2XRXA 1SQPE 2HMNA 2E75C 3GL0A 3CX5E 3N0QA 2BMRA 3L74E 1O7PA 1KB9E 2A06E 4PV1C 3GB4A 3L72E 4U3FE 2NUKA 2JZAA 4NB8D 3H1JE 1NYKA 2E76D 4H13D 2DE7D 3D89A 1VF5C 2IBZE 1O7GA 1EZVE 4H0LC 4H44D 4NBGD 1SQQE 2E4QA 2YFLA 4PD4E 4AIVA 1O7WA 1RIEA 2ZT9C 2E74C 2YFIA 2NVEA 3GTEA 2BMQA 4NBFD 2FYNC 4OGQC 5AEUA 3DQYA 3EQQA 1G8JB 3C0DA 3GOBA 3BCCE 4HM5A 3VCPA 1SQBE 4QDCA 3GCEA 5HL4A 1UUVA 2YMKA 2ZYLA 1FQTA 4NBHD 4QDDA 4NB9D 3VMHD 2D2CD 4P1BH 4HM0A 2HMKA 1EG9A 5BOKA 2HMJA 2DE6D 3L75E 1BCCE 1SQXE 2BMOA 1NDOA 1G8KB 4HM7A 4I7ZC 3VMGD 2E75D 3VCAA 1RFSA 1ULIA 3GTSA 3FOUA 3GZXA 3H1HE 4P1CH 2BCCE 1L0NE 2CKFA 2QJYC 4PV1D 3H1KE 3CWBE 2B24A 5KLVE 1KYOE 1O7MA 5AEWA 2B1XA 4HM4A 1O7HA 1NTZE 2HMLA 3AZCA 1VF5D 1NU1E 4HM6A 1BE3E 4HM2A 5KKZC 1NTKE 2E76C 4QUQA 2I7FA 3VMID 4H13C 1SQVE 3GZYA 3H1IE 4NBED 4H0LD 3GKEA 4QDFB 2YVJB 1PPJE 4QUPA 1Q90C 4H44C 1PP9E 1JM1A 4NBCD 2ZT9D 2E74D 2E4PA 2FYUE 2XSHA 4OGQD 4NBAD 2QJKC 1SJGA
chains in the Genus database with same CATH superfamily
2RKLA 3EN1A 1OW8A 2QA4P 5CCGD 2OYHC 4O9BA 4M3LA 1EDLA 5APYA 3R4YA 1LJ2A 4N78E 2QJPC 1SQVJ 3IF4A 3L73E 4XFJA 5KLIC 1ULJA 1VM9A 3MZWB 1EQ7A 1SP4A 3VTPC 4XE5B 1HJBA 3L70D 3C8VA 3CCSP 1TU3F 2WPRA 1FAVA 1H88A 1LNQA 2POHA 3A0HE 3FX0A 1R5SA 3KYQA 1O7WA 1RIEA 3HTKA 3C1LA 5AEUA 3CMAP 1FZCC 4KJMA 2O3JA 4AUWA 4D6TD 2QIWA 5AW4B 3AE3C 2E76B 5AW3B 3T97A 3L35A 1RFSA 2E75B 1LTJB 1P84I 2CK3H 2VRSA 5APTA 1WRGA 2JEEA 2BCCE 3E1RA 2N9BA 2OYHA 1KFMA 3L72D 1LTTC 2R32A 3H1JD 1FOSF 3GZYA 4H0LD 1GD2E 1ZXGA 3S9OA 3BRTB 3V2NA 1SQXJ 2FYNB 4NPDA 1ZOYC 1SJGA 2C9NY 3RL0D 4RJTA 1NTKD 2N1TC 4HM3A 2J59M 5CBOA 2WZ7A 1FC2C 1FZCA 4DOJA 3GL0A 3TGUJ 5CJ0A 3L74E 1ZW0A 1YQ3C 1JEKA 2KSJA 1Q90D 4C7RA 1PP9D 3TSIA 3A2AA 4JBZA 1SQPD 1HUCA 4ZKUA 2ZVNB 2W8ZA 3WU2E 1WMKA 2H43A 1IFIA 2E42A 4UB8H 1LTBC 2FYZA 5AVWB 1KN7A 2HG5D 1LT9C 3TNUA 2KYVA 1HF9A 1WT6A 2OGUA 2BCCG 3WMM0 3OAKA 1OW6A 1NDOA 2K1AA 1IFJA 1DEEG 2YIUB 3AE2C 2LKMA 2HPCA 2KXPB 1L2PA 2K37A 2WITA 1AV1A 5KAFH 1IK7A 2H88C 2QVAA 1MV8A 3CCEP 1K05A 1SFCA 1AA0A 1M1JA 1LGHB 2W6BA 4GOFA 2QJKC 5AW8B 2Y0DA 2WT7A 1L0ND 1SQBD 3CXHE 1VPCA 5AVTB 4WBAA 4AAYB 2IPPA 3WUUA 2P10A 2GBWA 1EC5A 2Q5UA 4NBDD 2FFDB 1IC2A 3VMAA 3TF5A 3L74G 5APSA 3USSA 1X9VA 1FOSE 3EFFK 4JQ0D 2IYOA 1ZMEC 3HD7D 1DD3A 3HE4A 2JZAA 1ZRTD 1LT9A 1S1CX 1K9MQ 1KTMA 1YYCA 3AE9C 1LP1A 3FXDA 5AVQB 1PPJD 3E1IA 3V2QA 5TISH 2E4QA 2L5GB 2ZT9C 2R5DA 2JWAA 4NBFD 4I7ZB 3QWOC 3H1LD 3C0DA 1OXZA 3H1IG 5KAIH 1VQ5P 1OW7A 2OYIB 2FYUG 1GU4A 4HH2A 2DE6D 1GL2B 4WY4D 4IL6H 2YNYA 2QJYC 1PGQA 1JY3P 2O1JA 5KKZC 5H2FE 2I7FA 1SQVE 1EZVD 5KLIB 1X22A 1BCCD 2E74D 1NJIQ 1CZQA 3TK1A 2C0XA 2W27A 2QRXA 4PJ0H 3F89A 1O7NA 4HKVA 4YXWH 1KYOD 4ASVA 1DIPA 1NGMB 4YTPC 2WPVB 1UUWA 2PP6A 1VL2A 3Q5RA 4RO0A 2WSFJ 4HKZH 3SSUA 2WSCH 2FXOA 2KUBA 2E75C 1LTJC 1VQNP 3L71J 1CI6B 1KB9E 2A06E 2M3BA 3CL3D 3LW5J 1JTHB 4NB8D 1VQMP 1VQ9P 2UWJE 3NFQA 2HODB 1PZQA 3D89A 2IBZE 3L73D 2I1KA 1JMMA 3GTEA 2BMQA 2FYNC 3V2RA 1SQVK 5B5EE 3DQYA 1BE3G 2IYPA 4GIFA 1PFIA 5HL4A 4RESB 1PV3A 1RF1C 4TLFA 2QSIA 1L0LD 1QL2A 1AJYA 1SQXE 3ZDMA 1IFNA 3AEBC 3VCAA 1KZUB 3G9RA 1MKMA 3FOUA 3PLNA 1SQVG 4I2LC 5CCHC 4PV1D 4EIJA 2BEQD 2B1XA 2V7QH 4YXDC 1VF5D 1HJ0A 5B66H 1HTLC 2N1TB 4H0LB 5GTHH 3SWKA 2R3SA 1LTJA 1T3UA 3TGUE 1KMIZ 4CPGA 3A0BE 2ZFCA 1SLQA 3H1KJ 5KLVJ 3U1AA 2HMMA 3P32A 2OTKE 2QM7A 2C0WA 3FXEA 2Q3WA 2A06G 2FYUJ 2XRXA 2KZJA 1OWAA 1GMJA 2IBZG 3N0QA 1SQXK 3U1CA 3CWBD 4EYYQ 1RF1A 2W83C 1AFOA 1L4AD 3SWYA 4OWFA 1K73Q 5AVVB 3RK3D 5CCHA 1YJ9P 1MFTA 2YMKA 5GTIH 2ZXEB 1SQXG 2ZXXA 3OJAB 1EG9A 2HMJA 4A7PA 2FFDC 4HJGH 3P7KA 4HM7A 2HLOA 4R4MA 4AQRD 1GK4A 2QJKB 3IN6A 3HUSC 4BXLA 4GODA 4U3FD 4EDFA 3PRJA 1YI2P 2Q1KA 3IR9A 4H13C 2FKWB 4QDFB 2YVJB 5KJ7C 3TGUG 1JM1A 2V4HA 3FWLA 5C39A 2XSHA 2KB7P 2AXTH 1HGZA 1PGOA 1VCKA 2OYIC 3LIEA 1VQKP 1BE3J 1KC8Q 2KIKA 1P84E 2XSOA 4Z1MH 1S5LX 1YIJP 3CXHD 2WSEH 5APXA 2BMRA 1NTZD 1KV4A 4YPCA 3MUDC 2FFDA 1U7JA 3L4FA 1FS0E 1FE6A 5AW5B 1S9KE 4K3AA 1NU1G 1W2BO 1G8JB 1K8AQ 2WTYA 1KQSO 2R3CA 2W6JH 2QJYB 2AEJA 1KFNA 2IFMA 5CCGC 3L72J 2RMZA 1Q2NA 3H1JJ 3EFGA 5KKZB 4HM0A 3MTUE 5KJ7A 2MKVA 1QX8A 3II6A 4WVZA 1Y47A 1N86A 3QH9A 4WY4B 1VQ8P 1S4XA 3CCVP 2RH0A 3AEAC 3FGAD 5KTBA 1YITP 2OYIA 3IAOA 4GT1A 2ZYAA 3VMID 3GKEA 1ZR2A 1GL2A 1S5LE 1GK6A 5L8RJ 1VQ6P 1SQQD 1IFPA 2E4PA 1RQUA 2B87B 1EZVI 3L71E 2Y0CA 1YTZI 3S4RA 4C7NB 3G4SP 3I55P 1VQ7P 2YXQB 2E43A 1JY3N 1KYOI 2NVFA 3L75D 1PP9J 2YKOA 3GL2A 1JO5A 4W7ZA 3H1HD 1IO4A 4NPFX 5CCGA 1ZN5A 1ZV8A 2H89C 3CMEP 1RF1B 1LTIC 1Y9BA 5AW9B 5APVA 2KLUA 4H0LC 3B5ND 2J58A 2WPSA 2Q7CA 2LXBA 3CI9A 3GF3A 1SFCD 1ZLLA 4LGDE 2DW3A 3L36A 4JPZB 1VQPP 3RK2D 1MFZA 1CI6A 3RL0C 1JTHA 2GUVA 2WSCJ 2HODA 3GW6A 4GDOA 2C9LY 2YO2A 4Y99C 5DJTB 1IFMA 3CXHH 3KXDA 1NHLA 2RN0A 5APWA 4UB6H 1YJNP 1LTSC 1W5CE 2WMMA 3CX5D 1N7LA 3KZIH 3CC4P 1SQBJ 3Q5PA 3H1KE 1BGYD 5KLVE 1O7MA 1HVVA 1VF5B 3H1IE 1JY2N 3CCUP 3CD6P 1EDKA 1N2DC 3L71G 1N73B 2KI7B 1Q90C 4PD4D 1NVOA 2FYUE 1JCCA 4OGQD 5BU5A 2GA1A 3RBZA 3HE5B 2HMOA 2GUSA 2QE7H 3CCQP 2N1TA 2ZJSE 1NU1J 2O1KA 3CC7P 3BCCG 3OA7A 3R2PA 2V7QJ 5AW7B 3H1LJ 1Q86Q 3M9QA 2R5BA 2NPSD 4HB1A 2SPZA 2I1JA 2FBWC 4RKUJ 2KNCB 1O7GA 2QEXP 4H44D 3KPEA 5KLVK 2NVEA 4IFFA 2CPBA 3NMDA 2WQYC 4W80A 3RK3B 1T3JA 3HUSB 3VCPA 1G1IA 1YBKA 1NTMD 2FYUK 2A45H 3B8EB 4NBHD 4NB9D 3AEFC 1SVFA 4H13B 3JCUH 1RY3A 1S2EA 1BCCJ 2HFED 4HYTB 1N7SD 4UB8E 3H1KG 4W7YA 1QVFO 5KLVG 5CBNA 1PL5A 4N6JA 3U59A 3AE6C 2JDIH 3HD7C 1U7MA 3D70A 2XDJA 4HM4A 1O7HA 3PH0A 1BE3E 1S72P 1ZP0C 1KILD 1VQ4P 2G8YA 1H89A 2ZYDA 1K04A 2WPQA 5KAFE 5E79H 4MN4C 1G2CA 1DH3A 3SWFA 2YFJA 2IFNA 5B5EH 4HM1A 2I8DA 4QDFA 3M0AA 3L73J 3CX5H 3I56P 3VP9A 2XR8A 1MZ9A 4WY4C 1OFCX 3VYIA 4Y28J 5AVYB 3FWNA 3NTNA 4PD4H 3L72E 3H1JE 2E76D 1EXJA 1PGPA 3CXHI 3P8CD 1P84D 3G6EP 1QVGO 1L0LJ 1CW5A 3D6YA 2Q6QA 2YFLA 1UIXA 2E74C 2YFIA 1T6AA 1RE4C 2Q3IA 3AEEC 4BWNA 1GZLA 3CC2P 1KQGB 5TISE 3VMXA 2P2UA 3AE8C 4B86A 4XA4A 1M8OB 3VN0A 2IDBA 2OTLP 4P1BH 3RL0g 4N78D 1RE3C 5KAIE 2E5TA 4GOEA 1H0TA 2WSEJ 3L70G 4KT0J 1S9KD 3EQ2A 3K5BA 3BCCJ 3SFDC 1YHQP 1KQLA 4IL6E 4L75A 4IOIH 2HMLA 1JY2P 1H8AA 3O8ZA 2L91A 1PGJA 1PP9E 4NBCD 3GHGC 4WY4A 1RF0C 3G3ZA 4NBAD 1FZGA 4D6TG 1M7LA 3H32B 4NBBD 1USEA 1EDJA 1FDIA 3TYYA 2YXRB 3CWBJ 2W90A 3D71A 2QPZA 4PJ0E 4EMJB 3AECC 1VDFA 2M3EA 3E7KA 3CCJP 3V2PA 2B87A 2NUMA 3L72G 3BATA 3H1JG 2HR3A 2A45I 2BCCD 1VQLP 3RL0B 4C7NA 2ZVOB 4PV1C 3L75G 1A02J 3JC22 1VF5C 1RE3A 4Y99B 1RQVA 3MD0A 5TJHA 1BDDA 1QGKB 3B5NB 1YJWP 1N73C 1DD4A 1FJPA 3M9BA 1BSHA 2R44A 1NTKG 1DX7A 1EDIA 1FJKA 1D7MA 1BDCA 2ITAA 1SQBE 3HRNA 3RK2B 1GW4A 3W67A 3AEDC 4U3FJ 2D2CD 1URQD 1RF0A 1EXIA 1KYOH 2FY8A 2PGDA 3L74D 1PP9G 4L74A 1NU1E 5M1BA 4DZOA 4QUQA 3CX5I 3B71A 1SQPG 1JCDA 1L4AC 1PPJE 1J1DB 5K5GB 5AVSB 3MGNA 5B66E 4OGQB 2GM4A 3H1LE 5GTHE 3P8MC 3RK3C 4QCKA 4PD4I 3RBXA 1XTCC 3EWKA 1G2CB 2DE5D 2IZ1A 1NTZJ 3H1ID 3H25A 1L0NK 1SQBK 1NH4A 1N73A 2M8RA 5AW0B 2NWFA 4WB4A 2FYUD 1CSBA 3G71P 4K35A 2B89A 4WWIA 4I1LA 1JY3O 5CJ4A 3HE5A 3PP5A 1T2KD 3AE5C 3M9HA 3A0HH 2YO3A 2BASA 3L70J 2NPSB 4DT0A 1NKZB 1IK9A 3A3YB 3ITKA 1EZVE 1GL2D 4H44B 2H7HA 1JNMA 1L0NG 1SQBG 1NU1K 2P58A 1U57A 3MP7B 3AE4C 3GCEA 3HD7B 4ASWA 1UUVA 4ZKPA 2ZYLA 1FQTA 1IFDA 2KNCA 4D6TJ 1JM0A 3Q2YA 1YTZT 1X8YA 3PHLA 1JUNA 2XNXA 3PJSK 3C9IA 5GTIE 1NTMG 1SQQJ 1FBMA 1N7SB 3V4WA 1H0TB 4C46A 1A02F 3GTSA 2Q3EA 3HUSA 3H6PA 3GZXA 5APUA 1SS1A 1QEXA 4JYBA 1PPJG 2B24A 1PIXA 4OVNF 4NBED 1KILB 4OH8B 3H1LG 5AW1B 3L75J 1M90Q 1E79H 2LXCB 1GTWA 1JY2O 1DEBA 3H1HJ 4DCKA 3V4QA 4QMAA 1JMBA 1J2JB 2FXPA 1BE3D 2AXTE 3VMYA 1WQLA 2K9YA 3WUTA 1NTKJ 1L0LE 1X79B 1LTGC 1LWUB 3O6QB 2M5AB 4QURA 2KSEA 2GBXA 3OW2O 2NVGA 2E74B 3BVHA 4LLHA 1RH5B 1R8EA 1EZVG 1O7PA 1BCCG 2KZIA 2DE7D 3Q1MA 1SQVD 3MUDA 1IZNB 2E5YA 3KQGA 3WU2H 4NBGD 1FU1A 2B88A 4DJGA 3L37A 2PAJA 2PFXA 1SQPJ 5CMZA 4R4LA 2YMYA 2OTJP 3BCCE 1NOHA 2O01H 1BGYJ 1FDOA 2N1TD 1USDA 2KS1B 1HWTC 2HYNA 3B4SA 5AVUB 3GHGB 1L0LK 3Q5SA 1KQFB 4P1CH 3L73G 3LIDA 3CWBE 2BEZF 1KB9D 2A06D 3I5CA 2YKQA 3N4XA 3WUVA 1NKNA 1M1KQ 2IBZD 3RGUA 2WVRA 3B5NC 4IFMA 1JOCA 3M91A 1SFCC 1M1JC 2P1JA 3RK3E 5EFWB 3M0DC 1Q7YQ 4HM8A 1L0LG 3RK2C 1L0NJ 4PV1B 5DJUB 2ZAEB 3Q3DA 2J5UA 2CPSA 3ABVC 3GG2A 1SQXD 1YQ4C 1GW3A 3H32A 2JWDA 5AVXB 2IZ0A 4U3FE 1NTMJ 1Y8AA 2B9BA 3KHUA 2JJLA 2PRRA 1J1DC 2OQQA 4AIVA 2KLVA 4OGQC 5AVRB 3TDKA 2XKMA 3TGUD 2FXMA 1QLED 1RHZB 2JP3A 2D2CB 2HMKA 2IX7C 3B5NA 1L4AB 1LTAC 1URQB 3CPWO 3CWBG 3N7NA 5H2FH 3A7OA 3M0DA 1N8RQ 1FZBA 4UB6E 2KOGA 3F5HA 3AZCA 1NTZE 4HM6A 2NPSC 2K9JA 1X0TA 5CHXA 3CLQA 3V6IA 1FZEA 3KZIE 4QUPA 4H44C 1R5LA 1OIPA 2ZT9D 5AW2B 1J1EB 1AVOA 1NYHA 1AQ5A 3L70E 2Z5HA 2ZYGA 3CCMP 1NU1D 4HJLA 5CXMA 4AYCA 1ZR4A 1KB9H 1IJDB 2KP8A 2OARA 3MIWA 1N7SC 3AE7C 4U3FG 3HTKB 2HMNA 1MUUA 2Y9YA 1KORA 2Y0EA 3MHVA 1NYKA 4D6TE 2MJZA 3KDPB 3T97B 2OYOA 1KILC 4JYCA 1HBWA 1SQQE 4IL6X 1NTZK 3JSVC 2G3AA 5BVZA 4HM5A 1G1JA 4TT3H 4ZMDA 1Q82Q 2NPSA 2OYHB 2Y9ZA 3VMHD 4GKGA 2QJPB 1FZFA 1LWUC 4BRYA 4LC1A 5BOKA 3L75E 2XV5A 1GU5A 2XU6A 2NRGA 1NO4A 2E75D 3CCRP 1AQTA 1W2EA 1NTZG 3H1HE 3JCUE 3HD7A 4I6MC 1NTKE 2E76C 1M56D 2KK7A 4U7JA 2AEFA 3A0BH 1N7SA 1T8ZA 3M06A 2AXCA 1Q81Q 1OVRA 3V5BA 4KHXA 1FZCB 1SQQK 2BCCJ 3AEGC 1AVYA 5E79E 1KILA 4EI2A 1Z56A 2JO6A 1SQPE 3CX5E 5CCHD 1BGYE 3UIAA 1SQQG 2Z4EA 1LWUA 3O6QA 2M5AA 3TNUB 4PD4E 1OMIA 1RE4A 1NTKK 3D6ZA 2WWWA 3EQQA 3L71D 3A5TA 3GMAA 1QL1A 5AW6B 2HPCB 3CCLP 2WSSH 3L74J 2A45G 1OVVA 2Q9IA 3H1HG 1M57D 2K88A 2BMOA 1G8KB 2QG4A 4EOTA 1SFCB 1M1JB 4N3YB 1ULIA 3BCCD 1HH0A 1UIIA 1L0NE 2CKFA 2WT7B 1E5WA 1SQPK 4HM2A 2KS1A 1JB0J 1VQOP 3H1IJ 1GDTA 2K9JB 1KB9I 3BASA 2O01J 3GHGA 1OVUA 2IBZI 2K3RA 2YKPA 2H8PD 2YIUC 3PTZA 1P84H 2O01N 5APQA 1NTME 3AE1C 3HE4B 4IFDK 1ZRTE 2Z5IA 4NPEA 1HGVA 1LT9B 2D2CC 3GF7A 1LP1B 3S1KA 2JKVA 2W6AA 1URQC 1FZAA 1BGYG 2JR8A 2LR2A 3VP8A 3W68A 3NXSA 4L73A 3H1KD 3GB4A 5KLVD 2NUKA 1NAYA 4L76A 4H13D 3GLMA 1KILE 1LT1A 5KJ7D 1J1EC 2P67A 4ZNCA 1NAFA 2M0BA 1S3JA 3GOBA 3BRVB 4QDCA 4JF7A 1KD1Q 3VMZA 4QDDA 1FDMA 1NTMK 1BSNA 4BRYB 1BCCE 1OZHA 4I7ZC 3IFMA 3VMGD 3VOPA 2P7JA 1XTGB 1OX3A 1T2KC 5AVZB 1S5LH 2WSFH 2N9YB 1KYOE 5AEWA 1NWQA 3SFEC 2AEMA 3P8CE 2XNDH 2JO1A 1L4AA 2XZRA 1GL2C 1URQA 2NZ2A 3LW5H 2ZT9B 5BU8B 2QM8A
chains in the Genus database with same CATH topology
3TGUE 1KMIZ 3EN1A 4HM8A 1OW8A 2YFJA 4PV1B 4HM1A 3R4YA 3Q3DA 4QDFA 2QJPC 3L73E 4XFJA 5KLIC 2HMMA 2J5UA 1ULJA 2XR8A 3ABVC 1VM9A 1YQ4C 2Q3WA 2XRXA 4Y28J 1GMJA 3C8VA 3N0QA 4U3FE 3L72E 3H1JE 2E76D 1TU3F 1EXJA 2OQQA 3D6YA 2YFLA 4AIVA 1O7WA 1RIEA 1UIXA 2E74C 2YFIA 4OGQC 3AEEC 5AEUA 1KQGB 3AE8C 2YMKA 2JP3A 2IDBA 2QIWA 4P1BH 3AE3C 2D2CB 2E76B 3RL0g 2HMKA 1EG9A 2HMJA 2WSEJ 4KT0J 4HM7A 1RFSA 2E75B 4R4MA 3IN6A 2BCCE 3SFDC 3AZCA 1NTZE 2HMLA 4HM6A 4H13C 3GZYA 4H0LD 4QDFB 2YVJB 4QUPA 4H44C 1PP9E 1JM1A 4NBCD 3S9OA 2ZT9D 2XSHA 4NBAD 1ZOYC 1SJGA 4NBBD 1NYHA 1FDIA 3L70E 1VCKA 3D71A 2QPZA 4HJLA 5CXMA 4EMJB 4HM3A 1P84E 3AECC 2XSOA 3AE7C 2NUMA 2HMNA 4Z1MH 1S5LX 1KORA 3GL0A 2BMRA 3L74E 4PV1C 1NYKA 1YQ3C 1VF5C 3T97B 1RQVA 1Q90D 1SQQE 4IL6X 1DD4A 2G3AA 1G8JB 4HM5A 1SQBE 1WMKA 4TT3H 3AEDC 3VMHD 2D2CD 4HM0A 2MKVA 5BOKA 1HF9A 3L75E 1EXIA 1NDOA 1OW6A 2E75D 3AE2C 3H1HE 3AEAC 3FGAD 3IAOA 1NU1E 5M1BA 2E76C 1NTKE 4QUQA 1IK7A 3VMID 3B71A 2H88C 3GKEA 1PPJE 5L8RJ 4U7JA 2E4PA 1RQUA 1K05A 4OGQB 2QJKC 3H1LE 3L71E 4QCKA 3CXHE 3EWKA 3AEGC 4AAYB 2DE5D 3H25A 2P10A 2GBWA 2NVFA 4NBDD 2NWFA 3GL2A 2JO6A 1SQPE 3AE5C 1ZMEC 3CX5E 1DD3A 2H89C 2JZAA 1S1CX 1KTMA 3O6QA 1Y9BA 3AE9C 1EZVE 4H0LC 4H44B 2E4QA 4PD4E 1OMIA 3GF3A 2ZT9C 4NBFD 4I7ZB 1U57A 3D6ZA 3EQQA 3C0DA 3GMAA 3AE4C 3GCEA 1OW7A 1UUVA 2WSCJ 2ZYLA 1FQTA 4GDOA 3Q2YA 2DE6D 2BMOA 1G8KB 1ULIA 3GTSA 3GZXA 1L0NE 2QJYC 2CKFA 3Q5PA 3H1KE 2B24A 5KLVE 1O7MA 1PIXA 4HM2A 1JB0J 1VF5B 5KKZC 2I7FA 1SQVE 3H1IE 4NBED 1Q90C 2O01J 2E74D 2FYUE 4OGQD 2HMOA 2YIUC 1O7NA 4HKVA 1NTME 3AE1C 1DIPA 2FXPA 1NGMB 1WQLA 1ZRTE 2K9YA 2D2CC 4YTPC 1L0LE 3GF7A 2WPVB 4QURA 1UUWA 1VL2A 3Q5RA 2WSFJ 2GBXA 2NVGA 2E74B 2V7QJ 2E75C 1R8EA 1O7PA 1KB9E 2A06E 3GB4A 3LW5J 2NUKA 4NB8D 4H13D 2DE7D 3D89A 3Q1MA 2FBWC 4RKUJ 2IBZE 3GLMA 1KILE 1O7GA 4H44D 4NBGD 2NVEA 3GTEA 2BMQA 2FYNC 3DQYA 4R4LA 2WQYC 3GOBA 3BCCE 3VCPA 4QDCA 5HL4A 1FDOA 1PV3A 4NBHD 4QDDA 4NB9D 3AEFC 2QSIA 4H13B 1AJYA 1BCCE 1SQXE 3AEBC 4I7ZC 3VMGD 3VCAA 3G9RA 3Q5SA 1MKMA 1PL5A 1KQFB 3FOUA 3AE6C 4P1CH 4PV1D 3CWBE 2BEZF 2BEQD 1KYOE 5AEWA 2B1XA 3D70A 4YXDC 1O7HA 4HM4A 3SFEC 1VF5D 1HJ0A 1BE3E 1ZP0C 2JO1A 4H0LB 2G8YA 2NZ2A 2ZT9B 1K04A 3RK3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMO A;  2YIU C;  3H1L E;  3L71 E;  1O7N A;  3TGU E;  4QCK A;  3EN1 A;  4NBB D;  4HM8 A;  3CXH E;  3L70 E;  4HKV A;  1NTM E;  1VCK A;  2YFJ A;  4AAY B;  4HM1 A;  2DE5 D;  1WQL A;  1ZRT E;  2QPZ A;  4HJL A;  2D2C C;  1L0L E;  4QDF A;  5CXM A;  4EMJ B;  4HM3 A;  2QJP C;  4QUR A;  2GBW A;  1P84 E;  3L73 E;  1UUW A;  5KLI C;  2HMM A;  1ULJ A;  2NVF A;  2XSO A;  2XR8 A;  4NBD D;  2GBX A;  1VM9 A;  2NWF A;  3GL2 A;  2NVG A;  2NUM A;  2JO6 A;  2Q3W A;  2XRX A;  1SQP E;  2HMN A;  2E75 C;  3GL0 A;  3CX5 E;  3N0Q A;  2BMR A;  3L74 E;  1O7P A;  1KB9 E;  2A06 E;  4PV1 C;  3GB4 A;  3L72 E;  4U3F E;  2NUK A;  2JZA A;  4NB8 D;  3H1J E;  1NYK A;  2E76 D;  4H13 D;  2DE7 D;  3D89 A;  1VF5 C;  2IBZ E;  1O7G A;  1EZV E;  4H0L C;  4H44 D;  4NBG D;  1SQQ E;  2E4Q A;  2YFL A;  4PD4 E;  4AIV A;  1O7W A;  1RIE A;  2ZT9 C;  2E74 C;  2YFI A;  2NVE A;  3GTE A;  2BMQ A;  4NBF D;  2FYN C;  4OGQ C;  5AEU A;  3DQY A;  3EQQ A;  1G8J B;  3C0D A;  3GOB A;  3BCC E;  4HM5 A;  3VCP A;  1SQB E;  4QDC A;  3GCE A;  5HL4 A;  1UUV A;  2YMK A;  2ZYL A;  1FQT A;  4NBH D;  4QDD A;  4NB9 D;  3VMH D;  2D2C D;  4P1B H;  4HM0 A;  2HMK A;  1EG9 A;  5BOK A;  2HMJ A;  2DE6 D;  3L75 E;  1BCC E;  1SQX E;  2BMO A;  1NDO A;  1G8K B;  4HM7 A;  4I7Z C;  3VMG D;  2E75 D;  3VCA A;  1RFS A;  1ULI A;  3GTS A;  3FOU A;  3GZX A;  3H1H E;  4P1C H;  2BCC E;  1L0N E;  2CKF A;  2QJY C;  4PV1 D;  3H1K E;  3CWB E;  2B24 A;  5KLV E;  1KYO E;  1O7M A;  5AEW A;  2B1X A;  4HM4 A;  1O7H A;  1NTZ E;  2HML A;  3AZC A;  1VF5 D;  1NU1 E;  4HM6 A;  1BE3 E;  4HM2 A;  5KKZ C;  1NTK E;  2E76 C;  4QUQ A;  2I7F A;  3VMI D;  4H13 C;  1SQV E;  3GZY A;  3H1I E;  4NBE D;  4H0L D;  3GKE A;  4QDF B;  2YVJ B;  1PPJ E;  4QUP A;  1Q90 C;  4H44 C;  1PP9 E;  1JM1 A;  4NBC D;  2ZT9 D;  2E74 D;  2E4P A;  2FYU E;  2XSH A;  4OGQ D;  4NBA D;  2QJK C;  1SJG A; 
#chains in the Genus database with same CATH topology
 2RKL A;  3EN1 A;  1OW8 A;  2QA4 P;  5CCG D;  2OYH C;  4O9B A;  4M3L A;  1EDL A;  5APY A;  3R4Y A;  1LJ2 A;  4N78 E;  2QJP C;  1SQV J;  3IF4 A;  3L73 E;  4XFJ A;  5KLI C;  1ULJ A;  1VM9 A;  3MZW B;  1EQ7 A;  1SP4 A;  3VTP C;  4XE5 B;  1HJB A;  3L70 D;  3C8V A;  3CCS P;  1TU3 F;  2WPR A;  1FAV A;  1H88 A;  1LNQ A;  2POH A;  3A0H E;  3FX0 A;  1R5S A;  3KYQ A;  1O7W A;  1RIE A;  3HTK A;  3C1L A;  5AEU A;  3CMA P;  1FZC C;  4KJM A;  2O3J A;  4AUW A;  4D6T D;  2QIW A;  5AW4 B;  3AE3 C;  2E76 B;  5AW3 B;  3T97 A;  3L35 A;  1RFS A;  2E75 B;  1LTJ B;  1P84 I;  2CK3 H;  2VRS A;  5APT A;  1WRG A;  2JEE A;  2BCC E;  3E1R A;  2N9B A;  2OYH A;  1KFM A;  3L72 D;  1LTT C;  2R32 A;  3H1J D;  1FOS F;  3GZY A;  4H0L D;  1GD2 E;  1ZXG A;  3S9O A;  3BRT B;  3V2N A;  1SQX J;  2FYN B;  4NPD A;  1ZOY C;  1SJG A;  2C9N Y;  3RL0 D;  4RJT A;  1NTK D;  2N1T C;  4HM3 A;  2J59 M;  5CBO A;  2WZ7 A;  1FC2 C;  1FZC A;  4DOJ A;  3GL0 A;  3TGU J;  5CJ0 A;  3L74 E;  1ZW0 A;  1YQ3 C;  1JEK A;  2KSJ A;  1Q90 D;  4C7R A;  1PP9 D;  3TSI A;  3A2A A;  4JBZ A;  1SQP D;  1HUC A;  4ZKU A;  2ZVN B;  2W8Z A;  3WU2 E;  1WMK A;  2H43 A;  1IFI A;  2E42 A;  4UB8 H;  1LTB C;  2FYZ A;  5AVW B;  1KN7 A;  2HG5 D;  1LT9 C;  3TNU A;  2KYV A;  1HF9 A;  1WT6 A;  2OGU A;  2BCC G;  3WMM 0;  3OAK A;  1OW6 A;  1NDO A;  2K1A A;  1IFJ A;  1DEE G;  2YIU B;  3AE2 C;  2LKM A;  2HPC A;  2KXP B;  1L2P A;  2K37 A;  2WIT A;  1AV1 A;  5KAF H;  1IK7 A;  2H88 C;  2QVA A;  1MV8 A;  3CCE P;  1K05 A;  1SFC A;  1AA0 A;  1M1J A;  1LGH B;  2W6B A;  4GOF A;  2QJK C;  5AW8 B;  2Y0D A;  2WT7 A;  1L0N D;  1SQB D;  3CXH E;  1VPC A;  5AVT B;  4WBA A;  4AAY B;  2IPP A;  3WUU A;  2P10 A;  2GBW A;  1EC5 A;  2Q5U A;  4NBD D;  2FFD B;  1IC2 A;  3VMA A;  3TF5 A;  3L74 G;  5APS A;  3USS A;  1X9V A;  1FOS E;  3EFF K;  4JQ0 D;  2IYO A;  1ZME C;  3HD7 D;  1DD3 A;  3HE4 A;  2JZA A;  1ZRT D;  1LT9 A;  1S1C X;  1K9M Q;  1KTM A;  1YYC A;  3AE9 C;  1LP1 A;  3FXD A;  5AVQ B;  1PPJ D;  3E1I A;  3V2Q A;  5TIS H;  2E4Q A;  2L5G B;  2ZT9 C;  2R5D A;  2JWA A;  4NBF D;  4I7Z B;  3QWO C;  3H1L D;  3C0D A;  1OXZ A;  3H1I G;  5KAI H;  1VQ5 P;  1OW7 A;  2OYI B;  2FYU G;  1GU4 A;  4HH2 A;  2DE6 D;  1GL2 B;  4WY4 D;  4IL6 H;  2YNY A;  2QJY C;  1PGQ A;  1JY3 P;  2O1J A;  5KKZ C;  5H2F E;  2I7F A;  1SQV E;  1EZV D;  5KLI B;  1X22 A;  1BCC D;  2E74 D;  1NJI Q;  1CZQ A;  3TK1 A;  2C0X A;  2W27 A;  2QRX A;  4PJ0 H;  3F89 A;  1O7N A;  4HKV A;  4YXW H;  1KYO D;  4ASV A;  1DIP A;  1NGM B;  4YTP C;  2WPV B;  1UUW A;  2PP6 A;  1VL2 A;  3Q5R A;  4RO0 A;  2WSF J;  4HKZ H;  3SSU A;  2WSC H;  2FXO A;  2KUB A;  2E75 C;  1LTJ C;  1VQN P;  3L71 J;  1CI6 B;  1KB9 E;  2A06 E;  2M3B A;  3CL3 D;  3LW5 J;  1JTH B;  4NB8 D;  1VQM P;  1VQ9 P;  2UWJ E;  3NFQ A;  2HOD B;  1PZQ A;  3D89 A;  2IBZ E;  3L73 D;  2I1K A;  1JMM A;  3GTE A;  2BMQ A;  2FYN C;  3V2R A;  1SQV K;  5B5E E;  3DQY A;  1BE3 G;  2IYP A;  4GIF A;  1PFI A;  5HL4 A;  4RES B;  1PV3 A;  1RF1 C;  4TLF A;  2QSI A;  1L0L D;  1QL2 A;  1AJY A;  1SQX E;  3ZDM A;  1IFN A;  3AEB C;  3VCA A;  1KZU B;  3G9R A;  1MKM A;  3FOU A;  3PLN A;  1SQV G;  4I2L C;  5CCH C;  4PV1 D;  4EIJ A;  2BEQ D;  2B1X A;  2V7Q H;  4YXD C;  1VF5 D;  1HJ0 A;  5B66 H;  1HTL C;  2N1T B;  4H0L B;  5GTH H;  3SWK A;  2R3S A;  1LTJ A;  1T3U A;  3TGU E;  1KMI Z;  4CPG A;  3A0B E;  2ZFC A;  1SLQ A;  3H1K J;  5KLV J;  3U1A A;  2HMM A;  3P32 A;  2OTK E;  2QM7 A;  2C0W A;  3FXE A;  2Q3W A;  2A06 G;  2FYU J;  2XRX A;  2KZJ A;  1OWA A;  1GMJ A;  2IBZ G;  3N0Q A;  1SQX K;  3U1C A;  3CWB D;  4EYY Q;  1RF1 A;  2W83 C;  1AFO A;  1L4A D;  3SWY A;  4OWF A;  1K73 Q;  5AVV B;  3RK3 D;  5CCH A;  1YJ9 P;  1MFT A;  2YMK A;  5GTI H;  2ZXE B;  1SQX G;  2ZXX A;  3OJA B;  1EG9 A;  2HMJ A;  4A7P A;  2FFD C;  4HJG H;  3P7K A;  4HM7 A;  2HLO A;  4R4M A;  4AQR D;  1GK4 A;  2QJK B;  3IN6 A;  3HUS C;  4BXL A;  4GOD A;  4U3F D;  4EDF A;  3PRJ A;  1YI2 P;  2Q1K A;  3IR9 A;  4H13 C;  2FKW B;  4QDF B;  2YVJ B;  5KJ7 C;  3TGU G;  1JM1 A;  2V4H A;  3FWL A;  5C39 A;  2XSH A;  2KB7 P;  2AXT H;  1HGZ A;  1PGO A;  1VCK A;  2OYI C;  3LIE A;  1VQK P;  1BE3 J;  1KC8 Q;  2KIK A;  1P84 E;  2XSO A;  4Z1M H;  1S5L X;  1YIJ P;  3CXH D;  2WSE H;  5APX A;  2BMR A;  1NTZ D;  1KV4 A;  4YPC A;  3MUD C;  2FFD A;  1U7J A;  3L4F A;  1FS0 E;  1FE6 A;  5AW5 B;  1S9K E;  4K3A A;  1NU1 G;  1W2B O;  1G8J B;  1K8A Q;  2WTY A;  1KQS O;  2R3C A;  2W6J H;  2QJY B;  2AEJ A;  1KFN A;  2IFM A;  5CCG C;  3L72 J;  2RMZ A;  1Q2N A;  3H1J J;  3EFG A;  5KKZ B;  4HM0 A;  3MTU E;  5KJ7 A;  2MKV A;  1QX8 A;  3II6 A;  4WVZ A;  1Y47 A;  1N86 A;  3QH9 A;  4WY4 B;  1VQ8 P;  1S4X A;  3CCV P;  2RH0 A;  3AEA C;  3FGA D;  5KTB A;  1YIT P;  2OYI A;  3IAO A;  4GT1 A;  2ZYA A;  3VMI D;  3GKE A;  1ZR2 A;  1GL2 A;  1S5L E;  1GK6 A;  5L8R J;  1VQ6 P;  1SQQ D;  1IFP A;  2E4P A;  1RQU A;  2B87 B;  1EZV I;  3L71 E;  2Y0C A;  1YTZ I;  3S4R A;  4C7N B;  3G4S P;  3I55 P;  1VQ7 P;  2YXQ B;  2E43 A;  1JY3 N;  1KYO I;  2NVF A;  3L75 D;  1PP9 J;  2YKO A;  3GL2 A;  1JO5 A;  4W7Z A;  3H1H D;  1IO4 A;  4NPF X;  5CCG A;  1ZN5 A;  1ZV8 A;  2H89 C;  3CME P;  1RF1 B;  1LTI C;  1Y9B A;  5AW9 B;  5APV A;  2KLU A;  4H0L C;  3B5N D;  2J58 A;  2WPS A;  2Q7C A;  2LXB A;  3CI9 A;  3GF3 A;  1SFC D;  1ZLL A;  4LGD E;  2DW3 A;  3L36 A;  4JPZ B;  1VQP P;  3RK2 D;  1MFZ A;  1CI6 A;  3RL0 C;  1JTH A;  2GUV A;  2WSC J;  2HOD A;  3GW6 A;  4GDO A;  2C9L Y;  2YO2 A;  4Y99 C;  5DJT B;  1IFM A;  3CXH H;  3KXD A;  1NHL A;  2RN0 A;  5APW A;  4UB6 H;  1YJN P;  1LTS C;  1W5C E;  2WMM A;  3CX5 D;  1N7L A;  3KZI H;  3CC4 P;  1SQB J;  3Q5P A;  3H1K E;  1BGY D;  5KLV E;  1O7M A;  1HVV A;  1VF5 B;  3H1I E;  1JY2 N;  3CCU P;  3CD6 P;  1EDK A;  1N2D C;  3L71 G;  1N73 B;  2KI7 B;  1Q90 C;  4PD4 D;  1NVO A;  2FYU E;  1JCC A;  4OGQ D;  5BU5 A;  2GA1 A;  3RBZ A;  3HE5 B;  2HMO A;  2GUS A;  2QE7 H;  3CCQ P;  2N1T A;  2ZJS E;  1NU1 J;  2O1K A;  3CC7 P;  3BCC G;  3OA7 A;  3R2P A;  2V7Q J;  5AW7 B;  3H1L J;  1Q86 Q;  3M9Q A;  2R5B A;  2NPS D;  4HB1 A;  2SPZ A;  2I1J A;  2FBW C;  4RKU J;  2KNC B;  1O7G A;  2QEX P;  4H44 D;  3KPE A;  5KLV K;  2NVE A;  4IFF A;  2CPB A;  3NMD A;  2WQY C;  4W80 A;  3RK3 B;  1T3J A;  3HUS B;  3VCP A;  1G1I A;  1YBK A;  1NTM D;  2FYU K;  2A45 H;  3B8E B;  4NBH D;  4NB9 D;  3AEF C;  1SVF A;  4H13 B;  3JCU H;  1RY3 A;  1S2E A;  1BCC J;  2HFE D;  4HYT B;  1N7S D;  4UB8 E;  3H1K G;  4W7Y A;  1QVF O;  5KLV G;  5CBN A;  1PL5 A;  4N6J A;  3U59 A;  3AE6 C;  2JDI H;  3HD7 C;  1U7M A;  3D70 A;  2XDJ A;  4HM4 A;  1O7H A;  3PH0 A;  1BE3 E;  1S72 P;  1ZP0 C;  1KIL D;  1VQ4 P;  2G8Y A;  1H89 A;  2ZYD A;  1K04 A;  2WPQ A;  5KAF E;  5E79 H;  4MN4 C;  1G2C A;  1DH3 A;  3SWF A;  2YFJ A;  2IFN A;  5B5E H;  4HM1 A;  2I8D A;  4QDF A;  3M0A A;  3L73 J;  3CX5 H;  3I56 P;  3VP9 A;  2XR8 A;  1MZ9 A;  4WY4 C;  1OFC X;  3VYI A;  4Y28 J;  5AVY B;  3FWN A;  3NTN A;  4PD4 H;  3L72 E;  3H1J E;  2E76 D;  1EXJ A;  1PGP A;  3CXH I;  3P8C D;  1P84 D;  3G6E P;  1QVG O;  1L0L J;  1CW5 A;  3D6Y A;  2Q6Q A;  2YFL A;  1UIX A;  2E74 C;  2YFI A;  1T6A A;  1RE4 C;  2Q3I A;  3AEE C;  4BWN A;  1GZL A;  3CC2 P;  1KQG B;  5TIS E;  3VMX A;  2P2U A;  3AE8 C;  4B86 A;  4XA4 A;  1M8O B;  3VN0 A;  2IDB A;  2OTL P;  4P1B H;  3RL0 g;  4N78 D;  1RE3 C;  5KAI E;  2E5T A;  4GOE A;  1H0T A;  2WSE J;  3L70 G;  4KT0 J;  1S9K D;  3EQ2 A;  3K5B A;  3BCC J;  3SFD C;  1YHQ P;  1KQL A;  4IL6 E;  4L75 A;  4IOI H;  2HML A;  1JY2 P;  1H8A A;  3O8Z A;  2L91 A;  1PGJ A;  1PP9 E;  4NBC D;  3GHG C;  4WY4 A;  1RF0 C;  3G3Z A;  4NBA D;  1FZG A;  4D6T G;  1M7L A;  3H32 B;  4NBB D;  1USE A;  1EDJ A;  1FDI A;  3TYY A;  2YXR B;  3CWB J;  2W90 A;  3D71 A;  2QPZ A;  4PJ0 E;  4EMJ B;  3AEC C;  1VDF A;  2M3E A;  3E7K A;  3CCJ P;  3V2P A;  2B87 A;  2NUM A;  3L72 G;  3BAT A;  3H1J G;  2HR3 A;  2A45 I;  2BCC D;  1VQL P;  3RL0 B;  4C7N A;  2ZVO B;  4PV1 C;  3L75 G;  1A02 J;  3JC2 2;  1VF5 C;  1RE3 A;  4Y99 B;  1RQV A;  3MD0 A;  5TJH A;  1BDD A;  1QGK B;  3B5N B;  1YJW P;  1N73 C;  1DD4 A;  1FJP A;  3M9B A;  1BSH A;  2R44 A;  1NTK G;  1DX7 A;  1EDI A;  1FJK A;  1D7M A;  1BDC A;  2ITA A;  1SQB E;  3HRN A;  3RK2 B;  1GW4 A;  3W67 A;  3AED C;  4U3F J;  2D2C D;  1URQ D;  1RF0 A;  1EXI A;  1KYO H;  2FY8 A;  2PGD A;  3L74 D;  1PP9 G;  4L74 A;  1NU1 E;  5M1B A;  4DZO A;  4QUQ A;  3CX5 I;  3B71 A;  1SQP G;  1JCD A;  1L4A C;  1PPJ E;  1J1D B;  5K5G B;  5AVS B;  3MGN A;  5B66 E;  4OGQ B;  2GM4 A;  3H1L E;  5GTH E;  3P8M C;  3RK3 C;  4QCK A;  4PD4 I;  3RBX A;  1XTC C;  3EWK A;  1G2C B;  2DE5 D;  2IZ1 A;  1NTZ J;  3H1I D;  3H25 A;  1L0N K;  1SQB K;  1NH4 A;  1N73 A;  2M8R A;  5AW0 B;  2NWF A;  4WB4 A;  2FYU D;  1CSB A;  3G71 P;  4K35 A;  2B89 A;  4WWI A;  4I1L A;  1JY3 O;  5CJ4 A;  3HE5 A;  3PP5 A;  1T2K D;  3AE5 C;  3M9H A;  3A0H H;  2YO3 A;  2BAS A;  3L70 J;  2NPS B;  4DT0 A;  1NKZ B;  1IK9 A;  3A3Y B;  3ITK A;  1EZV E;  1GL2 D;  4H44 B;  2H7H A;  1JNM A;  1L0N G;  1SQB G;  1NU1 K;  2P58 A;  1U57 A;  3MP7 B;  3AE4 C;  3GCE A;  3HD7 B;  4ASW A;  1UUV A;  4ZKP A;  2ZYL A;  1FQT A;  1IFD A;  2KNC A;  4D6T J;  1JM0 A;  3Q2Y A;  1YTZ T;  1X8Y A;  3PHL A;  1JUN A;  2XNX A;  3PJS K;  3C9I A;  5GTI E;  1NTM G;  1SQQ J;  1FBM A;  1N7S B;  3V4W A;  1H0T B;  4C46 A;  1A02 F;  3GTS A;  2Q3E A;  3HUS A;  3H6P A;  3GZX A;  5APU A;  1SS1 A;  1QEX A;  4JYB A;  1PPJ G;  2B24 A;  1PIX A;  4OVN F;  4NBE D;  1KIL B;  4OH8 B;  3H1L G;  5AW1 B;  3L75 J;  1M90 Q;  1E79 H;  2LXC B;  1GTW A;  1JY2 O;  1DEB A;  3H1H J;  4DCK A;  3V4Q A;  4QMA A;  1JMB A;  1J2J B;  2FXP A;  1BE3 D;  2AXT E;  3VMY A;  1WQL A;  2K9Y A;  3WUT A;  1NTK J;  1L0L E;  1X79 B;  1LTG C;  1LWU B;  3O6Q B;  2M5A B;  4QUR A;  2KSE A;  2GBX A;  3OW2 O;  2NVG A;  2E74 B;  3BVH A;  4LLH A;  1RH5 B;  1R8E A;  1EZV G;  1O7P A;  1BCC G;  2KZI A;  2DE7 D;  3Q1M A;  1SQV D;  3MUD A;  1IZN B;  2E5Y A;  3KQG A;  3WU2 H;  4NBG D;  1FU1 A;  2B88 A;  4DJG A;  3L37 A;  2PAJ A;  2PFX A;  1SQP J;  5CMZ A;  4R4L A;  2YMY A;  2OTJ P;  3BCC E;  1NOH A;  2O01 H;  1BGY J;  1FDO A;  2N1T D;  1USD A;  2KS1 B;  1HWT C;  2HYN A;  3B4S A;  5AVU B;  3GHG B;  1L0L K;  3Q5S A;  1KQF B;  4P1C H;  3L73 G;  3LID A;  3CWB E;  2BEZ F;  1KB9 D;  2A06 D;  3I5C A;  2YKQ A;  3N4X A;  3WUV A;  1NKN A;  1M1K Q;  2IBZ D;  3RGU A;  2WVR A;  3B5N C;  4IFM A;  1JOC A;  3M91 A;  1SFC C;  1M1J C;  2P1J A;  3RK3 E;  5EFW B;  3M0D C;  1Q7Y Q;  4HM8 A;  1L0L G;  3RK2 C;  1L0N J;  4PV1 B;  5DJU B;  2ZAE B;  3Q3D A;  2J5U A;  2CPS A;  3ABV C;  3GG2 A;  1SQX D;  1YQ4 C;  1GW3 A;  3H32 A;  2JWD A;  5AVX B;  2IZ0 A;  4U3F E;  1NTM J;  1Y8A A;  2B9B A;  3KHU A;  2JJL A;  2PRR A;  1J1D C;  2OQQ A;  4AIV A;  2KLV A;  4OGQ C;  5AVR B;  3TDK A;  2XKM A;  3TGU D;  2FXM A;  1QLE D;  1RHZ B;  2JP3 A;  2D2C B;  2HMK A;  2IX7 C;  3B5N A;  1L4A B;  1LTA C;  1URQ B;  3CPW O;  3CWB G;  3N7N A;  5H2F H;  3A7O A;  3M0D A;  1N8R Q;  1FZB A;  4UB6 E;  2KOG A;  3F5H A;  3AZC A;  1NTZ E;  4HM6 A;  2NPS C;  2K9J A;  1X0T A;  5CHX A;  3CLQ A;  3V6I A;  1FZE A;  3KZI E;  4QUP A;  4H44 C;  1R5L A;  1OIP A;  2ZT9 D;  5AW2 B;  1J1E B;  1AVO A;  1NYH A;  1AQ5 A;  3L70 E;  2Z5H A;  2ZYG A;  3CCM P;  1NU1 D;  4HJL A;  5CXM A;  4AYC A;  1ZR4 A;  1KB9 H;  1IJD B;  2KP8 A;  2OAR A;  3MIW A;  1N7S C;  3AE7 C;  4U3F G;  3HTK B;  2HMN A;  1MUU A;  2Y9Y A;  1KOR A;  2Y0E A;  3MHV A;  1NYK A;  4D6T E;  2MJZ A;  3KDP B;  3T97 B;  2OYO A;  1KIL C;  4JYC A;  1HBW A;  1SQQ E;  4IL6 X;  1NTZ K;  3JSV C;  2G3A A;  5BVZ A;  4HM5 A;  1G1J A;  4TT3 H;  4ZMD A;  1Q82 Q;  2NPS A;  2OYH B;  2Y9Z A;  3VMH D;  4GKG A;  2QJP B;  1FZF A;  1LWU C;  4BRY A;  4LC1 A;  5BOK A;  3L75 E;  2XV5 A;  1GU5 A;  2XU6 A;  2NRG A;  1NO4 A;  2E75 D;  3CCR P;  1AQT A;  1W2E A;  1NTZ G;  3H1H E;  3JCU E;  3HD7 A;  4I6M C;  1NTK E;  2E76 C;  1M56 D;  2KK7 A;  4U7J A;  2AEF A;  3A0B H;  1N7S A;  1T8Z A;  3M06 A;  2AXC A;  1Q81 Q;  1OVR A;  3V5B A;  4KHX A;  1FZC B;  1SQQ K;  2BCC J;  3AEG C;  1AVY A;  5E79 E;  1KIL A;  4EI2 A;  1Z56 A;  2JO6 A;  1SQP E;  3CX5 E;  5CCH D;  1BGY E;  3UIA A;  1SQQ G;  2Z4E A;  1LWU A;  3O6Q A;  2M5A A;  3TNU B;  4PD4 E;  1OMI A;  1RE4 A;  1NTK K;  3D6Z A;  2WWW A;  3EQQ A;  3L71 D;  3A5T A;  3GMA A;  1QL1 A;  5AW6 B;  2HPC B;  3CCL P;  2WSS H;  3L74 J;  2A45 G;  1OVV A;  2Q9I A;  3H1H G;  1M57 D;  2K88 A;  2BMO A;  1G8K B;  2QG4 A;  4EOT A;  1SFC B;  1M1J B;  4N3Y B;  1ULI A;  3BCC D;  1HH0 A;  1UII A;  1L0N E;  2CKF A;  2WT7 B;  1E5W A;  1SQP K;  4HM2 A;  2KS1 A;  1JB0 J;  1VQO P;  3H1I J;  1GDT A;  2K9J B;  1KB9 I;  3BAS A;  2O01 J;  3GHG A;  1OVU A;  2IBZ I;  2K3R A;  2YKP A;  2H8P D;  2YIU C;  3PTZ A;  1P84 H;  2O01 N;  5APQ A;  1NTM E;  3AE1 C;  3HE4 B;  4IFD K;  1ZRT E;  2Z5I A;  4NPE A;  1HGV A;  1LT9 B;  2D2C C;  3GF7 A;  1LP1 B;  3S1K A;  2JKV A;  2W6A A;  1URQ C;  1FZA A;  1BGY G;  2JR8 A;  2LR2 A;  3VP8 A;  3W68 A;  3NXS A;  4L73 A;  3H1K D;  3GB4 A;  5KLV D;  2NUK A;  1NAY A;  4L76 A;  4H13 D;  3GLM A;  1KIL E;  1LT1 A;  5KJ7 D;  1J1E C;  2P67 A;  4ZNC A;  1NAF A;  2M0B A;  1S3J A;  3GOB A;  3BRV B;  4QDC A;  4JF7 A;  1KD1 Q;  3VMZ A;  4QDD A;  1FDM A;  1NTM K;  1BSN A;  4BRY B;  1BCC E;  1OZH A;  4I7Z C;  3IFM A;  3VMG D;  3VOP A;  2P7J A;  1XTG B;  1OX3 A;  1T2K C;  5AVZ B;  1S5L H;  2WSF H;  2N9Y B;  1KYO E;  5AEW A;  1NWQ A;  3SFE C;  2AEM A;  3P8C E;  2XND H;  2JO1 A;  1L4A A;  2XZR A;  1GL2 C;  1URQ A;  2NZ2 A;  3LW5 H;  2ZT9 B;  5BU8 B;  2QM8 A; 
#chains in the Genus database with same CATH homology
 3TGU E;  1KMI Z;  3EN1 A;  4HM8 A;  1OW8 A;  2YFJ A;  4PV1 B;  4HM1 A;  3R4Y A;  3Q3D A;  4QDF A;  2QJP C;  3L73 E;  4XFJ A;  5KLI C;  2HMM A;  2J5U A;  1ULJ A;  2XR8 A;  3ABV C;  1VM9 A;  1YQ4 C;  2Q3W A;  2XRX A;  4Y28 J;  1GMJ A;  3C8V A;  3N0Q A;  4U3F E;  3L72 E;  3H1J E;  2E76 D;  1TU3 F;  1EXJ A;  2OQQ A;  3D6Y A;  2YFL A;  4AIV A;  1O7W A;  1RIE A;  1UIX A;  2E74 C;  2YFI A;  4OGQ C;  3AEE C;  5AEU A;  1KQG B;  3AE8 C;  2YMK A;  2JP3 A;  2IDB A;  2QIW A;  4P1B H;  3AE3 C;  2D2C B;  2E76 B;  3RL0 g;  2HMK A;  1EG9 A;  2HMJ A;  2WSE J;  4KT0 J;  4HM7 A;  1RFS A;  2E75 B;  4R4M A;  3IN6 A;  2BCC E;  3SFD C;  3AZC A;  1NTZ E;  2HML A;  4HM6 A;  4H13 C;  3GZY A;  4H0L D;  4QDF B;  2YVJ B;  4QUP A;  4H44 C;  1PP9 E;  1JM1 A;  4NBC D;  3S9O A;  2ZT9 D;  2XSH A;  4NBA D;  1ZOY C;  1SJG A;  4NBB D;  1NYH A;  1FDI A;  3L70 E;  1VCK A;  3D71 A;  2QPZ A;  4HJL A;  5CXM A;  4EMJ B;  4HM3 A;  1P84 E;  3AEC C;  2XSO A;  3AE7 C;  2NUM A;  2HMN A;  4Z1M H;  1S5L X;  1KOR A;  3GL0 A;  2BMR A;  3L74 E;  4PV1 C;  1NYK A;  1YQ3 C;  1VF5 C;  3T97 B;  1RQV A;  1Q90 D;  1SQQ E;  4IL6 X;  1DD4 A;  2G3A A;  1G8J B;  4HM5 A;  1SQB E;  1WMK A;  4TT3 H;  3AED C;  3VMH D;  2D2C D;  4HM0 A;  2MKV A;  5BOK A;  1HF9 A;  3L75 E;  1EXI A;  1NDO A;  1OW6 A;  2E75 D;  3AE2 C;  3H1H E;  3AEA C;  3FGA D;  3IAO A;  1NU1 E;  5M1B A;  2E76 C;  1NTK E;  4QUQ A;  1IK7 A;  3VMI D;  3B71 A;  2H88 C;  3GKE A;  1PPJ E;  5L8R J;  4U7J A;  2E4P A;  1RQU A;  1K05 A;  4OGQ B;  2QJK C;  3H1L E;  3L71 E;  4QCK A;  3CXH E;  3EWK A;  3AEG C;  4AAY B;  2DE5 D;  3H25 A;  2P10 A;  2GBW A;  2NVF A;  4NBD D;  2NWF A;  3GL2 A;  2JO6 A;  1SQP E;  3AE5 C;  1ZME C;  3CX5 E;  1DD3 A;  2H89 C;  2JZA A;  1S1C X;  1KTM A;  3O6Q A;  1Y9B A;  3AE9 C;  1EZV E;  4H0L C;  4H44 B;  2E4Q A;  4PD4 E;  1OMI A;  3GF3 A;  2ZT9 C;  4NBF D;  4I7Z B;  1U57 A;  3D6Z A;  3EQQ A;  3C0D A;  3GMA A;  3AE4 C;  3GCE A;  1OW7 A;  1UUV A;  2WSC J;  2ZYL A;  1FQT A;  4GDO A;  3Q2Y A;  2DE6 D;  2BMO A;  1G8K B;  1ULI A;  3GTS A;  3GZX A;  1L0N E;  2QJY C;  2CKF A;  3Q5P A;  3H1K E;  2B24 A;  5KLV E;  1O7M A;  1PIX A;  4HM2 A;  1JB0 J;  1VF5 B;  5KKZ C;  2I7F A;  1SQV E;  3H1I E;  4NBE D;  1Q90 C;  2O01 J;  2E74 D;  2FYU E;  4OGQ D;  2HMO A;  2YIU C;  1O7N A;  4HKV A;  1NTM E;  3AE1 C;  1DIP A;  2FXP A;  1NGM B;  1WQL A;  1ZRT E;  2K9Y A;  2D2C C;  4YTP C;  1L0L E;  3GF7 A;  2WPV B;  4QUR A;  1UUW A;  1VL2 A;  3Q5R A;  2WSF J;  2GBX A;  2NVG A;  2E74 B;  2V7Q J;  2E75 C;  1R8E A;  1O7P A;  1KB9 E;  2A06 E;  3GB4 A;  3LW5 J;  2NUK A;  4NB8 D;  4H13 D;  2DE7 D;  3D89 A;  3Q1M A;  2FBW C;  4RKU J;  2IBZ E;  3GLM A;  1KIL E;  1O7G A;  4H44 D;  4NBG D;  2NVE A;  3GTE A;  2BMQ A;  2FYN C;  3DQY A;  4R4L A;  2WQY C;  3GOB A;  3BCC E;  3VCP A;  4QDC A;  5HL4 A;  1FDO A;  1PV3 A;  4NBH D;  4QDD A;  4NB9 D;  3AEF C;  2QSI A;  4H13 B;  1AJY A;  1BCC E;  1SQX E;  3AEB C;  4I7Z C;  3VMG D;  3VCA A;  3G9R A;  3Q5S A;  1MKM A;  1PL5 A;  1KQF B;  3FOU A;  3AE6 C;  4P1C H;  4PV1 D;  3CWB E;  2BEZ F;  2BEQ D;  1KYO E;  5AEW A;  2B1X A;  3D70 A;  4YXD C;  1O7H A;  4HM4 A;  3SFE C;  1VF5 D;  1HJ0 A;  1BE3 E;  1ZP0 C;  2JO1 A;  4H0L B;  2G8Y A;  2NZ2 A;  2ZT9 B;  1K04 A;  3RK3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...