4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
2E74D 1SQXE 2HMLA 2BMRA 2QPZA 5KKZC 1UUWA 4PD4E 4NBBD 1O7GA 1EZVE 4I7ZC 1VM9A 2HMKA 2QJPC 3DQYA 3VMID 4HM0A 4U3FE 2NVFA 5HL4A 3CWBE 2QJKC 2YIUC 3EN1A 2GBXA 3BCCE 4NBCD 2E75C 2NWFA 2XSHA 2CKFA 4HM1A 4NBAD 3L72E 4NBED 1RIEA 2BMOA 4NBHD 5AEUA 4NB9D 1ULJA 2HMJA 2D2CD 2E76C 1SQPE 4P1BH 4PV1D 1NTKE 2E74C 2NUKA 3H1LE 4QUQA 1ZRTE 1VF5D 3H1JE 2ZT9D 4HM7A 4HM3A 1WQLA 4NB8D 2ZYLA 3GB4A 3L70E 3VMHD 4NBDD 5CXMA 2B24A 2YFJA 1G8JB 1NTME 3GTSA 4H13C 1L0LE 1VCKA 4HM6A 1NU1E 1PPJE 3D89A 1ULIA 2IBZE 4QDDA 2D2CC 2DE5D 1FQTA 4H0LD 2FYNC 4QDFB 3VCPA 4H44C 5AEWA 1SQBE 2DE7D 4AIVA 1VF5C 2ZT9C 2NVGA 3GKEA 5BOKA 1EG9A 4HJLA 5KLVE 4NBGD 2HMOA 3L74E 1KYOE 2HMMA 2I7FA 1O7NA 4QURA 2Q3WA 4P1CH 2XR8A 1NYKA 1SQQE 3H1HE 3L71E 4HM8A 1RFSA 1NTZE 1O7MA 3L73E 2BMQA 4OGQD 2FYUE 4QCKA 3H1KE 1G8KB 1L0NE 1BE3E 1KB9E 3VCAA 1SQVE 2JO6A 2QJYC 2E75D 2YVJB 2DE6D 1UUVA 4QDCA 3GOBA 3GL0A 4PV1C 3TGUE 4QUPA 4HM4A 2HMNA 2XRXA 4EMJB 3N0QA 2E76D 1P84E 3GTEA 2YFIA 3CX5E 3H1IE 2NVEA 3CXHE 1O7HA 2E4QA 2A06E 3L75E 4OGQC 2YFLA 2BCCE 5KLIC 2NUMA 2XSOA 3GZXA 2JZAA 3GZYA 2GBWA 4H0LC 1BCCE 3C0DA 3GL2A 4H13D 4QDFA 1Q90C 3EQQA 4HKVA 2B1XA 3AZCA 3FOUA 1PP9E 2YMKA 1NDOA 3GCEA 4H44D 4HM2A 4AAYB 1SJGA 1O7WA 3VMGD 4NBFD 2E4PA 4HM5A 1JM1A 1O7PA
chains in the Genus database with same CATH superfamily
2QA4P 5AW9B 3B5ND 1YQ3C 2NVFA 1NWQA 3CMEP 2C9LY 3Q1MA 4PV1D 2HODA 2N1TB 5APVA 5KJ7C 3H25A 2CPSA 3B5NA 3GB4A 1FZFA 3CWBG 4L76A 1VCKA 4RESB 2JWAA 3IN6A 3VN0A 1FQTA 4H0LD 2ZAEB 1H0TA 3D6ZA 2NVGA 4ZMDA 1FJPA 1K73Q 5EFWB 1L4AB 2R3SA 4LGDE 1ZLLA 2OTLP 2YXQB 3BATA 4IFDK 1O7MA 1BE3G 1PGPA 4QDCA 2KP8A 1HBWA 3AE5C 2XU6A 4HM4A 2E74B 1KD1Q 3M9BA 5CJ4A 3L71G 2KS1A 4N6JA 1LT9A 3RK2D 4LLHA 4EYYQ 2XNXA 5GTIE 2PFXA 1BSNA 2Z4EA 1RF0A 2FYUK 2IBZI 1LTJB 3S9OA 1SQQJ 3AEGC 1ZRTD 2Z5IA 2N1TC 1L0LJ 2I8DA 4NBBD 3M91A 1PV3A 2E75C 3HE5A 1SQVD 4NBED 1DX7A 5BU8B 4NB9D 1L2PA 2MJZA 4K3AA 1E79H 4UB8H 1N8RQ 2BASA 1L4AC 1QL1A 3AE1C 1GU5A 2Q3IA 1L0NJ 1K8AQ 1YJWP 2FBWC 1VQ7P 3CXHI 2WSEJ 3BRTB 4QDFB 1NKNA 3S1KA 2G3AA 3IF4A 1VQPP 3H6PA 1G1IA 1RQVA 5CCGD 4WY4B 1X0TA 1FZEA 2WSFJ 3LW5J 1G2CB 2QJKB 1J1DC 2L91A 2BMQA 3MP7B 2WITA 3AE9C 2JO6A 1QVGO 2IYPA 3TDKA 5CCGA 1K04A 4IFMA 3WMM0 2P58A 3CWBJ 5AVWB 4BWNA 1IK9A 3GL2A 5AW0B 1NTZK 2BEZF 4HKVA 3EWKA 1VQ8P 1PP9E 3A7OA 1S3JA 2JKVA 3M06A 5AVSB 5KAFE 1SQXE 2K9JB 2K3RA 4ASVA 4C7NA 2J5UA 1BE3J 1URQB 3JCUH 1BCCG 4AYCA 2FYUD 1OX3A 2CKFA 2DW3A 1M7LA 4NPFX 5APYA 1D7MA 1P84D 3H1ID 1KN7A 1N73B 2NZ2A 3L70E 1GZLA 2P1JA 4HH2A 3UIAA 2R32A 2WSCH 3U59A 1NU1E 3CX5H 1Q81Q 4JPZB 5H2FH 1GK4A 1KB9D 3USSA 2KSJA 2FXPA 5AVTB 4IL6X 2ZT9C 3S4RA 3CC7P 3W68A 3WUVA 1JB0J 1RHZB 1NTMG 4U3FD 1M8OB 3CD6P 4PJ0H 2AXCA 1NTMK 4RKUJ 3P8CE 1VQ5P 3RBZA 3TGUE 1TU3F 3P8MC 4GIFA 2QM7A 1YJ9P 1SQBK 3E1IA 2AXTH 3HRNA 1VPCA 1AA0A 2QIWA 2Y9ZA 2BCCE 1AJYA 3H1KG 3B71A 4ZKPA 3RK3D 1PP9G 3HUSC 3F5HA 3OAKA 1JM0A 1JY2N 2FYNB 1N7SB 1FZCB 2HPCA 1FS0E 3TNUB 2JWDA 1QEXA 4AAYB 1O7WA 2KIKA 4HM5A 4WB4A 3AEAC 4DZOA 1NTZD 2H7HA 2N9YB 4YXDC 3AE6C 3GG2A 1SQPE 2IFMA 1W2EA 3O6QA 1WQLA 5E79H 3NXSA 2ZXEB 3LIDA 2QE7H 3RBXA 4OGQB 1PPJE 1HUCA 4QDDA 3MGNA 2B89A 1GDTA 4KHXA 2QEXP 3GKEA 3MUDA 3VP9A 2HG5D 1BCCJ 2Q3WA 4P1CH 2Z5HA 2C0XA 1RFSA 1RE4A 4UB8E 2PRRA 2Y0EA 3L73E 3T97A 3ABVC 3TGUG 2FXOA 1N7SC 1KILB 4O9BA 2OYHB 3P32A 5AW7B 5KLVK 2BCCG 2FY8A 4GODA 4XFJA 1CI6A 1YTZT 3EQQA 2D2CB 1LTBC 1SQBD 2P2UA 4IOIH 1RF0C 1RF1A 2J58A 3Q3DA 5B5EH 2H8PD 1NTMJ 2BMRA 3P7KA 3L75G 3V2NA 2HMKA 3D71A 4HM0A 3EFGA 2XSHA 4NBAD 1LTJA 1UIXA 1Q82Q 1FOSF 5AW5B 1S9KE 3R2PA 1WRGA 1ZRTE 4JF7A 3GW6A 4YPCA 1KYOD 1FZGA 5KKZB 2Q1KA 2O3JA 3H1KJ 3Q5RA 1N2DC 1PP9J 1PPJG 1Z56A 2PAJA 1ULIA 3WUUA 1JY2O 3JCUE 5DJUB 1FE6A 1E5WA 1WT6A 1S5LH 2IPPA 4L75A 3L74E 4PD4D 1YIJP 3AE4C 3G71P 3L73G 1YYCA 1SFCA 1FBMA 1GL2B 3L72D 3ZDMA 1G8KB 2OGUA 2WTYA 2DE6D 3MHVA 1HGVA 3CLQA 1VQOP 3EFFK 5CCGC 3H1JD 1FU1A 1JCDA 3N0QA 2YFIA 3CX5E 1H89A 1T2KC 4XA4A 1FOSE 2R44A 2OTJP 2Q9IA 4OWFA 5KLIC 1X22A 4Y99C 2H43A 1NKZB 2B9BA 3I55P 1SQQK 1M90Q 3TF5A 1GW3A 1VQ6P 1AV1A 2VRSA 3GCEA 2JEEA 3KQGA 1T8ZA 4D6TD 4PJ0E 2ZVNB 1T3UA 2HMLA 2FFDA 1JUNA 5KKZC 2Y0DA 2UWJE 5CCHD 2LXCB 1HWTC 2FKWB 3TGUJ 4N78D 3BCCE 5GTHH 2AXTE 5CBOA 1IK7A 1KYOH 3N4XA 3PRJA 1DIPA 1VF5D 5CCHA 2BCCJ 4I6MC 4A7PA 2WT7B 4EOTA 3B4SA 4AUWA 4L74A 4IL6E 1QX8A 4JYCA 4BXLA 1YBKA 3V5BA 3SWKA 3D89A 1GL2C 2DE5D 1VQ9P 1IFIA 1OFCX 5AEWA 1FZBA 3VTPC 1MZ9A 1EC5A 4HJLA 3L74G 3L75J 1IFDA 2M5AA 4WBAA 1KFMA 2M3EA 4GOEA 1VL2A 3RL0D 2E75B 1FZAA 3HD7D 5E79E 1KB9E 3MZWB 4JBZA 1W2BO 1JTHA 2E76D 3B8EB 1U7JA 3K5BA 3H1HG 1A02F 4KJMA 1LGHB 2B87A 3HD7A 1YJNP 2YFLA 3GZXA 1YHQP 2IBZD 4MN4C 3CI9A 2QJYB 4L73A 3AE2C 5TJHA 3PHLA 1HH0A 3ITKA 5CBNA 4RO0A 3VMXA 3A0BH 2J59M 1SQQD 3L73J 5APWA 2XV5A 2KB7P 1LTSC 1NVOA 2LR2A 3VMID 3DQYA 3BCCG 1MV8A 2Q6QA 1L0LD 2O01N 1J1DB 2KNCA 2ZVOB 1KTMA 1RIEA 3FXDA 1ULJA 4CPGA 4R4MA 3V2PA 1IFNA 3H1LE 1NGMB 2A06D 4NBDD 5BU5A 2B24A 3GTSA 5B5EE 2LKMA 3NFQA 3MD0A 3GHGA 5L8RJ 1GMJA 1L0ND 2O1KA 1LP1A 1JCCA 5KTBA 4HYTB 3F89A 1KFNA 5DJTB 1Y47A 5APUA 1VQLP 3AE7C 1RE4C 3WUTA 1GU4A 2WPRA 2QJYC 1J2JB 1BSHA 5AW2B 1M1JB 4W7ZA 3HTKB 1KILD 1ZXGA 3VMZA 1BGYE 3CC2P 3Q2YA 1KQLA 2KYVA 1X9VA 3Q5PA 3CCJP 2XDJA 2OYIA 3CWBD 1S5LE 3C0DA 1Q90C 5AW4B 5C39A 1S4XA 3L74J 2M0BA 2RMZA 3CCEP 2ZT9B 1LWUA 1RF1C 2KOGA 4W80A 1FC2C 1EZVE 2GUSA 4ASWA 3VYIA 2AEMA 2JR8A 2GBXA 1S72P 2WSCJ 4GDOA 1BE3D 1ZN5A 1Y9BA 1IO4A 1IFMA 3H1LG 2NPSD 2RKLA 3HE4B 2W6JH 3H1HJ 4NB8D 2N9BA 3TK1A 3M9HA 3H32A 3L71D 1VQMP 5CXMA 3CX5I 1OW7A 2WWWA 1LTGC 1U7MA 2NPSA 3VCPA 3VOPA 3HUSB 4IFFA 4N3YB 2FYZA 1M1JC 3V2RA 4BRYA 1JEKA 5GTHE 1NAFA 1KYOE 3BCCJ 1PGJA 2XR8A 3D70A 4H13B 1SFCC 5CMZA 3VCAA 4H44B 2JDIH 2WMMA 1KMIZ 1LTAC 1DEEG 3QH9A 1BGYG 1JY3P 2HODB 1R5LA 1CSBA 1ZP0C 5KJ7D 1S2EA 2L5GB 3O8ZA 1RE3A 2SPZA 3E7KA 4ZKUA 3AEEC 2BEQD 3FOUA 3AEBC 4PV1B 3SSUA 1H0TB 1EDLA 1H8AA 3G4SP 5KJ7A 1SS1A 2PGDA 2HMNA 1CZQA 2OYOA 1EZVG 2FFDC 2ZYAA 1VM9A 4DT0A 3CPWO 2KSEA 1LJ2A 3AE3C 3EQ2A 2BMOA 4NBHD 3A3YB 1KQSO 4IL6H 1KB9I 1NTKE 5AVXB 1SQXG 3FWLA 1BDDA 3VMHD 2Y9YA 2KS1B 2JP3A 1SQXK 4H13C 3RGUA 3CCRP 2IX7C 1FDOA 4HB1A 4N78E 5AW8B 1P84H 3A0BE 1IC2A 4H44C 5APTA 1VF5C 2K9YA 1RH5B 2HYNA 3L70G 1KB9H 2I7FA 4QURA 2N1TD 2K88A 3B5NC 1NYKA 4ZNCA 1LNQA 4XE5B 1GTWA 2B88A 1NU1G 1IFPA 1BCCD 3H1LJ 3HE5B 3KHUA 4RJTA 2E75D 5AVZB 1NU1K 1OW6A 4PV1C 4YXWH 2V7QH 2YO3A 4DJGA 5APSA 2XRXA 3Q5SA 1RY3A 2N1TA 4OH8B 3AEDC 2A45I 1L4AD 2E42A 2ZJSE 2KUBA 3V4QA 3HD7C 3SWYA 3GZYA 4H0LC 4AQRD 3G3ZA 2R5DA 2NRGA 3L35A 3L36A 1YTZI 1L4AA 4NBFD 1LTIC 2E74D 2JO1A 1YI2P 1NTMD 3C8VA 1DD4A 4I2LC 1OZHA 1LT9C 2A45H 2NWFA 1HJBA 2RN0A 1LT1A 1BGYJ 2G8YA 1NTKG 2HMJA 2ZXXA 4HM7A 3M9QA 2IZ0A 3RK2C 3AEFC 5KLIB 1L0LE 4Y99B 3CC4P 2W6AA 5B66H 1ZR2A 2KLVA 3H1KD 3GHGC 3M0DA 1PP9D 2O1JA 1SQPG 1KV4A 1IZNB 1AQTA 2WVRA 2E5TA 1SQPK 2HMMA 1O7NA 2YKQA 1QGKB 4C7NB 3SWFA 2QM8A 1EZVI 1L0NE 1SQVE 3GOBA 3GL0A 1SQXJ 3CL3D 3U1AA 3GTEA 3KZIH 3M0AA 2NVEA 1KZUB 1VQKP 2WPSA 3GMAA 4WY4D 1VDFA 2OYIC 1W5CE 3PP5A 3L4FA 1OVRA 2GBWA 5CHXA 4QDFA 3KPEA 2O01H 2QVAA 2Q3EA 1MFZA 3HTKA 1KORA 1EDIA 3L70J 1LWUC 1HTLC 4WY4A 5AVYB 2QPZA 1UUWA 1NU1J 1O7GA 1G2CA 1KYOI 3CWBE 1PFIA 1EQ7A 1PZQA 2KZIA 3TGUD 1X79B 3FX0A 4P1BH 5KLVD 2WPVB 4QUQA 4NPDA 1SP4A 2ZYLA 3FGAD 1NHLA 2BCCD 1G8JB 1QLED 4W7YA 4HM6A 1URQD 3VMAA 1AVYA 2NPSC 1USDA 2HPCB 2E43A 1EG9A 1OMIA 3FWNA 3MTUE 3CMAP 1X8YA 2K9JA 1MFTA 2AEFA 1URQA 3L71E 3L75D 1YQ4C 1JO5A 1G1JA 3HUSA 1SQVG 3N7NA 2FYUE 2I1JA 1NTKJ 1ZW0A 1M56D 2XZRA 1R5SA 4PD4H 1N73A 1OWAA 3G9RA 1P84E 3I5CA 3H1IE 3O6QB 3CCMP 3VMYA 2Q5UA 1N86A 1PPJD 1RE3C 3SFDC 2W27A 1SQPJ 2E5YA 2YMKA 2ZYGA 5APXA 4GOFA 1SJGA 1O7PA 5AW1B 2KK7A 2C0WA 2XKMA 4U3FE 3L73D 2I1KA 1T6AA 3R4YA 3BRVB 3T97B 5AEUA 1PGQA 3BVHA 2KLUA 4OVNF 1N7SD 1AVOA 1QL2A 1XTGB 2YFJA 3RK3C 2YKOA 1M1KQ 1CI6B 1OVUA 3RK3E 1N7SA 3BASA 4KT0J 1FZCA 3TNUA 1Y8AA 1J1EC 2KZJA 1RF1B 2YO2A 4NBGD 2HR3A 4UB6E 2WSSH 2GM4A 3CXHD 1NTZE 2R5BA 2FYUG 4U7JA 4OGQD 2YVJB 1JNMA 3A0HE 3D6YA 1S9KD 4QUPA 4EIJA 4EMJB 1AQ5A 3H1IG 3KXDA 3U1CA 4TLFA 5B66E 1OXZA 1XTCC 1OIPA 2YKPA 3MUDC 2KI7B 4Y28J 3VP8A 1FJKA 1IFJA 1BCCE 2AEJA 1KQGB 2JJLA 1VQNP 4JQ0D 3VMGD 3L74D 2MKVA 4U3FG 1VQ4P 1SQVJ 4HKZH 1EXJA 3EN1A 1SFCB 3KZIE 1HGZA 2ITAA 3LIEA 1KILA 1UIIA 2D2CD 2OYHA 2E74C 2K1AA 3CX5D 1HF9A 3MIWA 3CCVP 1T2KD 1N7LA 3H1HD 2WPQA 4I7ZB 1FDMA 1NTME 3CCSP 2YIUB 1GW4A 1OVVA 4WWIA 3M0DC 3CXHH 2IYOA 1JY3N 1SQBE 5AW3B 5KAIH 3GF3A 1GD2E 1LTJC 2A45G 4B86A 3QWOC 1Q86Q 1JMBA 2KXPB 4C46A 1ZV8A 4NPEA 1NTZG 2FFDB 4DOJA 2WSEH 1GK6A 3BCCD 2HFED 2P67A 3H1KE 3CCUP 2OQQA 3PTZA 2K37A 1MKMA 2QSIA 5K5GB 4GT1A 1S1CX 2W83C 5M1BA 3OW2O 2WSFH 3LW5H 2YMYA 2NUMA 1NYHA 2IFNA 3OJAB 1GL2D 2H88C 2R3CA 1VF5B 1ZR4A 3L71J 2E4PA 3SFEC 3A2AA 5TISH 3V2QA 4WY4C 2FYUJ 4PD4E 2CPBA 3B5NB 2M5AB 4I7ZC 1GL2A 2QJKC 2YIUC 4HM1A 3L72E 1FDIA 2W6BA 3H1IJ 4TT3H 3V4WA 2NUKA 1U57A 1JTHB 3H1JE 1EXIA 4HM3A 5AVVB 5APQA 1P84I 3RL0B 1OW8A 2QJPB 2B87B 1NOHA 3HD7B 4H0LB 1SQBG 2IDBA 2E76B 3C9IA 3WU2H 2V7QJ 5KLVE 4U3FJ 2P10A 4D6TE 1CW5A 5CCHC 4I1LA 1URQC 2POHA 3C1LA 3A5TA 4HJGH 1LT9B 3E1RA 2C9NY 2KNCB 2LXBA 1UUVA 5AVQB 3IFMA 3H1LD 1NJIQ 2WT7A 1N73C 1O7HA 2E4QA 3L75E 3RK2B 1ZOYC 2JZAA 1Q2NA 2OTKE 2PP6A 3GHGB 3AZCA 3CCQP 2ZYDA 4QMAA 1NDOA 4HM2A 1LP1B 1RQUA 1JY3O 3KDPB 1IJDB 1NTZJ 4WVZA 2WQYC 1A02J 3RL0C 2QJPC 3JSVC 4R4LA 3NMDA 3L72G 4NBCD 2CK3H 4K35A 4LC1A 3PH0A 2E76C 3IAOA 2Y0CA 3H1JG 1AFOA 1JY2P 2H89C 1BGYD 5BVZA 1USEA 3NTNA 3PLNA 2OYIB 1WMKA 2IBZE 4UB6H 2QRXA 2FYNC 2OARA 1Q90D 1LTTC 1FZCC 2DE7D 4AIVA 5KLVG 4GKGA 3V6IA 1MUUA 4D6TG 1LWUB 2HMOA 3AECC 3II6A 5GTIH 2RH0A 1NTKK 2M3BA 1SQQE 1BDCA 1EZVD 1NAYA 1KQFB 3A0HH 1SVFA 3G6EP 2WZ7A 2Q7CA 1R8EA 3KYQA 2GA1A 1M57D 2V4HA 3AE8C 4QCKA 2GUVA 2O01J 3IR9A 3TYYA 5AVRB 1K05A 4DCKA 1S5LX 3L37A 1SQXD 3CXHE 2A06E 5KAIE 3H32B 4OGQC 1H88A 1SQBJ 2YNYA 2XSOA 3GF7A 2M8RA 2NPSB 1YITP 1DD3A 1EDJA 4BRYB 2QG4A 1HVVA 3L70D 4C7RA 2HLOA 2FXMA 2ZFCA 5HL4A 2W90A 1NU1D 3OA7A 1FAVA 2W8ZA 1SFCD 1M1JA 1JMMA 1KILC 2P7JA 2IZ1A 2OYHC 3RL0g 1KILE 2ZT9D 5AVUB 1KC8Q 4EI2A 2YXRB 2IBZG 4M3LA 1SLQA 1ZMEC 5TISE 1DEBA 2D2CC 1NH4A 3P8CD 1PGOA 3JC22 5BOKA 1HJ0A 1T3JA 5H2FE 4Z1MH 1DH3A 1SQQG 3CCLP 3W67A 3GLMA 3H1HE 3L72J 4HM8A 1JOCA 1L0LG 1PIXA 4PD4I 1NO4A 5KAFH 5AW6B 1BE3E 3FXEA 1L0LK 5CJ0A 3H1JJ 3PJSK 1Q7YQ 3HE4A 1NTKD 1K9MQ 2A06G 1EDKA 3WU2E 4JYBA 3RK3B 1QVFO 2XNDH 1L0NG 4H13D 5KLVJ 2B1XA 3TSIA 4D6TJ 1J1EB 1SQPD 1L0NK 4H44D 4EDFA 1SQVK 4YTPC 1JM1A 1PL5A 3I56P
chains in the Genus database with same CATH topology
2MKVA 2BMRA 1VM9A 2HMKA 3D71A 4HM0A 1YQ3C 3AE3C 2NVFA 1EXJA 3EN1A 2XSHA 4NBAD 2BMOA 4NBHD 1UIXA 2D2CD 3Q1MA 4PV1D 1NTKE 2E74C 1ZRTE 3H25A 1HF9A 3GB4A 3VMHD 4I7ZB 2JP3A 3Q5RA 1NTME 4H13C 1VCKA 1FDOA 3IN6A 1ULIA 1FQTA 4H0LD 4H44C 1SQBE 3GF3A 1VF5C 3D6ZA 2NVGA 2K9YA 3L74E 4QURA 2I7FA 1NYKA 3AE4C 1O7MA 3H1KE 1G8KB 4QDCA 2E75D 2DE6D 1OW6A 2OQQA 3AE5C 4PV1C 4HM4A 1MKMA 2XRXA 2QSIA 3Q5SA 2E74B 3N0QA 1S1CX 2YFIA 3CX5E 5M1BA 3AEDC 5KLIC 2NUMA 1NYHA 3GZYA 4H0LC 2H88C 1VF5B 3GCEA 3S9OA 3AEGC 4NBFD 2E4PA 3SFEC 2E74D 2HMLA 2JO1A 5KKZC 4PD4E 4NBBD 4I7ZC 1PV3A 3C8VA 1DD4A 2QJKC 2YIUC 3BCCE 2E75C 2NWFA 1IK7A 4HM1A 3L72E 1FDIA 4NBED 4NB9D 2G8YA 4TT3H 2HMJA 1DIPA 2NUKA 1U57A 1VF5D 1EXIA 3H1JE 4HM7A 4HM3A 3AE1C 1OW8A 3AEFC 2FBWC 1L0LE 2WSEJ 4H0LB 3D89A 2IDBA 2DE5D 4QDFB 5AEWA 2E76B 2G3AA 4HJLA 2V7QJ 5KLVE 1RQVA 2P10A 2HMMA 1O7NA 1VL2A 2WSFJ 3LW5J 2BMQA 2E75B 1L0NE 3AE9C 1KB9E 1SQVE 2JO6A 1UUVA 3GOBA 3GL0A 1K04A 2E76D 3GTEA 2NVEA 1O7HA 2E4QA 3L75E 1ZOYC 3GMAA 2YFLA 3GZXA 2JZAA 2GBWA 3GL2A 4QDFA 2BEZF 4HKVA 3EWKA 3AZCA 1PP9E 3AE2C 1NDOA 1KORA 4HM2A 1RQUA 1SQXE 2QPZA 1UUWA 2J5UA 2WQYC 1O7GA 3VMID 3DQYA 2QJPC 4R4LA 3CWBE 4NBCD 2CKFA 1KTMA 1RIEA 1ULJA 2E76C 3IAOA 4R4MA 4P1BH 3H1LE 2WPVB 4QUQA 1NGMB 2H89C 2NZ2A 2ZYLA 3L70E 4NBDD 3FGAD 2B24A 1G8JB 3GTSA 4HM6A 1NU1E 5L8RJ 1WMKA 1GMJA 2IBZE 2FYNC 1Q90D 2DE7D 2FXPA 4AIVA 4IL6X 2ZT9C 1EG9A 1OMIA 2HMOA 1JB0J 3AECC 1SQQE 1KQFB 3L71E 1YQ4C 1R8EA 3AE7C 3AE8C 2FYUE 4QCKA 4RKUJ 2QJYC 3TGUE 1TU3F 2O01J 1K05A 3G9RA 1P84E 1S5LX 3H1IE 3Q2YA 3CXHE 3Q5PA 2A06E 4OGQC 2QIWA 2BCCE 2XSOA 1AJYA 3GF7A 3SFDC 3B71A 3C0DA 1Q90C 2YMKA 2ZT9B 1DD3A 4AAYB 1SJGA 1O7WA 4HM5A 1O7PA 3AEAC 1EZVE 4U3FE 5HL4A 4YXDC 2GBXA 2WSCJ 4GDOA 3R4YA 1Y9BA 3AE6C 3T97B 5AEUA 1SQPE 3RL0g 1KILE 3O6QA 2ZT9D 1WQLA 4NB8D 5CXMA 1OW7A 2YFJA 4OGQB 1ZMEC 1PPJE 4QDDA 2D2CC 3RK3E 3VCPA 4KT0J 3GKEA 5BOKA 1HJ0A 4NBGD 4Z1MH 1KYOE 2Q3WA 4P1CH 2XR8A 3GLMA 3H1HE 4HM8A 3D70A 1RFSA 1PIXA 1NTZE 4H13B 4U7JA 3L73E 4OGQD 3ABVC 1BE3E 3VCAA 2YVJB 4H44B 1KMIZ 3D6YA 4QUPA 4EMJB 1ZP0C 4Y28J 4XFJA 1BCCE 3AEEC 4H13D 3EQQA 2BEQD 2D2CB 2B1XA 3FOUA 3AEBC 4PV1B 1KQGB 4H44D 3Q3DA 3VMGD 4YTPC 1JM1A 1PL5A 2HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 D;  1SQX E;  2HML A;  2BMR A;  2QPZ A;  5KKZ C;  1UUW A;  4PD4 E;  4NBB D;  1O7G A;  1EZV E;  4I7Z C;  1VM9 A;  2HMK A;  2QJP C;  3DQY A;  3VMI D;  4HM0 A;  4U3F E;  2NVF A;  5HL4 A;  3CWB E;  2QJK C;  2YIU C;  3EN1 A;  2GBX A;  3BCC E;  4NBC D;  2E75 C;  2NWF A;  2XSH A;  2CKF A;  4HM1 A;  4NBA D;  3L72 E;  4NBE D;  1RIE A;  2BMO A;  4NBH D;  5AEU A;  4NB9 D;  1ULJ A;  2HMJ A;  2D2C D;  2E76 C;  1SQP E;  4P1B H;  4PV1 D;  1NTK E;  2E74 C;  2NUK A;  3H1L E;  4QUQ A;  1ZRT E;  1VF5 D;  3H1J E;  2ZT9 D;  4HM7 A;  4HM3 A;  1WQL A;  4NB8 D;  2ZYL A;  3GB4 A;  3L70 E;  3VMH D;  4NBD D;  5CXM A;  2B24 A;  2YFJ A;  1G8J B;  1NTM E;  3GTS A;  4H13 C;  1L0L E;  1VCK A;  4HM6 A;  1NU1 E;  1PPJ E;  3D89 A;  1ULI A;  2IBZ E;  4QDD A;  2D2C C;  2DE5 D;  1FQT A;  4H0L D;  2FYN C;  4QDF B;  3VCP A;  4H44 C;  5AEW A;  1SQB E;  2DE7 D;  4AIV A;  1VF5 C;  2ZT9 C;  2NVG A;  3GKE A;  5BOK A;  1EG9 A;  4HJL A;  5KLV E;  4NBG D;  2HMO A;  3L74 E;  1KYO E;  2HMM A;  2I7F A;  1O7N A;  4QUR A;  2Q3W A;  4P1C H;  2XR8 A;  1NYK A;  1SQQ E;  3H1H E;  3L71 E;  4HM8 A;  1RFS A;  1NTZ E;  1O7M A;  3L73 E;  2BMQ A;  4OGQ D;  2FYU E;  4QCK A;  3H1K E;  1G8K B;  1L0N E;  1BE3 E;  1KB9 E;  3VCA A;  1SQV E;  2JO6 A;  2QJY C;  2E75 D;  2YVJ B;  2DE6 D;  1UUV A;  4QDC A;  3GOB A;  3GL0 A;  4PV1 C;  3TGU E;  4QUP A;  4HM4 A;  2HMN A;  2XRX A;  4EMJ B;  3N0Q A;  2E76 D;  1P84 E;  3GTE A;  2YFI A;  3CX5 E;  3H1I E;  2NVE A;  3CXH E;  1O7H A;  2E4Q A;  2A06 E;  3L75 E;  4OGQ C;  2YFL A;  2BCC E;  5KLI C;  2NUM A;  2XSO A;  3GZX A;  2JZA A;  3GZY A;  2GBW A;  4H0L C;  1BCC E;  3C0D A;  3GL2 A;  4H13 D;  4QDF A;  1Q90 C;  3EQQ A;  4HKV A;  2B1X A;  3AZC A;  3FOU A;  1PP9 E;  2YMK A;  1NDO A;  3GCE A;  4H44 D;  4HM2 A;  4AAY B;  1SJG A;  1O7W A;  3VMG D;  4NBF D;  2E4P A;  4HM5 A;  1JM1 A;  1O7P A; 
#chains in the Genus database with same CATH topology
 2QA4 P;  5AW9 B;  3B5N D;  1YQ3 C;  2NVF A;  1NWQ A;  3CME P;  2C9L Y;  3Q1M A;  4PV1 D;  2HOD A;  2N1T B;  5APV A;  5KJ7 C;  3H25 A;  2CPS A;  3B5N A;  3GB4 A;  1FZF A;  3CWB G;  4L76 A;  1VCK A;  4RES B;  2JWA A;  3IN6 A;  3VN0 A;  1FQT A;  4H0L D;  2ZAE B;  1H0T A;  3D6Z A;  2NVG A;  4ZMD A;  1FJP A;  1K73 Q;  5EFW B;  1L4A B;  2R3S A;  4LGD E;  1ZLL A;  2OTL P;  2YXQ B;  3BAT A;  4IFD K;  1O7M A;  1BE3 G;  1PGP A;  4QDC A;  2KP8 A;  1HBW A;  3AE5 C;  2XU6 A;  4HM4 A;  2E74 B;  1KD1 Q;  3M9B A;  5CJ4 A;  3L71 G;  2KS1 A;  4N6J A;  1LT9 A;  3RK2 D;  4LLH A;  4EYY Q;  2XNX A;  5GTI E;  2PFX A;  1BSN A;  2Z4E A;  1RF0 A;  2FYU K;  2IBZ I;  1LTJ B;  3S9O A;  1SQQ J;  3AEG C;  1ZRT D;  2Z5I A;  2N1T C;  1L0L J;  2I8D A;  4NBB D;  3M91 A;  1PV3 A;  2E75 C;  3HE5 A;  1SQV D;  4NBE D;  1DX7 A;  5BU8 B;  4NB9 D;  1L2P A;  2MJZ A;  4K3A A;  1E79 H;  4UB8 H;  1N8R Q;  2BAS A;  1L4A C;  1QL1 A;  3AE1 C;  1GU5 A;  2Q3I A;  1L0N J;  1K8A Q;  1YJW P;  2FBW C;  1VQ7 P;  3CXH I;  2WSE J;  3BRT B;  4QDF B;  1NKN A;  3S1K A;  2G3A A;  3IF4 A;  1VQP P;  3H6P A;  1G1I A;  1RQV A;  5CCG D;  4WY4 B;  1X0T A;  1FZE A;  2WSF J;  3LW5 J;  1G2C B;  2QJK B;  1J1D C;  2L91 A;  2BMQ A;  3MP7 B;  2WIT A;  3AE9 C;  2JO6 A;  1QVG O;  2IYP A;  3TDK A;  5CCG A;  1K04 A;  4IFM A;  3WMM 0;  2P58 A;  3CWB J;  5AVW B;  4BWN A;  1IK9 A;  3GL2 A;  5AW0 B;  1NTZ K;  2BEZ F;  4HKV A;  3EWK A;  1VQ8 P;  1PP9 E;  3A7O A;  1S3J A;  2JKV A;  3M06 A;  5AVS B;  5KAF E;  1SQX E;  2K9J B;  2K3R A;  4ASV A;  4C7N A;  2J5U A;  1BE3 J;  1URQ B;  3JCU H;  1BCC G;  4AYC A;  2FYU D;  1OX3 A;  2CKF A;  2DW3 A;  1M7L A;  4NPF X;  5APY A;  1D7M A;  1P84 D;  3H1I D;  1KN7 A;  1N73 B;  2NZ2 A;  3L70 E;  1GZL A;  2P1J A;  4HH2 A;  3UIA A;  2R32 A;  2WSC H;  3U59 A;  1NU1 E;  3CX5 H;  1Q81 Q;  4JPZ B;  5H2F H;  1GK4 A;  1KB9 D;  3USS A;  2KSJ A;  2FXP A;  5AVT B;  4IL6 X;  2ZT9 C;  3S4R A;  3CC7 P;  3W68 A;  3WUV A;  1JB0 J;  1RHZ B;  1NTM G;  4U3F D;  1M8O B;  3CD6 P;  4PJ0 H;  2AXC A;  1NTM K;  4RKU J;  3P8C E;  1VQ5 P;  3RBZ A;  3TGU E;  1TU3 F;  3P8M C;  4GIF A;  2QM7 A;  1YJ9 P;  1SQB K;  3E1I A;  2AXT H;  3HRN A;  1VPC A;  1AA0 A;  2QIW A;  2Y9Z A;  2BCC E;  1AJY A;  3H1K G;  3B71 A;  4ZKP A;  3RK3 D;  1PP9 G;  3HUS C;  3F5H A;  3OAK A;  1JM0 A;  1JY2 N;  2FYN B;  1N7S B;  1FZC B;  2HPC A;  1FS0 E;  3TNU B;  2JWD A;  1QEX A;  4AAY B;  1O7W A;  2KIK A;  4HM5 A;  4WB4 A;  3AEA C;  4DZO A;  1NTZ D;  2H7H A;  2N9Y B;  4YXD C;  3AE6 C;  3GG2 A;  1SQP E;  2IFM A;  1W2E A;  3O6Q A;  1WQL A;  5E79 H;  3NXS A;  2ZXE B;  3LID A;  2QE7 H;  3RBX A;  4OGQ B;  1PPJ E;  1HUC A;  4QDD A;  3MGN A;  2B89 A;  1GDT A;  4KHX A;  2QEX P;  3GKE A;  3MUD A;  3VP9 A;  2HG5 D;  1BCC J;  2Q3W A;  4P1C H;  2Z5H A;  2C0X A;  1RFS A;  1RE4 A;  4UB8 E;  2PRR A;  2Y0E A;  3L73 E;  3T97 A;  3ABV C;  3TGU G;  2FXO A;  1N7S C;  1KIL B;  4O9B A;  2OYH B;  3P32 A;  5AW7 B;  5KLV K;  2BCC G;  2FY8 A;  4GOD A;  4XFJ A;  1CI6 A;  1YTZ T;  3EQQ A;  2D2C B;  1LTB C;  1SQB D;  2P2U A;  4IOI H;  1RF0 C;  1RF1 A;  2J58 A;  3Q3D A;  5B5E H;  2H8P D;  1NTM J;  2BMR A;  3P7K A;  3L75 G;  3V2N A;  2HMK A;  3D71 A;  4HM0 A;  3EFG A;  2XSH A;  4NBA D;  1LTJ A;  1UIX A;  1Q82 Q;  1FOS F;  5AW5 B;  1S9K E;  3R2P A;  1WRG A;  1ZRT E;  4JF7 A;  3GW6 A;  4YPC A;  1KYO D;  1FZG A;  5KKZ B;  2Q1K A;  2O3J A;  3H1K J;  3Q5R A;  1N2D C;  1PP9 J;  1PPJ G;  1Z56 A;  2PAJ A;  1ULI A;  3WUU A;  1JY2 O;  3JCU E;  5DJU B;  1FE6 A;  1E5W A;  1WT6 A;  1S5L H;  2IPP A;  4L75 A;  3L74 E;  4PD4 D;  1YIJ P;  3AE4 C;  3G71 P;  3L73 G;  1YYC A;  1SFC A;  1FBM A;  1GL2 B;  3L72 D;  3ZDM A;  1G8K B;  2OGU A;  2WTY A;  2DE6 D;  3MHV A;  1HGV A;  3CLQ A;  1VQO P;  3EFF K;  5CCG C;  3H1J D;  1FU1 A;  1JCD A;  3N0Q A;  2YFI A;  3CX5 E;  1H89 A;  1T2K C;  4XA4 A;  1FOS E;  2R44 A;  2OTJ P;  2Q9I A;  4OWF A;  5KLI C;  1X22 A;  4Y99 C;  2H43 A;  1NKZ B;  2B9B A;  3I55 P;  1SQQ K;  1M90 Q;  3TF5 A;  1GW3 A;  1VQ6 P;  1AV1 A;  2VRS A;  3GCE A;  2JEE A;  3KQG A;  1T8Z A;  4D6T D;  4PJ0 E;  2ZVN B;  1T3U A;  2HML A;  2FFD A;  1JUN A;  5KKZ C;  2Y0D A;  2UWJ E;  5CCH D;  2LXC B;  1HWT C;  2FKW B;  3TGU J;  4N78 D;  3BCC E;  5GTH H;  2AXT E;  5CBO A;  1IK7 A;  1KYO H;  3N4X A;  3PRJ A;  1DIP A;  1VF5 D;  5CCH A;  2BCC J;  4I6M C;  4A7P A;  2WT7 B;  4EOT A;  3B4S A;  4AUW A;  4L74 A;  4IL6 E;  1QX8 A;  4JYC A;  4BXL A;  1YBK A;  3V5B A;  3SWK A;  3D89 A;  1GL2 C;  2DE5 D;  1VQ9 P;  1IFI A;  1OFC X;  5AEW A;  1FZB A;  3VTP C;  1MZ9 A;  1EC5 A;  4HJL A;  3L74 G;  3L75 J;  1IFD A;  2M5A A;  4WBA A;  1KFM A;  2M3E A;  4GOE A;  1VL2 A;  3RL0 D;  2E75 B;  1FZA A;  3HD7 D;  5E79 E;  1KB9 E;  3MZW B;  4JBZ A;  1W2B O;  1JTH A;  2E76 D;  3B8E B;  1U7J A;  3K5B A;  3H1H G;  1A02 F;  4KJM A;  1LGH B;  2B87 A;  3HD7 A;  1YJN P;  2YFL A;  3GZX A;  1YHQ P;  2IBZ D;  4MN4 C;  3CI9 A;  2QJY B;  4L73 A;  3AE2 C;  5TJH A;  3PHL A;  1HH0 A;  3ITK A;  5CBN A;  4RO0 A;  3VMX A;  3A0B H;  2J59 M;  1SQQ D;  3L73 J;  5APW A;  2XV5 A;  2KB7 P;  1LTS C;  1NVO A;  2LR2 A;  3VMI D;  3DQY A;  3BCC G;  1MV8 A;  2Q6Q A;  1L0L D;  2O01 N;  1J1D B;  2KNC A;  2ZVO B;  1KTM A;  1RIE A;  3FXD A;  1ULJ A;  4CPG A;  4R4M A;  3V2P A;  1IFN A;  3H1L E;  1NGM B;  2A06 D;  4NBD D;  5BU5 A;  2B24 A;  3GTS A;  5B5E E;  2LKM A;  3NFQ A;  3MD0 A;  3GHG A;  5L8R J;  1GMJ A;  1L0N D;  2O1K A;  1LP1 A;  1JCC A;  5KTB A;  4HYT B;  3F89 A;  1KFN A;  5DJT B;  1Y47 A;  5APU A;  1VQL P;  3AE7 C;  1RE4 C;  3WUT A;  1GU4 A;  2WPR A;  2QJY C;  1J2J B;  1BSH A;  5AW2 B;  1M1J B;  4W7Z A;  3HTK B;  1KIL D;  1ZXG A;  3VMZ A;  1BGY E;  3CC2 P;  3Q2Y A;  1KQL A;  2KYV A;  1X9V A;  3Q5P A;  3CCJ P;  2XDJ A;  2OYI A;  3CWB D;  1S5L E;  3C0D A;  1Q90 C;  5AW4 B;  5C39 A;  1S4X A;  3L74 J;  2M0B A;  2RMZ A;  3CCE P;  2ZT9 B;  1LWU A;  1RF1 C;  2KOG A;  4W80 A;  1FC2 C;  1EZV E;  2GUS A;  4ASW A;  3VYI A;  2AEM A;  2JR8 A;  2GBX A;  1S72 P;  2WSC J;  4GDO A;  1BE3 D;  1ZN5 A;  1Y9B A;  1IO4 A;  1IFM A;  3H1L G;  2NPS D;  2RKL A;  3HE4 B;  2W6J H;  3H1H J;  4NB8 D;  2N9B A;  3TK1 A;  3M9H A;  3H32 A;  3L71 D;  1VQM P;  5CXM A;  3CX5 I;  1OW7 A;  2WWW A;  1LTG C;  1U7M A;  2NPS A;  3VCP A;  3VOP A;  3HUS B;  4IFF A;  4N3Y B;  2FYZ A;  1M1J C;  3V2R A;  4BRY A;  1JEK A;  5GTH E;  1NAF A;  1KYO E;  3BCC J;  1PGJ A;  2XR8 A;  3D70 A;  4H13 B;  1SFC C;  5CMZ A;  3VCA A;  4H44 B;  2JDI H;  2WMM A;  1KMI Z;  1LTA C;  1DEE G;  3QH9 A;  1BGY G;  1JY3 P;  2HOD B;  1R5L A;  1CSB A;  1ZP0 C;  5KJ7 D;  1S2E A;  2L5G B;  3O8Z A;  1RE3 A;  2SPZ A;  3E7K A;  4ZKU A;  3AEE C;  2BEQ D;  3FOU A;  3AEB C;  4PV1 B;  3SSU A;  1H0T B;  1EDL A;  1H8A A;  3G4S P;  5KJ7 A;  1SS1 A;  2PGD A;  2HMN A;  1CZQ A;  2OYO A;  1EZV G;  2FFD C;  2ZYA A;  1VM9 A;  4DT0 A;  3CPW O;  2KSE A;  1LJ2 A;  3AE3 C;  3EQ2 A;  2BMO A;  4NBH D;  3A3Y B;  1KQS O;  4IL6 H;  1KB9 I;  1NTK E;  5AVX B;  1SQX G;  3FWL A;  1BDD A;  3VMH D;  2Y9Y A;  2KS1 B;  2JP3 A;  1SQX K;  4H13 C;  3RGU A;  3CCR P;  2IX7 C;  1FDO A;  4HB1 A;  4N78 E;  5AW8 B;  1P84 H;  3A0B E;  1IC2 A;  4H44 C;  5APT A;  1VF5 C;  2K9Y A;  1RH5 B;  2HYN A;  3L70 G;  1KB9 H;  2I7F A;  4QUR A;  2N1T D;  2K88 A;  3B5N C;  1NYK A;  4ZNC A;  1LNQ A;  4XE5 B;  1GTW A;  2B88 A;  1NU1 G;  1IFP A;  1BCC D;  3H1L J;  3HE5 B;  3KHU A;  4RJT A;  2E75 D;  5AVZ B;  1NU1 K;  1OW6 A;  4PV1 C;  4YXW H;  2V7Q H;  2YO3 A;  4DJG A;  5APS A;  2XRX A;  3Q5S A;  1RY3 A;  2N1T A;  4OH8 B;  3AED C;  2A45 I;  1L4A D;  2E42 A;  2ZJS E;  2KUB A;  3V4Q A;  3HD7 C;  3SWY A;  3GZY A;  4H0L C;  4AQR D;  3G3Z A;  2R5D A;  2NRG A;  3L35 A;  3L36 A;  1YTZ I;  1L4A A;  4NBF D;  1LTI C;  2E74 D;  2JO1 A;  1YI2 P;  1NTM D;  3C8V A;  1DD4 A;  4I2L C;  1OZH A;  1LT9 C;  2A45 H;  2NWF A;  1HJB A;  2RN0 A;  1LT1 A;  1BGY J;  2G8Y A;  1NTK G;  2HMJ A;  2ZXX A;  4HM7 A;  3M9Q A;  2IZ0 A;  3RK2 C;  3AEF C;  5KLI B;  1L0L E;  4Y99 B;  3CC4 P;  2W6A A;  5B66 H;  1ZR2 A;  2KLV A;  3H1K D;  3GHG C;  3M0D A;  1PP9 D;  2O1J A;  1SQP G;  1KV4 A;  1IZN B;  1AQT A;  2WVR A;  2E5T A;  1SQP K;  2HMM A;  1O7N A;  2YKQ A;  1QGK B;  4C7N B;  3SWF A;  2QM8 A;  1EZV I;  1L0N E;  1SQV E;  3GOB A;  3GL0 A;  1SQX J;  3CL3 D;  3U1A A;  3GTE A;  3KZI H;  3M0A A;  2NVE A;  1KZU B;  1VQK P;  2WPS A;  3GMA A;  4WY4 D;  1VDF A;  2OYI C;  1W5C E;  3PP5 A;  3L4F A;  1OVR A;  2GBW A;  5CHX A;  4QDF A;  3KPE A;  2O01 H;  2QVA A;  2Q3E A;  1MFZ A;  3HTK A;  1KOR A;  1EDI A;  3L70 J;  1LWU C;  1HTL C;  4WY4 A;  5AVY B;  2QPZ A;  1UUW A;  1NU1 J;  1O7G A;  1G2C A;  1KYO I;  3CWB E;  1PFI A;  1EQ7 A;  1PZQ A;  2KZI A;  3TGU D;  1X79 B;  3FX0 A;  4P1B H;  5KLV D;  2WPV B;  4QUQ A;  4NPD A;  1SP4 A;  2ZYL A;  3FGA D;  1NHL A;  2BCC D;  1G8J B;  1QLE D;  4W7Y A;  4HM6 A;  1URQ D;  3VMA A;  1AVY A;  2NPS C;  1USD A;  2HPC B;  2E43 A;  1EG9 A;  1OMI A;  3FWN A;  3MTU E;  3CMA P;  1X8Y A;  2K9J A;  1MFT A;  2AEF A;  1URQ A;  3L71 E;  3L75 D;  1YQ4 C;  1JO5 A;  1G1J A;  3HUS A;  1SQV G;  3N7N A;  2FYU E;  2I1J A;  1NTK J;  1ZW0 A;  1M56 D;  2XZR A;  1R5S A;  4PD4 H;  1N73 A;  1OWA A;  3G9R A;  1P84 E;  3I5C A;  3H1I E;  3O6Q B;  3CCM P;  3VMY A;  2Q5U A;  1N86 A;  1PPJ D;  1RE3 C;  3SFD C;  2W27 A;  1SQP J;  2E5Y A;  2YMK A;  2ZYG A;  5APX A;  4GOF A;  1SJG A;  1O7P A;  5AW1 B;  2KK7 A;  2C0W A;  2XKM A;  4U3F E;  3L73 D;  2I1K A;  1T6A A;  3R4Y A;  3BRV B;  3T97 B;  5AEU A;  1PGQ A;  3BVH A;  2KLU A;  4OVN F;  1N7S D;  1AVO A;  1QL2 A;  1XTG B;  2YFJ A;  3RK3 C;  2YKO A;  1M1K Q;  1CI6 B;  1OVU A;  3RK3 E;  1N7S A;  3BAS A;  4KT0 J;  1FZC A;  3TNU A;  1Y8A A;  1J1E C;  2KZJ A;  1RF1 B;  2YO2 A;  4NBG D;  2HR3 A;  4UB6 E;  2WSS H;  2GM4 A;  3CXH D;  1NTZ E;  2R5B A;  2FYU G;  4U7J A;  4OGQ D;  2YVJ B;  1JNM A;  3A0H E;  3D6Y A;  1S9K D;  4QUP A;  4EIJ A;  4EMJ B;  1AQ5 A;  3H1I G;  3KXD A;  3U1C A;  4TLF A;  5B66 E;  1OXZ A;  1XTC C;  1OIP A;  2YKP A;  3MUD C;  2KI7 B;  4Y28 J;  3VP8 A;  1FJK A;  1IFJ A;  1BCC E;  2AEJ A;  1KQG B;  2JJL A;  1VQN P;  4JQ0 D;  3VMG D;  3L74 D;  2MKV A;  4U3F G;  1VQ4 P;  1SQV J;  4HKZ H;  1EXJ A;  3EN1 A;  1SFC B;  3KZI E;  1HGZ A;  2ITA A;  3LIE A;  1KIL A;  1UII A;  2D2C D;  2OYH A;  2E74 C;  2K1A A;  3CX5 D;  1HF9 A;  3MIW A;  3CCV P;  1T2K D;  1N7L A;  3H1H D;  2WPQ A;  4I7Z B;  1FDM A;  1NTM E;  3CCS P;  2YIU B;  1GW4 A;  1OVV A;  4WWI A;  3M0D C;  3CXH H;  2IYO A;  1JY3 N;  1SQB E;  5AW3 B;  5KAI H;  3GF3 A;  1GD2 E;  1LTJ C;  2A45 G;  4B86 A;  3QWO C;  1Q86 Q;  1JMB A;  2KXP B;  4C46 A;  1ZV8 A;  4NPE A;  1NTZ G;  2FFD B;  4DOJ A;  2WSE H;  1GK6 A;  3BCC D;  2HFE D;  2P67 A;  3H1K E;  3CCU P;  2OQQ A;  3PTZ A;  2K37 A;  1MKM A;  2QSI A;  5K5G B;  4GT1 A;  1S1C X;  2W83 C;  5M1B A;  3OW2 O;  2WSF H;  3LW5 H;  2YMY A;  2NUM A;  1NYH A;  2IFN A;  3OJA B;  1GL2 D;  2H88 C;  2R3C A;  1VF5 B;  1ZR4 A;  3L71 J;  2E4P A;  3SFE C;  3A2A A;  5TIS H;  3V2Q A;  4WY4 C;  2FYU J;  4PD4 E;  2CPB A;  3B5N B;  2M5A B;  4I7Z C;  1GL2 A;  2QJK C;  2YIU C;  4HM1 A;  3L72 E;  1FDI A;  2W6B A;  3H1I J;  4TT3 H;  3V4W A;  2NUK A;  1U57 A;  1JTH B;  3H1J E;  1EXI A;  4HM3 A;  5AVV B;  5APQ A;  1P84 I;  3RL0 B;  1OW8 A;  2QJP B;  2B87 B;  1NOH A;  3HD7 B;  4H0L B;  1SQB G;  2IDB A;  2E76 B;  3C9I A;  3WU2 H;  2V7Q J;  5KLV E;  4U3F J;  2P10 A;  4D6T E;  1CW5 A;  5CCH C;  4I1L A;  1URQ C;  2POH A;  3C1L A;  3A5T A;  4HJG H;  1LT9 B;  3E1R A;  2C9N Y;  2KNC B;  2LXB A;  1UUV A;  5AVQ B;  3IFM A;  3H1L D;  1NJI Q;  2WT7 A;  1N73 C;  1O7H A;  2E4Q A;  3L75 E;  3RK2 B;  1ZOY C;  2JZA A;  1Q2N A;  2OTK E;  2PP6 A;  3GHG B;  3AZC A;  3CCQ P;  2ZYD A;  4QMA A;  1NDO A;  4HM2 A;  1LP1 B;  1RQU A;  1JY3 O;  3KDP B;  1IJD B;  1NTZ J;  4WVZ A;  2WQY C;  1A02 J;  3RL0 C;  2QJP C;  3JSV C;  4R4L A;  3NMD A;  3L72 G;  4NBC D;  2CK3 H;  4K35 A;  4LC1 A;  3PH0 A;  2E76 C;  3IAO A;  2Y0C A;  3H1J G;  1AFO A;  1JY2 P;  2H89 C;  1BGY D;  5BVZ A;  1USE A;  3NTN A;  3PLN A;  2OYI B;  1WMK A;  2IBZ E;  4UB6 H;  2QRX A;  2FYN C;  2OAR A;  1Q90 D;  1LTT C;  1FZC C;  2DE7 D;  4AIV A;  5KLV G;  4GKG A;  3V6I A;  1MUU A;  4D6T G;  1LWU B;  2HMO A;  3AEC C;  3II6 A;  5GTI H;  2RH0 A;  1NTK K;  2M3B A;  1SQQ E;  1BDC A;  1EZV D;  1NAY A;  1KQF B;  3A0H H;  1SVF A;  3G6E P;  2WZ7 A;  2Q7C A;  1R8E A;  3KYQ A;  2GA1 A;  1M57 D;  2V4H A;  3AE8 C;  4QCK A;  2GUV A;  2O01 J;  3IR9 A;  3TYY A;  5AVR B;  1K05 A;  4DCK A;  1S5L X;  3L37 A;  1SQX D;  3CXH E;  2A06 E;  5KAI E;  3H32 B;  4OGQ C;  1H88 A;  1SQB J;  2YNY A;  2XSO A;  3GF7 A;  2M8R A;  2NPS B;  1YIT P;  1DD3 A;  1EDJ A;  4BRY B;  2QG4 A;  1HVV A;  3L70 D;  4C7R A;  2HLO A;  2FXM A;  2ZFC A;  5HL4 A;  2W90 A;  1NU1 D;  3OA7 A;  1FAV A;  2W8Z A;  1SFC D;  1M1J A;  1JMM A;  1KIL C;  2P7J A;  2IZ1 A;  2OYH C;  3RL0 g;  1KIL E;  2ZT9 D;  5AVU B;  1KC8 Q;  4EI2 A;  2YXR B;  2IBZ G;  4M3L A;  1SLQ A;  1ZME C;  5TIS E;  1DEB A;  2D2C C;  1NH4 A;  3P8C D;  1PGO A;  3JC2 2;  5BOK A;  1HJ0 A;  1T3J A;  5H2F E;  4Z1M H;  1DH3 A;  1SQQ G;  3CCL P;  3W67 A;  3GLM A;  3H1H E;  3L72 J;  4HM8 A;  1JOC A;  1L0L G;  1PIX A;  4PD4 I;  1NO4 A;  5KAF H;  5AW6 B;  1BE3 E;  3FXE A;  1L0L K;  5CJ0 A;  3H1J J;  3PJS K;  1Q7Y Q;  3HE4 A;  1NTK D;  1K9M Q;  2A06 G;  1EDK A;  3WU2 E;  4JYB A;  3RK3 B;  1QVF O;  2XND H;  1L0N G;  4H13 D;  5KLV J;  2B1X A;  3TSI A;  4D6T J;  1J1E B;  1SQP D;  1L0N K;  4H44 D;  4EDF A;  1SQV K;  4YTP C;  1JM1 A;  1PL5 A;  3I56 P; 
#chains in the Genus database with same CATH homology
 2MKV A;  2BMR A;  1VM9 A;  2HMK A;  3D71 A;  4HM0 A;  1YQ3 C;  3AE3 C;  2NVF A;  1EXJ A;  3EN1 A;  2XSH A;  4NBA D;  2BMO A;  4NBH D;  1UIX A;  2D2C D;  3Q1M A;  4PV1 D;  1NTK E;  2E74 C;  1ZRT E;  3H25 A;  1HF9 A;  3GB4 A;  3VMH D;  4I7Z B;  2JP3 A;  3Q5R A;  1NTM E;  4H13 C;  1VCK A;  1FDO A;  3IN6 A;  1ULI A;  1FQT A;  4H0L D;  4H44 C;  1SQB E;  3GF3 A;  1VF5 C;  3D6Z A;  2NVG A;  2K9Y A;  3L74 E;  4QUR A;  2I7F A;  1NYK A;  3AE4 C;  1O7M A;  3H1K E;  1G8K B;  4QDC A;  2E75 D;  2DE6 D;  1OW6 A;  2OQQ A;  3AE5 C;  4PV1 C;  4HM4 A;  1MKM A;  2XRX A;  2QSI A;  3Q5S A;  2E74 B;  3N0Q A;  1S1C X;  2YFI A;  3CX5 E;  5M1B A;  3AED C;  5KLI C;  2NUM A;  1NYH A;  3GZY A;  4H0L C;  2H88 C;  1VF5 B;  3GCE A;  3S9O A;  3AEG C;  4NBF D;  2E4P A;  3SFE C;  2E74 D;  2HML A;  2JO1 A;  5KKZ C;  4PD4 E;  4NBB D;  4I7Z C;  1PV3 A;  3C8V A;  1DD4 A;  2QJK C;  2YIU C;  3BCC E;  2E75 C;  2NWF A;  1IK7 A;  4HM1 A;  3L72 E;  1FDI A;  4NBE D;  4NB9 D;  2G8Y A;  4TT3 H;  2HMJ A;  1DIP A;  2NUK A;  1U57 A;  1VF5 D;  1EXI A;  3H1J E;  4HM7 A;  4HM3 A;  3AE1 C;  1OW8 A;  3AEF C;  2FBW C;  1L0L E;  2WSE J;  4H0L B;  3D89 A;  2IDB A;  2DE5 D;  4QDF B;  5AEW A;  2E76 B;  2G3A A;  4HJL A;  2V7Q J;  5KLV E;  1RQV A;  2P10 A;  2HMM A;  1O7N A;  1VL2 A;  2WSF J;  3LW5 J;  2BMQ A;  2E75 B;  1L0N E;  3AE9 C;  1KB9 E;  1SQV E;  2JO6 A;  1UUV A;  3GOB A;  3GL0 A;  1K04 A;  2E76 D;  3GTE A;  2NVE A;  1O7H A;  2E4Q A;  3L75 E;  1ZOY C;  3GMA A;  2YFL A;  3GZX A;  2JZA A;  2GBW A;  3GL2 A;  4QDF A;  2BEZ F;  4HKV A;  3EWK A;  3AZC A;  1PP9 E;  3AE2 C;  1NDO A;  1KOR A;  4HM2 A;  1RQU A;  1SQX E;  2QPZ A;  1UUW A;  2J5U A;  2WQY C;  1O7G A;  3VMI D;  3DQY A;  2QJP C;  4R4L A;  3CWB E;  4NBC D;  2CKF A;  1KTM A;  1RIE A;  1ULJ A;  2E76 C;  3IAO A;  4R4M A;  4P1B H;  3H1L E;  2WPV B;  4QUQ A;  1NGM B;  2H89 C;  2NZ2 A;  2ZYL A;  3L70 E;  4NBD D;  3FGA D;  2B24 A;  1G8J B;  3GTS A;  4HM6 A;  1NU1 E;  5L8R J;  1WMK A;  1GMJ A;  2IBZ E;  2FYN C;  1Q90 D;  2DE7 D;  2FXP A;  4AIV A;  4IL6 X;  2ZT9 C;  1EG9 A;  1OMI A;  2HMO A;  1JB0 J;  3AEC C;  1SQQ E;  1KQF B;  3L71 E;  1YQ4 C;  1R8E A;  3AE7 C;  3AE8 C;  2FYU E;  4QCK A;  4RKU J;  2QJY C;  3TGU E;  1TU3 F;  2O01 J;  1K05 A;  3G9R A;  1P84 E;  1S5L X;  3H1I E;  3Q2Y A;  3CXH E;  3Q5P A;  2A06 E;  4OGQ C;  2QIW A;  2BCC E;  2XSO A;  1AJY A;  3GF7 A;  3SFD C;  3B71 A;  3C0D A;  1Q90 C;  2YMK A;  2ZT9 B;  1DD3 A;  4AAY B;  1SJG A;  1O7W A;  4HM5 A;  1O7P A;  3AEA C;  1EZV E;  4U3F E;  5HL4 A;  4YXD C;  2GBX A;  2WSC J;  4GDO A;  3R4Y A;  1Y9B A;  3AE6 C;  3T97 B;  5AEU A;  1SQP E;  3RL0 g;  1KIL E;  3O6Q A;  2ZT9 D;  1WQL A;  4NB8 D;  5CXM A;  1OW7 A;  2YFJ A;  4OGQ B;  1ZME C;  1PPJ E;  4QDD A;  2D2C C;  3RK3 E;  3VCP A;  4KT0 J;  3GKE A;  5BOK A;  1HJ0 A;  4NBG D;  4Z1M H;  1KYO E;  2Q3W A;  4P1C H;  2XR8 A;  3GLM A;  3H1H E;  4HM8 A;  3D70 A;  1RFS A;  1PIX A;  1NTZ E;  4H13 B;  4U7J A;  3L73 E;  4OGQ D;  3ABV C;  1BE3 E;  3VCA A;  2YVJ B;  4H44 B;  1KMI Z;  3D6Y A;  4QUP A;  4EMJ B;  1ZP0 C;  4Y28 J;  4XFJ A;  1BCC E;  3AEE C;  4H13 D;  3EQQ A;  2BEQ D;  2D2C B;  2B1X A;  3FOU A;  3AEB C;  4PV1 B;  1KQG B;  4H44 D;  3Q3D A;  3VMG D;  4YTP C;  1JM1 A;  1PL5 A;  2HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...