4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
1VCKA 2NWFA 4QCKA 1EG9A 4HM3A 4QDDA 2NVFA 4NBFD 2JO6A 3GL2A 4P1CH 3BCCE 3L75E 4PV1C 1ULIA 4HKVA 3GZYA 4HJLA 3CWBE 2JZAA 3VCAA 3VMHD 3GB4A 2HMOA 2ZYLA 4PV1D 3GCEA 1NTME 4EMJB 4H13C 2BMOA 5KLIC 2HMKA 4NB9D 1SQQE 2HMNA 4P1BH 1WQLA 1O7MA 5AEUA 2E4PA 4PD4E 3GTEA 4NB8D 1RFSA 4H13D 3GKEA 5KKZC 4NBCD 2DE5D 4QDCA 1L0LE 4QUQA 3H1LE 1SQBE 2HMMA 3TGUE 2NVGA 4HM4A 4AAYB 1VF5C 2GBXA 2A06E 4HM2A 2NUMA 3AZCA 1UUVA 2NVEA 1SJGA 4NBDD 5BOKA 1VF5D 4NBED 2NUKA 5HL4A 2B1XA 1UUWA 4QUPA 2YFLA 2BMQA 1O7NA 1SQPE 2IBZE 3CX5E 4QURA 2XSHA 3L73E 3C0DA 3GTSA 1ULJA 2QPZA 2YMKA 3CXHE 3VCPA 4U3FE 2CKFA 1O7GA 3GZXA 4NBGD 4HM6A 2B24A 2E74C 1FQTA 1NYKA 2QJKC 2YIUC 1Q90C 5CXMA 3H1IE 1PP9E 2YFIA 2E76C 3FOUA 3H1HE 5KLVE 1PPJE 4NBAD 1JM1A 3DQYA 1G8JB 2E74D 3L70E 4NBBD 1SQXE 3D89A 3GOBA 2DE6D 2E76D 2Q3WA 3VMGD 1KB9E 2E4QA 1BE3E 2FYNC 2BMRA 1RIEA 3H1KE 3EQQA 5AEWA 1SQVE 1NTKE 2ZT9D 1NU1E 3H1JE 3VMID 2FYUE 4OGQC 1O7WA 2QJYC 1EZVE 3L74E 4HM5A 2DE7D 2YFJA 2I7FA 4HM8A 4QDFB 4H0LC 4H44C 4QDFA 2XR8A 4OGQD 2YVJB 3GL0A 1KYOE 1P84E 2HMJA 2HMLA 4I7ZC 4HM1A 1VM9A 1O7PA 1NDOA 4H0LD 4H44D 4NBHD 3L72E 2XRXA 3EN1A 2D2CC 4HM0A 2QJPC 2ZT9C 1BCCE 1NTZE 2E75C 1L0NE 2GBWA 2BCCE 1ZRTE 1G8KB 2D2CD 3L71E 4HM7A 1O7HA 2XSOA 2E75D 3N0QA 4AIVA
chains in the Genus database with same CATH superfamily
2NWFA 2PAJA 3D6ZA 4HKVA 4IL6H 3KXDA 1NH4A 1NTMD 1NKZB 1S5LE 4NB9D 1SQQE 1RFSA 2DE5D 1SQVJ 3W67A 1L4AB 2FYUJ 2P10A 1KTMA 4JQ0D 2A06D 3LIDA 4K3AA 5APVA 2IYOA 1FZGA 1JOCA 2H88C 3NFQA 2BMQA 1Y9BA 1T2KD 1BCCJ 1M1KQ 2PP6A 3NXSA 5AVUB 2WPVB 5CXMA 3QWOC 1JM1A 4GKGA 3L70E 2P67A 3VMZA 2ZJSE 3H1KE 2C9NY 3V2NA 3A7OA 4YXWH 1NTKD 1JMMA 1N86A 2KSJA 1YQ4C 4IFFA 1U57A 1HJ0A 2DE7D 2ITAA 4QDFB 3H1JG 3A3YB 1N73C 2E43A 3LW5J 3SWYA 4OGQB 1YYCA 2WITA 3H1LJ 1VQPP 1NTZE 1SS1A 2OGUA 1L0ND 1ZOYC 4AIVA 1GL2B 1SQVG 2O1KA 1IFMA 3HTKB 2OTLP 2WPSA 3GL2A 1VQMP 5CCHA 1JEKA 1IFDA 2K9JA 3E1RA 3VCAA 3H1IJ 1GD2E 3PTZA 2HMKA 2AXTH 3CCQP 1BCCG 1PFIA 4PD4D 2E4PA 3CMEP 1JY2P 3U1AA 3ABVC 1FBMA 1AJYA 2GM4A 1H8AA 1L0LG 2QA4P 3CCLP 5APSA 2HG5D 3R2PA 3WUTA 1H88A 3AE6C 3VTPC 1OMIA 2XSHA 3L73E 3CXHE 4U3FE 1SQPG 2PGDA 2K1AA 4WY4A 1PPJD 2XZRA 3DQYA 1KFNA 3RK3C 1G2CA 1FAVA 2E76D 3CC2P 1JTHB 1HUCA 5B66H 5AEWA 1HGZA 1E5WA 4EDFA 1RIEA 3H1JD 3FWNA 3VN0A 1Q7YQ 4AQRD 2W6BA 2XV5A 3L74G 1S9KD 1H0TA 4H0LD 2KSEA 2P1JA 3L72E 2G3AA 3H1IG 2Y9ZA 1IFIA 2YXRB 1JY2O 1OW8A 3WU2H 2E75D 2JO1A 2IFNA 2W8ZA 5CCHC 1VCKA 2Y0CA 1BGYE 3PLNA 1ZR4A 1IZNB 3L75E 4PV1C 4O9BA 4MN4C 4HYTB 2ZYLA 1PP9J 1OIPA 5AW5B 1AV1A 4LLHA 3OW2O 3MGNA 1L0LD 3CLQA 1KORA 1N7SD 3KQGA 1DEEG 3TGUE 1M90Q 1LTJA 1SQBG 3AZCA 5KJ7D 1LWUB 1XTCC 4NBDD 1T8ZA 4NBED 1RQUA 5KAIH 5HL4A 3RK2D 4WY4C 4QUPA 2YFLA 1SQPD 4YXDC 2CKFA 2IBZG 1VQ6P 3IF4A 1NOHA 3A0BH 2QJKC 2J5UA 2KNCB 1IK9A 3FOUA 2JP3A 1QVGO 2FBWC 1HTLC 5KLVK 1IFPA 1X79B 2QVAA 2YIUB 3S1KA 3RK3E 3B71A 3BCCJ 1FZAA 3L74D 4D6TE 2AEJA 4C7NA 3AECC 1EZVG 2NPSA 1P84D 1BDDA 4YTPC 2HMJA 3HUSA 4I7ZC 2WSFH 3H1ID 2RH0A 4HJGH 2KOGA 1LT9B 4HKZH 1L4AC 5AW8B 2GBWA 4IL6E 2KI7B 5CCGA 3Q5PA 3Q5RA 2BCCG 1YJWP 3EWKA 2ZT9B 1FOSF 2I1JA 2E75B 1NGMB 1OX3A 2JKVA 3I55P 4NBFD 1QL1A 3C1LA 2JO6A 3HD7D 4IFDK 1WRGA 4XFJA 4U7JA 1H89A 4W7YA 1GU4A 1SFCD 3H1HJ 1PGPA 3BRVB 4N78E 1LTJC 4H13D 1SQBD 1NU1J 4DZOA 3Q2YA 2O01N 1PGOA 3EQ2A 3F5HA 3BCCG 4WB4A 3IFMA 4DT0A 2IBZD 1FC2C 1K05A 1ULJA 3RK2B 4I1LA 1GK6A 1SQQK 1J1EC 3F89A 3V2PA 3G6EP 1JY2N 1YJNP 3N4XA 2E4QA 1SQXK 1BDCA 2NPSC 3HUSC 2Y0EA 1EZVD 4RJTA 1ZMEC 1NTMJ 4BWNA 3HE5B 4AYCA 3JSVC 1ZR2A 1KYOE 1NDOA 4H44D 5CCGC 2FY8A 3BASA 3G3ZA 3RL0C 5GTIE 3CXHH 2BCCD 2HODB 2M5AA 2KZJA 2V7QJ 3TDKA 1IFJA 2AXTE 4UB8H 5AW2B 2P58A 1A02J 2QM7A 4EOTA 2HR3A 2YKQA 2C9LY 3HD7B 3MUDA 2K9YA 2HMOA 1EQ7A 1SFCB 2YMYA 1NTZK 1G1IA 3M0DA 1KZUB 1NTKJ 4H13B 2E5TA 3SFDC 2HMMA 3II6A 4Z1MH 1VQ4P 2LXCB 1HWTC 3BRTB 4GODA 2B1XA 1USEA 2FYZA 2FKWB 2PFXA 3A5TA 3CCSP 1M56D 4I6MC 3GTSA 5B66E 2H43A 3QH9A 3FGAD 3SWFA 2ZVOB 1L0NJ 1AVOA 2ZAEB 5E79H 4OH8B 1DD4A 5KLVE 2WSEJ 2B9BA 1Q90D 3CX5H 3O6QB 2FXPA 1L2PA 4L75A 1HVVA 2A06G 1EXIA 3I56P 3CCJP 1VF5B 2KLUA 4HM5A 2FYUK 3CCMP 3TNUB 1JO5A 1R5LA 5KTBA 2B88A 4NBHD 3P8CE 4XE5B 3EN1A 1FZCB 3PHLA 1OW7A 4BRYA 1ZLLA 1JCCA 2HPCA 1ZP0C 3JCUE 5APTA 3H6PA 3AE9C 3MZWB 1LWUC 2P7JA 1KYOI 3MUDC 2QM8A 2Q7CA 4LGDE 3M0DC 4CPGA 2ZYDA 3SSUA 1N73A 4DJGA 4ZKUA 1S1CX 3B8EB 3KDPB 3L36A 1JB0J 2R3CA 3H1JJ 2O01H 3CC4P 2G8YA 2GBXA 3V5BA 3A0BE 2XNXA 1E79H 3TK1A 1CSBA 3L37A 2V4HA 4RESB 4NBGD 3RBXA 2ZFCA 1SQXE 3GLMA 4KJMA 3NMDA 1BE3E 1JUNA 1T6AA 3B5NA 3L70G 5AW6B 2K3RA 3M0AA 3R4YA 1NAYA 3CWBJ 3M9HA 1K9MQ 1VL2A 3AEBC 3GL0A 1KILB 3T97B 2BEZF 2FFDB 1L0LJ 1M1JB 1PPJG 4DCKA 2E74B 1URQA 1RF1B 4NPFX 3L71E 2XSOA 4EYYQ 1NYHA 2FYNB 1SQPJ 1LP1A 3OAKA 3VMHD 5APYA 5CJ4A 3GCEA 1GW4A 1MFZA 2K37A 2N1TA 1SQQD 3KYQA 1KYOH 2LR2A 2O3JA 2D2CB 4NBCD 1DD3A 1YTZT 3C9IA 1IJDB 1IFNA 5KLIB 3L74J 2WSSH 5GTIH 2A45G 4N3YB 3AEEC 1YITP 3CWBG 3GG2A 2QRXA 4EI2A 2VRSA 4KT0J 4GT1A 1S9KE 3L73G 3B5NC 3WUVA 1RHZB 4U3FG 2OYIB 3L70D 2QSIA 2L5GB 5TJHA 1KB9E 1KC8Q 1NVOA 3GHGA 1AQTA 2ZYAA 1SQVE 5B5EE 4K35A 2FYUE 3KZIH 2J58A 1LT1A 1URQC 4L76A 1HGVA 3VMXA 3JC22 4Y99C 3CMAP 2GUVA 1BCCE 4UB8E 1SQBJ 3L72G 1ZRTE 4HM7A 1GW3A 1AFOA 1O7HA 2OYHA 5AW0B 2B87B 2PRRA 1HBWA 3VOPA 2N1TC 2KS1B 1FZFA 1NJIQ 2QJYB 1VQLP 1ULIA 2KP8A 1BSNA 5APXA 3L75G 5K5GB 2KXPB 4NB8D 2CK3H 3WUUA 3PH0A 4EIJA 1RE4A 3AE8C 3G71P 3H1LE 2WVRA 1L4AA 1VF5C 2KZIA 3CPWO 1FJKA 3TGUG 1CW5A 5GTHH 5E79E 3CWBD 3JCUH 1VPCA 4OWFA 5AVSB 2YKOA 1YJ9P 2GUSA 3CX5E 3L73D 2N9BA 1MFTA 1LTIC 3OJAB 4U3FD 1FZCC 2B24A 2BCCJ 2RKLA 1NYKA 1X0TA 3GHGC 3H1IE 2YFIA 2V7QH 2M3BA 3ZDMA 3GOBA 5AVTB 1VQ8P 2R32A 5KKZB 2YO2A 3VP8A 4GOFA 3MTUE 4PJ0E 2O1JA 5CBOA 1NU1K 4QMAA 3V4WA 4QDFA 1J1DB 4D6TG 4HM1A 5APUA 2OYHC 3L72D 3IAOA 1KB9I 2WSCJ 3TYYA 1ZXGA 3O8ZA 3E1IA 2IYPA 2DW3A 1PGJA 3IN6A 2E76B 3K5BA 2Z5IA 3MHVA 4TLFA 3CXHI 3E7KA 1GL2A 5AVWB 1UIIA 3HTKA 2CPSA 3H32B 1BGYD 3L75D 1MUUA 1RE3A 4H0LB 2WT7B 1RE4C 1AVYA 3CCVP 1USDA 1CI6B 1Q81Q 2HMNA 1NTMK 1WQLA 3PJSK 2QJPB 3D6YA 1EDLA 3TGUD 2Y0DA 5AVVB 2R3SA 3M91A 4PD4H 4KHXA 1KILC 2JJLA 3HE4B 1O7GA 1K04A 2FFDC 2E74C 2Q9IA 2YKPA 1PP9E 1OVUA 2W90A 1G8JB 1N7SB 2NZ2A 2DE6D 1G1JA 2Q3WA 2FYNC 2BMRA 1JTHA 4HB1A 3EQQA 1M57D 3CX5I 3RK3D 4OGQC 4D6TD 1NTKK 2XNDH 2I7FA 5CJ0A 1FS0E 3BVHA 1FJPA 3AEGC 2H89C 1S3JA 1KQLA 1JM0A 4WBAA 2D2CC 1GL2C 4OVNF 2WQYC 1IO4A 2NRGA 1L0NK 1FZEA 1RE3C 1ZW0A 3NTNA 4QCKA 5H2FE 4L74A 2M0BA 5CCHD 1K8AQ 1KB9H 3M9QA 3S4RA 4P1CH 1JMBA 3BCCE 5B5EH 1W5CE 1YTZI 3PRJA 1ZV8A 2ZYGA 4PV1D 5EFWB 2OQQA 4EMJB 2K88A 4N78D 4P1BH 1Q82Q 1KQFB 2POHA 2GA1A 3G9RA 1RH5B 4HM4A 4AAYB 5BOKA 1LWUA 1T2KC 1HF9A 2LKMA 2N9YB 4QURA 2ZVNB 1W2BO 1FOSE 4WY4D 2OTKE 1KILE 2QE7H 3HRNA 3GZXA 1GK4A 2Z5HA 2I1KA 3V2QA 3H1HE 2KNCA 3CCEP 3KZIE 3U59A 1LJ2A 1PGQA 5KLVG 3Q3DA 3LW5H 1GMJA 1MV8A 1X8YA 3AE2C 3L35A 3RBZA 1FZBA 1NU1E 3VMID 2QJYC 3RK3B 5C39A 5AVQB 1SQQJ 2IDBA 5APWA 1VDFA 3USSA 2ZXEB 2RMZA 1VQ5P 1LT9A 4RKUJ 3D71A 1CI6A 1UIXA 3BATA 1QLED 1QEXA 2WMMA 1DIPA 1L4AD 1SQVK 3P8MC 3RL0g 2K9JB 4H44B 4PJ0H 2JZAA 5AVZB 2AXCA 1NTME 3L70J 2JR8A 5GTHE 4PV1B 4LC1A 1AQ5A 3TF5A 1QX8A 3HE4A 3H1KJ 5KKZC 1AA0A 1QVFO 1YI2P 2KK7A 4I2LC 4JYBA 1L0LK 2A06E 2HYNA 3EFFK 4BXLA 3TSIA 1UUWA 3SFEC 3FX0A 1K73Q 2B89A 1SQPK 3Q1MA 2HFED 1TU3F 3N7NA 1NTZJ 1LTGC 1SQQG 2YIUC 4DOJA 2E76C 2YO3A 5KLVD 5CHXA 1G2CB 3VP9A 2R44A 1M7LA 4IOIH 1PIXA 1SQXG 3V6IA 1NTKE 1OVRA 2NPSD 1JNMA 2QIWA 4H0LC 3C8VA 4WVZA 2BEQD 1VQ9P 1LT9C 3HE5A 1H0TB 5AVXB 4GOEA 4ZNCA 3P8CD 1SVFA 4HM0A 4UB6E 2QJPC 5CCGD 2ZT9C 3AE1C 2E75C 4I7ZB 1L0NE 5AW4B 2OYOA 3G4SP 3RL0D 3N0QA 2HODA 3H1KG 2J59M 3L71G 1Z56A 4N6JA 3L73J 4WWIA 1KFMA 2WWWA 4U3FJ 1U7MA 3U1CA 3GB4A 3HD7A 1SFCA 4PD4E 1NTZG 1N7SC 1JCDA 3GKEA 3M06A 5L8RJ 5TISE 4QUQA 3SWKA 5KJ7C 3GF7A 1LTJB 1SQBK 4HM2A 3RK2C 4JYCA 5APQA 1UUVA 2NVEA 1RF0C 2NUKA 2WSCH 4IL6X 1O7NA 1KD1Q 3W68A 1R8EA 1LTTC 2KYVA 3AE4C 3L72J 2QPZA 5H2FH 1VQ7P 1FQTA 2P2UA 1PPJE 1SQXD 5DJTB 2WTYA 3O6QA 1DEBA 1BE3D 1J1EB 2IPPA 1LTSC 1BGYJ 3H1JE 3L75J 4C7NB 3A2AA 4HM8A 5DJUB 2NPSB 2FYUG 2XR8A 2YVJB 3HUSB 2IZ1A 3TNUA 2IZ0A 1PV3A 3WMM0 1FZCA 3TGUJ 3S9OA 3H1KD 3ITKA 1G8KB 3L71D 2OARA 2JDIH 1YBKA 1HJBA 4JBZA 3RL0B 1NO4A 3HD7C 1RQVA 4HM3A 4QDDA 2NVFA 2SPZA 1SFCC 3IR9A 2JWAA 2RN0A 1S4XA 4HJLA 3CWBE 3MD0A 1WT6A 5BU5A 1NTZD 4H13C 3H25A 1O7MA 3AE3C 1N2DC 4ZMDA 1OZHA 2AEFA 1L0LE 4XA4A 4W80A 4ASWA 1R5SA 4D6TJ 3KPEA 2NUMA 3H1LG 1J2JB 1U7JA 5CMZA 2Q6QA 3PP5A 1BGYG 1KQGB 1GU5A 1VQNP 1SQPE 4PD4I 3P32A 3C0DA 2Y9YA 2O01J 3LIEA 3VYIA 4M3LA 3D70A 1NAFA 1Y47A 1KV4A 4A7PA 4NBBD 1ZN5A 1X9VA 1KB9D 3P7KA 2KIKA 1SQVD 2ZT9D 1QL2A 2FYUD 2E5YA 3L74E 2BASA 3M9BA 3CXHD 3EFGA 4H44C 1P84E 2M8RA 1KILA 1FE6A 1PZQA 3T97A 4C46A 3Q5SA 1Q86Q 1EDJA 1BCCD 2UWJE 2FFDA 2E42A 1M1JA 1ZRTD 1RF1A 2M5AB 2Q5UA 5AVRB 1GZLA 1KQSO 1EC5A 1VQOP 4R4MA 2XDJA 1RY3A 4L73A 2FXMA 5KAFE 5AW3B 3AE7C 3V4QA 3A0HE 3GTEA 2A45I 1YHQP 3H1LD 1SQBE 1KMIZ 4UB6H 1M8OB 1FU1A 2IX7C 2JWDA 1S5LH 3L4FA 3I5CA 2WSEH 1VQKP 2IBZE 3CX5D 4C7RA 2H8PD 3OA7A 3VCPA 1Q2NA 3CCRP 1T3UA 2HLOA 1Q90C 2XKMA 4NBAD 1JY3P 3B5ND 2OYIA 3UIAA 1OXZA 3D89A 1PP9G 1FDMA 1FDIA 1SP4A 1DX7A 5TISH 1MZ9A 1EZVE 4JF7A 2WZ7A 1M1JC 1YIJP 1HH0A 2HMLA 4W7ZA 4NPDA 3VMAA 1RF1C 1O7PA 1URQD 2XRXA 1N7LA 1W2EA 4BRYB 1YQ3C 4IFMA 5AW1B 2HPCB 2Q3EA 2BCCE 4TT3H 1S5LX 1WMKA 4RO0A 4JPZB 2L91A 2KB7P 2KLVA 4R4LA 2B87A 2C0WA 1SLQA 1P84I 1LNQA 1EDKA 2YNYA 3CD6P 1NHLA 2KS1A 2N1TD 3FXEA 1N73B 1OFCX 5AW7B 5KLVJ 5KLIC 5M1BA 1NKNA 2MJZA 1JY3O 1LTBC 4QDCA 2MKVA 2NVGA 4GIFA 5BVZA 3RGUA 3GF3A 1SJGA 1N8RQ 1VF5D 2C0XA 2H7HA 4GDOA 2OYIC 1D7MA 2A45H 2LXBA 2YMKA 1GDTA 4AUWA 1PP9D 5AW9B 1NWQA 1OWAA 3H1HG 2I8DA 3VMGD 3B5NB 2IBZI 4ZKPA 4YPCA 5AVYB 1FDOA 2Q1KA 3AEDC 1NU1G 2R5DA 1A02F 2W6JH 1T3JA 3GW6A 2YXQB 1URQB 1QGKB 1S72P 2R5BA 1MKMA 1EZVI 4Y99B 2IFMA 3KHUA 2W83C 1EG9A 4B86A 1Y8AA 4Y28J 1KYOD 1LP1B 2W27A 4NPEA 3H32A 1OVVA 3BCCD 2M3EA 3GZYA 3VMYA 2KUBA 2WT7A 3MIWA 2N1TB 4ASVA 3CC7P 2BMOA 1DH3A 1SQXJ 5AEUA 1CZQA 1NTMG 1P84H 2WSFJ 3V2RA 3CL3D 1BE3J 3AEFC 2WPRA 3AE5C 5CBNA 1KN7A 3B4SA 2AEMA 2QEXP 2Q3IA 2W6AA 1IC2A 4HH2A 1KILD 3CCUP 3WU2E 4HM6A 1LTAC 1EDIA 3CI9A 1XTGB 3L71J 2XU6A 3H1HD 2Z4EA 2E74D 5KAFH 1BSHA 1N7SA 2FXOA 5BU8B 3GHGB 1GTWA 1J1DC 3A0HH 2JEEA 1NU1D 5KJ7A 1EXJA 1O7WA 1S2EA 2OTJP 1NTKG 2YFJA 2QG4A 4OGQD 3FWLA 1RF0A 2ZXXA 4WY4B 1VM9A 1OW6A 1IK7A 2CPBA 2WPQA 3MP7B 3AEAC 3GMAA 1LGHB 1PL5A 1X22A 2QJKB 2D2CD 1GL2D 1JY3N 2OYHB 5KAIE 3FXDA 1BE3G 1L0NG
chains in the Genus database with same CATH topology
2V7QJ 2NWFA 1RQVA 3D6ZA 4HM3A 4QDDA 2NVFA 4HKVA 4HJLA 3CWBE 4H0LB 2K9YA 2HMOA 4H13C 3H25A 4NB9D 1SQQE 2HMNA 1WQLA 1O7MA 3AE3C 1RFSA 3D6YA 2DE5D 1L0LE 4H13B 3SFDC 2HMMA 2P10A 1KTMA 4Z1MH 2NUMA 2H88C 2B1XA 1KQGB 2BMQA 1SQPE 1Y9BA 3C0DA 3GTSA 2O01J 1O7GA 1K04A 3FGAD 2E74C 3D70A 5CXMA 2WPVB 1PP9E 1DD4A 5KLVE 1JM1A 4NBBD 1G8JB 3L70E 2WSEJ 1Q90D 2NZ2A 2FXPA 2DE6D 2Q3WA 2FYNC 2BMRA 3H1KE 3EQQA 1EXIA 2ZT9D 1YQ4C 1VF5B 1U57A 1HJ0A 4OGQC 3L74E 4HM5A 2DE7D 2I7FA 4QDFB 4H44C 1P84E 3AEGC 2H89C 3LW5J 4NBHD 4OGQB 3Q5SA 3EN1A 2D2CC 1OW7A 2WQYC 1NTZE 1ZP0C 1ZOYC 3AE9C 4AIVA 4QCKA 3GL2A 4P1CH 3BCCE 4R4MA 3VCAA 4PV1D 2OQQA 4EMJB 2HMKA 3AE7C 4P1BH 2E4PA 3GTEA 1S1CX 1KQFB 3ABVC 1AJYA 1JB0J 3G9RA 1SQBE 4HM4A 1KMIZ 4AAYB 2G8YA 2GBXA 5BOKA 3AE6C 1HF9A 2IBZE 1OMIA 4QURA 2XSHA 3L73E 3CXHE 3VCPA 1KILE 4U3FE 3GZXA 4NBGD 1Q90C 3H1HE 4NBAD 3DQYA 1SQXE 3D89A 3GLMA 2E76D 3Q3DA 1BE3E 5AEWA 1RIEA 1GMJA 1FDIA 3AE2C 3R4YA 1NU1E 3VMID 2QJYC 1EZVE 1VL2A 3AEBC 3GL0A 2HMLA 2IDBA 3T97B 1O7PA 4H0LD 3L72E 2XRXA 2BEZF 2G3AA 1YQ3C 2E74B 2BCCE 4RKUJ 1OW8A 4TT3H 1UIXA 3D71A 1S5LX 3L71E 1WMKA 2XSOA 2E75D 1DIPA 1NYHA 2JO1A 4R4LA 1VCKA 3RL0g 3L75E 4PV1C 4H44B 2JZAA 3VMHD 2ZYLA 3GCEA 1NTME 5KLIC 5M1BA 4PV1B 2D2CB 5KKZC 4NBCD 1DD3A 4QDCA 1KORA 2MKVA 3TGUE 2NVGA 2A06E 3AZCA 3GF3A 1SJGA 4NBDD 1VF5D 4NBED 1RQUA 5HL4A 1UUWA 4QUPA 2YFLA 3AEEC 4GDOA 3SFEC 2YMKA 4YXDC 3Q1MA 1TU3F 2CKFA 4KT0J 2QJKC 2YIUC 2J5UA 2E76C 3FOUA 2JP3A 2FBWC 2QSIA 3VMGD 1KB9E 1PIXA 3RK3E 1SQVE 1NTKE 3B71A 2FYUE 1FDOA 3AEDC 2QIWA 4H0LC 3AECC 3C8VA 2BEQD 2HMJA 4YTPC 4I7ZC 4HM0A 2QJPC 2ZT9C 3AE1C 1BCCE 2E75C 4I7ZB 1L0NE 2GBWA 1ZRTE 1MKMA 4HM7A 3Q5PA 1O7HA 3N0QA 3Q5RA 3EWKA 2ZT9B 2E75B 1NGMB 1EG9A 4Y28J 4NBFD 2JO6A 1ULIA 4XFJA 3GZYA 4U7JA 3GB4A 2BMOA 5AEUA 4PD4E 2WSFJ 4NB8D 4H13D 3AEFC 3GKEA 5L8RJ 3AE8C 4QUQA 3H1LE 3Q2YA 1VF5C 3GF7A 4HM2A 1UUVA 2NVEA 3AE5C 2NUKA 4IL6X 1O7NA 3CX5E 1R8EA 1K05A 3AE4C 1ULJA 2QPZA 4HM6A 2B24A 1FQTA 1NYKA 3H1IE 2YFIA 1PPJE 2E74D 3GOBA 3O6QA 2E4QA 3H1JE 1EXJA 1O7WA 1ZMEC 2YFJA 4HM8A 4QDFA 2XR8A 4OGQD 2YVJB 1KYOE 4HM1A 1VM9A 1OW6A 1IK7A 4H44D 1NDOA 1PV3A 3AEAC 3GMAA 3IAOA 2WSCJ 1PL5A 3S9OA 1G8KB 3IN6A 2D2CD 2E76B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCK A;  2NWF A;  4QCK A;  1EG9 A;  4HM3 A;  4QDD A;  2NVF A;  4NBF D;  2JO6 A;  3GL2 A;  4P1C H;  3BCC E;  3L75 E;  4PV1 C;  1ULI A;  4HKV A;  3GZY A;  4HJL A;  3CWB E;  2JZA A;  3VCA A;  3VMH D;  3GB4 A;  2HMO A;  2ZYL A;  4PV1 D;  3GCE A;  1NTM E;  4EMJ B;  4H13 C;  2BMO A;  5KLI C;  2HMK A;  4NB9 D;  1SQQ E;  2HMN A;  4P1B H;  1WQL A;  1O7M A;  5AEU A;  2E4P A;  4PD4 E;  3GTE A;  4NB8 D;  1RFS A;  4H13 D;  3GKE A;  5KKZ C;  4NBC D;  2DE5 D;  4QDC A;  1L0L E;  4QUQ A;  3H1L E;  1SQB E;  2HMM A;  3TGU E;  2NVG A;  4HM4 A;  4AAY B;  1VF5 C;  2GBX A;  2A06 E;  4HM2 A;  2NUM A;  3AZC A;  1UUV A;  2NVE A;  1SJG A;  4NBD D;  5BOK A;  1VF5 D;  4NBE D;  2NUK A;  5HL4 A;  2B1X A;  1UUW A;  4QUP A;  2YFL A;  2BMQ A;  1O7N A;  1SQP E;  2IBZ E;  3CX5 E;  4QUR A;  2XSH A;  3L73 E;  3C0D A;  3GTS A;  1ULJ A;  2QPZ A;  2YMK A;  3CXH E;  3VCP A;  4U3F E;  2CKF A;  1O7G A;  3GZX A;  4NBG D;  4HM6 A;  2B24 A;  2E74 C;  1FQT A;  1NYK A;  2QJK C;  2YIU C;  1Q90 C;  5CXM A;  3H1I E;  1PP9 E;  2YFI A;  2E76 C;  3FOU A;  3H1H E;  5KLV E;  1PPJ E;  4NBA D;  1JM1 A;  3DQY A;  1G8J B;  2E74 D;  3L70 E;  4NBB D;  1SQX E;  3D89 A;  3GOB A;  2DE6 D;  2E76 D;  2Q3W A;  3VMG D;  1KB9 E;  2E4Q A;  1BE3 E;  2FYN C;  2BMR A;  1RIE A;  3H1K E;  3EQQ A;  5AEW A;  1SQV E;  1NTK E;  2ZT9 D;  1NU1 E;  3H1J E;  3VMI D;  2FYU E;  4OGQ C;  1O7W A;  2QJY C;  1EZV E;  3L74 E;  4HM5 A;  2DE7 D;  2YFJ A;  2I7F A;  4HM8 A;  4QDF B;  4H0L C;  4H44 C;  4QDF A;  2XR8 A;  4OGQ D;  2YVJ B;  3GL0 A;  1KYO E;  1P84 E;  2HMJ A;  2HML A;  4I7Z C;  4HM1 A;  1VM9 A;  1O7P A;  1NDO A;  4H0L D;  4H44 D;  4NBH D;  3L72 E;  2XRX A;  3EN1 A;  2D2C C;  4HM0 A;  2QJP C;  2ZT9 C;  1BCC E;  1NTZ E;  2E75 C;  1L0N E;  2GBW A;  2BCC E;  1ZRT E;  1G8K B;  2D2C D;  3L71 E;  4HM7 A;  1O7H A;  2XSO A;  2E75 D;  3N0Q A;  4AIV A; 
#chains in the Genus database with same CATH topology
 2NWF A;  2PAJ A;  3D6Z A;  4HKV A;  4IL6 H;  3KXD A;  1NH4 A;  1NTM D;  1NKZ B;  1S5L E;  4NB9 D;  1SQQ E;  1RFS A;  2DE5 D;  1SQV J;  3W67 A;  1L4A B;  2FYU J;  2P10 A;  1KTM A;  4JQ0 D;  2A06 D;  3LID A;  4K3A A;  5APV A;  2IYO A;  1FZG A;  1JOC A;  2H88 C;  3NFQ A;  2BMQ A;  1Y9B A;  1T2K D;  1BCC J;  1M1K Q;  2PP6 A;  3NXS A;  5AVU B;  2WPV B;  5CXM A;  3QWO C;  1JM1 A;  4GKG A;  3L70 E;  2P67 A;  3VMZ A;  2ZJS E;  3H1K E;  2C9N Y;  3V2N A;  3A7O A;  4YXW H;  1NTK D;  1JMM A;  1N86 A;  2KSJ A;  1YQ4 C;  4IFF A;  1U57 A;  1HJ0 A;  2DE7 D;  2ITA A;  4QDF B;  3H1J G;  3A3Y B;  1N73 C;  2E43 A;  3LW5 J;  3SWY A;  4OGQ B;  1YYC A;  2WIT A;  3H1L J;  1VQP P;  1NTZ E;  1SS1 A;  2OGU A;  1L0N D;  1ZOY C;  4AIV A;  1GL2 B;  1SQV G;  2O1K A;  1IFM A;  3HTK B;  2OTL P;  2WPS A;  3GL2 A;  1VQM P;  5CCH A;  1JEK A;  1IFD A;  2K9J A;  3E1R A;  3VCA A;  3H1I J;  1GD2 E;  3PTZ A;  2HMK A;  2AXT H;  3CCQ P;  1BCC G;  1PFI A;  4PD4 D;  2E4P A;  3CME P;  1JY2 P;  3U1A A;  3ABV C;  1FBM A;  1AJY A;  2GM4 A;  1H8A A;  1L0L G;  2QA4 P;  3CCL P;  5APS A;  2HG5 D;  3R2P A;  3WUT A;  1H88 A;  3AE6 C;  3VTP C;  1OMI A;  2XSH A;  3L73 E;  3CXH E;  4U3F E;  1SQP G;  2PGD A;  2K1A A;  4WY4 A;  1PPJ D;  2XZR A;  3DQY A;  1KFN A;  3RK3 C;  1G2C A;  1FAV A;  2E76 D;  3CC2 P;  1JTH B;  1HUC A;  5B66 H;  5AEW A;  1HGZ A;  1E5W A;  4EDF A;  1RIE A;  3H1J D;  3FWN A;  3VN0 A;  1Q7Y Q;  4AQR D;  2W6B A;  2XV5 A;  3L74 G;  1S9K D;  1H0T A;  4H0L D;  2KSE A;  2P1J A;  3L72 E;  2G3A A;  3H1I G;  2Y9Z A;  1IFI A;  2YXR B;  1JY2 O;  1OW8 A;  3WU2 H;  2E75 D;  2JO1 A;  2IFN A;  2W8Z A;  5CCH C;  1VCK A;  2Y0C A;  1BGY E;  3PLN A;  1ZR4 A;  1IZN B;  3L75 E;  4PV1 C;  4O9B A;  4MN4 C;  4HYT B;  2ZYL A;  1PP9 J;  1OIP A;  5AW5 B;  1AV1 A;  4LLH A;  3OW2 O;  3MGN A;  1L0L D;  3CLQ A;  1KOR A;  1N7S D;  3KQG A;  1DEE G;  3TGU E;  1M90 Q;  1LTJ A;  1SQB G;  3AZC A;  5KJ7 D;  1LWU B;  1XTC C;  4NBD D;  1T8Z A;  4NBE D;  1RQU A;  5KAI H;  5HL4 A;  3RK2 D;  4WY4 C;  4QUP A;  2YFL A;  1SQP D;  4YXD C;  2CKF A;  2IBZ G;  1VQ6 P;  3IF4 A;  1NOH A;  3A0B H;  2QJK C;  2J5U A;  2KNC B;  1IK9 A;  3FOU A;  2JP3 A;  1QVG O;  2FBW C;  1HTL C;  5KLV K;  1IFP A;  1X79 B;  2QVA A;  2YIU B;  3S1K A;  3RK3 E;  3B71 A;  3BCC J;  1FZA A;  3L74 D;  4D6T E;  2AEJ A;  4C7N A;  3AEC C;  1EZV G;  2NPS A;  1P84 D;  1BDD A;  4YTP C;  2HMJ A;  3HUS A;  4I7Z C;  2WSF H;  3H1I D;  2RH0 A;  4HJG H;  2KOG A;  1LT9 B;  4HKZ H;  1L4A C;  5AW8 B;  2GBW A;  4IL6 E;  2KI7 B;  5CCG A;  3Q5P A;  3Q5R A;  2BCC G;  1YJW P;  3EWK A;  2ZT9 B;  1FOS F;  2I1J A;  2E75 B;  1NGM B;  1OX3 A;  2JKV A;  3I55 P;  4NBF D;  1QL1 A;  3C1L A;  2JO6 A;  3HD7 D;  4IFD K;  1WRG A;  4XFJ A;  4U7J A;  1H89 A;  4W7Y A;  1GU4 A;  1SFC D;  3H1H J;  1PGP A;  3BRV B;  4N78 E;  1LTJ C;  4H13 D;  1SQB D;  1NU1 J;  4DZO A;  3Q2Y A;  2O01 N;  1PGO A;  3EQ2 A;  3F5H A;  3BCC G;  4WB4 A;  3IFM A;  4DT0 A;  2IBZ D;  1FC2 C;  1K05 A;  1ULJ A;  3RK2 B;  4I1L A;  1GK6 A;  1SQQ K;  1J1E C;  3F89 A;  3V2P A;  3G6E P;  1JY2 N;  1YJN P;  3N4X A;  2E4Q A;  1SQX K;  1BDC A;  2NPS C;  3HUS C;  2Y0E A;  1EZV D;  4RJT A;  1ZME C;  1NTM J;  4BWN A;  3HE5 B;  4AYC A;  3JSV C;  1ZR2 A;  1KYO E;  1NDO A;  4H44 D;  5CCG C;  2FY8 A;  3BAS A;  3G3Z A;  3RL0 C;  5GTI E;  3CXH H;  2BCC D;  2HOD B;  2M5A A;  2KZJ A;  2V7Q J;  3TDK A;  1IFJ A;  2AXT E;  4UB8 H;  5AW2 B;  2P58 A;  1A02 J;  2QM7 A;  4EOT A;  2HR3 A;  2YKQ A;  2C9L Y;  3HD7 B;  3MUD A;  2K9Y A;  2HMO A;  1EQ7 A;  1SFC B;  2YMY A;  1NTZ K;  1G1I A;  3M0D A;  1KZU B;  1NTK J;  4H13 B;  2E5T A;  3SFD C;  2HMM A;  3II6 A;  4Z1M H;  1VQ4 P;  2LXC B;  1HWT C;  3BRT B;  4GOD A;  2B1X A;  1USE A;  2FYZ A;  2FKW B;  2PFX A;  3A5T A;  3CCS P;  1M56 D;  4I6M C;  3GTS A;  5B66 E;  2H43 A;  3QH9 A;  3FGA D;  3SWF A;  2ZVO B;  1L0N J;  1AVO A;  2ZAE B;  5E79 H;  4OH8 B;  1DD4 A;  5KLV E;  2WSE J;  2B9B A;  1Q90 D;  3CX5 H;  3O6Q B;  2FXP A;  1L2P A;  4L75 A;  1HVV A;  2A06 G;  1EXI A;  3I56 P;  3CCJ P;  1VF5 B;  2KLU A;  4HM5 A;  2FYU K;  3CCM P;  3TNU B;  1JO5 A;  1R5L A;  5KTB A;  2B88 A;  4NBH D;  3P8C E;  4XE5 B;  3EN1 A;  1FZC B;  3PHL A;  1OW7 A;  4BRY A;  1ZLL A;  1JCC A;  2HPC A;  1ZP0 C;  3JCU E;  5APT A;  3H6P A;  3AE9 C;  3MZW B;  1LWU C;  2P7J A;  1KYO I;  3MUD C;  2QM8 A;  2Q7C A;  4LGD E;  3M0D C;  4CPG A;  2ZYD A;  3SSU A;  1N73 A;  4DJG A;  4ZKU A;  1S1C X;  3B8E B;  3KDP B;  3L36 A;  1JB0 J;  2R3C A;  3H1J J;  2O01 H;  3CC4 P;  2G8Y A;  2GBX A;  3V5B A;  3A0B E;  2XNX A;  1E79 H;  3TK1 A;  1CSB A;  3L37 A;  2V4H A;  4RES B;  4NBG D;  3RBX A;  2ZFC A;  1SQX E;  3GLM A;  4KJM A;  3NMD A;  1BE3 E;  1JUN A;  1T6A A;  3B5N A;  3L70 G;  5AW6 B;  2K3R A;  3M0A A;  3R4Y A;  1NAY A;  3CWB J;  3M9H A;  1K9M Q;  1VL2 A;  3AEB C;  3GL0 A;  1KIL B;  3T97 B;  2BEZ F;  2FFD B;  1L0L J;  1M1J B;  1PPJ G;  4DCK A;  2E74 B;  1URQ A;  1RF1 B;  4NPF X;  3L71 E;  2XSO A;  4EYY Q;  1NYH A;  2FYN B;  1SQP J;  1LP1 A;  3OAK A;  3VMH D;  5APY A;  5CJ4 A;  3GCE A;  1GW4 A;  1MFZ A;  2K37 A;  2N1T A;  1SQQ D;  3KYQ A;  1KYO H;  2LR2 A;  2O3J A;  2D2C B;  4NBC D;  1DD3 A;  1YTZ T;  3C9I A;  1IJD B;  1IFN A;  5KLI B;  3L74 J;  2WSS H;  5GTI H;  2A45 G;  4N3Y B;  3AEE C;  1YIT P;  3CWB G;  3GG2 A;  2QRX A;  4EI2 A;  2VRS A;  4KT0 J;  4GT1 A;  1S9K E;  3L73 G;  3B5N C;  3WUV A;  1RHZ B;  4U3F G;  2OYI B;  3L70 D;  2QSI A;  2L5G B;  5TJH A;  1KB9 E;  1KC8 Q;  1NVO A;  3GHG A;  1AQT A;  2ZYA A;  1SQV E;  5B5E E;  4K35 A;  2FYU E;  3KZI H;  2J58 A;  1LT1 A;  1URQ C;  4L76 A;  1HGV A;  3VMX A;  3JC2 2;  4Y99 C;  3CMA P;  2GUV A;  1BCC E;  4UB8 E;  1SQB J;  3L72 G;  1ZRT E;  4HM7 A;  1GW3 A;  1AFO A;  1O7H A;  2OYH A;  5AW0 B;  2B87 B;  2PRR A;  1HBW A;  3VOP A;  2N1T C;  2KS1 B;  1FZF A;  1NJI Q;  2QJY B;  1VQL P;  1ULI A;  2KP8 A;  1BSN A;  5APX A;  3L75 G;  5K5G B;  2KXP B;  4NB8 D;  2CK3 H;  3WUU A;  3PH0 A;  4EIJ A;  1RE4 A;  3AE8 C;  3G71 P;  3H1L E;  2WVR A;  1L4A A;  1VF5 C;  2KZI A;  3CPW O;  1FJK A;  3TGU G;  1CW5 A;  5GTH H;  5E79 E;  3CWB D;  3JCU H;  1VPC A;  4OWF A;  5AVS B;  2YKO A;  1YJ9 P;  2GUS A;  3CX5 E;  3L73 D;  2N9B A;  1MFT A;  1LTI C;  3OJA B;  4U3F D;  1FZC C;  2B24 A;  2BCC J;  2RKL A;  1NYK A;  1X0T A;  3GHG C;  3H1I E;  2YFI A;  2V7Q H;  2M3B A;  3ZDM A;  3GOB A;  5AVT B;  1VQ8 P;  2R32 A;  5KKZ B;  2YO2 A;  3VP8 A;  4GOF A;  3MTU E;  4PJ0 E;  2O1J A;  5CBO A;  1NU1 K;  4QMA A;  3V4W A;  4QDF A;  1J1D B;  4D6T G;  4HM1 A;  5APU A;  2OYH C;  3L72 D;  3IAO A;  1KB9 I;  2WSC J;  3TYY A;  1ZXG A;  3O8Z A;  3E1I A;  2IYP A;  2DW3 A;  1PGJ A;  3IN6 A;  2E76 B;  3K5B A;  2Z5I A;  3MHV A;  4TLF A;  3CXH I;  3E7K A;  1GL2 A;  5AVW B;  1UII A;  3HTK A;  2CPS A;  3H32 B;  1BGY D;  3L75 D;  1MUU A;  1RE3 A;  4H0L B;  2WT7 B;  1RE4 C;  1AVY A;  3CCV P;  1USD A;  1CI6 B;  1Q81 Q;  2HMN A;  1NTM K;  1WQL A;  3PJS K;  2QJP B;  3D6Y A;  1EDL A;  3TGU D;  2Y0D A;  5AVV B;  2R3S A;  3M91 A;  4PD4 H;  4KHX A;  1KIL C;  2JJL A;  3HE4 B;  1O7G A;  1K04 A;  2FFD C;  2E74 C;  2Q9I A;  2YKP A;  1PP9 E;  1OVU A;  2W90 A;  1G8J B;  1N7S B;  2NZ2 A;  2DE6 D;  1G1J A;  2Q3W A;  2FYN C;  2BMR A;  1JTH A;  4HB1 A;  3EQQ A;  1M57 D;  3CX5 I;  3RK3 D;  4OGQ C;  4D6T D;  1NTK K;  2XND H;  2I7F A;  5CJ0 A;  1FS0 E;  3BVH A;  1FJP A;  3AEG C;  2H89 C;  1S3J A;  1KQL A;  1JM0 A;  4WBA A;  2D2C C;  1GL2 C;  4OVN F;  2WQY C;  1IO4 A;  2NRG A;  1L0N K;  1FZE A;  1RE3 C;  1ZW0 A;  3NTN A;  4QCK A;  5H2F E;  4L74 A;  2M0B A;  5CCH D;  1K8A Q;  1KB9 H;  3M9Q A;  3S4R A;  4P1C H;  1JMB A;  3BCC E;  5B5E H;  1W5C E;  1YTZ I;  3PRJ A;  1ZV8 A;  2ZYG A;  4PV1 D;  5EFW B;  2OQQ A;  4EMJ B;  2K88 A;  4N78 D;  4P1B H;  1Q82 Q;  1KQF B;  2POH A;  2GA1 A;  3G9R A;  1RH5 B;  4HM4 A;  4AAY B;  5BOK A;  1LWU A;  1T2K C;  1HF9 A;  2LKM A;  2N9Y B;  4QUR A;  2ZVN B;  1W2B O;  1FOS E;  4WY4 D;  2OTK E;  1KIL E;  2QE7 H;  3HRN A;  3GZX A;  1GK4 A;  2Z5H A;  2I1K A;  3V2Q A;  3H1H E;  2KNC A;  3CCE P;  3KZI E;  3U59 A;  1LJ2 A;  1PGQ A;  5KLV G;  3Q3D A;  3LW5 H;  1GMJ A;  1MV8 A;  1X8Y A;  3AE2 C;  3L35 A;  3RBZ A;  1FZB A;  1NU1 E;  3VMI D;  2QJY C;  3RK3 B;  5C39 A;  5AVQ B;  1SQQ J;  2IDB A;  5APW A;  1VDF A;  3USS A;  2ZXE B;  2RMZ A;  1VQ5 P;  1LT9 A;  4RKU J;  3D71 A;  1CI6 A;  1UIX A;  3BAT A;  1QLE D;  1QEX A;  2WMM A;  1DIP A;  1L4A D;  1SQV K;  3P8M C;  3RL0 g;  2K9J B;  4H44 B;  4PJ0 H;  2JZA A;  5AVZ B;  2AXC A;  1NTM E;  3L70 J;  2JR8 A;  5GTH E;  4PV1 B;  4LC1 A;  1AQ5 A;  3TF5 A;  1QX8 A;  3HE4 A;  3H1K J;  5KKZ C;  1AA0 A;  1QVF O;  1YI2 P;  2KK7 A;  4I2L C;  4JYB A;  1L0L K;  2A06 E;  2HYN A;  3EFF K;  4BXL A;  3TSI A;  1UUW A;  3SFE C;  3FX0 A;  1K73 Q;  2B89 A;  1SQP K;  3Q1M A;  2HFE D;  1TU3 F;  3N7N A;  1NTZ J;  1LTG C;  1SQQ G;  2YIU C;  4DOJ A;  2E76 C;  2YO3 A;  5KLV D;  5CHX A;  1G2C B;  3VP9 A;  2R44 A;  1M7L A;  4IOI H;  1PIX A;  1SQX G;  3V6I A;  1NTK E;  1OVR A;  2NPS D;  1JNM A;  2QIW A;  4H0L C;  3C8V A;  4WVZ A;  2BEQ D;  1VQ9 P;  1LT9 C;  3HE5 A;  1H0T B;  5AVX B;  4GOE A;  4ZNC A;  3P8C D;  1SVF A;  4HM0 A;  4UB6 E;  2QJP C;  5CCG D;  2ZT9 C;  3AE1 C;  2E75 C;  4I7Z B;  1L0N E;  5AW4 B;  2OYO A;  3G4S P;  3RL0 D;  3N0Q A;  2HOD A;  3H1K G;  2J59 M;  3L71 G;  1Z56 A;  4N6J A;  3L73 J;  4WWI A;  1KFM A;  2WWW A;  4U3F J;  1U7M A;  3U1C A;  3GB4 A;  3HD7 A;  1SFC A;  4PD4 E;  1NTZ G;  1N7S C;  1JCD A;  3GKE A;  3M06 A;  5L8R J;  5TIS E;  4QUQ A;  3SWK A;  5KJ7 C;  3GF7 A;  1LTJ B;  1SQB K;  4HM2 A;  3RK2 C;  4JYC A;  5APQ A;  1UUV A;  2NVE A;  1RF0 C;  2NUK A;  2WSC H;  4IL6 X;  1O7N A;  1KD1 Q;  3W68 A;  1R8E A;  1LTT C;  2KYV A;  3AE4 C;  3L72 J;  2QPZ A;  5H2F H;  1VQ7 P;  1FQT A;  2P2U A;  1PPJ E;  1SQX D;  5DJT B;  2WTY A;  3O6Q A;  1DEB A;  1BE3 D;  1J1E B;  2IPP A;  1LTS C;  1BGY J;  3H1J E;  3L75 J;  4C7N B;  3A2A A;  4HM8 A;  5DJU B;  2NPS B;  2FYU G;  2XR8 A;  2YVJ B;  3HUS B;  2IZ1 A;  3TNU A;  2IZ0 A;  1PV3 A;  3WMM 0;  1FZC A;  3TGU J;  3S9O A;  3H1K D;  3ITK A;  1G8K B;  3L71 D;  2OAR A;  2JDI H;  1YBK A;  1HJB A;  4JBZ A;  3RL0 B;  1NO4 A;  3HD7 C;  1RQV A;  4HM3 A;  4QDD A;  2NVF A;  2SPZ A;  1SFC C;  3IR9 A;  2JWA A;  2RN0 A;  1S4X A;  4HJL A;  3CWB E;  3MD0 A;  1WT6 A;  5BU5 A;  1NTZ D;  4H13 C;  3H25 A;  1O7M A;  3AE3 C;  1N2D C;  4ZMD A;  1OZH A;  2AEF A;  1L0L E;  4XA4 A;  4W80 A;  4ASW A;  1R5S A;  4D6T J;  3KPE A;  2NUM A;  3H1L G;  1J2J B;  1U7J A;  5CMZ A;  2Q6Q A;  3PP5 A;  1BGY G;  1KQG B;  1GU5 A;  1VQN P;  1SQP E;  4PD4 I;  3P32 A;  3C0D A;  2Y9Y A;  2O01 J;  3LIE A;  3VYI A;  4M3L A;  3D70 A;  1NAF A;  1Y47 A;  1KV4 A;  4A7P A;  4NBB D;  1ZN5 A;  1X9V A;  1KB9 D;  3P7K A;  2KIK A;  1SQV D;  2ZT9 D;  1QL2 A;  2FYU D;  2E5Y A;  3L74 E;  2BAS A;  3M9B A;  3CXH D;  3EFG A;  4H44 C;  1P84 E;  2M8R A;  1KIL A;  1FE6 A;  1PZQ A;  3T97 A;  4C46 A;  3Q5S A;  1Q86 Q;  1EDJ A;  1BCC D;  2UWJ E;  2FFD A;  2E42 A;  1M1J A;  1ZRT D;  1RF1 A;  2M5A B;  2Q5U A;  5AVR B;  1GZL A;  1KQS O;  1EC5 A;  1VQO P;  4R4M A;  2XDJ A;  1RY3 A;  4L73 A;  2FXM A;  5KAF E;  5AW3 B;  3AE7 C;  3V4Q A;  3A0H E;  3GTE A;  2A45 I;  1YHQ P;  3H1L D;  1SQB E;  1KMI Z;  4UB6 H;  1M8O B;  1FU1 A;  2IX7 C;  2JWD A;  1S5L H;  3L4F A;  3I5C A;  2WSE H;  1VQK P;  2IBZ E;  3CX5 D;  4C7R A;  2H8P D;  3OA7 A;  3VCP A;  1Q2N A;  3CCR P;  1T3U A;  2HLO A;  1Q90 C;  2XKM A;  4NBA D;  1JY3 P;  3B5N D;  2OYI A;  3UIA A;  1OXZ A;  3D89 A;  1PP9 G;  1FDM A;  1FDI A;  1SP4 A;  1DX7 A;  5TIS H;  1MZ9 A;  1EZV E;  4JF7 A;  2WZ7 A;  1M1J C;  1YIJ P;  1HH0 A;  2HML A;  4W7Z A;  4NPD A;  3VMA A;  1RF1 C;  1O7P A;  1URQ D;  2XRX A;  1N7L A;  1W2E A;  4BRY B;  1YQ3 C;  4IFM A;  5AW1 B;  2HPC B;  2Q3E A;  2BCC E;  4TT3 H;  1S5L X;  1WMK A;  4RO0 A;  4JPZ B;  2L91 A;  2KB7 P;  2KLV A;  4R4L A;  2B87 A;  2C0W A;  1SLQ A;  1P84 I;  1LNQ A;  1EDK A;  2YNY A;  3CD6 P;  1NHL A;  2KS1 A;  2N1T D;  3FXE A;  1N73 B;  1OFC X;  5AW7 B;  5KLV J;  5KLI C;  5M1B A;  1NKN A;  2MJZ A;  1JY3 O;  1LTB C;  4QDC A;  2MKV A;  2NVG A;  4GIF A;  5BVZ A;  3RGU A;  3GF3 A;  1SJG A;  1N8R Q;  1VF5 D;  2C0X A;  2H7H A;  4GDO A;  2OYI C;  1D7M A;  2A45 H;  2LXB A;  2YMK A;  1GDT A;  4AUW A;  1PP9 D;  5AW9 B;  1NWQ A;  1OWA A;  3H1H G;  2I8D A;  3VMG D;  3B5N B;  2IBZ I;  4ZKP A;  4YPC A;  5AVY B;  1FDO A;  2Q1K A;  3AED C;  1NU1 G;  2R5D A;  1A02 F;  2W6J H;  1T3J A;  3GW6 A;  2YXQ B;  1URQ B;  1QGK B;  1S72 P;  2R5B A;  1MKM A;  1EZV I;  4Y99 B;  2IFM A;  3KHU A;  2W83 C;  1EG9 A;  4B86 A;  1Y8A A;  4Y28 J;  1KYO D;  1LP1 B;  2W27 A;  4NPE A;  3H32 A;  1OVV A;  3BCC D;  2M3E A;  3GZY A;  3VMY A;  2KUB A;  2WT7 A;  3MIW A;  2N1T B;  4ASV A;  3CC7 P;  2BMO A;  1DH3 A;  1SQX J;  5AEU A;  1CZQ A;  1NTM G;  1P84 H;  2WSF J;  3V2R A;  3CL3 D;  1BE3 J;  3AEF C;  2WPR A;  3AE5 C;  5CBN A;  1KN7 A;  3B4S A;  2AEM A;  2QEX P;  2Q3I A;  2W6A A;  1IC2 A;  4HH2 A;  1KIL D;  3CCU P;  3WU2 E;  4HM6 A;  1LTA C;  1EDI A;  3CI9 A;  1XTG B;  3L71 J;  2XU6 A;  3H1H D;  2Z4E A;  2E74 D;  5KAF H;  1BSH A;  1N7S A;  2FXO A;  5BU8 B;  3GHG B;  1GTW A;  1J1D C;  3A0H H;  2JEE A;  1NU1 D;  5KJ7 A;  1EXJ A;  1O7W A;  1S2E A;  2OTJ P;  1NTK G;  2YFJ A;  2QG4 A;  4OGQ D;  3FWL A;  1RF0 A;  2ZXX A;  4WY4 B;  1VM9 A;  1OW6 A;  1IK7 A;  2CPB A;  2WPQ A;  3MP7 B;  3AEA C;  3GMA A;  1LGH B;  1PL5 A;  1X22 A;  2QJK B;  2D2C D;  1GL2 D;  1JY3 N;  2OYH B;  5KAI E;  3FXD A;  1BE3 G;  1L0N G; 
#chains in the Genus database with same CATH homology
 2V7Q J;  2NWF A;  1RQV A;  3D6Z A;  4HM3 A;  4QDD A;  2NVF A;  4HKV A;  4HJL A;  3CWB E;  4H0L B;  2K9Y A;  2HMO A;  4H13 C;  3H25 A;  4NB9 D;  1SQQ E;  2HMN A;  1WQL A;  1O7M A;  3AE3 C;  1RFS A;  3D6Y A;  2DE5 D;  1L0L E;  4H13 B;  3SFD C;  2HMM A;  2P10 A;  1KTM A;  4Z1M H;  2NUM A;  2H88 C;  2B1X A;  1KQG B;  2BMQ A;  1SQP E;  1Y9B A;  3C0D A;  3GTS A;  2O01 J;  1O7G A;  1K04 A;  3FGA D;  2E74 C;  3D70 A;  5CXM A;  2WPV B;  1PP9 E;  1DD4 A;  5KLV E;  1JM1 A;  4NBB D;  1G8J B;  3L70 E;  2WSE J;  1Q90 D;  2NZ2 A;  2FXP A;  2DE6 D;  2Q3W A;  2FYN C;  2BMR A;  3H1K E;  3EQQ A;  1EXI A;  2ZT9 D;  1YQ4 C;  1VF5 B;  1U57 A;  1HJ0 A;  4OGQ C;  3L74 E;  4HM5 A;  2DE7 D;  2I7F A;  4QDF B;  4H44 C;  1P84 E;  3AEG C;  2H89 C;  3LW5 J;  4NBH D;  4OGQ B;  3Q5S A;  3EN1 A;  2D2C C;  1OW7 A;  2WQY C;  1NTZ E;  1ZP0 C;  1ZOY C;  3AE9 C;  4AIV A;  4QCK A;  3GL2 A;  4P1C H;  3BCC E;  4R4M A;  3VCA A;  4PV1 D;  2OQQ A;  4EMJ B;  2HMK A;  3AE7 C;  4P1B H;  2E4P A;  3GTE A;  1S1C X;  1KQF B;  3ABV C;  1AJY A;  1JB0 J;  3G9R A;  1SQB E;  4HM4 A;  1KMI Z;  4AAY B;  2G8Y A;  2GBX A;  5BOK A;  3AE6 C;  1HF9 A;  2IBZ E;  1OMI A;  4QUR A;  2XSH A;  3L73 E;  3CXH E;  3VCP A;  1KIL E;  4U3F E;  3GZX A;  4NBG D;  1Q90 C;  3H1H E;  4NBA D;  3DQY A;  1SQX E;  3D89 A;  3GLM A;  2E76 D;  3Q3D A;  1BE3 E;  5AEW A;  1RIE A;  1GMJ A;  1FDI A;  3AE2 C;  3R4Y A;  1NU1 E;  3VMI D;  2QJY C;  1EZV E;  1VL2 A;  3AEB C;  3GL0 A;  2HML A;  2IDB A;  3T97 B;  1O7P A;  4H0L D;  3L72 E;  2XRX A;  2BEZ F;  2G3A A;  1YQ3 C;  2E74 B;  2BCC E;  4RKU J;  1OW8 A;  4TT3 H;  1UIX A;  3D71 A;  1S5L X;  3L71 E;  1WMK A;  2XSO A;  2E75 D;  1DIP A;  1NYH A;  2JO1 A;  4R4L A;  1VCK A;  3RL0 g;  3L75 E;  4PV1 C;  4H44 B;  2JZA A;  3VMH D;  2ZYL A;  3GCE A;  1NTM E;  5KLI C;  5M1B A;  4PV1 B;  2D2C B;  5KKZ C;  4NBC D;  1DD3 A;  4QDC A;  1KOR A;  2MKV A;  3TGU E;  2NVG A;  2A06 E;  3AZC A;  3GF3 A;  1SJG A;  4NBD D;  1VF5 D;  4NBE D;  1RQU A;  5HL4 A;  1UUW A;  4QUP A;  2YFL A;  3AEE C;  4GDO A;  3SFE C;  2YMK A;  4YXD C;  3Q1M A;  1TU3 F;  2CKF A;  4KT0 J;  2QJK C;  2YIU C;  2J5U A;  2E76 C;  3FOU A;  2JP3 A;  2FBW C;  2QSI A;  3VMG D;  1KB9 E;  1PIX A;  3RK3 E;  1SQV E;  1NTK E;  3B71 A;  2FYU E;  1FDO A;  3AED C;  2QIW A;  4H0L C;  3AEC C;  3C8V A;  2BEQ D;  2HMJ A;  4YTP C;  4I7Z C;  4HM0 A;  2QJP C;  2ZT9 C;  3AE1 C;  1BCC E;  2E75 C;  4I7Z B;  1L0N E;  2GBW A;  1ZRT E;  1MKM A;  4HM7 A;  3Q5P A;  1O7H A;  3N0Q A;  3Q5R A;  3EWK A;  2ZT9 B;  2E75 B;  1NGM B;  1EG9 A;  4Y28 J;  4NBF D;  2JO6 A;  1ULI A;  4XFJ A;  3GZY A;  4U7J A;  3GB4 A;  2BMO A;  5AEU A;  4PD4 E;  2WSF J;  4NB8 D;  4H13 D;  3AEF C;  3GKE A;  5L8R J;  3AE8 C;  4QUQ A;  3H1L E;  3Q2Y A;  1VF5 C;  3GF7 A;  4HM2 A;  1UUV A;  2NVE A;  3AE5 C;  2NUK A;  4IL6 X;  1O7N A;  3CX5 E;  1R8E A;  1K05 A;  3AE4 C;  1ULJ A;  2QPZ A;  4HM6 A;  2B24 A;  1FQT A;  1NYK A;  3H1I E;  2YFI A;  1PPJ E;  2E74 D;  3GOB A;  3O6Q A;  2E4Q A;  3H1J E;  1EXJ A;  1O7W A;  1ZME C;  2YFJ A;  4HM8 A;  4QDF A;  2XR8 A;  4OGQ D;  2YVJ B;  1KYO E;  4HM1 A;  1VM9 A;  1OW6 A;  1IK7 A;  4H44 D;  1NDO A;  1PV3 A;  3AEA C;  3GMA A;  3IAO A;  2WSC J;  1PL5 A;  3S9O A;  1G8K B;  3IN6 A;  2D2C D;  2E76 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...