4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
3VMID 1NYKA 2HMKA 2FYNC 4OGQD 4NBFD 4OGQC 1KYOE 3AZCA 4QDDA 2IBZE 4QCKA 2ZT9D 1ULJA 4I7ZC 4NBAD 4EMJB 3VMGD 2YVJB 3N0QA 2YIUC 5AEUA 2E74C 2NUMA 3GTSA 1EG9A 3H1KE 4HM1A 3GOBA 5BOKA 2QJKC 1O7HA 1VF5C 4QURA 4H13D 2I7FA 4H13C 2NUKA 3FOUA 3L75E 1ZRTE 3VCPA 3GZYA 5AEWA 4QDFA 4QDFB 3CX5E 4QUPA 3GL0A 1PP9E 4H44C 4H0LD 1O7NA 3H1LE 4H44D 3GZXA 3GB4A 2QJYC 3D89A 5KLVE 2E4QA 3C0DA 2BCCE 3L71E 2XRXA 3DQYA 3TGUE 2NWFA 4P1CH 2DE5D 2E76D 2E75C 1RIEA 2DE7D 2HMLA 1O7GA 3VMHD 3GCEA 2E4PA 2GBWA 4HJLA 2DE6D 4NB8D 1NTZE 2CKFA 1ULIA 1L0NE 2HMOA 1NTME 2NVGA 1SQXE 4HM6A 2ZT9C 1UUWA 4AIVA 4HM3A 4QUQA 2HMMA 1BE3E 1G8KB 3H1JE 4QDCA 1SQVE 1FQTA 3VCAA 5KKZC 2D2CC 3GKEA 2D2CD 1O7WA 2FYUE 3GTEA 2B1XA 4HM7A 4U3FE 5HL4A 4HM8A 3EQQA 3L72E 2JZAA 2BMOA 4HKVA 2QPZA 4NB9D 1L0LE 1WQLA 4HM0A 2BMRA 2NVEA 3L74E 3H1HE 4P1BH 5CXMA 4H0LC 3GL2A 1VF5D 1VM9A 4NBED 2BMQA 1G8JB 3H1IE 1Q90C 1NTKE 4HM4A 2YFJA 2YMKA 1SJGA 1NU1E 1BCCE 1NDOA 4NBHD 1UUVA 1EZVE 2B24A 1VCKA 3EN1A 3BCCE 1PPJE 2ZYLA 2QJPC 2HMNA 2HMJA 2XSHA 1O7PA 2A06E 1O7MA 2XSOA 4HM2A 3CWBE 4NBBD 1P84E 1RFSA 4PV1C 4HM5A 3CXHE 4NBDD 2E74D 2E75D 2YFLA 5KLIC 2Q3WA 3L70E 1SQPE 4NBGD 2GBXA 3L73E 1JM1A 1SQBE 1SQQE 4PV1D 2YFIA 4NBCD 4AAYB 2NVFA 1KB9E 2JO6A 2XR8A 2E76C 4PD4E
chains in the Genus database with same CATH superfamily
4U3FD 1EDJA 1J1EC 1LTGC 1ULJA 4I7ZC 1RQVA 1GL2B 1PGQA 4XA4A 3L75E 1AVOA 3V2NA 5CJ4A 1L4AD 4IFFA 2YKPA 1VQNP 3QH9A 2JJLA 5KLVE 3D89A 4NPEA 2WPRA 1SQBJ 3D70A 1JOCA 1S3JA 1SFCD 4I7ZB 4WVZA 2R3SA 2Y9ZA 4Z1MH 2ITAA 4PJ0E 2HMLA 1WMKA 1KQSO 2BEQD 3OAKA 4KHXA 4HJLA 3JCUE 1YQ3C 3BCCD 3SSUA 1SQXE 4UB6E 1MFZA 3T97B 1RF1C 3MIWA 1ZRTD 5K5GB 2I1KA 2WPVB 2IYOA 2Q6QA 3HUSB 2ZXEB 4DOJA 3CC4P 1IK7A 3L74E 1RF0C 1P84H 1MKMA 4DJGA 3B5NB 3L70J 1IFIA 1JNMA 1HTLC 3AEFC 4ZNCA 1BCCE 1DEBA 1LWUB 3Q1MA 3KZIH 1BGYE 4HM2A 4MN4C 1RFSA 4PV1C 3O6QB 1DX7A 2E74D 2YFLA 4EI2A 1SQBE 4W7YA 2JO1A 3U1CA 3IF4A 3LW5H 2IBZE 5BU5A 1FS0E 2P2UA 3EFGA 1PFIA 1VQMP 3MD0A 5TISH 2FBWC 4BRYA 1LNQA 4BWNA 4KJMA 3L75D 1SQPD 1URQD 3BRTB 3AEEC 5APUA 2NPSC 2B88A 2W6AA 1H0TB 2PGDA 3VP9A 1JCDA 2KI7B 3AE2C 1YJ9P 2DE6D 3FWNA 2QVAA 4NPDA 2HMOA 2O1KA 3CL3D 1LTTC 2HFED 2A06G 1G8KB 1SQVE 1PP9G 1OW7A 3L75G 3M0DA 1L0LE 1NAYA 4A7PA 1IFPA 1TU3F 2QRXA 2M8RA 3A7OA 3L4FA 1SJGA 3CMAP 2OYHA 2ZT9B 3BCCE 5B66E 1VQ9P 2QJPC 4EYYQ 4O9BA 1O7PA 1RHZB 3KZIE 2E74B 4GT1A 1S5LX 3Q3DA 3AECC 3HUSA 4BXLA 3A0BE 5KLVG 1J1DB 3WUUA 1T6AA 2KXPB 2ZYDA 2FFDC 1FDOA 1BE3J 2HMKA 3RL0D 2K37A 2BCCG 3GG2A 5AVWB 4EMJB 1Q7YQ 5CCGA 3AEBC 3GTSA 3USSA 2YO2A 1X9VA 2NPSD 1VF5C 2KZIA 1J1EB 3H1KD 5H2FH 2W8ZA 2R32A 3ITKA 1OVRA 3AEDC 2UWJE 3GHGB 4IOIH 2QM8A 1OW6A 2KYVA 2GM4A 1H0TA 2RN0A 5EFWB 2Z4EA 4HYTB 2WSFH 1JY3N 1Y9BA 4NB8D 1ULIA 1NTME 1BGYJ 2RKLA 2ZAEB 5AW4B 1L0LJ 2B1XA 3IR9A 2BMOA 1S5LH 4GOFA 5CCHA 3TGUD 1VL2A 2R44A 5AVVB 1EZVD 3S4RA 1KORA 2QE7H 2K3RA 1L0ND 3CMEP 2I1JA 1NGMB 3PHLA 3H32B 3MUDA 1YTZT 5KAFH 4HM5A 4WY4A 2Q5UA 3AE5C 4D6TJ 3P32A 3CCMP 2BEZF 3PLNA 1OXZA 1NTKJ 2PFXA 3H1HG 4K35A 3H1LJ 1HF9A 4KT0J 4RO0A 1GK6A 1PZQA 2HR3A 3AE4C 1M1KQ 2ZT9D 3TGUG 3SWFA 1KQLA 2ZXXA 5AEUA 3L74J 4D6TE 3V4QA 4I6MC 1HH0A 1FZCB 2M3EA 1OX3A 1ZRTE 1L0NK 5AEWA 1L0LG 3HE4A 5KJ7A 3AE9C 4TT3H 2JWDA 2OGUA 4N78D 3S1KA 2V7QJ 3SFEC 2K1AA 3V2QA 4RJTA 2QA4P 2NWFA 1YIJP 2K9JB 1RE3C 3B71A 1O7GA 1VQ8P 2A45H 2ZVOB 3ABVC 1NU1D 2WITA 4HM3A 1W5CE 1FDIA 2HMMA 1LTJC 1QX8A 1GK4A 4GKGA 4U3FE 4JYCA 4EIJA 2E76B 1L2PA 4HM4A 1Q90D 2JP3A 3A0BH 5KJ7D 1UUVA 2B24A 1JUNA 3FX0A 2QSIA 3EQ2A 2H7HA 1NTMG 1O7MA 1M7LA 1SS1A 3BRVB 3L74G 3P7KA 2IYPA 4W80A 5AW9B 2Q7CA 1M90Q 2N1TC 3M9QA 3H1IG 1SQPE 3RBXA 2Y9YA 3D6ZA 2OTJP 4LGDE 1N7SA 1M56D 1SQVK 2HODA 4PD4E 1GL2C 2WZ7A 1NOHA 3L71G 1AQ5A 1Z56A 2CPSA 2OQQA 3L73D 4C46A 2R5BA 4HKZH 4WY4D 1UIIA 2KK7A 1DD3A 1O7HA 1FZFA 3M91A 2NUKA 1U7JA 1SQPJ 2DW3A 1FZCC 4HJGH 3SWYA 5AW6B 4IFMA 2WT7B 1OFCX 3MP7B 2E4QA 3C0DA 1Q2NA 1LTAC 5GTIH 5KKZB 3GHGC 1LWUA 1NTZD 1A02J 1RE4A 1RY3A 2P10A 1SFCA 3H1JE 1PPJG 2D2CD 1SQBK 3RK2C 3HTKA 1BCCJ 1LTJB 3MHVA 3Q2YA 4K3AA 3HTKB 3AE8C 3TF5A 1L4AB 5BVZA 3H1HE 4P1BH 1PV3A 1VF5D 1U57A 1Q90C 1M1JA 3PTZA 1IFNA 2YFJA 1SQVG 2IX7C 3OJAB 5AW8B 1KILA 1GZLA 1PGJA 2Z5HA 3LIDA 2HYNA 4NBDD 3KQGA 2K88A 2WSEJ 1JM1A 1BSNA 3V6IA 3F89A 3RK3B 3MGNA 3HE4B 5BU8B 4ASWA 1KYOH 1K04A 3AEAC 1M8OB 3V5BA 1R8EA 3CWBG 2E75B 2NUMA 4Y99C 3H1KJ 4LC1A 1WT6A 5APQA 3CC7P 1L4AA 2Y0DA 2MJZA 1O7NA 1N73C 5APVA 3CC2P 3KDPB 4OVNF 1JB0J 3BVHA 2GUVA 2Q3EA 2DE5D 2E76D 4P1CH 2E75C 3W67A 4XFJA 5E79H 4HH2A 1K73Q 1QVGO 2H89C 1L0NE 1SQVJ 4GIFA 1FQTA 1N8RQ 4HM7A 2RMZA 1PPJD 3I56P 1PGOA 2AEFA 2YKQA 1HGVA 1AV1A 3B8EB 4PD4I 3EN1A 2P67A 2HMJA 3B5NA 2NPSA 1PGPA 1IFMA 1JTHB 3H1JG 3CXHE 3H1KG 1J2JB 1LTSC 1M57D 5AVQB 3L72G 2HPCB 3SFDC 1KFNA 4NBCD 1OVVA 1SQXJ 2WPQA 3CCSP 3EWKA 1Q82Q 1ZXGA 1OMIA 4NBFD 3AZCA 1USEA 2Y0CA 3U1AA 3CCQP 2Q3IA 2VRSA 3M9BA 2WVRA 4QMAA 1S72P 4JYBA 1JMMA 4EDFA 3NFQA 3H1HJ 5AVZB 2QJYB 3H1LE 5APYA 3GB4A 1T3UA 2WSSH 4GDOA 2RH0A 1ZOYC 4CPGA 3TGUE 1JM0A 2W6JH 4B86A 2DE7D 3P8CE 3V4WA 5GTHE 3WMM0 3RL0g 3JC22 1RQUA 1NTZK 3V2RA 2L91A 5KKZC 1SQQK 2B87B 5KLVD 1CI6A 1VDFA 2P1JA 2NRGA 1VQ7P 1KQFB 3L70D 1FJPA 5CCGC 2YO3A 2BMQA 1PP9D 2OYOA 1SQXG 1NDOA 2E42A 3OW2O 1FDMA 1BDDA 2O3JA 1GL2D 3PJSK 1L0NG 3VP8A 1VQ5P 4GODA 2QG4A 1AJYA 2OTKE 4DCKA 4IL6E 4GOEA 3AE3C 5AVRB 2XV5A 5CCHD 1KQGB 2HODB 1X8YA 3VMYA 4IFDK 3HE5B 1GDTA 3CCVP 2M0BA 2GUSA 3IAOA 4N78E 3L73J 2SPZA 1LGHB 3CLQA 4ZMDA 2YVJB 1GTWA 2QJPB 3RK3D 5AW3B 2OYIC 2I7FA 3LW5J 2XNDH 4QDFB 2FYUG 5C39A 1YTZI 1NTMK 1FC2C 2QJYC 2XRXA 1SQQD 2YIUB 2WT7A 3RK3E 3P8CD 3VMXA 2OARA 1OWAA 2KZJA 1BE3D 2L5GB 4UB6H 1DEEG 2ZT9C 1LTBC 3GW6A 1O7WA 1RF1B 1VF5B 2KNCB 4HM8A 3L72E 4HKVA 1H88A 1WQLA 3I5CA 2NVEA 2E43A 4ZKUA 1QVFO 3L71D 4H0LC 2C9LY 3FXEA 1G8JB 1LP1B 1KILD 2KIKA 2FKWB 1SQPK 1PPJE 3L72D 3G4SP 3PH0A 3Q5SA 2FXPA 2ZYGA 2E75D 2ZJSE 4W7ZA 4M3LA 5KLIC 3G6EP 3L70E 2KUBA 2W90A 2JO6A 1LJ2A 1RF1A 1JTHA 3BCCG 2Y0EA 1E79H 1FZBA 1LT1A 1GU4A 1T3JA 2QJKC 2LR2A 1IFDA 3U59A 2ZVNB 2N1TD 2MKVA 1KB9H 2A06D 2IZ1A 2KP8A 3GLMA 4YXDC 3M9HA 3CX5H 3CCLP 3TK1A 4YTPC 4D6TD 2KSJA 1KV4A 2BCCE 3RGUA 1HJBA 2YXQB 2YMYA 5KLVK 3G9RA 1E5WA 3RK2B 3CWBJ 4ZKPA 2J58A 3H6PA 3HD7A 1NTKG 1OW8A 5APWA 1KFMA 4HM6A 4U7JA 2WSCH 1BDCA 1BE3E 1N7SC 1AVYA 1NYHA 1OVUA 3GTEA 2AXCA 5AVYB 3M0DC 2WSCJ 2FY8A 3TGUJ 5KAFE 3O8ZA 1OIPA 5AW1B 4BRYB 2OTLP 1K9MQ 1N2DC 3HD7B 1RH5B 1URQB 2IBZI 1EZVE 3Q5PA 1R5LA 3RL0B 1IFJA 1MZ9A 2PRRA 3WU2H 3FWLA 3B4SA 1NU1J 3E7KA 4WY4C 5B5EH 1SQXD 4WWIA 1J1DC 1XTGB 3Q5RA 1N7LA 1CSBA 4OGQC 1KILB 1JY2P 1JY3O 4JPZB 1MUUA 2A45I 1CZQA 3L74D 4L76A 1FZGA 2FXMA 5H2FE 3CD6P 1N73B 3A3YB 1ZN5A 2KSEA 2KS1A 1NTMJ 2PAJA 1AFOA 1PL5A 1T2KD 4JQ0D 1KC8Q 1KILC 3I55P 2R3CA 1G2CB 1VQKP 1ZR2A 3GCEA 2B89A 4D6TG 1NTZE 1VQ6P 1HJ0A 3GKEA 1VPCA 3H1LG 1YITP 2KOGA 2R5DA 3CI9A 3O6QA 2M5AA 3A0HH 2BCCD 3AE6C 3M0AA 1GW3A 3HD7D 1NO4A 4OWFA 1P84D 2JR8A 2K9JA 1URQA 4I1LA 2XU6A 4U3FG 3G71P 2V7QH 3W68A 5AW5B 3A5TA 5CBNA 4IL6H 4PJ0H 1U7MA 1XTCC 1VQPP 4H44B 4AYCA 2OYHB 4PV1D 4HB1A 4DZOA 1EXIA 2AXTH 2WWWA 2AEMA 4PD4D 1KYOE 3AE1C 4QCKA 1L0LD 1HVVA 2C0WA 5DJUB 3CX5D 2OYHC 1KB9D 4L74A 3SWKA 1R5SA 2KS1B 5CMZA 4H0LD 2E5TA 2FXOA 3L71E 1SQQJ 3N4XA 1Y47A 4LLHA 3IFMA 5CCGD 2E4PA 3D71A 1ZV8A 1LT9C 4R4MA 3H1IJ 2WPSA 1BCCD 3VYIA 3CX5I 2IFMA 1EC5A 5HL4A 3L36A 4IL6X 2QPZA 3L71J 3EFFK 2WQYC 3KYQA 1Q81Q 3R2PA 2J59M 2YNYA 1KTMA 1FE6A 4L73A 1QL1A 2HMNA 2XSHA 2FYUD 2XSOA 2LKMA 3GF3A 4XE5B 3HE5A 1BGYD 2N1TA 1FOSE 5TISE 1IO4A 2Q9IA 2N1TB 1P84I 2XR8A 2FFDA 2W27A 3E1RA 2IPPA 2O01J 5AVUB 1T2KC 1JY2O 1X0TA 4NBAD 1QGKB 1USDA 5E79E 2W6BA 3L70G 4H13C 3FOUA 3VCPA 2H88C 1NHLA 1IK9A 2G8YA 4H44D 3TYYA 3K5BA 3TSIA 5GTIE 3CWBD 1LWUC 5APXA 3VMHD 1GMJA 3H1LD 1NVOA 1SQVD 1G1IA 2CKFA 1NWQA 4H13B 5AVTB 4AIVA 1YBKA 3NXSA 3CCEP 4NB9D 3QWOC 3VMAA 5KTBA 3CXHH 5CXMA 3LIEA 1M1JC 2CK3H 3TDKA 5APTA 1ZR4A 1W2EA 3E1IA 4ASVA 5KJ7C 1HUCA 1FZCA 2YKOA 3GF7A 2FYNB 1G1JA 3MUDC 2XZRA 2CPBA 2YXRB 2B9BA 1RE3A 3RBZA 3JSVC 3F5HA 2Z5IA 3HUSC 1QEXA 2IFNA 1CI6B 1H89A 2WSFJ 1GU5A 1NU1K 4YPCA 3M06A 3PP5A 5B66H 2P7JA 5CJ0A 1MV8A 2FYNC 2JDIH 1S5LE 3CXHD 1SVFA 1RF0A 3H32A 3VMGD 2E74C 3H1KE 1EG9A 3TNUA 3GOBA 2KNCA 1JY2N 4N6JA 3C1LA 1X79B 1NJIQ 3H1HD 1NTMD 1NKNA 3GL0A 1KYOD 1S2EA 4WB4A 4H0LB 1GD2E 1QLED 1DIPA 3H1JJ 1RIEA 1ZW0A 2GBWA 2G3AA 1JCCA 1YYCA 2ZFCA 5KLVJ 1FAVA 2WTYA 2D2CC 1N86A 3UIAA 4RKUJ 3EQQA 5CCHC 2HPCA 1LT9B 2C9NY 1W2BO 4RESB 2BCCJ 1A02F 5L8RJ 1FZEA 5M1BA 3GMAA 2NPSB 1ZP0C 2FFDB 4YXWH 2IDBA 1K05A 5KAIE 2PP6A 3B5NC 2QJKB 3CCUP 1K8AQ 4NBBD 1CW5A 1JMBA 1NKZB 4JBZA 2I8DA 1FOSF 2Q3WA 4OGQB 1SFCC 2WSEH 2HG5D 3TNUB 4AAYB 1NTKK 4PD4H 2B87A 3VMID 2W83C 3L35A 1FU1A 4U3FJ 4QDDA 3WUTA 2POHA 2YIUC 3AE7C 1N7SB 3HRNA 3L37A 4H13D 3KXDA 1EDLA 1JEKA 4UB8E 5KLIB 2HLOA 3GZXA 1L0NJ 5AVXB 1SQBD 1HBWA 2ZYAA 3GHGA 5GTHH 3VOPA 1EDKA 3RL0C 1RE4C 2KLVA 3JCUH 1YI2P 2NVGA 2O1JA 3II6A 3A2AA 3V2PA 4QUQA 3BCCJ 4QDCA 2E5YA 1FJKA 5CHXA 2FYUE 1KD1Q 3MZWB 1VQ4P 3N7NA 3MTUE 1KB9I 1KZUB 2IBZD 3L73G 1VQOP 2BMRA 1SQQG 1HWTC 1X22A 2FYZA 5AW7B 1SQPG 3H1IE 3G3ZA 3CCJP 2YMKA 2P58A 1ZLLA 3IN6A 1MFTA 4NBHD 1KILE 2WMMA 3B5ND 2FYUJ 1M1JB 1YJNP 1VQLP 3H25A 1Y8AA 3ZDMA 1ZMEC 3CXHI 2AEJA 5DJTB 2M3BA 5TJHA 3T97A 1KB9E 1QL2A 1LP1A 1S1CX 2M5AB 3NTNA 3CPWO 2N9BA 4L75A 2A45G 4Y99B 3N0QA 5BOKA 4HM1A 2FYUK 2OYIB 2N9YB 1AQTA 3OA7A 4WY4B 5APSA 4C7NA 1PP9J 1PP9E 3L75J 1DH3A 3WU2E 3C8VA 1LTIC 1Q86Q 1L0LK 1G2CA 1N73A 3DQYA 1NU1G 3NMDA 3HD7C 3VMZA 4NPFX 1S9KD 5AVSB 1EDIA 2QEXP 1AA0A 2JZAA 4I2LC 2D2CB 3GL2A 1VM9A 4NBED 1NTKE 1H8AA 1KMIZ 4AUWA 1S9KE 1BE3G 1VCKA 2V4HA 4OH8B 1PIXA 2NZ2A 1YHQP 1IJDB 5AW2B 3CWBE 1P84E 1NAFA 3VTPC 2XNXA 1SP4A 2GA1A 2H43A 4NBGD 2J5UA 3L73E 2GBXA 1EQ7A 3CCRP 1SQQE 1LT9A 2YFIA 1NTZJ 3PRJA 1LTJA 1GW4A 2E76C 1SLQA 1EZVG 1NYKA 1OZHA 4OGQD 1HGZA 1BCCG 1SFCB 1D7MA 1YQ4C 3AEGC 2QM7A 1EXJA 4QURA 1BGYG 3KHUA 1KN7A 3GZYA 2LXCB 3FGAD 4QDFA 3CX5E 4AQRD 1L4AC 1NH4A 4QUPA 3R4YA 1EZVI 4H44C 2K9YA 1FBMA 1JY3P 3H1JD 3L72J 3A0HE 2JWAA 1IZNB 2XKMA 2KLUA 1FZAA 1SQXK 1YJWP 1JO5A 1UIXA 1UUWA 4EOTA 3C9IA 3P8MC 4WBAA 3VCAA 1GL2A 2AXTE 4N3YB 4C7RA 3WUVA 3S9OA 2QIWA 4HM0A 1WRGA 2C0XA 1SQBG 5CBOA 4C7NB 1N7SD 1S4XA 2H8PD 3D6YA 2OYIA 1BSHA 2JKVA 4JF7A 2O01H 3RK3C 2XDJA 2IZ0A 1IC2A 1KYOI 1NTZG 1NU1E 5AW0B 4R4LA 2IBZG 1URQC 2O01N 5KAIH 4UB8H 2ZYLA 4DT0A 3FXDA 2A06E 4PV1B 2KB7P 3VN0A 3RK2D 3H1ID 3KPEA 4Y28J 5B5EE 2BASA 1DD4A 2LXBA 3BASA 2Q1KA 1T8ZA 3BATA 2JEEA 2NVFA 1NTKD 4TLFA
chains in the Genus database with same CATH topology
2FYNC 2OQQA 1ULJA 4I7ZC 1RQVA 3VMGD 2E74C 1EG9A 3H1KE 3GOBA 2QJKC 1DD3A 1O7HA 2NUKA 3L75E 2MKVA 3GLMA 4YXDC 3GL0A 4YTPC 4H0LB 3D89A 5KLVE 2E4QA 3C0DA 2BCCE 3D70A 1DIPA 4I7ZB 3G9RA 4Z1MH 1RIEA 2HMLA 1WMKA 2BEQD 2GBWA 1OW8A 4HJLA 2G3AA 1YQ3C 2P10A 4HM6A 1SQXE 4U7JA 3T97B 1BE3E 3H1JE 2D2CC 1NYHA 2D2CD 3GTEA 2WPVB 4RKUJ 3EQQA 3Q2YA 2WSCJ 3AE8C 1IK7A 3L74E 5L8RJ 3H1HE 4P1BH 1MKMA 5M1BA 1PV3A 3GMAA 1ZP0C 1VF5D 1U57A 1Q90C 3AEFC 2YFJA 1BCCE 2IDBA 1EZVE 3Q5PA 1K05A 3Q1MA 4HM2A 4NBBD 1RFSA 4PV1C 4NBDD 2E74D 2YFLA 2Q3WA 4OGQB 2WSEJ 1JM1A 1SQBE 4AAYB 2JO1A 3Q5RA 3VMID 1K04A 4OGQC 3AEAC 4QDDA 2IBZE 1R8EA 2YIUC 2E75B 3AE7C 2NUMA 4H13D 2FBWC 3AEEC 1O7NA 3GZXA 1PL5A 1JB0J 4P1CH 2DE5D 2E76D 2E75C 4XFJA 3GCEA 3AE2C 2DE6D 2H89C 1NTZE 1L0NE 2HMOA 2NVGA 1HJ0A 4QUQA 1G8KB 4QDCA 1SQVE 1FQTA 3GKEA 2FYUE 4HM7A 1OW7A 1L0LE 3O6QA 2BMRA 1TU3F 3AE6C 3H1IE 2YMKA 1SJGA 2ZT9B 3IN6A 4NBHD 1KILE 3EN1A 3BCCE 2QJPC 2HMJA 1O7PA 3H25A 3CXHE 2E74B 1ZMEC 1S5LX 3Q3DA 3AECC 4H44B 3SFDC 4PV1D 4NBCD 1KB9E 1EXIA 1FDOA 2HMKA 3EWKA 1S1CX 1OMIA 4NBFD 1KYOE 3AZCA 3AE1C 4QCKA 4EMJB 3N0QA 3AEBC 3GTSA 5BOKA 4HM1A 1VF5C 3AEDC 1PP9E 4H0LD 3H1LE 3C8VA 3GB4A 4GDOA 1OW6A 3L71E 3DQYA 1ZOYC 3TGUE 2DE7D 2E4PA 3D71A 1Y9BA 3RL0g 4NB8D 4R4MA 1RQUA 1ULIA 1NTME 5KKZC 2B1XA 5HL4A 2JZAA 2BMOA 4IL6X 2QPZA 2WQYC 1KQFB 2D2CB 1VL2A 3GL2A 1VM9A 4NBED 2BMQA 1KTMA 1NTKE 1KMIZ 1KORA 1NDOA 1VCKA 2HMNA 1NGMB 1PIXA 2XSHA 2NZ2A 2XSOA 1AJYA 3CWBE 3GF3A 1P84E 4HM5A 3AE5C 2BEZF 3AE3C 1KQGB 4NBGD 2J5UA 2GBXA 3L73E 1SQQE 2YFIA 2XR8A 2E76C 1HF9A 4KT0J 1NYKA 3AE4C 3IAOA 4OGQD 2O01J 2ZT9D 4NBAD 2YVJB 5AEUA 1YQ4C 3AEGC 1EXJA 4QURA 2I7FA 4H13C 3FOUA 3VCPA 2H88C 1ZRTE 3LW5J 3GZYA 5AEWA 3FGAD 4QDFA 4QDFB 3CX5E 4QUPA 3R4YA 3AE9C 4H44C 4TT3H 2G8YA 4H44D 2V7QJ 2K9YA 2QJYC 3SFEC 2XRXA 2NWFA 3B71A 1O7GA 3RK3E 3VMHD 1GMJA 2CKFA 4H13B 3ABVC 1UIXA 2ZT9C 1UUWA 4AIVA 4HM3A 2HMMA 1FDIA 3VCAA 1O7WA 1VF5B 4U3FE 4HM8A 3S9OA 3L72E 2QIWA 4HKVA 4NB9D 1WQLA 4HM0A 2NVEA 5CXMA 4H0LC 2E76B 3D6YA 1G8JB 4HM4A 1Q90D 1NU1E 2JP3A 4R4LA 1UUVA 2B24A 3GF7A 1PPJE 2ZYLA 2QSIA 2A06E 1O7MA 4PV1B 3Q5SA 2FXPA 2E75D 4Y28J 5KLIC 3L70E 1SQPE 1DD4A 2WSFJ 3D6ZA 2NVFA 2JO6A 4PD4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI D;  1NYK A;  2HMK A;  2FYN C;  4OGQ D;  4NBF D;  4OGQ C;  1KYO E;  3AZC A;  4QDD A;  2IBZ E;  4QCK A;  2ZT9 D;  1ULJ A;  4I7Z C;  4NBA D;  4EMJ B;  3VMG D;  2YVJ B;  3N0Q A;  2YIU C;  5AEU A;  2E74 C;  2NUM A;  3GTS A;  1EG9 A;  3H1K E;  4HM1 A;  3GOB A;  5BOK A;  2QJK C;  1O7H A;  1VF5 C;  4QUR A;  4H13 D;  2I7F A;  4H13 C;  2NUK A;  3FOU A;  3L75 E;  1ZRT E;  3VCP A;  3GZY A;  5AEW A;  4QDF A;  4QDF B;  3CX5 E;  4QUP A;  3GL0 A;  1PP9 E;  4H44 C;  4H0L D;  1O7N A;  3H1L E;  4H44 D;  3GZX A;  3GB4 A;  2QJY C;  3D89 A;  5KLV E;  2E4Q A;  3C0D A;  2BCC E;  3L71 E;  2XRX A;  3DQY A;  3TGU E;  2NWF A;  4P1C H;  2DE5 D;  2E76 D;  2E75 C;  1RIE A;  2DE7 D;  2HML A;  1O7G A;  3VMH D;  3GCE A;  2E4P A;  2GBW A;  4HJL A;  2DE6 D;  4NB8 D;  1NTZ E;  2CKF A;  1ULI A;  1L0N E;  2HMO A;  1NTM E;  2NVG A;  1SQX E;  4HM6 A;  2ZT9 C;  1UUW A;  4AIV A;  4HM3 A;  4QUQ A;  2HMM A;  1BE3 E;  1G8K B;  3H1J E;  4QDC A;  1SQV E;  1FQT A;  3VCA A;  5KKZ C;  2D2C C;  3GKE A;  2D2C D;  1O7W A;  2FYU E;  3GTE A;  2B1X A;  4HM7 A;  4U3F E;  5HL4 A;  4HM8 A;  3EQQ A;  3L72 E;  2JZA A;  2BMO A;  4HKV A;  2QPZ A;  4NB9 D;  1L0L E;  1WQL A;  4HM0 A;  2BMR A;  2NVE A;  3L74 E;  3H1H E;  4P1B H;  5CXM A;  4H0L C;  3GL2 A;  1VF5 D;  1VM9 A;  4NBE D;  2BMQ A;  1G8J B;  3H1I E;  1Q90 C;  1NTK E;  4HM4 A;  2YFJ A;  2YMK A;  1SJG A;  1NU1 E;  1BCC E;  1NDO A;  4NBH D;  1UUV A;  1EZV E;  2B24 A;  1VCK A;  3EN1 A;  3BCC E;  1PPJ E;  2ZYL A;  2QJP C;  2HMN A;  2HMJ A;  2XSH A;  1O7P A;  2A06 E;  1O7M A;  2XSO A;  4HM2 A;  3CWB E;  4NBB D;  1P84 E;  1RFS A;  4PV1 C;  4HM5 A;  3CXH E;  4NBD D;  2E74 D;  2E75 D;  2YFL A;  5KLI C;  2Q3W A;  3L70 E;  1SQP E;  4NBG D;  2GBX A;  3L73 E;  1JM1 A;  1SQB E;  1SQQ E;  4PV1 D;  2YFI A;  4NBC D;  4AAY B;  2NVF A;  1KB9 E;  2JO6 A;  2XR8 A;  2E76 C;  4PD4 E; 
#chains in the Genus database with same CATH topology
 4U3F D;  1EDJ A;  1J1E C;  1LTG C;  1ULJ A;  4I7Z C;  1RQV A;  1GL2 B;  1PGQ A;  4XA4 A;  3L75 E;  1AVO A;  3V2N A;  5CJ4 A;  1L4A D;  4IFF A;  2YKP A;  1VQN P;  3QH9 A;  2JJL A;  5KLV E;  3D89 A;  4NPE A;  2WPR A;  1SQB J;  3D70 A;  1JOC A;  1S3J A;  1SFC D;  4I7Z B;  4WVZ A;  2R3S A;  2Y9Z A;  4Z1M H;  2ITA A;  4PJ0 E;  2HML A;  1WMK A;  1KQS O;  2BEQ D;  3OAK A;  4KHX A;  4HJL A;  3JCU E;  1YQ3 C;  3BCC D;  3SSU A;  1SQX E;  4UB6 E;  1MFZ A;  3T97 B;  1RF1 C;  3MIW A;  1ZRT D;  5K5G B;  2I1K A;  2WPV B;  2IYO A;  2Q6Q A;  3HUS B;  2ZXE B;  4DOJ A;  3CC4 P;  1IK7 A;  3L74 E;  1RF0 C;  1P84 H;  1MKM A;  4DJG A;  3B5N B;  3L70 J;  1IFI A;  1JNM A;  1HTL C;  3AEF C;  4ZNC A;  1BCC E;  1DEB A;  1LWU B;  3Q1M A;  3KZI H;  1BGY E;  4HM2 A;  4MN4 C;  1RFS A;  4PV1 C;  3O6Q B;  1DX7 A;  2E74 D;  2YFL A;  4EI2 A;  1SQB E;  4W7Y A;  2JO1 A;  3U1C A;  3IF4 A;  3LW5 H;  2IBZ E;  5BU5 A;  1FS0 E;  2P2U A;  3EFG A;  1PFI A;  1VQM P;  3MD0 A;  5TIS H;  2FBW C;  4BRY A;  1LNQ A;  4BWN A;  4KJM A;  3L75 D;  1SQP D;  1URQ D;  3BRT B;  3AEE C;  5APU A;  2NPS C;  2B88 A;  2W6A A;  1H0T B;  2PGD A;  3VP9 A;  1JCD A;  2KI7 B;  3AE2 C;  1YJ9 P;  2DE6 D;  3FWN A;  2QVA A;  4NPD A;  2HMO A;  2O1K A;  3CL3 D;  1LTT C;  2HFE D;  2A06 G;  1G8K B;  1SQV E;  1PP9 G;  1OW7 A;  3L75 G;  3M0D A;  1L0L E;  1NAY A;  4A7P A;  1IFP A;  1TU3 F;  2QRX A;  2M8R A;  3A7O A;  3L4F A;  1SJG A;  3CMA P;  2OYH A;  2ZT9 B;  3BCC E;  5B66 E;  1VQ9 P;  2QJP C;  4EYY Q;  4O9B A;  1O7P A;  1RHZ B;  3KZI E;  2E74 B;  4GT1 A;  1S5L X;  3Q3D A;  3AEC C;  3HUS A;  4BXL A;  3A0B E;  5KLV G;  1J1D B;  3WUU A;  1T6A A;  2KXP B;  2ZYD A;  2FFD C;  1FDO A;  1BE3 J;  2HMK A;  3RL0 D;  2K37 A;  2BCC G;  3GG2 A;  5AVW B;  4EMJ B;  1Q7Y Q;  5CCG A;  3AEB C;  3GTS A;  3USS A;  2YO2 A;  1X9V A;  2NPS D;  1VF5 C;  2KZI A;  1J1E B;  3H1K D;  5H2F H;  2W8Z A;  2R32 A;  3ITK A;  1OVR A;  3AED C;  2UWJ E;  3GHG B;  4IOI H;  2QM8 A;  1OW6 A;  2KYV A;  2GM4 A;  1H0T A;  2RN0 A;  5EFW B;  2Z4E A;  4HYT B;  2WSF H;  1JY3 N;  1Y9B A;  4NB8 D;  1ULI A;  1NTM E;  1BGY J;  2RKL A;  2ZAE B;  5AW4 B;  1L0L J;  2B1X A;  3IR9 A;  2BMO A;  1S5L H;  4GOF A;  5CCH A;  3TGU D;  1VL2 A;  2R44 A;  5AVV B;  1EZV D;  3S4R A;  1KOR A;  2QE7 H;  2K3R A;  1L0N D;  3CME P;  2I1J A;  1NGM B;  3PHL A;  3H32 B;  3MUD A;  1YTZ T;  5KAF H;  4HM5 A;  4WY4 A;  2Q5U A;  3AE5 C;  4D6T J;  3P32 A;  3CCM P;  2BEZ F;  3PLN A;  1OXZ A;  1NTK J;  2PFX A;  3H1H G;  4K35 A;  3H1L J;  1HF9 A;  4KT0 J;  4RO0 A;  1GK6 A;  1PZQ A;  2HR3 A;  3AE4 C;  1M1K Q;  2ZT9 D;  3TGU G;  3SWF A;  1KQL A;  2ZXX A;  5AEU A;  3L74 J;  4D6T E;  3V4Q A;  4I6M C;  1HH0 A;  1FZC B;  2M3E A;  1OX3 A;  1ZRT E;  1L0N K;  5AEW A;  1L0L G;  3HE4 A;  5KJ7 A;  3AE9 C;  4TT3 H;  2JWD A;  2OGU A;  4N78 D;  3S1K A;  2V7Q J;  3SFE C;  2K1A A;  3V2Q A;  4RJT A;  2QA4 P;  2NWF A;  1YIJ P;  2K9J B;  1RE3 C;  3B71 A;  1O7G A;  1VQ8 P;  2A45 H;  2ZVO B;  3ABV C;  1NU1 D;  2WIT A;  4HM3 A;  1W5C E;  1FDI A;  2HMM A;  1LTJ C;  1QX8 A;  1GK4 A;  4GKG A;  4U3F E;  4JYC A;  4EIJ A;  2E76 B;  1L2P A;  4HM4 A;  1Q90 D;  2JP3 A;  3A0B H;  5KJ7 D;  1UUV A;  2B24 A;  1JUN A;  3FX0 A;  2QSI A;  3EQ2 A;  2H7H A;  1NTM G;  1O7M A;  1M7L A;  1SS1 A;  3BRV B;  3L74 G;  3P7K A;  2IYP A;  4W80 A;  5AW9 B;  2Q7C A;  1M90 Q;  2N1T C;  3M9Q A;  3H1I G;  1SQP E;  3RBX A;  2Y9Y A;  3D6Z A;  2OTJ P;  4LGD E;  1N7S A;  1M56 D;  1SQV K;  2HOD A;  4PD4 E;  1GL2 C;  2WZ7 A;  1NOH A;  3L71 G;  1AQ5 A;  1Z56 A;  2CPS A;  2OQQ A;  3L73 D;  4C46 A;  2R5B A;  4HKZ H;  4WY4 D;  1UII A;  2KK7 A;  1DD3 A;  1O7H A;  1FZF A;  3M91 A;  2NUK A;  1U7J A;  1SQP J;  2DW3 A;  1FZC C;  4HJG H;  3SWY A;  5AW6 B;  4IFM A;  2WT7 B;  1OFC X;  3MP7 B;  2E4Q A;  3C0D A;  1Q2N A;  1LTA C;  5GTI H;  5KKZ B;  3GHG C;  1LWU A;  1NTZ D;  1A02 J;  1RE4 A;  1RY3 A;  2P10 A;  1SFC A;  3H1J E;  1PPJ G;  2D2C D;  1SQB K;  3RK2 C;  3HTK A;  1BCC J;  1LTJ B;  3MHV A;  3Q2Y A;  4K3A A;  3HTK B;  3AE8 C;  3TF5 A;  1L4A B;  5BVZ A;  3H1H E;  4P1B H;  1PV3 A;  1VF5 D;  1U57 A;  1Q90 C;  1M1J A;  3PTZ A;  1IFN A;  2YFJ A;  1SQV G;  2IX7 C;  3OJA B;  5AW8 B;  1KIL A;  1GZL A;  1PGJ A;  2Z5H A;  3LID A;  2HYN A;  4NBD D;  3KQG A;  2K88 A;  2WSE J;  1JM1 A;  1BSN A;  3V6I A;  3F89 A;  3RK3 B;  3MGN A;  3HE4 B;  5BU8 B;  4ASW A;  1KYO H;  1K04 A;  3AEA C;  1M8O B;  3V5B A;  1R8E A;  3CWB G;  2E75 B;  2NUM A;  4Y99 C;  3H1K J;  4LC1 A;  1WT6 A;  5APQ A;  3CC7 P;  1L4A A;  2Y0D A;  2MJZ A;  1O7N A;  1N73 C;  5APV A;  3CC2 P;  3KDP B;  4OVN F;  1JB0 J;  3BVH A;  2GUV A;  2Q3E A;  2DE5 D;  2E76 D;  4P1C H;  2E75 C;  3W67 A;  4XFJ A;  5E79 H;  4HH2 A;  1K73 Q;  1QVG O;  2H89 C;  1L0N E;  1SQV J;  4GIF A;  1FQT A;  1N8R Q;  4HM7 A;  2RMZ A;  1PPJ D;  3I56 P;  1PGO A;  2AEF A;  2YKQ A;  1HGV A;  1AV1 A;  3B8E B;  4PD4 I;  3EN1 A;  2P67 A;  2HMJ A;  3B5N A;  2NPS A;  1PGP A;  1IFM A;  1JTH B;  3H1J G;  3CXH E;  3H1K G;  1J2J B;  1LTS C;  1M57 D;  5AVQ B;  3L72 G;  2HPC B;  3SFD C;  1KFN A;  4NBC D;  1OVV A;  1SQX J;  2WPQ A;  3CCS P;  3EWK A;  1Q82 Q;  1ZXG A;  1OMI A;  4NBF D;  3AZC A;  1USE A;  2Y0C A;  3U1A A;  3CCQ P;  2Q3I A;  2VRS A;  3M9B A;  2WVR A;  4QMA A;  1S72 P;  4JYB A;  1JMM A;  4EDF A;  3NFQ A;  3H1H J;  5AVZ B;  2QJY B;  3H1L E;  5APY A;  3GB4 A;  1T3U A;  2WSS H;  4GDO A;  2RH0 A;  1ZOY C;  4CPG A;  3TGU E;  1JM0 A;  2W6J H;  4B86 A;  2DE7 D;  3P8C E;  3V4W A;  5GTH E;  3WMM 0;  3RL0 g;  3JC2 2;  1RQU A;  1NTZ K;  3V2R A;  2L91 A;  5KKZ C;  1SQQ K;  2B87 B;  5KLV D;  1CI6 A;  1VDF A;  2P1J A;  2NRG A;  1VQ7 P;  1KQF B;  3L70 D;  1FJP A;  5CCG C;  2YO3 A;  2BMQ A;  1PP9 D;  2OYO A;  1SQX G;  1NDO A;  2E42 A;  3OW2 O;  1FDM A;  1BDD A;  2O3J A;  1GL2 D;  3PJS K;  1L0N G;  3VP8 A;  1VQ5 P;  4GOD A;  2QG4 A;  1AJY A;  2OTK E;  4DCK A;  4IL6 E;  4GOE A;  3AE3 C;  5AVR B;  2XV5 A;  5CCH D;  1KQG B;  2HOD B;  1X8Y A;  3VMY A;  4IFD K;  3HE5 B;  1GDT A;  3CCV P;  2M0B A;  2GUS A;  3IAO A;  4N78 E;  3L73 J;  2SPZ A;  1LGH B;  3CLQ A;  4ZMD A;  2YVJ B;  1GTW A;  2QJP B;  3RK3 D;  5AW3 B;  2OYI C;  2I7F A;  3LW5 J;  2XND H;  4QDF B;  2FYU G;  5C39 A;  1YTZ I;  1NTM K;  1FC2 C;  2QJY C;  2XRX A;  1SQQ D;  2YIU B;  2WT7 A;  3RK3 E;  3P8C D;  3VMX A;  2OAR A;  1OWA A;  2KZJ A;  1BE3 D;  2L5G B;  4UB6 H;  1DEE G;  2ZT9 C;  1LTB C;  3GW6 A;  1O7W A;  1RF1 B;  1VF5 B;  2KNC B;  4HM8 A;  3L72 E;  4HKV A;  1H88 A;  1WQL A;  3I5C A;  2NVE A;  2E43 A;  4ZKU A;  1QVF O;  3L71 D;  4H0L C;  2C9L Y;  3FXE A;  1G8J B;  1LP1 B;  1KIL D;  2KIK A;  2FKW B;  1SQP K;  1PPJ E;  3L72 D;  3G4S P;  3PH0 A;  3Q5S A;  2FXP A;  2ZYG A;  2E75 D;  2ZJS E;  4W7Z A;  4M3L A;  5KLI C;  3G6E P;  3L70 E;  2KUB A;  2W90 A;  2JO6 A;  1LJ2 A;  1RF1 A;  1JTH A;  3BCC G;  2Y0E A;  1E79 H;  1FZB A;  1LT1 A;  1GU4 A;  1T3J A;  2QJK C;  2LR2 A;  1IFD A;  3U59 A;  2ZVN B;  2N1T D;  2MKV A;  1KB9 H;  2A06 D;  2IZ1 A;  2KP8 A;  3GLM A;  4YXD C;  3M9H A;  3CX5 H;  3CCL P;  3TK1 A;  4YTP C;  4D6T D;  2KSJ A;  1KV4 A;  2BCC E;  3RGU A;  1HJB A;  2YXQ B;  2YMY A;  5KLV K;  3G9R A;  1E5W A;  3RK2 B;  3CWB J;  4ZKP A;  2J58 A;  3H6P A;  3HD7 A;  1NTK G;  1OW8 A;  5APW A;  1KFM A;  4HM6 A;  4U7J A;  2WSC H;  1BDC A;  1BE3 E;  1N7S C;  1AVY A;  1NYH A;  1OVU A;  3GTE A;  2AXC A;  5AVY B;  3M0D C;  2WSC J;  2FY8 A;  3TGU J;  5KAF E;  3O8Z A;  1OIP A;  5AW1 B;  4BRY B;  2OTL P;  1K9M Q;  1N2D C;  3HD7 B;  1RH5 B;  1URQ B;  2IBZ I;  1EZV E;  3Q5P A;  1R5L A;  3RL0 B;  1IFJ A;  1MZ9 A;  2PRR A;  3WU2 H;  3FWL A;  3B4S A;  1NU1 J;  3E7K A;  4WY4 C;  5B5E H;  1SQX D;  4WWI A;  1J1D C;  1XTG B;  3Q5R A;  1N7L A;  1CSB A;  4OGQ C;  1KIL B;  1JY2 P;  1JY3 O;  4JPZ B;  1MUU A;  2A45 I;  1CZQ A;  3L74 D;  4L76 A;  1FZG A;  2FXM A;  5H2F E;  3CD6 P;  1N73 B;  3A3Y B;  1ZN5 A;  2KSE A;  2KS1 A;  1NTM J;  2PAJ A;  1AFO A;  1PL5 A;  1T2K D;  4JQ0 D;  1KC8 Q;  1KIL C;  3I55 P;  2R3C A;  1G2C B;  1VQK P;  1ZR2 A;  3GCE A;  2B89 A;  4D6T G;  1NTZ E;  1VQ6 P;  1HJ0 A;  3GKE A;  1VPC A;  3H1L G;  1YIT P;  2KOG A;  2R5D A;  3CI9 A;  3O6Q A;  2M5A A;  3A0H H;  2BCC D;  3AE6 C;  3M0A A;  1GW3 A;  3HD7 D;  1NO4 A;  4OWF A;  1P84 D;  2JR8 A;  2K9J A;  1URQ A;  4I1L A;  2XU6 A;  4U3F G;  3G71 P;  2V7Q H;  3W68 A;  5AW5 B;  3A5T A;  5CBN A;  4IL6 H;  4PJ0 H;  1U7M A;  1XTC C;  1VQP P;  4H44 B;  4AYC A;  2OYH B;  4PV1 D;  4HB1 A;  4DZO A;  1EXI A;  2AXT H;  2WWW A;  2AEM A;  4PD4 D;  1KYO E;  3AE1 C;  4QCK A;  1L0L D;  1HVV A;  2C0W A;  5DJU B;  3CX5 D;  2OYH C;  1KB9 D;  4L74 A;  3SWK A;  1R5S A;  2KS1 B;  5CMZ A;  4H0L D;  2E5T A;  2FXO A;  3L71 E;  1SQQ J;  3N4X A;  1Y47 A;  4LLH A;  3IFM A;  5CCG D;  2E4P A;  3D71 A;  1ZV8 A;  1LT9 C;  4R4M A;  3H1I J;  2WPS A;  1BCC D;  3VYI A;  3CX5 I;  2IFM A;  1EC5 A;  5HL4 A;  3L36 A;  4IL6 X;  2QPZ A;  3L71 J;  3EFF K;  2WQY C;  3KYQ A;  1Q81 Q;  3R2P A;  2J59 M;  2YNY A;  1KTM A;  1FE6 A;  4L73 A;  1QL1 A;  2HMN A;  2XSH A;  2FYU D;  2XSO A;  2LKM A;  3GF3 A;  4XE5 B;  3HE5 A;  1BGY D;  2N1T A;  1FOS E;  5TIS E;  1IO4 A;  2Q9I A;  2N1T B;  1P84 I;  2XR8 A;  2FFD A;  2W27 A;  3E1R A;  2IPP A;  2O01 J;  5AVU B;  1T2K C;  1JY2 O;  1X0T A;  4NBA D;  1QGK B;  1USD A;  5E79 E;  2W6B A;  3L70 G;  4H13 C;  3FOU A;  3VCP A;  2H88 C;  1NHL A;  1IK9 A;  2G8Y A;  4H44 D;  3TYY A;  3K5B A;  3TSI A;  5GTI E;  3CWB D;  1LWU C;  5APX A;  3VMH D;  1GMJ A;  3H1L D;  1NVO A;  1SQV D;  1G1I A;  2CKF A;  1NWQ A;  4H13 B;  5AVT B;  4AIV A;  1YBK A;  3NXS A;  3CCE P;  4NB9 D;  3QWO C;  3VMA A;  5KTB A;  3CXH H;  5CXM A;  3LIE A;  1M1J C;  2CK3 H;  3TDK A;  5APT A;  1ZR4 A;  1W2E A;  3E1I A;  4ASV A;  5KJ7 C;  1HUC A;  1FZC A;  2YKO A;  3GF7 A;  2FYN B;  1G1J A;  3MUD C;  2XZR A;  2CPB A;  2YXR B;  2B9B A;  1RE3 A;  3RBZ A;  3JSV C;  3F5H A;  2Z5I A;  3HUS C;  1QEX A;  2IFN A;  1CI6 B;  1H89 A;  2WSF J;  1GU5 A;  1NU1 K;  4YPC A;  3M06 A;  3PP5 A;  5B66 H;  2P7J A;  5CJ0 A;  1MV8 A;  2FYN C;  2JDI H;  1S5L E;  3CXH D;  1SVF A;  1RF0 A;  3H32 A;  3VMG D;  2E74 C;  3H1K E;  1EG9 A;  3TNU A;  3GOB A;  2KNC A;  1JY2 N;  4N6J A;  3C1L A;  1X79 B;  1NJI Q;  3H1H D;  1NTM D;  1NKN A;  3GL0 A;  1KYO D;  1S2E A;  4WB4 A;  4H0L B;  1GD2 E;  1QLE D;  1DIP A;  3H1J J;  1RIE A;  1ZW0 A;  2GBW A;  2G3A A;  1JCC A;  1YYC A;  2ZFC A;  5KLV J;  1FAV A;  2WTY A;  2D2C C;  1N86 A;  3UIA A;  4RKU J;  3EQQ A;  5CCH C;  2HPC A;  1LT9 B;  2C9N Y;  1W2B O;  4RES B;  2BCC J;  1A02 F;  5L8R J;  1FZE A;  5M1B A;  3GMA A;  2NPS B;  1ZP0 C;  2FFD B;  4YXW H;  2IDB A;  1K05 A;  5KAI E;  2PP6 A;  3B5N C;  2QJK B;  3CCU P;  1K8A Q;  4NBB D;  1CW5 A;  1JMB A;  1NKZ B;  4JBZ A;  2I8D A;  1FOS F;  2Q3W A;  4OGQ B;  1SFC C;  2WSE H;  2HG5 D;  3TNU B;  4AAY B;  1NTK K;  4PD4 H;  2B87 A;  3VMI D;  2W83 C;  3L35 A;  1FU1 A;  4U3F J;  4QDD A;  3WUT A;  2POH A;  2YIU C;  3AE7 C;  1N7S B;  3HRN A;  3L37 A;  4H13 D;  3KXD A;  1EDL A;  1JEK A;  4UB8 E;  5KLI B;  2HLO A;  3GZX A;  1L0N J;  5AVX B;  1SQB D;  1HBW A;  2ZYA A;  3GHG A;  5GTH H;  3VOP A;  1EDK A;  3RL0 C;  1RE4 C;  2KLV A;  3JCU H;  1YI2 P;  2NVG A;  2O1J A;  3II6 A;  3A2A A;  3V2P A;  4QUQ A;  3BCC J;  4QDC A;  2E5Y A;  1FJK A;  5CHX A;  2FYU E;  1KD1 Q;  3MZW B;  1VQ4 P;  3N7N A;  3MTU E;  1KB9 I;  1KZU B;  2IBZ D;  3L73 G;  1VQO P;  2BMR A;  1SQQ G;  1HWT C;  1X22 A;  2FYZ A;  5AW7 B;  1SQP G;  3H1I E;  3G3Z A;  3CCJ P;  2YMK A;  2P58 A;  1ZLL A;  3IN6 A;  1MFT A;  4NBH D;  1KIL E;  2WMM A;  3B5N D;  2FYU J;  1M1J B;  1YJN P;  1VQL P;  3H25 A;  1Y8A A;  3ZDM A;  1ZME C;  3CXH I;  2AEJ A;  5DJT B;  2M3B A;  5TJH A;  3T97 A;  1KB9 E;  1QL2 A;  1LP1 A;  1S1C X;  2M5A B;  3NTN A;  3CPW O;  2N9B A;  4L75 A;  2A45 G;  4Y99 B;  3N0Q A;  5BOK A;  4HM1 A;  2FYU K;  2OYI B;  2N9Y B;  1AQT A;  3OA7 A;  4WY4 B;  5APS A;  4C7N A;  1PP9 J;  1PP9 E;  3L75 J;  1DH3 A;  3WU2 E;  3C8V A;  1LTI C;  1Q86 Q;  1L0L K;  1G2C A;  1N73 A;  3DQY A;  1NU1 G;  3NMD A;  3HD7 C;  3VMZ A;  4NPF X;  1S9K D;  5AVS B;  1EDI A;  2QEX P;  1AA0 A;  2JZA A;  4I2L C;  2D2C B;  3GL2 A;  1VM9 A;  4NBE D;  1NTK E;  1H8A A;  1KMI Z;  4AUW A;  1S9K E;  1BE3 G;  1VCK A;  2V4H A;  4OH8 B;  1PIX A;  2NZ2 A;  1YHQ P;  1IJD B;  5AW2 B;  3CWB E;  1P84 E;  1NAF A;  3VTP C;  2XNX A;  1SP4 A;  2GA1 A;  2H43 A;  4NBG D;  2J5U A;  3L73 E;  2GBX A;  1EQ7 A;  3CCR P;  1SQQ E;  1LT9 A;  2YFI A;  1NTZ J;  3PRJ A;  1LTJ A;  1GW4 A;  2E76 C;  1SLQ A;  1EZV G;  1NYK A;  1OZH A;  4OGQ D;  1HGZ A;  1BCC G;  1SFC B;  1D7M A;  1YQ4 C;  3AEG C;  2QM7 A;  1EXJ A;  4QUR A;  1BGY G;  3KHU A;  1KN7 A;  3GZY A;  2LXC B;  3FGA D;  4QDF A;  3CX5 E;  4AQR D;  1L4A C;  1NH4 A;  4QUP A;  3R4Y A;  1EZV I;  4H44 C;  2K9Y A;  1FBM A;  1JY3 P;  3H1J D;  3L72 J;  3A0H E;  2JWA A;  1IZN B;  2XKM A;  2KLU A;  1FZA A;  1SQX K;  1YJW P;  1JO5 A;  1UIX A;  1UUW A;  4EOT A;  3C9I A;  3P8M C;  4WBA A;  3VCA A;  1GL2 A;  2AXT E;  4N3Y B;  4C7R A;  3WUV A;  3S9O A;  2QIW A;  4HM0 A;  1WRG A;  2C0X A;  1SQB G;  5CBO A;  4C7N B;  1N7S D;  1S4X A;  2H8P D;  3D6Y A;  2OYI A;  1BSH A;  2JKV A;  4JF7 A;  2O01 H;  3RK3 C;  2XDJ A;  2IZ0 A;  1IC2 A;  1KYO I;  1NTZ G;  1NU1 E;  5AW0 B;  4R4L A;  2IBZ G;  1URQ C;  2O01 N;  5KAI H;  4UB8 H;  2ZYL A;  4DT0 A;  3FXD A;  2A06 E;  4PV1 B;  2KB7 P;  3VN0 A;  3RK2 D;  3H1I D;  3KPE A;  4Y28 J;  5B5E E;  2BAS A;  1DD4 A;  2LXB A;  3BAS A;  2Q1K A;  1T8Z A;  3BAT A;  2JEE A;  2NVF A;  1NTK D;  4TLF A; 
#chains in the Genus database with same CATH homology
 2FYN C;  2OQQ A;  1ULJ A;  4I7Z C;  1RQV A;  3VMG D;  2E74 C;  1EG9 A;  3H1K E;  3GOB A;  2QJK C;  1DD3 A;  1O7H A;  2NUK A;  3L75 E;  2MKV A;  3GLM A;  4YXD C;  3GL0 A;  4YTP C;  4H0L B;  3D89 A;  5KLV E;  2E4Q A;  3C0D A;  2BCC E;  3D70 A;  1DIP A;  4I7Z B;  3G9R A;  4Z1M H;  1RIE A;  2HML A;  1WMK A;  2BEQ D;  2GBW A;  1OW8 A;  4HJL A;  2G3A A;  1YQ3 C;  2P10 A;  4HM6 A;  1SQX E;  4U7J A;  3T97 B;  1BE3 E;  3H1J E;  2D2C C;  1NYH A;  2D2C D;  3GTE A;  2WPV B;  4RKU J;  3EQQ A;  3Q2Y A;  2WSC J;  3AE8 C;  1IK7 A;  3L74 E;  5L8R J;  3H1H E;  4P1B H;  1MKM A;  5M1B A;  1PV3 A;  3GMA A;  1ZP0 C;  1VF5 D;  1U57 A;  1Q90 C;  3AEF C;  2YFJ A;  1BCC E;  2IDB A;  1EZV E;  3Q5P A;  1K05 A;  3Q1M A;  4HM2 A;  4NBB D;  1RFS A;  4PV1 C;  4NBD D;  2E74 D;  2YFL A;  2Q3W A;  4OGQ B;  2WSE J;  1JM1 A;  1SQB E;  4AAY B;  2JO1 A;  3Q5R A;  3VMI D;  1K04 A;  4OGQ C;  3AEA C;  4QDD A;  2IBZ E;  1R8E A;  2YIU C;  2E75 B;  3AE7 C;  2NUM A;  4H13 D;  2FBW C;  3AEE C;  1O7N A;  3GZX A;  1PL5 A;  1JB0 J;  4P1C H;  2DE5 D;  2E76 D;  2E75 C;  4XFJ A;  3GCE A;  3AE2 C;  2DE6 D;  2H89 C;  1NTZ E;  1L0N E;  2HMO A;  2NVG A;  1HJ0 A;  4QUQ A;  1G8K B;  4QDC A;  1SQV E;  1FQT A;  3GKE A;  2FYU E;  4HM7 A;  1OW7 A;  1L0L E;  3O6Q A;  2BMR A;  1TU3 F;  3AE6 C;  3H1I E;  2YMK A;  1SJG A;  2ZT9 B;  3IN6 A;  4NBH D;  1KIL E;  3EN1 A;  3BCC E;  2QJP C;  2HMJ A;  1O7P A;  3H25 A;  3CXH E;  2E74 B;  1ZME C;  1S5L X;  3Q3D A;  3AEC C;  4H44 B;  3SFD C;  4PV1 D;  4NBC D;  1KB9 E;  1EXI A;  1FDO A;  2HMK A;  3EWK A;  1S1C X;  1OMI A;  4NBF D;  1KYO E;  3AZC A;  3AE1 C;  4QCK A;  4EMJ B;  3N0Q A;  3AEB C;  3GTS A;  5BOK A;  4HM1 A;  1VF5 C;  3AED C;  1PP9 E;  4H0L D;  3H1L E;  3C8V A;  3GB4 A;  4GDO A;  1OW6 A;  3L71 E;  3DQY A;  1ZOY C;  3TGU E;  2DE7 D;  2E4P A;  3D71 A;  1Y9B A;  3RL0 g;  4NB8 D;  4R4M A;  1RQU A;  1ULI A;  1NTM E;  5KKZ C;  2B1X A;  5HL4 A;  2JZA A;  2BMO A;  4IL6 X;  2QPZ A;  2WQY C;  1KQF B;  2D2C B;  1VL2 A;  3GL2 A;  1VM9 A;  4NBE D;  2BMQ A;  1KTM A;  1NTK E;  1KMI Z;  1KOR A;  1NDO A;  1VCK A;  2HMN A;  1NGM B;  1PIX A;  2XSH A;  2NZ2 A;  2XSO A;  1AJY A;  3CWB E;  3GF3 A;  1P84 E;  4HM5 A;  3AE5 C;  2BEZ F;  3AE3 C;  1KQG B;  4NBG D;  2J5U A;  2GBX A;  3L73 E;  1SQQ E;  2YFI A;  2XR8 A;  2E76 C;  1HF9 A;  4KT0 J;  1NYK A;  3AE4 C;  3IAO A;  4OGQ D;  2O01 J;  2ZT9 D;  4NBA D;  2YVJ B;  5AEU A;  1YQ4 C;  3AEG C;  1EXJ A;  4QUR A;  2I7F A;  4H13 C;  3FOU A;  3VCP A;  2H88 C;  1ZRT E;  3LW5 J;  3GZY A;  5AEW A;  3FGA D;  4QDF A;  4QDF B;  3CX5 E;  4QUP A;  3R4Y A;  3AE9 C;  4H44 C;  4TT3 H;  2G8Y A;  4H44 D;  2V7Q J;  2K9Y A;  2QJY C;  3SFE C;  2XRX A;  2NWF A;  3B71 A;  1O7G A;  3RK3 E;  3VMH D;  1GMJ A;  2CKF A;  4H13 B;  3ABV C;  1UIX A;  2ZT9 C;  1UUW A;  4AIV A;  4HM3 A;  2HMM A;  1FDI A;  3VCA A;  1O7W A;  1VF5 B;  4U3F E;  4HM8 A;  3S9O A;  3L72 E;  2QIW A;  4HKV A;  4NB9 D;  1WQL A;  4HM0 A;  2NVE A;  5CXM A;  4H0L C;  2E76 B;  3D6Y A;  1G8J B;  4HM4 A;  1Q90 D;  1NU1 E;  2JP3 A;  4R4L A;  1UUV A;  2B24 A;  3GF7 A;  1PPJ E;  2ZYL A;  2QSI A;  2A06 E;  1O7M A;  4PV1 B;  3Q5S A;  2FXP A;  2E75 D;  4Y28 J;  5KLI C;  3L70 E;  1SQP E;  1DD4 A;  2WSF J;  3D6Z A;  2NVF A;  2JO6 A;  4PD4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...