4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
1ZRTE 5CXMA 1WQLA 4H13C 3L72E 1PPJE 5KLVE 4H44D 4HM2A 1O7NA 2XSHA 3H1JE 2DE6D 1VF5C 4NBAD 3GZXA 3L74E 3L75E 1SQXE 2DE7D 2QPZA 1O7PA 4QCKA 3GL0A 4QURA 4NBFD 1JM1A 2ZT9D 4PD4E 2E74C 4NBBD 4EMJB 4HM0A 5KLIC 5AEUA 2BCCE 3VMGD 4NBHD 2YFLA 3FOUA 1KB9E 4QDDA 5BOKA 1BE3E 3TGUE 1O7HA 2E75C 4OGQC 1L0LE 4P1CH 2YVJB 1NTME 3CWBE 4QDFA 2BMOA 2XRXA 4H13D 4QUPA 2E4QA 1NU1E 2NVFA 1ULJA 1G8JB 1O7WA 2NVGA 1KYOE 2Q3WA 1RFSA 3C0DA 4NBGD 4HJLA 4NBED 5AEWA 3CXHE 4PV1C 3GKEA 3GL2A 3BCCE 2JO6A 3L70E 4NB9D 3H1HE 2DE5D 1G8KB 3N0QA 1EG9A 3H1LE 4NBDD 4HM5A 3VCPA 2D2CD 1FQTA 2A06E 3CX5E 2I7FA 1VM9A 2E75D 4OGQD 4NB8D 4P1BH 2B24A 2NUKA 2QJKC 4AIVA 3D89A 1SQPE 4HM1A 3EQQA 1VCKA 2FYNC 2HMOA 4QDFB 1UUVA 1NYKA 1SQQE 2XSOA 3GCEA 4H44C 4QUQA 1VF5D 4PV1D 1EZVE 4H0LC 1BCCE 1UUWA 2YFJA 2IBZE 4HM3A 1O7GA 3EN1A 3GTSA 2E74D 4HM4A 4AAYB 1PP9E 2HMKA 2YIUC 2HMJA 3VMHD 1NTZE 1SQVE 2E76C 5KKZC 2YFIA 4HKVA 4NBCD 3GZYA 1SJGA 4HM7A 2NUMA 1RIEA 4U3FE 2HMMA 1NDOA 2YMKA 2QJYC 3VCAA 2BMQA 5HL4A 2ZYLA 2GBXA 4H0LD 2CKFA 2GBWA 3AZCA 2BMRA 1ULIA 2JZAA 3GOBA 3GTEA 3H1IE 1Q90C 1NTKE 2B1XA 2FYUE 1L0NE 3L71E 2NVEA 3VMID 1SQBE 2ZT9C 1O7MA 4I7ZC 2QJPC 4HM6A 2D2CC 2NWFA 3L73E 2E76D 2E4PA 3DQYA 2HMNA 2XR8A 4QDCA 3H1KE 2HMLA 3GB4A 1P84E 4HM8A
chains in the Genus database with same CATH superfamily
1GW4A 5AW3B 1KYOD 1PGOA 1EZVI 2YNYA 1H0TB 2H88C 1KILC 2PP6A 2W90A 2DE7D 3A7OA 1Q90D 2Q1KA 2QG4A 2KSJA 4HYTB 2E74C 2L91A 1G2CB 1NKNA 1IC2A 1NGMB 3D6ZA 2OYIC 1UIIA 3RL0C 1BE3E 3P8MC 1NO4A 1SQQG 4P1CH 1EZVG 1VQ8P 3HD7D 1N7LA 2E4QA 5AW5B 2IBZD 1ULJA 3MZWB 3A0HH 1LP1B 1OFCX 1XTGB 1SQVD 3GG2A 2P1JA 1GL2B 2ITAA 1FQTA 2E75D 3L72G 2K37A 5AW6B 2LR2A 5KAIE 3L71D 1NTKD 1VF5D 1BGYE 1J1EC 1NTZK 5KAFH 2KOGA 2O01H 1S3JA 1NYHA 2NPSA 2OYOA 3GZYA 5GTHE 1PPJD 4JBZA 4PD4H 4U3FE 1KV4A 2M0BA 2QJYC 1L0LJ 3H25A 2WSFH 3NTNA 1M1JA 1LWUC 2BCCD 1YBKA 1KB9D 1NTMG 1JUNA 1JM0A 2Q5UA 1JB0J 5AVXB 3Q5RA 2HMLA 3CMAP 4R4MA 1JTHA 4KT0J 4BXLA 5KLVE 4HJGH 3PH0A 4OGQB 3PRJA 2Y0CA 4JYCA 1SQQJ 3VMXA 4WY4A 1YYCA 5K5GB 2LXBA 3AEAC 3CWBE 3L73J 2RMZA 1PGPA 3CCLP 4IFMA 2KNCB 3GLMA 4BWNA 2E42A 2Q3WA 1IFNA 2QJKB 3AE5C 3HUSA 2J58A 2WWWA 3L72J 1NTZD 2QJYB 3TYYA 3W67A 2KP8A 1OW8A 2Z5IA 3CC7P 2A06E 2YO2A 1VQLP 1YTZI 1L4AB 2FYNC 2WITA 3MUDC 2KLVA 2E76B 4PV1D 1GW3A 1VQ4P 2XZRA 1D7MA 4NPEA 3CD6P 4HB1A 3CLQA 5DJUB 4N3YB 1RF1C 3P7KA 3RK3C 2ZYDA 1OX3A 1NJIQ 4A7PA 4AQRD 2WT7A 1FOSE 2ZT9B 4HH2A 4K35A 1SQXK 2N9BA 3HD7C 3CXHI 2WSCJ 1ZN5A 2BMQA 2YO3A 3AE4C 3USSA 3L35A 2B1XA 3BVHA 2FYUE 2NVEA 1SQPG 4HM6A 1KYOH 3M9QA 3GF3A 2FKWB 5KLIB 1SLQA 1SFCD 4H13C 4ZMDA 4H44D 1O7NA 2WPQA 3H1LG 1VF5C 3KQGA 2QPZA 5GTIE 4HKZH 2K3RA 3F5HA 3B71A 1MV8A 2I1JA 1L0LE 1NU1K 2BMOA 3RK2D 1T8ZA 2FXOA 3S9OA 3GKEA 2V7QH 3TSIA 5CCHA 3N0QA 4EYYQ 1RQVA 1M56D 1QVFO 2Y0EA 3L75G 1J2JB 3V2RA 1SQQE 3BASA 1H89A 1HVVA 4QUQA 1EZVE 1UUWA 2WMMA 4HM4A 1USEA 1T3UA 1URQB 4C7NB 1FZCA 1HJ0A 1RE3A 4K3AA 1OIPA 2Q6QA 1USDA 3AE6C 2HMMA 2J59M 5B5EE 1SQPJ 3H32B 1KB9H 2Z5HA 4D6TG 2Q3IA 2OTKE 3C9IA 4BRYA 2R32A 2N1TD 4RKUJ 2C9LY 3IFMA 1WMKA 3H1LJ 3P8CE 1NU1D 1J1DC 1AJYA 1K04A 4W7ZA 5AW2B 3F89A 1T6AA 3V4QA 2KSEA 3U1AA 5TISH 5AEUA 3B4SA 3FXEA 4ZKUA 1VQ6P 1O7HA 3QH9A 1NTME 4QDFA 1M1JC 2IDBA 3FXDA 1AQ5A 1MZ9A 2KUBA 1PP9G 1KN7A 3C0DA 3H1HD 5EFWB 1ZLLA 2WSEH 3H1JJ 1U7JA 3L75J 1JY3N 2AEJA 3SWFA 1ZMEC 4TT3H 4P1BH 3BRTB 1FZEA 3OA7A 2YXRB 2QVAA 1SFCC 4WWIA 3H1IG 4H44C 3CCRP 1SQBG 1GMJA 1R8EA 4WY4C 4RO0A 3EN1A 1PGQA 1OVVA 3BCCJ 1HWTC 3HTKA 1JY2N 1N2DC 2NPSB 1S5LE 2AXTE 1AVYA 3B5ND 3HUSC 4D6TJ 1FOSF 3TNUA 2JR8A 2KLUA 3L37A 2IZ1A 2RKLA 5APWA 1L0ND 4JPZB 1BE3D 1LTJB 5AVTB 3EFFK 2W83C 2GM4A 5KLVK 3CCUP 5TJHA 3CMEP 5APUA 4YXDC 2XSHA 1SQXE 3FX0A 1BDCA 1LNQA 4EMJB 2KI7B 3KYQA 2Y0DA 3VMGD 4I1LA 1ZW0A 3AEFC 3O8ZA 1PP9J 1N7SA 3H1KJ 1KMIZ 1S1CX 1KZUB 1X9VA 1BGYD 1FDIA 1VQKP 2O01J 3CXHE 1GTWA 1JCDA 1QEXA 3H1LE 3EWKA 3MUDA 3VCPA 2IYPA 5B66E 3H1IJ 1ZV8A 4OGQD 4NB8D 4U3FD 1SQBJ 2H7HA 1IFIA 1KQFB 3M0DA 4TLFA 3L4FA 2AEFA 4HM3A 3HD7A 1FZBA 5CCGD 2HODB 1M8OB 3N4XA 1QX8A 1LTTC 1VQNP 5KLVD 3U1CA 1AVOA 2J5UA 3NFQA 3M9BA 2PRRA 5CCHC 4KHXA 3GHGB 2KXPB 3TF5A 1U7MA 4ASVA 4EOTA 1MFZA 3CX5I 2WQYC 3WMM0 1FZFA 2E76D 2I8DA 3CWBD 1AV1A 4PJ0H 3CCSP 3DQYA 1FS0E 5CXMA 1G1JA 1Y8AA 1JNMA 1SS1A 4UB6E 1FZCC 3OAKA 1RE3C 1O7PA 3GL0A 2A06D 2ZT9D 3ITKA 2ZAEB 4IL6H 1L0LK 1FDMA 4D6TE 4IL6X 3I56P 3B5NC 4LC1A 1OVUA 3L71G 1O7WA 5AEWA 3HE4A 1G8KB 2W6JH 1VQOP 3AE3C 1VQPP 4U7JA 2D2CD 1CI6A 4HM8A 1X22A 1PPJG 5APTA 2POHA 1DEBA 1SQQK 2YIUB 1N73A 1U57A 2G8YA 2FYUD 4H0LC 4Y99C 1KFMA 1EDLA 1KILE 3S1KA 3L73G 1VQMP 3VYIA 3Q5SA 3PJSK 1E5WA 1PP9E 1IK7A 1PV3A 2HMJA 1RH5B 1DD4A 3V2NA 5BU5A 2WPVB 3T97A 5KJ7D 4NBCD 1LTSC 2M5AA 3MIWA 3VMAA 1Z56A 2B87B 2GBWA 2YMYA 1M57D 2B9BA 3H1IE 3PTZA 1SQBE 1L0LD 1KILB 2KS1B 4OH8B 4O9BA 2C9NY 1NHLA 2E74B 2AEMA 2DW3A 1SQVJ 1URQD 2OYIB 3RL0B 2DE6D 4IFDK 1AQTA 3HE5B 4NPDA 1PL5A 2JWAA 1VDFA 5KAIH 5CCGC 3TGUD 5CJ4A 3L71J 1NTMK 5BOKA 5AVQB 3GW6A 2Q9IA 1LTAC 1BDDA 1SQQD 5AW1B 1HGZA 2XRXA 1EZVD 4CPGA 2NVGA 4ZNCA 3O6QB 2QEXP 1YHQP 1SFCA 2ZVNB 5GTHH 2C0WA 3RBXA 2RN0A 3S4RA 2I7FA 2CK3H 2ZVOB 5AW0B 2OYHA 1J1EB 4HM1A 5E79H 1HF9A 2GUVA 1VCKA 2CPBA 3BATA 1NYKA 3R4YA 4GDOA 5AVZB 5C39A 2N9YB 2K9JA 3GTSA 3OW2O 3P8CD 1OVRA 1ZR2A 1N7SC 1LWUB 2GA1A 2YKQA 4HKVA 1H88A 2NUMA 4N78E 1IZNB 3MTUE 4GT1A 1N8RQ 2GBXA 2UWJE 1WRGA 3GTEA 2KK7A 1Q90C 2JDIH 1A02J 5AW4B 2QJPC 4I6MC 2D2CC 2FFDC 1NTMD 2JKVA 2HMNA 2QM8A 3M0DC 3M91A 3V5BA 2G3AA 3L70G 2WSEJ 2H89C 4GKGA 3VP8A 3M06A 4QURA 1FJKA 1FZAA 4XA4A 2HFED 1SQPK 3RK3E 1LT9A 2E75C 2ZFCA 1L2PA 2N1TA 1Q7YQ 3UIAA 1EDJA 2MKVA 1AFOA 1RFSA 4NBGD 1JCCA 2NRGA 2ZXXA 2FYNB 1EG9A 5AVUB 1EDKA 1IFJA 1MFTA 1P84I 3CX5E 3VN0A 1CW5A 2KZIA 1RF1B 1LTIC 3RK3B 3CCEP 2OARA 1GK4A 3RGUA 3P32A 1GK6A 1YJNP 1NAYA 3HD7B 2O1JA 1YI2P 2IFNA 2Q3EA 2IPPA 1S4XA 3G6EP 5GTIH 3H1JG 1RIEA 1H0TA 3L74G 1SQXD 1K05A 3EQ2A 2E43A 2E75B 2BMRA 4W80A 5CHXA 4H13B 1GDTA 5L8RJ 4I7ZC 3VMZA 1VF5B 3L70J 3L73E 1N73C 3MD0A 1M7LA 2W8ZA 3BCCG 3CXHD 3L72E 5AVYB 1LP1A 3H1HG 3A2AA 3H1LD 2O01N 2ZJSE 3B5NA 4QCKA 3LIEA 1GL2A 1K73Q 4NBHD 5TISE 1VQ9P 2XNDH 1M90Q 4KJMA 4QUPA 1BCCG 2R3SA 2JWDA 1PIXA 4JYBA 1S72P 4PV1C 1EQ7A 2WPRA 4NPFX 2FBWC 3HE4B 1HJBA 4NBDD 3II6A 2P2UA 4AIVA 1QL1A 3AECC 1DX7A 3AEGC 3EQQA 3GCEA 1L0NG 1UIXA 4PD4I 2FXPA 2B88A 2JO1A 1EXJA 3CL3D 5AVVB 3H1KG 2KB7P 3L74J 3Q5PA 3T97B 4DZOA 4HM7A 4WB4A 1KD1Q 2W6AA 2HG5D 1FZGA 3AE8C 4C46A 3VTPC 5HL4A 1J1DB 1SQBK 3JSVC 2WSCH 3JC22 2HLOA 4D6TD 1LTGC 2OYHC 3AE9C 3H1HJ 2OTLP 1AA0A 2SPZA 4XFJA 1JY3P 1ZRTE 3SFEC 5CCGA 3Q1MA 1K9MQ 3RK2C 2XKMA 1GL2D 2H43A 1LT1A 5APQA 1DIPA 1M1JB 4NBFD 1OMIA 4HM0A 3KZIE 1BCCJ 5H2FE 3PHLA 1IFPA 1HH0A 2Q7CA 3TDKA 4UB8H 1KILD 2HR3A 1JY2P 1JTHB 1PP9D 4W7YA 3FWNA 2JO6A 3L70E 1S5LH 1SFCB 1OW7A 3A0BH 4H44B 3RL0D 1S5LX 1L0NJ 3D89A 4WY4B 1SQPE 1DD3A 3KHUA 2QRXA 3H1ID 3D6YA 3D70A 1SQBD 3C8VA 1RHZB 3HUSB 4DCKA 1S9KE 1LT9C 3NXSA 2XV5A 3MHVA 2P67A 2N1TC 1RF0A 1SJGA 1Y9BA 3SFDC 2WSFJ 1KYOI 2FFDA 3WU2E 1DH3A 2K9YA 1HUCA 2CKFA 2KIKA 2GUSA 1ZP0C 2IYOA 3EFGA 3PLNA 2Y9ZA 2XR8A 2PFXA 1P84E 3CXHH 2WT7B 1WQLA 1IFDA 1NVOA 3JCUE 4PJ0E 5B66H 2IBZI 5KJ7A 3AE1C 3H1JE 3GZXA 3L74E 2OQQA 2CPSA 3L75E 3CC2P 1L4AD 4NBBD 5BU8B 2YFLA 3W68A 1N86A 4ASWA 1LT9B 2IBZG 3IF4A 2WZ7A 2FYUG 3VP9A 2H8PD 1M1KQ 4C7RA 3BCCE 1A02F 4EDFA 3KXDA 3H1HE 1URQA 1SQVG 1KQGB 4N6JA 4N78D 2W27A 3SWYA 2P10A 2NUKA 4LGDE 2P7JA 3G71P 2Z4EA 1UUVA 1EDIA 3H32A 3SWKA 1NTKG 1GL2C 4JQ0D 1BCCE 5DJTB 3IN6A 3AE7C 1KB9I 2HPCA 2HMKA 1ZXGA 4L73A 3A0HE 4UB6H 1Q82Q 3V4WA 4WVZA 1W5CE 3V6IA 1ZR4A 1GU4A 3SSUA 2IFMA 2BCCG 2XNXA 3VOPA 3RK3D 3VMID 1L0NE 3OJAB 3I5CA 1KQSO 3TGUG 3GMAA 5M1BA 1NH4A 4QDCA 2LXCB 1FZCB 3H1KE 4L76A 4B86A 2R3CA 1WT6A 1PGJA 3RBZA 5KAFE 1YIJP 2B89A 1FDOA 4HM2A 2O3JA 5AVSB 1NWQA 3B5NB 4GODA 4DOJA 1JM1A 3CX5D 4PD4E 3M0AA 1RE4C 4BRYB 2PAJA 2FYUJ 3MGNA 2HYNA 4M3LA 4OGQC 1VQ7P 4H13D 2V7QJ 1CSBA 1NTZG 1T2KD 2IX7C 3E7KA 1QVGO 4H0LB 4Y99B 1BSHA 1NTKJ 2QJKC 1SVFA 1FAVA 4QDFB 1JO5A 2WVRA 5E79E 1X8YA 3L73D 3LW5H 1L4AC 3CC4P 1LTJA 1W2BO 3ZDMA 2E76C 3L72D 2BCCJ 3D71A 1NDOA 3TGUJ 3VCAA 2L5GB 3CI9A 1NOHA 1ULIA 4DJGA 3GOBA 1GD2E 1LGHB 4OWFA 2JEEA 2ZT9C 1O7MA 4AYCA 3HTKB 1KTMA 1YJWP 4RESB 3IAOA 1YQ4C 2QIWA 3TNUB 2BASA 5APXA 4NBAD 1QL2A 3HRNA 4EIJA 1RF0C 5KLIC 1QGKB 3IR9A 2M8RA 1YJ9P 1H8AA 1G1IA 2FXMA 2QSIA 1GU5A 1NTZJ 1VPCA 2NVFA 2A45H 1SP4A 1EXIA 1KYOE 4NBED 3GL2A 3CCJP 3NMDA 2NPSD 1PZQA 2DE5D 2YXQB 2HODA 1FU1A 3PP5A 1QLED 1Q2NA 1VQ5P 5KJ7C 1MUUA 3E1IA 2YKPA 1SQXG 2HMOA 3GHGA 1JEKA 1N7SB 1NTMJ 2IBZE 3I55P 2R44A 1X79B 1HTLC 1YTZT 5APSA 3A5TA 5AW9B 4LLHA 1ZRTD 4GOFA 1SQVE 2M3EA 2XU6A 2QJPB 2D2CB 5AVRB 1NKZB 2FFDB 1URQC 2K1AA 4WY4D 3L71E 1NTKE 2XDJA 1T2KC 1FBMA 1YITP 1NAFA 2ZYGA 4AUWA 1T3JA 1NU1G 1KFNA 1LJ2A 4JF7A 1ZOYC 2RH0A 1FE6A 1PPJE 3L70D 2V4HA 3CX5H 3WUTA 1G2CA 4OVNF 2BCCE 1SQPD 1KB9E 4QDDA 1FC2C 3TGUE 2NZ2A 1JY3O 4YXWH 2YVJB 1R5SA 1E79H 3ABVC 1JOCA 4WBAA 1S9KD 1IK9A 4Y28J 4HM5A 1KC8Q 1SQXJ 2WSSH 4L74A 5KTBA 2OGUA 3U59A 2B87A 4EI2A 1JY2O 1K8AQ 4YPCA 4YTPC 2YFJA 1BSNA 1W2EA 1KILA 2HPCB 2KS1A 1P84D 1FJPA 1NTZE 2BEZF 5B5EH 1KQLA 1CI6B 3L36A 5KKZC 1RQUA 2VRSA 3H1JD 4I7ZB 2OYIA 3R2PA 5CMZA 3WUUA 1OZHA 3L74D 3L75D 3AEBC 3E1RA 1N73B 2ZYLA 3HE5A 1L0NK 4GOEA 2QE7H 2JZAA 1NU1J 1BE3G 2NPSC 3AE2C 3LIDA 5CJ0A 4R4LA 2E4PA 1PFIA 3RL0g 1RE4A 3C1LA 4GIFA 5CCHD 3WUVA 2M5AB 3O6QA 3BCCD 2P58A 2JP3A 1LTJC 1IFMA 4RJTA 1HGVA 3MP7B 3QWOC 3H6PA 2O1KA 1KORA 4PV1B 2R5DA 1JMMA 5APYA 1S2EA 3Q2YA 2KNCA 1BCCD 1BGYG 4MN4C 1G8JB 5KKZB 2YKOA 3VMYA 2JJLA 4UB8E 3KDPB 3G3ZA 1VL2A 1Q81Q 1LWUA 1X0TA 4U3FG 1VM9A 3A3YB 3FGAD 5BVZA 2C0XA 1L4AA 2LKMA 3A0BE 1DEEG 3TK1A 2XSOA 1HBWA 1MKMA 1O7GA 2FY8A 2E74D 4AAYB 2BEQD 2AXTH 1IO4A 3H1KD 3KPEA 3VMHD 4XE5B 2QA4P 5KLVG 1RY3A 2OYHB 1BE3J 1GZLA 2YMKA 3KZIH 5H2FH 1OXZA 1IJDB 4H0LD 4PD4D 2W6BA 2A45I 3Q3DA 2K9JB 3RK2B 2WPSA 3CWBG 3M9HA 2NWFA 2E5YA 3GHGC 3GB4A 3CCQP 1OW6A 2ZYAA 5CBOA 5AW7B 1Q86Q 2A45G 2A06G 4Z1MH 2QM7A 2WTYA 2M3BA 1XTCC 3FOUA 5APVA 1BGYJ 1RF1A 2OTJP 1NU1E 3AEEC 1EC5A 3LW5J 2AXCA 4HJLA 4U3FJ 5CBNA 3CPWO 4NB9D 3WU2H 3G4SP 1YQ3C 1JMBA 2KZJA 2B24A 5AVWB 4ZKPA 4IFFA 4IL6E 2I1KA 2Y9YA 3V2QA 4I2LC 2N1TB 3FWLA 2FYUK 1LTBC 1P84H 5KLVJ 2YIUC 1SQVK 4C7NA 2K88A 3JCUH 3G9RA 4QMAA 5AW8B 3B8EB 3BRVB 3AEDC 2YFIA 2FYZA 2ZXEB 1Y47A 2E5TA 2PGDA 3CCVP 1TU3F 3CCMP 1NTKK 4IOIH 3AZCA 1R5LA 3CWBJ 3V2PA 4DT0A 1L0LG 1CZQA 1N7SD 2R5BA 4L75A 2KYVA 1OWAA 3GF7A 3K5BA 3N7NA 2IZ0A 2MJZA
chains in the Genus database with same CATH topology
1KTMA 3IAOA 3L72E 2H88C 1YQ4C 2QIWA 4YXDC 2XSHA 4NBAD 1SQXE 2DE7D 1Q90D 4QCKA 2E74C 4EMJB 5KLIC 3VMGD 1NGMB 4NBHD 3D6ZA 3AEFC 1BE3E 4P1CH 2QSIA 4QUPA 2E4QA 1PIXA 1KMIZ 1S1CX 2NVFA 1ULJA 1EXIA 1FDIA 1KYOE 4NBED 2O01J 3CXHE 4PV1C 3GL2A 2FBWC 2DE5D 3H1LE 4NBDD 3EWKA 3VCPA 1FQTA 2E75D 4OGQD 4NB8D 4AIVA 3AECC 3AEGC 3EQQA 2HMOA 1KQFB 3GCEA 1VF5D 1UIXA 2FXPA 2IBZE 4HM3A 2JO1A 1EXJA 1NYHA 3Q5PA 1SQVE 3T97B 3GZYA 4HM7A 2J5UA 4U3FE 2D2CB 3AE8C 2QJYC 5HL4A 3H25A 3L71E 1NTKE 2WQYC 3AE9C 2E76D 3DQYA 1JB0J 3Q5RA 2HMLA 4R4MA 4XFJA 1ZRTE 5CXMA 3SFEC 3Q1MA 1ZOYC 4KT0J 1PPJE 5KLVE 1DIPA 4OGQB 1O7PA 3GL0A 4NBFD 2ZT9D 1OMIA 4HM0A 2BCCE 1KB9E 4QDDA 4IL6X 3TGUE 2NZ2A 3AEAC 2YVJB 3CWBE 3ABVC 3GLMA 1O7WA 2Q3WA 3AE5C 5AEWA 2JO6A 3L70E 1G8KB 1OW7A 4Y28J 4HM5A 1OW8A 3AE3C 4U7JA 2D2CD 4H44B 1S5LX 2A06E 3D89A 1SQPE 1DD3A 2FYNC 1U57A 2G8YA 3D6YA 2E76B 4PV1D 3D70A 4H0LC 3C8VA 4YTPC 2YFJA 1KILE 3Q5SA 1PP9E 1IK7A 1PV3A 2HMJA 1DD4A 1NTZE 2BEZF 2WPVB 5KKZC 4NBCD 1SJGA 1Y9BA 1RQUA 3SFDC 2ZT9B 2WSFJ 4I7ZB 3AEBC 2WSCJ 2BMQA 2K9YA 2ZYLA 2CKFA 2GBWA 3AE4C 2JZAA 3H1IE 2B1XA 2FYUE 3AE2C 2NVEA 1ZP0C 1SQBE 4HM6A 4R4LA 2E4PA 2XR8A 1P84E 3RL0g 3GF3A 2E74B 1WQLA 4H13C 3O6QA 4H44D 2JP3A 1O7NA 3AE1C 3H1JE 2DE6D 1VF5C 3GZXA 3L74E 2OQQA 3L75E 2QPZA 1PL5A 4NBBD 3B71A 2YFLA 5BOKA 1KORA 4PV1B 1L0LE 2BMOA 2XRXA 3Q2YA 1G8JB 2NVGA 3S9OA 3GKEA 3BCCE 3H1HE 3N0QA 1VL2A 1KQGB 1RQVA 2I7FA 1VM9A 2P10A 3FGAD 2NUKA 4HM1A 1HF9A 1VCKA 1UUVA 1NYKA 1SQQE 2XSOA 4QUQA 1EZVE 3R4YA 4GDOA 1MKMA 1BCCE 1UUWA 1O7GA 3IN6A 3AE7C 3GTSA 2E74D 4HM4A 4AAYB 2BEQD 2HMKA 3VMHD 1HJ0A 4HKVA 2NUMA 3AE6C 2HMMA 2YMKA 2GBXA 4H0LD 3GTEA 1Q90C 3VMID 1L0NE 3Q3DA 3GMAA 5M1BA 2QJPC 2D2CC 4RKUJ 2NWFA 2HMNA 4QDCA 3H1KE 1WMKA 3GB4A 1AJYA 1OW6A 1K04A 2G3AA 2WSEJ 2H89C 1FDOA 4HM2A 4Z1MH 4QURA 1JM1A 4PD4E 5AEUA 3FOUA 3RK3E 1O7HA 2E75C 4OGQC 1NTME 4QDFA 4H13D 2IDBA 2V7QJ 3AEEC 1NU1E 2MKVA 3LW5J 1RFSA 3C0DA 4NBGD 4HJLA 4NB9D 1EG9A 1YQ3C 3CX5E 4H0LB 4TT3H 1ZMEC 4P1BH 2B24A 2QJKC 4QDFB 4H44C 1GMJA 1R8EA 3EN1A 2YIUC 3G9RA 3AEDC 2E76C 2YFIA 1RIEA 3D71A 1NDOA 1TU3F 1K05A 3VCAA 2E75B 3AZCA 2BMRA 1ULIA 3GOBA 4H13B 5L8RJ 2ZT9C 1O7MA 4I7ZC 1VF5B 3L73E 3GF7A 4HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  5CXM A;  1WQL A;  4H13 C;  3L72 E;  1PPJ E;  5KLV E;  4H44 D;  4HM2 A;  1O7N A;  2XSH A;  3H1J E;  2DE6 D;  1VF5 C;  4NBA D;  3GZX A;  3L74 E;  3L75 E;  1SQX E;  2DE7 D;  2QPZ A;  1O7P A;  4QCK A;  3GL0 A;  4QUR A;  4NBF D;  1JM1 A;  2ZT9 D;  4PD4 E;  2E74 C;  4NBB D;  4EMJ B;  4HM0 A;  5KLI C;  5AEU A;  2BCC E;  3VMG D;  4NBH D;  2YFL A;  3FOU A;  1KB9 E;  4QDD A;  5BOK A;  1BE3 E;  3TGU E;  1O7H A;  2E75 C;  4OGQ C;  1L0L E;  4P1C H;  2YVJ B;  1NTM E;  3CWB E;  4QDF A;  2BMO A;  2XRX A;  4H13 D;  4QUP A;  2E4Q A;  1NU1 E;  2NVF A;  1ULJ A;  1G8J B;  1O7W A;  2NVG A;  1KYO E;  2Q3W A;  1RFS A;  3C0D A;  4NBG D;  4HJL A;  4NBE D;  5AEW A;  3CXH E;  4PV1 C;  3GKE A;  3GL2 A;  3BCC E;  2JO6 A;  3L70 E;  4NB9 D;  3H1H E;  2DE5 D;  1G8K B;  3N0Q A;  1EG9 A;  3H1L E;  4NBD D;  4HM5 A;  3VCP A;  2D2C D;  1FQT A;  2A06 E;  3CX5 E;  2I7F A;  1VM9 A;  2E75 D;  4OGQ D;  4NB8 D;  4P1B H;  2B24 A;  2NUK A;  2QJK C;  4AIV A;  3D89 A;  1SQP E;  4HM1 A;  3EQQ A;  1VCK A;  2FYN C;  2HMO A;  4QDF B;  1UUV A;  1NYK A;  1SQQ E;  2XSO A;  3GCE A;  4H44 C;  4QUQ A;  1VF5 D;  4PV1 D;  1EZV E;  4H0L C;  1BCC E;  1UUW A;  2YFJ A;  2IBZ E;  4HM3 A;  1O7G A;  3EN1 A;  3GTS A;  2E74 D;  4HM4 A;  4AAY B;  1PP9 E;  2HMK A;  2YIU C;  2HMJ A;  3VMH D;  1NTZ E;  1SQV E;  2E76 C;  5KKZ C;  2YFI A;  4HKV A;  4NBC D;  3GZY A;  1SJG A;  4HM7 A;  2NUM A;  1RIE A;  4U3F E;  2HMM A;  1NDO A;  2YMK A;  2QJY C;  3VCA A;  2BMQ A;  5HL4 A;  2ZYL A;  2GBX A;  4H0L D;  2CKF A;  2GBW A;  3AZC A;  2BMR A;  1ULI A;  2JZA A;  3GOB A;  3GTE A;  3H1I E;  1Q90 C;  1NTK E;  2B1X A;  2FYU E;  1L0N E;  3L71 E;  2NVE A;  3VMI D;  1SQB E;  2ZT9 C;  1O7M A;  4I7Z C;  2QJP C;  4HM6 A;  2D2C C;  2NWF A;  3L73 E;  2E76 D;  2E4P A;  3DQY A;  2HMN A;  2XR8 A;  4QDC A;  3H1K E;  2HML A;  3GB4 A;  1P84 E;  4HM8 A; 
#chains in the Genus database with same CATH topology
 1GW4 A;  5AW3 B;  1KYO D;  1PGO A;  1EZV I;  2YNY A;  1H0T B;  2H88 C;  1KIL C;  2PP6 A;  2W90 A;  2DE7 D;  3A7O A;  1Q90 D;  2Q1K A;  2QG4 A;  2KSJ A;  4HYT B;  2E74 C;  2L91 A;  1G2C B;  1NKN A;  1IC2 A;  1NGM B;  3D6Z A;  2OYI C;  1UII A;  3RL0 C;  1BE3 E;  3P8M C;  1NO4 A;  1SQQ G;  4P1C H;  1EZV G;  1VQ8 P;  3HD7 D;  1N7L A;  2E4Q A;  5AW5 B;  2IBZ D;  1ULJ A;  3MZW B;  3A0H H;  1LP1 B;  1OFC X;  1XTG B;  1SQV D;  3GG2 A;  2P1J A;  1GL2 B;  2ITA A;  1FQT A;  2E75 D;  3L72 G;  2K37 A;  5AW6 B;  2LR2 A;  5KAI E;  3L71 D;  1NTK D;  1VF5 D;  1BGY E;  1J1E C;  1NTZ K;  5KAF H;  2KOG A;  2O01 H;  1S3J A;  1NYH A;  2NPS A;  2OYO A;  3GZY A;  5GTH E;  1PPJ D;  4JBZ A;  4PD4 H;  4U3F E;  1KV4 A;  2M0B A;  2QJY C;  1L0L J;  3H25 A;  2WSF H;  3NTN A;  1M1J A;  1LWU C;  2BCC D;  1YBK A;  1KB9 D;  1NTM G;  1JUN A;  1JM0 A;  2Q5U A;  1JB0 J;  5AVX B;  3Q5R A;  2HML A;  3CMA P;  4R4M A;  1JTH A;  4KT0 J;  4BXL A;  5KLV E;  4HJG H;  3PH0 A;  4OGQ B;  3PRJ A;  2Y0C A;  4JYC A;  1SQQ J;  3VMX A;  4WY4 A;  1YYC A;  5K5G B;  2LXB A;  3AEA C;  3CWB E;  3L73 J;  2RMZ A;  1PGP A;  3CCL P;  4IFM A;  2KNC B;  3GLM A;  4BWN A;  2E42 A;  2Q3W A;  1IFN A;  2QJK B;  3AE5 C;  3HUS A;  2J58 A;  2WWW A;  3L72 J;  1NTZ D;  2QJY B;  3TYY A;  3W67 A;  2KP8 A;  1OW8 A;  2Z5I A;  3CC7 P;  2A06 E;  2YO2 A;  1VQL P;  1YTZ I;  1L4A B;  2FYN C;  2WIT A;  3MUD C;  2KLV A;  2E76 B;  4PV1 D;  1GW3 A;  1VQ4 P;  2XZR A;  1D7M A;  4NPE A;  3CD6 P;  4HB1 A;  3CLQ A;  5DJU B;  4N3Y B;  1RF1 C;  3P7K A;  3RK3 C;  2ZYD A;  1OX3 A;  1NJI Q;  4A7P A;  4AQR D;  2WT7 A;  1FOS E;  2ZT9 B;  4HH2 A;  4K35 A;  1SQX K;  2N9B A;  3HD7 C;  3CXH I;  2WSC J;  1ZN5 A;  2BMQ A;  2YO3 A;  3AE4 C;  3USS A;  3L35 A;  2B1X A;  3BVH A;  2FYU E;  2NVE A;  1SQP G;  4HM6 A;  1KYO H;  3M9Q A;  3GF3 A;  2FKW B;  5KLI B;  1SLQ A;  1SFC D;  4H13 C;  4ZMD A;  4H44 D;  1O7N A;  2WPQ A;  3H1L G;  1VF5 C;  3KQG A;  2QPZ A;  5GTI E;  4HKZ H;  2K3R A;  3F5H A;  3B71 A;  1MV8 A;  2I1J A;  1L0L E;  1NU1 K;  2BMO A;  3RK2 D;  1T8Z A;  2FXO A;  3S9O A;  3GKE A;  2V7Q H;  3TSI A;  5CCH A;  3N0Q A;  4EYY Q;  1RQV A;  1M56 D;  1QVF O;  2Y0E A;  3L75 G;  1J2J B;  3V2R A;  1SQQ E;  3BAS A;  1H89 A;  1HVV A;  4QUQ A;  1EZV E;  1UUW A;  2WMM A;  4HM4 A;  1USE A;  1T3U A;  1URQ B;  4C7N B;  1FZC A;  1HJ0 A;  1RE3 A;  4K3A A;  1OIP A;  2Q6Q A;  1USD A;  3AE6 C;  2HMM A;  2J59 M;  5B5E E;  1SQP J;  3H32 B;  1KB9 H;  2Z5H A;  4D6T G;  2Q3I A;  2OTK E;  3C9I A;  4BRY A;  2R32 A;  2N1T D;  4RKU J;  2C9L Y;  3IFM A;  1WMK A;  3H1L J;  3P8C E;  1NU1 D;  1J1D C;  1AJY A;  1K04 A;  4W7Z A;  5AW2 B;  3F89 A;  1T6A A;  3V4Q A;  2KSE A;  3U1A A;  5TIS H;  5AEU A;  3B4S A;  3FXE A;  4ZKU A;  1VQ6 P;  1O7H A;  3QH9 A;  1NTM E;  4QDF A;  1M1J C;  2IDB A;  3FXD A;  1AQ5 A;  1MZ9 A;  2KUB A;  1PP9 G;  1KN7 A;  3C0D A;  3H1H D;  5EFW B;  1ZLL A;  2WSE H;  3H1J J;  1U7J A;  3L75 J;  1JY3 N;  2AEJ A;  3SWF A;  1ZME C;  4TT3 H;  4P1B H;  3BRT B;  1FZE A;  3OA7 A;  2YXR B;  2QVA A;  1SFC C;  4WWI A;  3H1I G;  4H44 C;  3CCR P;  1SQB G;  1GMJ A;  1R8E A;  4WY4 C;  4RO0 A;  3EN1 A;  1PGQ A;  1OVV A;  3BCC J;  1HWT C;  3HTK A;  1JY2 N;  1N2D C;  2NPS B;  1S5L E;  2AXT E;  1AVY A;  3B5N D;  3HUS C;  4D6T J;  1FOS F;  3TNU A;  2JR8 A;  2KLU A;  3L37 A;  2IZ1 A;  2RKL A;  5APW A;  1L0N D;  4JPZ B;  1BE3 D;  1LTJ B;  5AVT B;  3EFF K;  2W83 C;  2GM4 A;  5KLV K;  3CCU P;  5TJH A;  3CME P;  5APU A;  4YXD C;  2XSH A;  1SQX E;  3FX0 A;  1BDC A;  1LNQ A;  4EMJ B;  2KI7 B;  3KYQ A;  2Y0D A;  3VMG D;  4I1L A;  1ZW0 A;  3AEF C;  3O8Z A;  1PP9 J;  1N7S A;  3H1K J;  1KMI Z;  1S1C X;  1KZU B;  1X9V A;  1BGY D;  1FDI A;  1VQK P;  2O01 J;  3CXH E;  1GTW A;  1JCD A;  1QEX A;  3H1L E;  3EWK A;  3MUD A;  3VCP A;  2IYP A;  5B66 E;  3H1I J;  1ZV8 A;  4OGQ D;  4NB8 D;  4U3F D;  1SQB J;  2H7H A;  1IFI A;  1KQF B;  3M0D A;  4TLF A;  3L4F A;  2AEF A;  4HM3 A;  3HD7 A;  1FZB A;  5CCG D;  2HOD B;  1M8O B;  3N4X A;  1QX8 A;  1LTT C;  1VQN P;  5KLV D;  3U1C A;  1AVO A;  2J5U A;  3NFQ A;  3M9B A;  2PRR A;  5CCH C;  4KHX A;  3GHG B;  2KXP B;  3TF5 A;  1U7M A;  4ASV A;  4EOT A;  1MFZ A;  3CX5 I;  2WQY C;  3WMM 0;  1FZF A;  2E76 D;  2I8D A;  3CWB D;  1AV1 A;  4PJ0 H;  3CCS P;  3DQY A;  1FS0 E;  5CXM A;  1G1J A;  1Y8A A;  1JNM A;  1SS1 A;  4UB6 E;  1FZC C;  3OAK A;  1RE3 C;  1O7P A;  3GL0 A;  2A06 D;  2ZT9 D;  3ITK A;  2ZAE B;  4IL6 H;  1L0L K;  1FDM A;  4D6T E;  4IL6 X;  3I56 P;  3B5N C;  4LC1 A;  1OVU A;  3L71 G;  1O7W A;  5AEW A;  3HE4 A;  1G8K B;  2W6J H;  1VQO P;  3AE3 C;  1VQP P;  4U7J A;  2D2C D;  1CI6 A;  4HM8 A;  1X22 A;  1PPJ G;  5APT A;  2POH A;  1DEB A;  1SQQ K;  2YIU B;  1N73 A;  1U57 A;  2G8Y A;  2FYU D;  4H0L C;  4Y99 C;  1KFM A;  1EDL A;  1KIL E;  3S1K A;  3L73 G;  1VQM P;  3VYI A;  3Q5S A;  3PJS K;  1E5W A;  1PP9 E;  1IK7 A;  1PV3 A;  2HMJ A;  1RH5 B;  1DD4 A;  3V2N A;  5BU5 A;  2WPV B;  3T97 A;  5KJ7 D;  4NBC D;  1LTS C;  2M5A A;  3MIW A;  3VMA A;  1Z56 A;  2B87 B;  2GBW A;  2YMY A;  1M57 D;  2B9B A;  3H1I E;  3PTZ A;  1SQB E;  1L0L D;  1KIL B;  2KS1 B;  4OH8 B;  4O9B A;  2C9N Y;  1NHL A;  2E74 B;  2AEM A;  2DW3 A;  1SQV J;  1URQ D;  2OYI B;  3RL0 B;  2DE6 D;  4IFD K;  1AQT A;  3HE5 B;  4NPD A;  1PL5 A;  2JWA A;  1VDF A;  5KAI H;  5CCG C;  3TGU D;  5CJ4 A;  3L71 J;  1NTM K;  5BOK A;  5AVQ B;  3GW6 A;  2Q9I A;  1LTA C;  1BDD A;  1SQQ D;  5AW1 B;  1HGZ A;  2XRX A;  1EZV D;  4CPG A;  2NVG A;  4ZNC A;  3O6Q B;  2QEX P;  1YHQ P;  1SFC A;  2ZVN B;  5GTH H;  2C0W A;  3RBX A;  2RN0 A;  3S4R A;  2I7F A;  2CK3 H;  2ZVO B;  5AW0 B;  2OYH A;  1J1E B;  4HM1 A;  5E79 H;  1HF9 A;  2GUV A;  1VCK A;  2CPB A;  3BAT A;  1NYK A;  3R4Y A;  4GDO A;  5AVZ B;  5C39 A;  2N9Y B;  2K9J A;  3GTS A;  3OW2 O;  3P8C D;  1OVR A;  1ZR2 A;  1N7S C;  1LWU B;  2GA1 A;  2YKQ A;  4HKV A;  1H88 A;  2NUM A;  4N78 E;  1IZN B;  3MTU E;  4GT1 A;  1N8R Q;  2GBX A;  2UWJ E;  1WRG A;  3GTE A;  2KK7 A;  1Q90 C;  2JDI H;  1A02 J;  5AW4 B;  2QJP C;  4I6M C;  2D2C C;  2FFD C;  1NTM D;  2JKV A;  2HMN A;  2QM8 A;  3M0D C;  3M91 A;  3V5B A;  2G3A A;  3L70 G;  2WSE J;  2H89 C;  4GKG A;  3VP8 A;  3M06 A;  4QUR A;  1FJK A;  1FZA A;  4XA4 A;  2HFE D;  1SQP K;  3RK3 E;  1LT9 A;  2E75 C;  2ZFC A;  1L2P A;  2N1T A;  1Q7Y Q;  3UIA A;  1EDJ A;  2MKV A;  1AFO A;  1RFS A;  4NBG D;  1JCC A;  2NRG A;  2ZXX A;  2FYN B;  1EG9 A;  5AVU B;  1EDK A;  1IFJ A;  1MFT A;  1P84 I;  3CX5 E;  3VN0 A;  1CW5 A;  2KZI A;  1RF1 B;  1LTI C;  3RK3 B;  3CCE P;  2OAR A;  1GK4 A;  3RGU A;  3P32 A;  1GK6 A;  1YJN P;  1NAY A;  3HD7 B;  2O1J A;  1YI2 P;  2IFN A;  2Q3E A;  2IPP A;  1S4X A;  3G6E P;  5GTI H;  3H1J G;  1RIE A;  1H0T A;  3L74 G;  1SQX D;  1K05 A;  3EQ2 A;  2E43 A;  2E75 B;  2BMR A;  4W80 A;  5CHX A;  4H13 B;  1GDT A;  5L8R J;  4I7Z C;  3VMZ A;  1VF5 B;  3L70 J;  3L73 E;  1N73 C;  3MD0 A;  1M7L A;  2W8Z A;  3BCC G;  3CXH D;  3L72 E;  5AVY B;  1LP1 A;  3H1H G;  3A2A A;  3H1L D;  2O01 N;  2ZJS E;  3B5N A;  4QCK A;  3LIE A;  1GL2 A;  1K73 Q;  4NBH D;  5TIS E;  1VQ9 P;  2XND H;  1M90 Q;  4KJM A;  4QUP A;  1BCC G;  2R3S A;  2JWD A;  1PIX A;  4JYB A;  1S72 P;  4PV1 C;  1EQ7 A;  2WPR A;  4NPF X;  2FBW C;  3HE4 B;  1HJB A;  4NBD D;  3II6 A;  2P2U A;  4AIV A;  1QL1 A;  3AEC C;  1DX7 A;  3AEG C;  3EQQ A;  3GCE A;  1L0N G;  1UIX A;  4PD4 I;  2FXP A;  2B88 A;  2JO1 A;  1EXJ A;  3CL3 D;  5AVV B;  3H1K G;  2KB7 P;  3L74 J;  3Q5P A;  3T97 B;  4DZO A;  4HM7 A;  4WB4 A;  1KD1 Q;  2W6A A;  2HG5 D;  1FZG A;  3AE8 C;  4C46 A;  3VTP C;  5HL4 A;  1J1D B;  1SQB K;  3JSV C;  2WSC H;  3JC2 2;  2HLO A;  4D6T D;  1LTG C;  2OYH C;  3AE9 C;  3H1H J;  2OTL P;  1AA0 A;  2SPZ A;  4XFJ A;  1JY3 P;  1ZRT E;  3SFE C;  5CCG A;  3Q1M A;  1K9M Q;  3RK2 C;  2XKM A;  1GL2 D;  2H43 A;  1LT1 A;  5APQ A;  1DIP A;  1M1J B;  4NBF D;  1OMI A;  4HM0 A;  3KZI E;  1BCC J;  5H2F E;  3PHL A;  1IFP A;  1HH0 A;  2Q7C A;  3TDK A;  4UB8 H;  1KIL D;  2HR3 A;  1JY2 P;  1JTH B;  1PP9 D;  4W7Y A;  3FWN A;  2JO6 A;  3L70 E;  1S5L H;  1SFC B;  1OW7 A;  3A0B H;  4H44 B;  3RL0 D;  1S5L X;  1L0N J;  3D89 A;  4WY4 B;  1SQP E;  1DD3 A;  3KHU A;  2QRX A;  3H1I D;  3D6Y A;  3D70 A;  1SQB D;  3C8V A;  1RHZ B;  3HUS B;  4DCK A;  1S9K E;  1LT9 C;  3NXS A;  2XV5 A;  3MHV A;  2P67 A;  2N1T C;  1RF0 A;  1SJG A;  1Y9B A;  3SFD C;  2WSF J;  1KYO I;  2FFD A;  3WU2 E;  1DH3 A;  2K9Y A;  1HUC A;  2CKF A;  2KIK A;  2GUS A;  1ZP0 C;  2IYO A;  3EFG A;  3PLN A;  2Y9Z A;  2XR8 A;  2PFX A;  1P84 E;  3CXH H;  2WT7 B;  1WQL A;  1IFD A;  1NVO A;  3JCU E;  4PJ0 E;  5B66 H;  2IBZ I;  5KJ7 A;  3AE1 C;  3H1J E;  3GZX A;  3L74 E;  2OQQ A;  2CPS A;  3L75 E;  3CC2 P;  1L4A D;  4NBB D;  5BU8 B;  2YFL A;  3W68 A;  1N86 A;  4ASW A;  1LT9 B;  2IBZ G;  3IF4 A;  2WZ7 A;  2FYU G;  3VP9 A;  2H8P D;  1M1K Q;  4C7R A;  3BCC E;  1A02 F;  4EDF A;  3KXD A;  3H1H E;  1URQ A;  1SQV G;  1KQG B;  4N6J A;  4N78 D;  2W27 A;  3SWY A;  2P10 A;  2NUK A;  4LGD E;  2P7J A;  3G71 P;  2Z4E A;  1UUV A;  1EDI A;  3H32 A;  3SWK A;  1NTK G;  1GL2 C;  4JQ0 D;  1BCC E;  5DJT B;  3IN6 A;  3AE7 C;  1KB9 I;  2HPC A;  2HMK A;  1ZXG A;  4L73 A;  3A0H E;  4UB6 H;  1Q82 Q;  3V4W A;  4WVZ A;  1W5C E;  3V6I A;  1ZR4 A;  1GU4 A;  3SSU A;  2IFM A;  2BCC G;  2XNX A;  3VOP A;  3RK3 D;  3VMI D;  1L0N E;  3OJA B;  3I5C A;  1KQS O;  3TGU G;  3GMA A;  5M1B A;  1NH4 A;  4QDC A;  2LXC B;  1FZC B;  3H1K E;  4L76 A;  4B86 A;  2R3C A;  1WT6 A;  1PGJ A;  3RBZ A;  5KAF E;  1YIJ P;  2B89 A;  1FDO A;  4HM2 A;  2O3J A;  5AVS B;  1NWQ A;  3B5N B;  4GOD A;  4DOJ A;  1JM1 A;  3CX5 D;  4PD4 E;  3M0A A;  1RE4 C;  4BRY B;  2PAJ A;  2FYU J;  3MGN A;  2HYN A;  4M3L A;  4OGQ C;  1VQ7 P;  4H13 D;  2V7Q J;  1CSB A;  1NTZ G;  1T2K D;  2IX7 C;  3E7K A;  1QVG O;  4H0L B;  4Y99 B;  1BSH A;  1NTK J;  2QJK C;  1SVF A;  1FAV A;  4QDF B;  1JO5 A;  2WVR A;  5E79 E;  1X8Y A;  3L73 D;  3LW5 H;  1L4A C;  3CC4 P;  1LTJ A;  1W2B O;  3ZDM A;  2E76 C;  3L72 D;  2BCC J;  3D71 A;  1NDO A;  3TGU J;  3VCA A;  2L5G B;  3CI9 A;  1NOH A;  1ULI A;  4DJG A;  3GOB A;  1GD2 E;  1LGH B;  4OWF A;  2JEE A;  2ZT9 C;  1O7M A;  4AYC A;  3HTK B;  1KTM A;  1YJW P;  4RES B;  3IAO A;  1YQ4 C;  2QIW A;  3TNU B;  2BAS A;  5APX A;  4NBA D;  1QL2 A;  3HRN A;  4EIJ A;  1RF0 C;  5KLI C;  1QGK B;  3IR9 A;  2M8R A;  1YJ9 P;  1H8A A;  1G1I A;  2FXM A;  2QSI A;  1GU5 A;  1NTZ J;  1VPC A;  2NVF A;  2A45 H;  1SP4 A;  1EXI A;  1KYO E;  4NBE D;  3GL2 A;  3CCJ P;  3NMD A;  2NPS D;  1PZQ A;  2DE5 D;  2YXQ B;  2HOD A;  1FU1 A;  3PP5 A;  1QLE D;  1Q2N A;  1VQ5 P;  5KJ7 C;  1MUU A;  3E1I A;  2YKP A;  1SQX G;  2HMO A;  3GHG A;  1JEK A;  1N7S B;  1NTM J;  2IBZ E;  3I55 P;  2R44 A;  1X79 B;  1HTL C;  1YTZ T;  5APS A;  3A5T A;  5AW9 B;  4LLH A;  1ZRT D;  4GOF A;  1SQV E;  2M3E A;  2XU6 A;  2QJP B;  2D2C B;  5AVR B;  1NKZ B;  2FFD B;  1URQ C;  2K1A A;  4WY4 D;  3L71 E;  1NTK E;  2XDJ A;  1T2K C;  1FBM A;  1YIT P;  1NAF A;  2ZYG A;  4AUW A;  1T3J A;  1NU1 G;  1KFN A;  1LJ2 A;  4JF7 A;  1ZOY C;  2RH0 A;  1FE6 A;  1PPJ E;  3L70 D;  2V4H A;  3CX5 H;  3WUT A;  1G2C A;  4OVN F;  2BCC E;  1SQP D;  1KB9 E;  4QDD A;  1FC2 C;  3TGU E;  2NZ2 A;  1JY3 O;  4YXW H;  2YVJ B;  1R5S A;  1E79 H;  3ABV C;  1JOC A;  4WBA A;  1S9K D;  1IK9 A;  4Y28 J;  4HM5 A;  1KC8 Q;  1SQX J;  2WSS H;  4L74 A;  5KTB A;  2OGU A;  3U59 A;  2B87 A;  4EI2 A;  1JY2 O;  1K8A Q;  4YPC A;  4YTP C;  2YFJ A;  1BSN A;  1W2E A;  1KIL A;  2HPC B;  2KS1 A;  1P84 D;  1FJP A;  1NTZ E;  2BEZ F;  5B5E H;  1KQL A;  1CI6 B;  3L36 A;  5KKZ C;  1RQU A;  2VRS A;  3H1J D;  4I7Z B;  2OYI A;  3R2P A;  5CMZ A;  3WUU A;  1OZH A;  3L74 D;  3L75 D;  3AEB C;  3E1R A;  1N73 B;  2ZYL A;  3HE5 A;  1L0N K;  4GOE A;  2QE7 H;  2JZA A;  1NU1 J;  1BE3 G;  2NPS C;  3AE2 C;  3LID A;  5CJ0 A;  4R4L A;  2E4P A;  1PFI A;  3RL0 g;  1RE4 A;  3C1L A;  4GIF A;  5CCH D;  3WUV A;  2M5A B;  3O6Q A;  3BCC D;  2P58 A;  2JP3 A;  1LTJ C;  1IFM A;  4RJT A;  1HGV A;  3MP7 B;  3QWO C;  3H6P A;  2O1K A;  1KOR A;  4PV1 B;  2R5D A;  1JMM A;  5APY A;  1S2E A;  3Q2Y A;  2KNC A;  1BCC D;  1BGY G;  4MN4 C;  1G8J B;  5KKZ B;  2YKO A;  3VMY A;  2JJL A;  4UB8 E;  3KDP B;  3G3Z A;  1VL2 A;  1Q81 Q;  1LWU A;  1X0T A;  4U3F G;  1VM9 A;  3A3Y B;  3FGA D;  5BVZ A;  2C0X A;  1L4A A;  2LKM A;  3A0B E;  1DEE G;  3TK1 A;  2XSO A;  1HBW A;  1MKM A;  1O7G A;  2FY8 A;  2E74 D;  4AAY B;  2BEQ D;  2AXT H;  1IO4 A;  3H1K D;  3KPE A;  3VMH D;  4XE5 B;  2QA4 P;  5KLV G;  1RY3 A;  2OYH B;  1BE3 J;  1GZL A;  2YMK A;  3KZI H;  5H2F H;  1OXZ A;  1IJD B;  4H0L D;  4PD4 D;  2W6B A;  2A45 I;  3Q3D A;  2K9J B;  3RK2 B;  2WPS A;  3CWB G;  3M9H A;  2NWF A;  2E5Y A;  3GHG C;  3GB4 A;  3CCQ P;  1OW6 A;  2ZYA A;  5CBO A;  5AW7 B;  1Q86 Q;  2A45 G;  2A06 G;  4Z1M H;  2QM7 A;  2WTY A;  2M3B A;  1XTC C;  3FOU A;  5APV A;  1BGY J;  1RF1 A;  2OTJ P;  1NU1 E;  3AEE C;  1EC5 A;  3LW5 J;  2AXC A;  4HJL A;  4U3F J;  5CBN A;  3CPW O;  4NB9 D;  3WU2 H;  3G4S P;  1YQ3 C;  1JMB A;  2KZJ A;  2B24 A;  5AVW B;  4ZKP A;  4IFF A;  4IL6 E;  2I1K A;  2Y9Y A;  3V2Q A;  4I2L C;  2N1T B;  3FWL A;  2FYU K;  1LTB C;  1P84 H;  5KLV J;  2YIU C;  1SQV K;  4C7N A;  2K88 A;  3JCU H;  3G9R A;  4QMA A;  5AW8 B;  3B8E B;  3BRV B;  3AED C;  2YFI A;  2FYZ A;  2ZXE B;  1Y47 A;  2E5T A;  2PGD A;  3CCV P;  1TU3 F;  3CCM P;  1NTK K;  4IOI H;  3AZC A;  1R5L A;  3CWB J;  3V2P A;  4DT0 A;  1L0L G;  1CZQ A;  1N7S D;  2R5B A;  4L75 A;  2KYV A;  1OWA A;  3GF7 A;  3K5B A;  3N7N A;  2IZ0 A;  2MJZ A; 
#chains in the Genus database with same CATH homology
 1KTM A;  3IAO A;  3L72 E;  2H88 C;  1YQ4 C;  2QIW A;  4YXD C;  2XSH A;  4NBA D;  1SQX E;  2DE7 D;  1Q90 D;  4QCK A;  2E74 C;  4EMJ B;  5KLI C;  3VMG D;  1NGM B;  4NBH D;  3D6Z A;  3AEF C;  1BE3 E;  4P1C H;  2QSI A;  4QUP A;  2E4Q A;  1PIX A;  1KMI Z;  1S1C X;  2NVF A;  1ULJ A;  1EXI A;  1FDI A;  1KYO E;  4NBE D;  2O01 J;  3CXH E;  4PV1 C;  3GL2 A;  2FBW C;  2DE5 D;  3H1L E;  4NBD D;  3EWK A;  3VCP A;  1FQT A;  2E75 D;  4OGQ D;  4NB8 D;  4AIV A;  3AEC C;  3AEG C;  3EQQ A;  2HMO A;  1KQF B;  3GCE A;  1VF5 D;  1UIX A;  2FXP A;  2IBZ E;  4HM3 A;  2JO1 A;  1EXJ A;  1NYH A;  3Q5P A;  1SQV E;  3T97 B;  3GZY A;  4HM7 A;  2J5U A;  4U3F E;  2D2C B;  3AE8 C;  2QJY C;  5HL4 A;  3H25 A;  3L71 E;  1NTK E;  2WQY C;  3AE9 C;  2E76 D;  3DQY A;  1JB0 J;  3Q5R A;  2HML A;  4R4M A;  4XFJ A;  1ZRT E;  5CXM A;  3SFE C;  3Q1M A;  1ZOY C;  4KT0 J;  1PPJ E;  5KLV E;  1DIP A;  4OGQ B;  1O7P A;  3GL0 A;  4NBF D;  2ZT9 D;  1OMI A;  4HM0 A;  2BCC E;  1KB9 E;  4QDD A;  4IL6 X;  3TGU E;  2NZ2 A;  3AEA C;  2YVJ B;  3CWB E;  3ABV C;  3GLM A;  1O7W A;  2Q3W A;  3AE5 C;  5AEW A;  2JO6 A;  3L70 E;  1G8K B;  1OW7 A;  4Y28 J;  4HM5 A;  1OW8 A;  3AE3 C;  4U7J A;  2D2C D;  4H44 B;  1S5L X;  2A06 E;  3D89 A;  1SQP E;  1DD3 A;  2FYN C;  1U57 A;  2G8Y A;  3D6Y A;  2E76 B;  4PV1 D;  3D70 A;  4H0L C;  3C8V A;  4YTP C;  2YFJ A;  1KIL E;  3Q5S A;  1PP9 E;  1IK7 A;  1PV3 A;  2HMJ A;  1DD4 A;  1NTZ E;  2BEZ F;  2WPV B;  5KKZ C;  4NBC D;  1SJG A;  1Y9B A;  1RQU A;  3SFD C;  2ZT9 B;  2WSF J;  4I7Z B;  3AEB C;  2WSC J;  2BMQ A;  2K9Y A;  2ZYL A;  2CKF A;  2GBW A;  3AE4 C;  2JZA A;  3H1I E;  2B1X A;  2FYU E;  3AE2 C;  2NVE A;  1ZP0 C;  1SQB E;  4HM6 A;  4R4L A;  2E4P A;  2XR8 A;  1P84 E;  3RL0 g;  3GF3 A;  2E74 B;  1WQL A;  4H13 C;  3O6Q A;  4H44 D;  2JP3 A;  1O7N A;  3AE1 C;  3H1J E;  2DE6 D;  1VF5 C;  3GZX A;  3L74 E;  2OQQ A;  3L75 E;  2QPZ A;  1PL5 A;  4NBB D;  3B71 A;  2YFL A;  5BOK A;  1KOR A;  4PV1 B;  1L0L E;  2BMO A;  2XRX A;  3Q2Y A;  1G8J B;  2NVG A;  3S9O A;  3GKE A;  3BCC E;  3H1H E;  3N0Q A;  1VL2 A;  1KQG B;  1RQV A;  2I7F A;  1VM9 A;  2P10 A;  3FGA D;  2NUK A;  4HM1 A;  1HF9 A;  1VCK A;  1UUV A;  1NYK A;  1SQQ E;  2XSO A;  4QUQ A;  1EZV E;  3R4Y A;  4GDO A;  1MKM A;  1BCC E;  1UUW A;  1O7G A;  3IN6 A;  3AE7 C;  3GTS A;  2E74 D;  4HM4 A;  4AAY B;  2BEQ D;  2HMK A;  3VMH D;  1HJ0 A;  4HKV A;  2NUM A;  3AE6 C;  2HMM A;  2YMK A;  2GBX A;  4H0L D;  3GTE A;  1Q90 C;  3VMI D;  1L0N E;  3Q3D A;  3GMA A;  5M1B A;  2QJP C;  2D2C C;  4RKU J;  2NWF A;  2HMN A;  4QDC A;  3H1K E;  1WMK A;  3GB4 A;  1AJY A;  1OW6 A;  1K04 A;  2G3A A;  2WSE J;  2H89 C;  1FDO A;  4HM2 A;  4Z1M H;  4QUR A;  1JM1 A;  4PD4 E;  5AEU A;  3FOU A;  3RK3 E;  1O7H A;  2E75 C;  4OGQ C;  1NTM E;  4QDF A;  4H13 D;  2IDB A;  2V7Q J;  3AEE C;  1NU1 E;  2MKV A;  3LW5 J;  1RFS A;  3C0D A;  4NBG D;  4HJL A;  4NB9 D;  1EG9 A;  1YQ3 C;  3CX5 E;  4H0L B;  4TT3 H;  1ZME C;  4P1B H;  2B24 A;  2QJK C;  4QDF B;  4H44 C;  1GMJ A;  1R8E A;  3EN1 A;  2YIU C;  3G9R A;  3AED C;  2E76 C;  2YFI A;  1RIE A;  3D71 A;  1NDO A;  1TU3 F;  1K05 A;  3VCA A;  2E75 B;  3AZC A;  2BMR A;  1ULI A;  3GOB A;  4H13 B;  5L8R J;  2ZT9 C;  1O7M A;  4I7Z C;  1VF5 B;  3L73 E;  3GF7 A;  4HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...