4H44D

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 27
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4h44D02
2HMMA 2I7FA 1SQXE 2NUKA 3C0DA 4NBBD 4NB8D 4QDFB 1NTZE 2YVJB 1O7GA 2FYNC 5AEUA 3VCPA 3EN1A 2E74D 1SJGA 3H1KE 2NVGA 2ZT9D 4NBHD 1ZRTE 4H44C 2E76C 3D89A 2B24A 2XRXA 1L0NE 4H44D 3L71E 4HM7A 3VMGD 1EG9A 3GTSA 4QDFA 2E74C 1RFSA 1VM9A 4P1BH 2NVEA 1KYOE 2GBWA 2E4QA 2QJKC 3L70E 4PV1D 2A06E 2GBXA 4HM0A 4QDDA 5CXMA 1O7PA 2E4PA 3H1IE 1KB9E 2DE5D 2HMLA 2HMOA 2QJPC 4P1CH 4NB9D 4NBFD 3CWBE 4HM6A 3GTEA 1RIEA 1SQPE 2CKFA 2HMNA 2NUMA 1NDOA 1ULJA 3GB4A 3GZYA 2IBZE 4EMJB 5KLIC 4PD4E 3H1LE 2BMRA 3GOBA 3EQQA 5AEWA 3L72E 4QDCA 2YFLA 4QUPA 4OGQC 4QURA 1PP9E 4PV1C 3VMHD 2XSOA 5BOKA 4HM8A 3FOUA 1NYKA 4NBGD 3GZXA 4AAYB 4HM1A 3L73E 4HM4A 2HMKA 1G8JB 2YFIA 3GCEA 3L74E 1L0LE 4HM2A 1Q90C 3GKEA 1PPJE 1WQLA 1UUWA 1JM1A 2DE6D 1BCCE 1NU1E 1O7WA 3DQYA 3TGUE 2ZT9C 2YIUC 2ZYLA 2NWFA 2BMQA 4NBDD 4QUQA 4QCKA 1SQVE 3GL2A 4H0LC 4AIVA 1VCKA 3VCAA 2Q3WA 2YMKA 2QJYC 3H1HE 5KLVE 4NBED 2QPZA 4OGQD 3L75E 2NVFA 2JZAA 3BCCE 3GL0A 5HL4A 1VF5C 2E75C 4H0LD 1G8KB 1P84E 2BCCE 1NTME 1SQBE 2B1XA 2DE7D 4H13C 1NTKE 4NBAD 1UUVA 2BMOA 1FQTA 3AZCA 1O7NA 3CX5E 2D2CD 2JO6A 3H1JE 1BE3E 5KKZC 3N0QA 4I7ZC 1VF5D 1O7HA 3VMID 4HKVA 2FYUE 2HMJA 2XSHA 2D2CC 1SQQE 2YFJA 2XR8A 4U3FE 3CXHE 1ULIA 1O7MA 4H13D 1EZVE 4HM3A 4HJLA 2E75D 4HM5A 4NBCD 2E76D
chains in the Genus database with same CATH superfamily
3H32B 2E75B 1N7SD 2WSEH 3AEFC 1K04A 4XFJA 2H8PD 2ZT9D 1QEXA 3PTZA 4H44D 1MV8A 3L71E 1SQQG 2B87B 3CPWO 5B5EH 2E4QA 2ITAA 2HMOA 1K73Q 3CCRP 2O01J 1NDOA 2R5BA 1NU1G 1MZ9A 5AW2B 2QJYB 4ZKPA 3PH0A 3L73E 2Q1KA 3AE5C 1IFNA 1NTKD 2I1JA 1FBMA 1HGZA 2OYOA 2XKMA 4YTPC 2I8DA 2WQYC 2JEEA 1L0ND 2MKVA 1HGVA 4PD4D 3KDPB 3P32A 1FU1A 1TU3F 2WPSA 2NVFA 2D2CB 2K1AA 2K37A 1S5LX 1NTZD 1LWUB 2IBZD 2NPSD 2W6JH 3GHGA 1H0TA 1QL1A 2H43A 2WZ7A 3F89A 3KZIE 2ZYDA 5AVYB 5KJ7C 1X22A 1GW4A 2R5DA 4NPEA 1JY3O 4U3FJ 3RL0B 1ZLLA 1PP9J 2UWJE 3QH9A 1Z56A 2QIWA 2HPCA 1RF1A 3QWOC 2OQQA 1PGOA 3FX0A 4H44C 2E42A 1NU1D 3VMGD 1EG9A 2FYUG 3H32A 4GOEA 1VM9A 1K05A 3JCUH 3L70E 1HJBA 2A06G 2Q3IA 5TISH 2E4PA 2VRSA 3HUSA 2QJPC 2Q9IA 1JY2O 3SFEC 3Q2YA 2CKFA 2HODA 2OYHC 3L74J 4WVZA 5KLIC 1BGYD 3H1IG 1RHZB 4W7YA 1KILC 2HODB 2O1JA 2IX7C 2AEJA 4N78D 3NMDA 4L76A 3SWYA 4I2LC 2JP3A 3AEBC 1EC5A 3FXEA 4R4MA 1NO4A 1GTWA 2OARA 2XNDH 1FZGA 4W80A 3GG2A 2E76B 2DE6D 1S72P 3TGUE 3CX5H 2KZJA 2P2UA 4QUQA 1K9MQ 3VYIA 1IFIA 1FZCC 3V2PA 2RKLA 1KILA 1RF1B 2C9NY 3GMAA 1JCCA 2B1XA 3TGUJ 2KYVA 1DIPA 1UIIA 1ZRTD 3L72D 3G4SP 5B66E 2QEXP 1O7MA 3H25A 1CZQA 3HE5B 3KPEA 1KQFB 4ASWA 3A0BE 5KLVK 4AYCA 1AJYA 3I5CA 1S5LE 1BE3D 5CCGD 1BCCD 3H1HJ 5AVQB 3IR9A 3TSIA 4QDFA 1VQPP 2NVEA 4DZOA 2JWAA 2NPSB 2HPCB 2WSFJ 3G3ZA 1ZN5A 2KOGA 4HKZH 3CWBE 3U1CA 5AW9B 3VN0A 3VP9A 5KLVG 1L0LK 1W2BO 3CCVP 2H88C 2HFED 2W83C 1PP9E 2XSOA 1KC8Q 4C7NA 1QX8A 1N8RQ 3W68A 2AXTH 1HJ0A 1L4AC 3CX5D 1LT1A 5CJ4A 1SQPD 1WQLA 2GM4A 1YJWP 2KP8A 2BMQA 4NBDD 4QCKA 4L74A 1VCKA 2E43A 1GK4A 1KILD 3GHGC 1LTGC 1J1EB 3WU2H 3GF7A 2IFMA 2NRGA 3WU2E 5APXA 1RE3A 2P58A 1Q7YQ 1VQ8P 4R4LA 2Q3EA 1RQVA 1FZBA 1RH5B 3CXHE 2Q7CA 2OYIC 1L4AB 3L73D 1Q2NA 4EOTA 4HJLA 2E75D 1S9KD 2M5AB 3II6A 2KB7P 1SQXE 5KKZB 1NTMJ 1NTZK 3G71P 3V2RA 2YMYA 1ZR2A 3VMXA 4PJ0E 2WSFH 4C7NB 1IK9A 2W6BA 1EXIA 2XU6A 3V2NA 2P7JA 1KYOE 4D6TD 2KXPB 5AW5B 5CJ0A 3RK3C 2GBXA 1J1DC 2FYUK 2JWDA 1IK7A 3EFFK 1LP1B 1PL5A 4N3YB 3L71J 3H1IJ 1WRGA 2ZYGA 3OAKA 4GDOA 3GB4A 4PD4H 2WSEJ 1AVOA 1OWAA 1VQ7P 4AAYB 2OYHB 1NYHA 1SS1A 2KNCA 2AXTE 4LLHA 3B5ND 1R5SA 1SFCC 3MUDC 3HTKA 2QM8A 5KTBA 1MUUA 3P8CE 3I56P 1AQTA 1EXJA 1SP4A 2BEZF 4AIVA 2KLUA 1P84I 1FZAA 1FOSF 3PJSK 2JZAA 1URQD 1FZCA 1ZP0C 1RE3C 1J2JB 1NTME 4H13C 1SQXJ 1UUVA 3NXSA 5KLVJ 4KJMA 1LTJC 1NAFA 3H1LD 3LW5H 1PGJA 2HMJA 3LIDA 3M0DA 1LTBC 3VTPC 4EYYQ 2JDIH 2NUKA 2IYOA 1LJ2A 4HM7A 2P10A 4Y99B 2IDBA 3PRJA 1SFCD 1PGQA 1VL2A 1BE3G 3Q5RA 2DE5D 3CCJP 3VMZA 5AVUB 4GOFA 2Y0CA 2LXCB 4PD4E 5TJHA 1N86A 4OGQC 1KORA 3R4YA 4QURA 1OW7A 2LR2A 1BDDA 2WPQA 4HM1A 2GUSA 2HMKA 1G8JB 3GCEA 1M8OB 1HH0A 2RN0A 3L72J 3B5NA 2O3JA 3P8MC 1BCCE 3IF4A 3L71G 3O8ZA 4YPCA 1SQPG 1W5CE 3VCAA 2Q3WA 2O01N 3L70D 1VF5C 1FS0E 2E75C 2B89A 2WITA 2ZVOB 3G9RA 1LTTC 1L0LD 1JO5A 1N7LA 1NTZJ 4OVNF 2FYUE 5APVA 1FZEA 4HM3A 1QVGO 2OYIA 1HWTC 4NBCD 5K5GB 1KQLA 3TK1A 3EFGA 1G2CB 2FYUJ 3RL0g 1P84D 1XTGB 1T3UA 3EN1A 1DD4A 1SJGA 2NVGA 4JF7A 1GD2E 5L8RJ 3D89A 2FBWC 5KAFH 3AE9C 5KJ7A 1J1EC 4IFFA 3KQGA 4GT1A 4PV1D 4HM0A 1M1JC 3L36A 4P1CH 4JPZB 1GL2A 3CC7P 4HM6A 3V4QA 4IL6H 3RK2D 1FDIA 4C46A 3HD7A 5AEWA 3L72E 4QDCA 3E1RA 3VOPA 2SPZA 2ZFCA 1L0LG 1SQVK 2E5YA 4UB8E 2C0WA 3L74E 1KB9D 4HM2A 3JC22 1KMIZ 3CXHH 2H89C 2KLVA 5KAIE 1O7WA 1VQNP 4AQRD 1JY3N 1IFDA 2NWFA 2BCCJ 2CPSA 3GL2A 3I55P 1G2CA 1KYOI 1Y8AA 2YMKA 1A02F 3B5NC 3UIAA 2H7HA 1GW3A 2W8ZA 1AVYA 2BCCE 1K8AQ 3CWBD 2FYZA 1G1JA 1X8YA 3AE4C 1JOCA 2IZ0A 3VMID 2IYPA 2D2CC 3VP8A 4ZNCA 3CXHI 3H1KG 2XV5A 1NAYA 3B4SA 2R44A 2FFDB 2O1KA 3BCCD 3FXDA 1KB9H 2A45H 1LTIC 5CHXA 1BE3J 1AQ5A 1U7JA 2NZ2A 3P8CD 2O01H 1N73C 3TGUG 4HYTB 5AW3B 1S5LH 3E7KA 3MGNA 5AVTB 2OTJP 1SQQD 4OWFA 1Q90D 2A06E 2N1TD 1RQUA 1IFJA 4NBFD 1M1JB 1RIEA 1AFOA 5APUA 5APWA 3L73J 5AVXB 3H1LE 3C1LA 3EQQA 3H1HD 2N9YB 1GL2B 2IFNA 1NYKA 1VQLP 3CXHD 1KTMA 3D71A 3CC4P 2YFIA 4RKUJ 2V7QH 1ZXGA 3AEEC 2PGDA 1BSHA 1OVVA 2BASA 1H8AA 1YI2P 3RK3B 1LT9C 5CCHC 5BVZA 2G8YA 1H89A 2LKMA 2YXRB 2PP6A 4RESB 5H2FE 4PJ0H 3L75J 4O9BA 1OVRA 3AZCA 2A45I 3M9BA 3P7KA 1SVFA 4I7ZC 3D70A 1O7HA 2FXOA 2XNXA 1PP9G 1LWUA 2NPSC 2ZXXA 4B86A 5CCHD 2IBZG 1JY3P 3M06A 1OX3A 2B87A 1FDMA 3WUVA 5APTA 1Y47A 4YXWH 1CI6A 2L5GB 4U3FG 4UB6H 3PP5A 1SQBG 3A5TA 3H1LG 1N7SA 1OFCX 1SQVJ 1NH4A 3HD7B 1JY2P 2QJKB 4U7JA 2KSEA 2NUMA 1NTMD 4WY4B 2K9JB 3MZWB 3T97B 1RF1C 2N1TC 4QUPA 4RO0A 1NU1K 4Y99C 3HD7C 2W6AA 3GZXA 3WUTA 4HM4A 1YTZI 1OVUA 3Q1MA 4DJGA 3CCEP 3AEDC 2CK3H 2PRRA 1IZNB 1EQ7A 3AE1C 3CWBJ 1BGYE 2POHA 2IZ1A 4N78E 2M3EA 1GU5A 1OXZA 4OGQD 3L75E 5AW1B 1SQXG 4H0LD 3CWBG 1G8KB 1GL2D 1SQBE 1PPJG 2JO6A 1QGKB 4I7ZB 5AVVB 3GLMA 5AW0B 2KSJA 1LGHB 3HE4A 4XA4A 3TNUB 1SLQA 1GDTA 4H0LC 1HUCA 1SQQJ 2K9JA 1U57A 3HE4B 1HBWA 4LC1A 2V7QJ 2Z5IA 1O7GA 1IJDB 1YQ4C 1JMBA 1ZRTE 3A7OA 3L75G 4PD4I 4JYCA 3GTSA 3H1LJ 5GTIE 4IFDK 2GBWA 1SQVD 1JCDA 1DEBA 4NPDA 1YJ9P 1KQSO 3L74G 2KZIA 5B5EE 3KYQA 2HMNA 1URQC 1KFNA 4I6MC 4PV1C 2FYUD 3FWNA 1KQGB 1S4XA 1AA0A 4JBZA 3TYYA 4QMAA 3SWKA 1M57D 2K88A 2KK7A 1DEEG 3TF5A 1UUWA 1JM1A 3PLNA 5AW6B 3IFMA 2WSCH 3MUDA 3A0BH 3TNUA 2ZYLA 4N6JA 1DD3A 1RF0C 2QJYC 1LTAC 1L0NJ 1URQA 2WWWA 2RMZA 4PV1B 1BGYG 3H1ID 1HTLC 3GHGB 1HF9A 1P84E 1H0TB 1URQB 1ZR4A 5GTHH 4NBAD 3L73G 3H1JE 1VF5D 3RK2B 5KAFE 4U3FE 3VMYA 1YTZT 3RK3D 2K3RA 5AW8B 3TDKA 1CI6B 4OH8B 1J1DB 1GZLA 1NTKG 3CI9A 2QSIA 1BDCA 1YJNP 1WMKA 2N1TB 1N7SC 3MIWA 2B9BA 4WY4A 1JTHB 3L74D 1NU1J 3U59A 1SQXK 3V6IA 1LT9A 3S9OA 1OMIA 4HH2A 3AECC 2ZYAA 2FXMA 3V2QA 2BMRA 2KI7B 3CMAP 3GOBA 3CC2P 3SSUA 1EDIA 1VQ5P 4HM8A 3H1KJ 1GL2C 1EZVG 1NOHA 3H1JG 4CPGA 4ZMDA 1Q90C 5AW4B 2YNYA 5APQA 1L4AD 2KUBA 2HLOA 1RE4C 4NPFX 1KB9I 1L0NG 2M0BA 1ZMEC 1R5LA 1HVVA 3Q5SA 4NBED 3B8EB 3BCCE 3NFQA 3BATA 1GK6A 2B88A 5E79H 3CLQA 4DT0A 2M8RA 1SQBK 2D2CD 3IN6A 3L71D 3BCCG 2GA1A 2MJZA 1FZCB 4W7ZA 2FY8A 2XDJA 1SQQE 2YFJA 2OTLP 2QE7H 2A06D 1KZUB 5GTHE 1GMJA 1LT9B 2JKVA 1VQ4P 3WMM0 5AVWB 3CX5I 2YVJB 2FYNC 1LTSC 2E5TA 1FE6A 4XE5B 1YQ3C 2Z4EA 2E74C 1RFSA 1NTMG 3AE8C 4P1BH 3L75D 1O7PA 1BCCJ 3CMEP 3EQ2A 1BGYJ 4D6TJ 1PV3A 4NB9D 4TT3H 3L70G 2PFXA 1T2KC 1ULJA 3GZYA 4EMJB 1IFMA 2GUVA 3R2PA 1JTHA 3RL0D 2Q6QA 1AV1A 4D6TG 1EZVD 1CW5A 3S1KA 5BOKA 5APYA 4H44B 5GTIH 1KFMA 4KT0J 2AEMA 2WT7B 2IBZI 1SQPJ 2ZXEB 3CCQP 1RE4A 2FXPA 3ZDMA 3H1KD 1FJKA 1S1CX 3HE5A 2IPPA 1SQVE 1BSNA 3B71A 1L2PA 5KLVE 2HYNA 3KHUA 3D6YA 3GL0A 1G1IA 3PHLA 5HL4A 5CBOA 3L4FA 5CBNA 2HG5D 1Q86Q 1PGPA 2BMOA 3AE6C 1KILB 1QLED 2AEFA 4JQ0D 2OTKE 3M9QA 3CCUP 1N73A 1S3JA 3Q5PA 2ZJSE 4ASVA 1JNMA 1YYCA 3S4RA 3C0DA 2YXQB 3LIEA 1N73B 2N1TA 3H1HG 1QVFO 1JUNA 1FAVA 1MFZA 2B24A 3K5BA 3MHVA 1X79B 2WT7A 5DJTB 1NGMB 3H1IE 3RL0C 1E79H 4EIJA 2W27A 1NTKK 3H1JD 5E79E 1SQBD 3TGUD 3U1AA 1CSBA 3RBXA 3VMHD 3CCLP 3CL3D 3ITKA 5BU8B 4HB1A 1FZFA 4DCKA 3GKEA 2KNCB 3Q3DA 1PPJE 3OJAB 3O6QA 1T6AA 1SQBJ 1Q82Q 2M5AA 3BASA 2QRXA 1ZW0A 5CCHA 2PAJA 3USSA 2YO3A 2M3BA 1BE3E 4IOIH 2WPVB 3F5HA 4HKVA 3RK2C 2ZT9B 3BRVB 1ZV8A 3L35A 4H13D 4Z1MH 1VQKP 1W2EA 1LP1A 2P1JA 3G6EP 2K9YA 2ZAEB 1NWQA 1M1KQ 2HMMA 1KN7A 4MN4C 4QDFB 2BCCD 5AEUA 5TISE 4H13B 2NPSA 3CCMP 1L4AA 1T8ZA 2QVAA 2FFDA 1PP9D 2Y9ZA 2OYHA 5AVSB 3C8VA 3HUSC 2I1KA 4H0LB 2JJLA 2V4HA 1VQ9P 4QDDA 3N7NA 1VPCA 2P67A 2Q5UA 1NKZB 1SQPE 1SQPK 2YKPA 3FGAD 3BVHA 1MFTA 3W67A 4EDFA 3RK3E 3GF3A 2E74B 4BRYA 2RH0A 4BWNA 3VMAA 2KS1A 3B5NB 1OIPA 3HD7D 4L73A 3H1HE 2W90A 3LW5J 3JSVC 3HTKB 5APSA 2QPZA 4GKGA 1QL2A 4HJGH 4RJTA 1NHLA 3MTUE 3BCCJ 1NTKE 1PFIA 1IFPA 5KKZC 2WPRA 3L37A 1SFCA 1L0LJ 2XR8A 2YIUB 3OA7A 1DX7A 3OW2O 2A45G 1N2DC 1NTZE 4Y28J 3H1KE 4NBHD 1M56D 4EI2A 1M90Q 2E76C 1NTKJ 2Y0EA 3E1IA 3BRTB 5CCGA 4WWIA 1LTJA 2J59M 1D7MA 3RGUA 5AW7B 2R3SA 1LTJB 3GTEA 3D6ZA 1IC2A 1A02J 5M1BA 1EDKA 1DH3A 3WUUA 3A3YB 3V5BA 2YFLA 4IL6E 3FOUA 1SQQK 1Y9BA 3T97A 4IL6X 2C9LY 2XZRA 3O6QB 3M91A 1FDOA 4ZKUA 1NU1E 1UIXA 1NTMK 3DQYA 4BXLA 3V4WA 3L70J 2L91A 4GODA 2OYIB 2AXCA 4YXDC 3RBZA 4BRYB 5DJUB 3ABVC 2QM7A 1T3JA 2Y0DA 1YIJP 3AEAC 2WSSH 1JEKA 1OW8A 3AEGC 3N0QA 5KAIH 2XSHA 4DOJA 1OZHA 4UB6E 1EZVE 1R8EA 4M3LA 2HR3A 4L75A 3IAOA 3H1JJ 2OGUA 1NKNA 2I7FA 3L72G 4NBBD 1JB0J 3AE7C 4A7PA 1FOSE 1YBKA 1JMMA 1L0NE 1L0NK 3N4XA 4K35A 1ZOYC 1YHQP 4WY4C 2BCCG 4LGDE 5AVZB 2CPBA 3A2AA 2QJKC 5B66H 1KD1Q 3H6PA 5KLVD 2HMLA 1VF5B 2R32A 3M9HA 1LNQA 3GW6A 1NVOA 4JYBA 2KIKA 2IBZE 4WB4A 2J5UA 2WTYA 3NTNA 2WSCJ 2YO2A 3M0AA 3CD6P 1NJIQ 3HRNA 1YITP 2KS1B 5KLIB 1L0LE 1EZVI 1P84H 1VQ6P 1KV4A 1E5WA 3A0HE 2Y9YA 4OGQB 5CMZA 2YIUC 3AE3C 1EDLA 1X9VA 1USDA 2QG4A 2R3CA 1KYOH 2JR8A 5BU5A 1Q81Q 1SFCB 5KJ7D 2FFDC 1IO4A 5EFWB 3CX5E 2LXBA 3SWFA 5H2FH 1T2KD 1SQVG 4IFMA 2JO1A 1PIXA 3C9IA 3M0DC 4HM5A 1XTCC 2E76D 3MD0A 1X0TA 2FYNB 4NB8D 2N9BA 3VCPA 1LWUC 2G3AA 4TLFA 2E74D 3JCUE 1JY2N 5CCGC 2C0XA 3EWKA 2XRXA 1RY3A 2BEQD 1VQMP 1VQOP 3KZIH 4U3FD 1EDJA 1KILE 2ZVNB 1PZQA 5CXMA 1S2EA 1KB9E 1WT6A 1FC2C 1S9KE 4KHXA 1MKMA 3FWLA 1PPJD 2QJPB 4AUWA 1RF0A 1BCCG 2FKWB 3HUSB 1JM0A 4I1LA 1OW6A 3A0HH 4C7RA 1M1JA 2QA4P 1KYOD 4WY4D 4NBGD 2YKQA 1SQXD 3KXDA 5C39A 4GIFA 4UB8H 1USEA 1FJPA 2ZT9C 4D6TE 4WBAA 2J58A 2YKOA 2WMMA 3AE2C 5AVRB 1H88A 1GU4A 1M7LA 2DW3A 1U7MA 4K3AA 2DE7D 1NTZG 1FQTA 1O7NA 2Z5HA 3CCSP 3MP7B 1N7SB 1ULIA 1VDFA 3SFDC 2WVRA
chains in the Genus database with same CATH topology
2HMMA 2NUKA 2E75B 1U57A 4QDFB 3AEFC 1K04A 2V7QJ 1O7GA 5AEUA 4H13B 4XFJA 1YQ4C 2ZT9D 1ZRTE 4H44D 3L71E 4HM7A 2P10A 3GTSA 2IDBA 3C8VA 2GBWA 1VL2A 2E4QA 4H0LB 4QDDA 3Q5RA 2DE5D 2HMOA 1SQPE 2HMNA 2O01J 1NDOA 3FGAD 4PD4E 4OGQC 1KORA 3R4YA 4PV1C 1OW7A 4QURA 1KQGB 3RK3E 3GF3A 4HM1A 3L73E 2HMKA 2E74B 1G8JB 3GCEA 3AE5C 4YTPC 2WQYC 1UUWA 1JM1A 1BCCE 2MKVA 2ZYLA 1DD3A 3VCAA 2QJYC 2Q3WA 3H1HE 3LW5J 1TU3F 2QPZA 2NVFA 2D2CB 4PV1B 1VF5C 2E75C 1S5LX 1HF9A 1P84E 3G9RA 1NTKE 4NBAD 3H1JE 5KKZC 1VF5D 2FYUE 4U3FE 2XR8A 4HM3A 4NBCD 3RL0g 2QIWA 1NTZE 4Y28J 2QSIA 3EN1A 1DD4A 1SJGA 3H1KE 2OQQA 2NVGA 4NBHD 4H44C 5L8RJ 2E76C 3D89A 2FBWC 3AE9C 3VMGD 1EG9A 1VM9A 1WMKA 1K05A 3L70E 4PV1D 4HM0A 2E4PA 2QJPC 4P1CH 3S9OA 3SFEC 4HM6A 1OMIA 3GTEA 3D6ZA 3Q2YA 2CKFA 5M1BA 3AECC 1FDIA 5KLIC 2BMRA 3GOBA 5AEWA 3L72E 4QDCA 2YFLA 4HM8A 3FOUA 1Y9BA 2JP3A 3AEBC 4IL6X 4R4MA 3L74E 4HM2A 1Q90C 1FDOA 1KMIZ 2H89C 2E76B 2DE6D 1NU1E 1UIXA 1O7WA 3DQYA 3TGUE 2NWFA 4YXDC 4QUQA 1ZMEC 3GL2A 2YMKA 3Q5SA 4NBED 3ABVC 3BCCE 3AEAC 3GMAA 2BCCE 2B1XA 1OW8A 1DIPA 2D2CD 3IN6A 3AEGC 3AE4C 3N0QA 3VMID 2XSHA 2D2CC 1SQQE 2YFJA 1O7MA 3H25A 1EZVE 1R8EA 1GMJA 3IAOA 1KQFB 2I7FA 4NBBD 2YVJB 2FYNC 1AJYA 1JB0J 3AE7C 2NZ2A 1L0NE 1YQ3C 1ZOYC 4QDFA 2E74C 1RFSA 3AE8C 2NVEA 4P1BH 2QJKC 1Q90D 2A06E 1O7PA 2WSFJ 2HMLA 1RQUA 1PV3A 1VF5B 4NB9D 3CWBE 4NBFD 4TT3H 1RIEA 1ULJA 3GZYA 2IBZE 4EMJB 3H1LE 2H88C 2J5UA 3EQQA 1PP9E 2WSCJ 2XSOA 5BOKA 4H44B 1NYKA 1KTMA 3D71A 4KT0J 2YFIA 4RKUJ 1HJ0A 1L0LE 3AEEC 2FXPA 1WQLA 4OGQB 2YIUC 3AE3C 2BMQA 1S1CX 4NBDD 4QCKA 1SQVE 2G8YA 3B71A 1VCKA 5KLVE 3D6YA 3GL0A 5HL4A 3GF7A 2BMOA 3AZCA 3CX5E 3AE6C 4I7ZC 3D70A 1O7HA 4R4LA 1RQVA 3CXHE 2JO1A 1PIXA 3Q5PA 4HJLA 2E75D 4HM5A 2E76D 1SQXE 3C0DA 4NB8D 3VCPA 2G3AA 2E74D 3EWKA 2B24A 2XRXA 2BEQD 1EXIA 1KYOE 1KILE 2GBXA 5CXMA 1NGMB 3H1IE 1KB9E 1IK7A 1MKMA 4U7JA 1PL5A 2NUMA 4GDOA 3GB4A 3T97B 1OW6A 4QUPA 2WSEJ 3VMHD 4NBGD 3GZXA 4AAYB 1NYHA 4HM4A 3Q1MA 3AEDC 3GKEA 3Q3DA 1PPJE 3O6QA 3AE1C 2ZT9C 1EXJA 2BEZF 4AIVA 3AE2C 4OGQD 3L75E 2JZAA 4H0LD 1ZP0C 1G8KB 1NTME 1SQBE 2DE7D 4H13C 1UUVA 1FQTA 1O7NA 2JO6A 4I7ZB 1BE3E 2WPVB 3GLMA 4HKVA 2HMJA 2ZT9B 1ULIA 4H13D 3SFDC 4Z1MH 2K9YA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMM A;  2I7F A;  1SQX E;  2NUK A;  3C0D A;  4NBB D;  4NB8 D;  4QDF B;  1NTZ E;  2YVJ B;  1O7G A;  2FYN C;  5AEU A;  3VCP A;  3EN1 A;  2E74 D;  1SJG A;  3H1K E;  2NVG A;  2ZT9 D;  4NBH D;  1ZRT E;  4H44 C;  2E76 C;  3D89 A;  2B24 A;  2XRX A;  1L0N E;  4H44 D;  3L71 E;  4HM7 A;  3VMG D;  1EG9 A;  3GTS A;  4QDF A;  2E74 C;  1RFS A;  1VM9 A;  4P1B H;  2NVE A;  1KYO E;  2GBW A;  2E4Q A;  2QJK C;  3L70 E;  4PV1 D;  2A06 E;  2GBX A;  4HM0 A;  4QDD A;  5CXM A;  1O7P A;  2E4P A;  3H1I E;  1KB9 E;  2DE5 D;  2HML A;  2HMO A;  2QJP C;  4P1C H;  4NB9 D;  4NBF D;  3CWB E;  4HM6 A;  3GTE A;  1RIE A;  1SQP E;  2CKF A;  2HMN A;  2NUM A;  1NDO A;  1ULJ A;  3GB4 A;  3GZY A;  2IBZ E;  4EMJ B;  5KLI C;  4PD4 E;  3H1L E;  2BMR A;  3GOB A;  3EQQ A;  5AEW A;  3L72 E;  4QDC A;  2YFL A;  4QUP A;  4OGQ C;  4QUR A;  1PP9 E;  4PV1 C;  3VMH D;  2XSO A;  5BOK A;  4HM8 A;  3FOU A;  1NYK A;  4NBG D;  3GZX A;  4AAY B;  4HM1 A;  3L73 E;  4HM4 A;  2HMK A;  1G8J B;  2YFI A;  3GCE A;  3L74 E;  1L0L E;  4HM2 A;  1Q90 C;  3GKE A;  1PPJ E;  1WQL A;  1UUW A;  1JM1 A;  2DE6 D;  1BCC E;  1NU1 E;  1O7W A;  3DQY A;  3TGU E;  2ZT9 C;  2YIU C;  2ZYL A;  2NWF A;  2BMQ A;  4NBD D;  4QUQ A;  4QCK A;  1SQV E;  3GL2 A;  4H0L C;  4AIV A;  1VCK A;  3VCA A;  2Q3W A;  2YMK A;  2QJY C;  3H1H E;  5KLV E;  4NBE D;  2QPZ A;  4OGQ D;  3L75 E;  2NVF A;  2JZA A;  3BCC E;  3GL0 A;  5HL4 A;  1VF5 C;  2E75 C;  4H0L D;  1G8K B;  1P84 E;  2BCC E;  1NTM E;  1SQB E;  2B1X A;  2DE7 D;  4H13 C;  1NTK E;  4NBA D;  1UUV A;  2BMO A;  1FQT A;  3AZC A;  1O7N A;  3CX5 E;  2D2C D;  2JO6 A;  3H1J E;  1BE3 E;  5KKZ C;  3N0Q A;  4I7Z C;  1VF5 D;  1O7H A;  3VMI D;  4HKV A;  2FYU E;  2HMJ A;  2XSH A;  2D2C C;  1SQQ E;  2YFJ A;  2XR8 A;  4U3F E;  3CXH E;  1ULI A;  1O7M A;  4H13 D;  1EZV E;  4HM3 A;  4HJL A;  2E75 D;  4HM5 A;  4NBC D;  2E76 D; 
#chains in the Genus database with same CATH topology
 3H32 B;  2E75 B;  1N7S D;  2WSE H;  3AEF C;  1K04 A;  4XFJ A;  2H8P D;  2ZT9 D;  1QEX A;  3PTZ A;  4H44 D;  1MV8 A;  3L71 E;  1SQQ G;  2B87 B;  3CPW O;  5B5E H;  2E4Q A;  2ITA A;  2HMO A;  1K73 Q;  3CCR P;  2O01 J;  1NDO A;  2R5B A;  1NU1 G;  1MZ9 A;  5AW2 B;  2QJY B;  4ZKP A;  3PH0 A;  3L73 E;  2Q1K A;  3AE5 C;  1IFN A;  1NTK D;  2I1J A;  1FBM A;  1HGZ A;  2OYO A;  2XKM A;  4YTP C;  2I8D A;  2WQY C;  2JEE A;  1L0N D;  2MKV A;  1HGV A;  4PD4 D;  3KDP B;  3P32 A;  1FU1 A;  1TU3 F;  2WPS A;  2NVF A;  2D2C B;  2K1A A;  2K37 A;  1S5L X;  1NTZ D;  1LWU B;  2IBZ D;  2NPS D;  2W6J H;  3GHG A;  1H0T A;  1QL1 A;  2H43 A;  2WZ7 A;  3F89 A;  3KZI E;  2ZYD A;  5AVY B;  5KJ7 C;  1X22 A;  1GW4 A;  2R5D A;  4NPE A;  1JY3 O;  4U3F J;  3RL0 B;  1ZLL A;  1PP9 J;  2UWJ E;  3QH9 A;  1Z56 A;  2QIW A;  2HPC A;  1RF1 A;  3QWO C;  2OQQ A;  1PGO A;  3FX0 A;  4H44 C;  2E42 A;  1NU1 D;  3VMG D;  1EG9 A;  2FYU G;  3H32 A;  4GOE A;  1VM9 A;  1K05 A;  3JCU H;  3L70 E;  1HJB A;  2A06 G;  2Q3I A;  5TIS H;  2E4P A;  2VRS A;  3HUS A;  2QJP C;  2Q9I A;  1JY2 O;  3SFE C;  3Q2Y A;  2CKF A;  2HOD A;  2OYH C;  3L74 J;  4WVZ A;  5KLI C;  1BGY D;  3H1I G;  1RHZ B;  4W7Y A;  1KIL C;  2HOD B;  2O1J A;  2IX7 C;  2AEJ A;  4N78 D;  3NMD A;  4L76 A;  3SWY A;  4I2L C;  2JP3 A;  3AEB C;  1EC5 A;  3FXE A;  4R4M A;  1NO4 A;  1GTW A;  2OAR A;  2XND H;  1FZG A;  4W80 A;  3GG2 A;  2E76 B;  2DE6 D;  1S72 P;  3TGU E;  3CX5 H;  2KZJ A;  2P2U A;  4QUQ A;  1K9M Q;  3VYI A;  1IFI A;  1FZC C;  3V2P A;  2RKL A;  1KIL A;  1RF1 B;  2C9N Y;  3GMA A;  1JCC A;  2B1X A;  3TGU J;  2KYV A;  1DIP A;  1UII A;  1ZRT D;  3L72 D;  3G4S P;  5B66 E;  2QEX P;  1O7M A;  3H25 A;  1CZQ A;  3HE5 B;  3KPE A;  1KQF B;  4ASW A;  3A0B E;  5KLV K;  4AYC A;  1AJY A;  3I5C A;  1S5L E;  1BE3 D;  5CCG D;  1BCC D;  3H1H J;  5AVQ B;  3IR9 A;  3TSI A;  4QDF A;  1VQP P;  2NVE A;  4DZO A;  2JWA A;  2NPS B;  2HPC B;  2WSF J;  3G3Z A;  1ZN5 A;  2KOG A;  4HKZ H;  3CWB E;  3U1C A;  5AW9 B;  3VN0 A;  3VP9 A;  5KLV G;  1L0L K;  1W2B O;  3CCV P;  2H88 C;  2HFE D;  2W83 C;  1PP9 E;  2XSO A;  1KC8 Q;  4C7N A;  1QX8 A;  1N8R Q;  3W68 A;  2AXT H;  1HJ0 A;  1L4A C;  3CX5 D;  1LT1 A;  5CJ4 A;  1SQP D;  1WQL A;  2GM4 A;  1YJW P;  2KP8 A;  2BMQ A;  4NBD D;  4QCK A;  4L74 A;  1VCK A;  2E43 A;  1GK4 A;  1KIL D;  3GHG C;  1LTG C;  1J1E B;  3WU2 H;  3GF7 A;  2IFM A;  2NRG A;  3WU2 E;  5APX A;  1RE3 A;  2P58 A;  1Q7Y Q;  1VQ8 P;  4R4L A;  2Q3E A;  1RQV A;  1FZB A;  1RH5 B;  3CXH E;  2Q7C A;  2OYI C;  1L4A B;  3L73 D;  1Q2N A;  4EOT A;  4HJL A;  2E75 D;  1S9K D;  2M5A B;  3II6 A;  2KB7 P;  1SQX E;  5KKZ B;  1NTM J;  1NTZ K;  3G71 P;  3V2R A;  2YMY A;  1ZR2 A;  3VMX A;  4PJ0 E;  2WSF H;  4C7N B;  1IK9 A;  2W6B A;  1EXI A;  2XU6 A;  3V2N A;  2P7J A;  1KYO E;  4D6T D;  2KXP B;  5AW5 B;  5CJ0 A;  3RK3 C;  2GBX A;  1J1D C;  2FYU K;  2JWD A;  1IK7 A;  3EFF K;  1LP1 B;  1PL5 A;  4N3Y B;  3L71 J;  3H1I J;  1WRG A;  2ZYG A;  3OAK A;  4GDO A;  3GB4 A;  4PD4 H;  2WSE J;  1AVO A;  1OWA A;  1VQ7 P;  4AAY B;  2OYH B;  1NYH A;  1SS1 A;  2KNC A;  2AXT E;  4LLH A;  3B5N D;  1R5S A;  1SFC C;  3MUD C;  3HTK A;  2QM8 A;  5KTB A;  1MUU A;  3P8C E;  3I56 P;  1AQT A;  1EXJ A;  1SP4 A;  2BEZ F;  4AIV A;  2KLU A;  1P84 I;  1FZA A;  1FOS F;  3PJS K;  2JZA A;  1URQ D;  1FZC A;  1ZP0 C;  1RE3 C;  1J2J B;  1NTM E;  4H13 C;  1SQX J;  1UUV A;  3NXS A;  5KLV J;  4KJM A;  1LTJ C;  1NAF A;  3H1L D;  3LW5 H;  1PGJ A;  2HMJ A;  3LID A;  3M0D A;  1LTB C;  3VTP C;  4EYY Q;  2JDI H;  2NUK A;  2IYO A;  1LJ2 A;  4HM7 A;  2P10 A;  4Y99 B;  2IDB A;  3PRJ A;  1SFC D;  1PGQ A;  1VL2 A;  1BE3 G;  3Q5R A;  2DE5 D;  3CCJ P;  3VMZ A;  5AVU B;  4GOF A;  2Y0C A;  2LXC B;  4PD4 E;  5TJH A;  1N86 A;  4OGQ C;  1KOR A;  3R4Y A;  4QUR A;  1OW7 A;  2LR2 A;  1BDD A;  2WPQ A;  4HM1 A;  2GUS A;  2HMK A;  1G8J B;  3GCE A;  1M8O B;  1HH0 A;  2RN0 A;  3L72 J;  3B5N A;  2O3J A;  3P8M C;  1BCC E;  3IF4 A;  3L71 G;  3O8Z A;  4YPC A;  1SQP G;  1W5C E;  3VCA A;  2Q3W A;  2O01 N;  3L70 D;  1VF5 C;  1FS0 E;  2E75 C;  2B89 A;  2WIT A;  2ZVO B;  3G9R A;  1LTT C;  1L0L D;  1JO5 A;  1N7L A;  1NTZ J;  4OVN F;  2FYU E;  5APV A;  1FZE A;  4HM3 A;  1QVG O;  2OYI A;  1HWT C;  4NBC D;  5K5G B;  1KQL A;  3TK1 A;  3EFG A;  1G2C B;  2FYU J;  3RL0 g;  1P84 D;  1XTG B;  1T3U A;  3EN1 A;  1DD4 A;  1SJG A;  2NVG A;  4JF7 A;  1GD2 E;  5L8R J;  3D89 A;  2FBW C;  5KAF H;  3AE9 C;  5KJ7 A;  1J1E C;  4IFF A;  3KQG A;  4GT1 A;  4PV1 D;  4HM0 A;  1M1J C;  3L36 A;  4P1C H;  4JPZ B;  1GL2 A;  3CC7 P;  4HM6 A;  3V4Q A;  4IL6 H;  3RK2 D;  1FDI A;  4C46 A;  3HD7 A;  5AEW A;  3L72 E;  4QDC A;  3E1R A;  3VOP A;  2SPZ A;  2ZFC A;  1L0L G;  1SQV K;  2E5Y A;  4UB8 E;  2C0W A;  3L74 E;  1KB9 D;  4HM2 A;  3JC2 2;  1KMI Z;  3CXH H;  2H89 C;  2KLV A;  5KAI E;  1O7W A;  1VQN P;  4AQR D;  1JY3 N;  1IFD A;  2NWF A;  2BCC J;  2CPS A;  3GL2 A;  3I55 P;  1G2C A;  1KYO I;  1Y8A A;  2YMK A;  1A02 F;  3B5N C;  3UIA A;  2H7H A;  1GW3 A;  2W8Z A;  1AVY A;  2BCC E;  1K8A Q;  3CWB D;  2FYZ A;  1G1J A;  1X8Y A;  3AE4 C;  1JOC A;  2IZ0 A;  3VMI D;  2IYP A;  2D2C C;  3VP8 A;  4ZNC A;  3CXH I;  3H1K G;  2XV5 A;  1NAY A;  3B4S A;  2R44 A;  2FFD B;  2O1K A;  3BCC D;  3FXD A;  1KB9 H;  2A45 H;  1LTI C;  5CHX A;  1BE3 J;  1AQ5 A;  1U7J A;  2NZ2 A;  3P8C D;  2O01 H;  1N73 C;  3TGU G;  4HYT B;  5AW3 B;  1S5L H;  3E7K A;  3MGN A;  5AVT B;  2OTJ P;  1SQQ D;  4OWF A;  1Q90 D;  2A06 E;  2N1T D;  1RQU A;  1IFJ A;  4NBF D;  1M1J B;  1RIE A;  1AFO A;  5APU A;  5APW A;  3L73 J;  5AVX B;  3H1L E;  3C1L A;  3EQQ A;  3H1H D;  2N9Y B;  1GL2 B;  2IFN A;  1NYK A;  1VQL P;  3CXH D;  1KTM A;  3D71 A;  3CC4 P;  2YFI A;  4RKU J;  2V7Q H;  1ZXG A;  3AEE C;  2PGD A;  1BSH A;  1OVV A;  2BAS A;  1H8A A;  1YI2 P;  3RK3 B;  1LT9 C;  5CCH C;  5BVZ A;  2G8Y A;  1H89 A;  2LKM A;  2YXR B;  2PP6 A;  4RES B;  5H2F E;  4PJ0 H;  3L75 J;  4O9B A;  1OVR A;  3AZC A;  2A45 I;  3M9B A;  3P7K A;  1SVF A;  4I7Z C;  3D70 A;  1O7H A;  2FXO A;  2XNX A;  1PP9 G;  1LWU A;  2NPS C;  2ZXX A;  4B86 A;  5CCH D;  2IBZ G;  1JY3 P;  3M06 A;  1OX3 A;  2B87 A;  1FDM A;  3WUV A;  5APT A;  1Y47 A;  4YXW H;  1CI6 A;  2L5G B;  4U3F G;  4UB6 H;  3PP5 A;  1SQB G;  3A5T A;  3H1L G;  1N7S A;  1OFC X;  1SQV J;  1NH4 A;  3HD7 B;  1JY2 P;  2QJK B;  4U7J A;  2KSE A;  2NUM A;  1NTM D;  4WY4 B;  2K9J B;  3MZW B;  3T97 B;  1RF1 C;  2N1T C;  4QUP A;  4RO0 A;  1NU1 K;  4Y99 C;  3HD7 C;  2W6A A;  3GZX A;  3WUT A;  4HM4 A;  1YTZ I;  1OVU A;  3Q1M A;  4DJG A;  3CCE P;  3AED C;  2CK3 H;  2PRR A;  1IZN B;  1EQ7 A;  3AE1 C;  3CWB J;  1BGY E;  2POH A;  2IZ1 A;  4N78 E;  2M3E A;  1GU5 A;  1OXZ A;  4OGQ D;  3L75 E;  5AW1 B;  1SQX G;  4H0L D;  3CWB G;  1G8K B;  1GL2 D;  1SQB E;  1PPJ G;  2JO6 A;  1QGK B;  4I7Z B;  5AVV B;  3GLM A;  5AW0 B;  2KSJ A;  1LGH B;  3HE4 A;  4XA4 A;  3TNU B;  1SLQ A;  1GDT A;  4H0L C;  1HUC A;  1SQQ J;  2K9J A;  1U57 A;  3HE4 B;  1HBW A;  4LC1 A;  2V7Q J;  2Z5I A;  1O7G A;  1IJD B;  1YQ4 C;  1JMB A;  1ZRT E;  3A7O A;  3L75 G;  4PD4 I;  4JYC A;  3GTS A;  3H1L J;  5GTI E;  4IFD K;  2GBW A;  1SQV D;  1JCD A;  1DEB A;  4NPD A;  1YJ9 P;  1KQS O;  3L74 G;  2KZI A;  5B5E E;  3KYQ A;  2HMN A;  1URQ C;  1KFN A;  4I6M C;  4PV1 C;  2FYU D;  3FWN A;  1KQG B;  1S4X A;  1AA0 A;  4JBZ A;  3TYY A;  4QMA A;  3SWK A;  1M57 D;  2K88 A;  2KK7 A;  1DEE G;  3TF5 A;  1UUW A;  1JM1 A;  3PLN A;  5AW6 B;  3IFM A;  2WSC H;  3MUD A;  3A0B H;  3TNU A;  2ZYL A;  4N6J A;  1DD3 A;  1RF0 C;  2QJY C;  1LTA C;  1L0N J;  1URQ A;  2WWW A;  2RMZ A;  4PV1 B;  1BGY G;  3H1I D;  1HTL C;  3GHG B;  1HF9 A;  1P84 E;  1H0T B;  1URQ B;  1ZR4 A;  5GTH H;  4NBA D;  3L73 G;  3H1J E;  1VF5 D;  3RK2 B;  5KAF E;  4U3F E;  3VMY A;  1YTZ T;  3RK3 D;  2K3R A;  5AW8 B;  3TDK A;  1CI6 B;  4OH8 B;  1J1D B;  1GZL A;  1NTK G;  3CI9 A;  2QSI A;  1BDC A;  1YJN P;  1WMK A;  2N1T B;  1N7S C;  3MIW A;  2B9B A;  4WY4 A;  1JTH B;  3L74 D;  1NU1 J;  3U59 A;  1SQX K;  3V6I A;  1LT9 A;  3S9O A;  1OMI A;  4HH2 A;  3AEC C;  2ZYA A;  2FXM A;  3V2Q A;  2BMR A;  2KI7 B;  3CMA P;  3GOB A;  3CC2 P;  3SSU A;  1EDI A;  1VQ5 P;  4HM8 A;  3H1K J;  1GL2 C;  1EZV G;  1NOH A;  3H1J G;  4CPG A;  4ZMD A;  1Q90 C;  5AW4 B;  2YNY A;  5APQ A;  1L4A D;  2KUB A;  2HLO A;  1RE4 C;  4NPF X;  1KB9 I;  1L0N G;  2M0B A;  1ZME C;  1R5L A;  1HVV A;  3Q5S A;  4NBE D;  3B8E B;  3BCC E;  3NFQ A;  3BAT A;  1GK6 A;  2B88 A;  5E79 H;  3CLQ A;  4DT0 A;  2M8R A;  1SQB K;  2D2C D;  3IN6 A;  3L71 D;  3BCC G;  2GA1 A;  2MJZ A;  1FZC B;  4W7Z A;  2FY8 A;  2XDJ A;  1SQQ E;  2YFJ A;  2OTL P;  2QE7 H;  2A06 D;  1KZU B;  5GTH E;  1GMJ A;  1LT9 B;  2JKV A;  1VQ4 P;  3WMM 0;  5AVW B;  3CX5 I;  2YVJ B;  2FYN C;  1LTS C;  2E5T A;  1FE6 A;  4XE5 B;  1YQ3 C;  2Z4E A;  2E74 C;  1RFS A;  1NTM G;  3AE8 C;  4P1B H;  3L75 D;  1O7P A;  1BCC J;  3CME P;  3EQ2 A;  1BGY J;  4D6T J;  1PV3 A;  4NB9 D;  4TT3 H;  3L70 G;  2PFX A;  1T2K C;  1ULJ A;  3GZY A;  4EMJ B;  1IFM A;  2GUV A;  3R2P A;  1JTH A;  3RL0 D;  2Q6Q A;  1AV1 A;  4D6T G;  1EZV D;  1CW5 A;  3S1K A;  5BOK A;  5APY A;  4H44 B;  5GTI H;  1KFM A;  4KT0 J;  2AEM A;  2WT7 B;  2IBZ I;  1SQP J;  2ZXE B;  3CCQ P;  1RE4 A;  2FXP A;  3ZDM A;  3H1K D;  1FJK A;  1S1C X;  3HE5 A;  2IPP A;  1SQV E;  1BSN A;  3B71 A;  1L2P A;  5KLV E;  2HYN A;  3KHU A;  3D6Y A;  3GL0 A;  1G1I A;  3PHL A;  5HL4 A;  5CBO A;  3L4F A;  5CBN A;  2HG5 D;  1Q86 Q;  1PGP A;  2BMO A;  3AE6 C;  1KIL B;  1QLE D;  2AEF A;  4JQ0 D;  2OTK E;  3M9Q A;  3CCU P;  1N73 A;  1S3J A;  3Q5P A;  2ZJS E;  4ASV A;  1JNM A;  1YYC A;  3S4R A;  3C0D A;  2YXQ B;  3LIE A;  1N73 B;  2N1T A;  3H1H G;  1QVF O;  1JUN A;  1FAV A;  1MFZ A;  2B24 A;  3K5B A;  3MHV A;  1X79 B;  2WT7 A;  5DJT B;  1NGM B;  3H1I E;  3RL0 C;  1E79 H;  4EIJ A;  2W27 A;  1NTK K;  3H1J D;  5E79 E;  1SQB D;  3TGU D;  3U1A A;  1CSB A;  3RBX A;  3VMH D;  3CCL P;  3CL3 D;  3ITK A;  5BU8 B;  4HB1 A;  1FZF A;  4DCK A;  3GKE A;  2KNC B;  3Q3D A;  1PPJ E;  3OJA B;  3O6Q A;  1T6A A;  1SQB J;  1Q82 Q;  2M5A A;  3BAS A;  2QRX A;  1ZW0 A;  5CCH A;  2PAJ A;  3USS A;  2YO3 A;  2M3B A;  1BE3 E;  4IOI H;  2WPV B;  3F5H A;  4HKV A;  3RK2 C;  2ZT9 B;  3BRV B;  1ZV8 A;  3L35 A;  4H13 D;  4Z1M H;  1VQK P;  1W2E A;  1LP1 A;  2P1J A;  3G6E P;  2K9Y A;  2ZAE B;  1NWQ A;  1M1K Q;  2HMM A;  1KN7 A;  4MN4 C;  4QDF B;  2BCC D;  5AEU A;  5TIS E;  4H13 B;  2NPS A;  3CCM P;  1L4A A;  1T8Z A;  2QVA A;  2FFD A;  1PP9 D;  2Y9Z A;  2OYH A;  5AVS B;  3C8V A;  3HUS C;  2I1K A;  4H0L B;  2JJL A;  2V4H A;  1VQ9 P;  4QDD A;  3N7N A;  1VPC A;  2P67 A;  2Q5U A;  1NKZ B;  1SQP E;  1SQP K;  2YKP A;  3FGA D;  3BVH A;  1MFT A;  3W67 A;  4EDF A;  3RK3 E;  3GF3 A;  2E74 B;  4BRY A;  2RH0 A;  4BWN A;  3VMA A;  2KS1 A;  3B5N B;  1OIP A;  3HD7 D;  4L73 A;  3H1H E;  2W90 A;  3LW5 J;  3JSV C;  3HTK B;  5APS A;  2QPZ A;  4GKG A;  1QL2 A;  4HJG H;  4RJT A;  1NHL A;  3MTU E;  3BCC J;  1NTK E;  1PFI A;  1IFP A;  5KKZ C;  2WPR A;  3L37 A;  1SFC A;  1L0L J;  2XR8 A;  2YIU B;  3OA7 A;  1DX7 A;  3OW2 O;  2A45 G;  1N2D C;  1NTZ E;  4Y28 J;  3H1K E;  4NBH D;  1M56 D;  4EI2 A;  1M90 Q;  2E76 C;  1NTK J;  2Y0E A;  3E1I A;  3BRT B;  5CCG A;  4WWI A;  1LTJ A;  2J59 M;  1D7M A;  3RGU A;  5AW7 B;  2R3S A;  1LTJ B;  3GTE A;  3D6Z A;  1IC2 A;  1A02 J;  5M1B A;  1EDK A;  1DH3 A;  3WUU A;  3A3Y B;  3V5B A;  2YFL A;  4IL6 E;  3FOU A;  1SQQ K;  1Y9B A;  3T97 A;  4IL6 X;  2C9L Y;  2XZR A;  3O6Q B;  3M91 A;  1FDO A;  4ZKU A;  1NU1 E;  1UIX A;  1NTM K;  3DQY A;  4BXL A;  3V4W A;  3L70 J;  2L91 A;  4GOD A;  2OYI B;  2AXC A;  4YXD C;  3RBZ A;  4BRY B;  5DJU B;  3ABV C;  2QM7 A;  1T3J A;  2Y0D A;  1YIJ P;  3AEA C;  2WSS H;  1JEK A;  1OW8 A;  3AEG C;  3N0Q A;  5KAI H;  2XSH A;  4DOJ A;  1OZH A;  4UB6 E;  1EZV E;  1R8E A;  4M3L A;  2HR3 A;  4L75 A;  3IAO A;  3H1J J;  2OGU A;  1NKN A;  2I7F A;  3L72 G;  4NBB D;  1JB0 J;  3AE7 C;  4A7P A;  1FOS E;  1YBK A;  1JMM A;  1L0N E;  1L0N K;  3N4X A;  4K35 A;  1ZOY C;  1YHQ P;  4WY4 C;  2BCC G;  4LGD E;  5AVZ B;  2CPB A;  3A2A A;  2QJK C;  5B66 H;  1KD1 Q;  3H6P A;  5KLV D;  2HML A;  1VF5 B;  2R32 A;  3M9H A;  1LNQ A;  3GW6 A;  1NVO A;  4JYB A;  2KIK A;  2IBZ E;  4WB4 A;  2J5U A;  2WTY A;  3NTN A;  2WSC J;  2YO2 A;  3M0A A;  3CD6 P;  1NJI Q;  3HRN A;  1YIT P;  2KS1 B;  5KLI B;  1L0L E;  1EZV I;  1P84 H;  1VQ6 P;  1KV4 A;  1E5W A;  3A0H E;  2Y9Y A;  4OGQ B;  5CMZ A;  2YIU C;  3AE3 C;  1EDL A;  1X9V A;  1USD A;  2QG4 A;  2R3C A;  1KYO H;  2JR8 A;  5BU5 A;  1Q81 Q;  1SFC B;  5KJ7 D;  2FFD C;  1IO4 A;  5EFW B;  3CX5 E;  2LXB A;  3SWF A;  5H2F H;  1T2K D;  1SQV G;  4IFM A;  2JO1 A;  1PIX A;  3C9I A;  3M0D C;  4HM5 A;  1XTC C;  2E76 D;  3MD0 A;  1X0T A;  2FYN B;  4NB8 D;  2N9B A;  3VCP A;  1LWU C;  2G3A A;  4TLF A;  2E74 D;  3JCU E;  1JY2 N;  5CCG C;  2C0X A;  3EWK A;  2XRX A;  1RY3 A;  2BEQ D;  1VQM P;  1VQO P;  3KZI H;  4U3F D;  1EDJ A;  1KIL E;  2ZVN B;  1PZQ A;  5CXM A;  1S2E A;  1KB9 E;  1WT6 A;  1FC2 C;  1S9K E;  4KHX A;  1MKM A;  3FWL A;  1PPJ D;  2QJP B;  4AUW A;  1RF0 A;  1BCC G;  2FKW B;  3HUS B;  1JM0 A;  4I1L A;  1OW6 A;  3A0H H;  4C7R A;  1M1J A;  2QA4 P;  1KYO D;  4WY4 D;  4NBG D;  2YKQ A;  1SQX D;  3KXD A;  5C39 A;  4GIF A;  4UB8 H;  1USE A;  1FJP A;  2ZT9 C;  4D6T E;  4WBA A;  2J58 A;  2YKO A;  2WMM A;  3AE2 C;  5AVR B;  1H88 A;  1GU4 A;  1M7L A;  2DW3 A;  1U7M A;  4K3A A;  2DE7 D;  1NTZ G;  1FQT A;  1O7N A;  2Z5H A;  3CCS P;  3MP7 B;  1N7S B;  1ULI A;  1VDF A;  3SFD C;  2WVR A; 
#chains in the Genus database with same CATH homology
 2HMM A;  2NUK A;  2E75 B;  1U57 A;  4QDF B;  3AEF C;  1K04 A;  2V7Q J;  1O7G A;  5AEU A;  4H13 B;  4XFJ A;  1YQ4 C;  2ZT9 D;  1ZRT E;  4H44 D;  3L71 E;  4HM7 A;  2P10 A;  3GTS A;  2IDB A;  3C8V A;  2GBW A;  1VL2 A;  2E4Q A;  4H0L B;  4QDD A;  3Q5R A;  2DE5 D;  2HMO A;  1SQP E;  2HMN A;  2O01 J;  1NDO A;  3FGA D;  4PD4 E;  4OGQ C;  1KOR A;  3R4Y A;  4PV1 C;  1OW7 A;  4QUR A;  1KQG B;  3RK3 E;  3GF3 A;  4HM1 A;  3L73 E;  2HMK A;  2E74 B;  1G8J B;  3GCE A;  3AE5 C;  4YTP C;  2WQY C;  1UUW A;  1JM1 A;  1BCC E;  2MKV A;  2ZYL A;  1DD3 A;  3VCA A;  2QJY C;  2Q3W A;  3H1H E;  3LW5 J;  1TU3 F;  2QPZ A;  2NVF A;  2D2C B;  4PV1 B;  1VF5 C;  2E75 C;  1S5L X;  1HF9 A;  1P84 E;  3G9R A;  1NTK E;  4NBA D;  3H1J E;  5KKZ C;  1VF5 D;  2FYU E;  4U3F E;  2XR8 A;  4HM3 A;  4NBC D;  3RL0 g;  2QIW A;  1NTZ E;  4Y28 J;  2QSI A;  3EN1 A;  1DD4 A;  1SJG A;  3H1K E;  2OQQ A;  2NVG A;  4NBH D;  4H44 C;  5L8R J;  2E76 C;  3D89 A;  2FBW C;  3AE9 C;  3VMG D;  1EG9 A;  1VM9 A;  1WMK A;  1K05 A;  3L70 E;  4PV1 D;  4HM0 A;  2E4P A;  2QJP C;  4P1C H;  3S9O A;  3SFE C;  4HM6 A;  1OMI A;  3GTE A;  3D6Z A;  3Q2Y A;  2CKF A;  5M1B A;  3AEC C;  1FDI A;  5KLI C;  2BMR A;  3GOB A;  5AEW A;  3L72 E;  4QDC A;  2YFL A;  4HM8 A;  3FOU A;  1Y9B A;  2JP3 A;  3AEB C;  4IL6 X;  4R4M A;  3L74 E;  4HM2 A;  1Q90 C;  1FDO A;  1KMI Z;  2H89 C;  2E76 B;  2DE6 D;  1NU1 E;  1UIX A;  1O7W A;  3DQY A;  3TGU E;  2NWF A;  4YXD C;  4QUQ A;  1ZME C;  3GL2 A;  2YMK A;  3Q5S A;  4NBE D;  3ABV C;  3BCC E;  3AEA C;  3GMA A;  2BCC E;  2B1X A;  1OW8 A;  1DIP A;  2D2C D;  3IN6 A;  3AEG C;  3AE4 C;  3N0Q A;  3VMI D;  2XSH A;  2D2C C;  1SQQ E;  2YFJ A;  1O7M A;  3H25 A;  1EZV E;  1R8E A;  1GMJ A;  3IAO A;  1KQF B;  2I7F A;  4NBB D;  2YVJ B;  2FYN C;  1AJY A;  1JB0 J;  3AE7 C;  2NZ2 A;  1L0N E;  1YQ3 C;  1ZOY C;  4QDF A;  2E74 C;  1RFS A;  3AE8 C;  2NVE A;  4P1B H;  2QJK C;  1Q90 D;  2A06 E;  1O7P A;  2WSF J;  2HML A;  1RQU A;  1PV3 A;  1VF5 B;  4NB9 D;  3CWB E;  4NBF D;  4TT3 H;  1RIE A;  1ULJ A;  3GZY A;  2IBZ E;  4EMJ B;  3H1L E;  2H88 C;  2J5U A;  3EQQ A;  1PP9 E;  2WSC J;  2XSO A;  5BOK A;  4H44 B;  1NYK A;  1KTM A;  3D71 A;  4KT0 J;  2YFI A;  4RKU J;  1HJ0 A;  1L0L E;  3AEE C;  2FXP A;  1WQL A;  4OGQ B;  2YIU C;  3AE3 C;  2BMQ A;  1S1C X;  4NBD D;  4QCK A;  1SQV E;  2G8Y A;  3B71 A;  1VCK A;  5KLV E;  3D6Y A;  3GL0 A;  5HL4 A;  3GF7 A;  2BMO A;  3AZC A;  3CX5 E;  3AE6 C;  4I7Z C;  3D70 A;  1O7H A;  4R4L A;  1RQV A;  3CXH E;  2JO1 A;  1PIX A;  3Q5P A;  4HJL A;  2E75 D;  4HM5 A;  2E76 D;  1SQX E;  3C0D A;  4NB8 D;  3VCP A;  2G3A A;  2E74 D;  3EWK A;  2B24 A;  2XRX A;  2BEQ D;  1EXI A;  1KYO E;  1KIL E;  2GBX A;  5CXM A;  1NGM B;  3H1I E;  1KB9 E;  1IK7 A;  1MKM A;  4U7J A;  1PL5 A;  2NUM A;  4GDO A;  3GB4 A;  3T97 B;  1OW6 A;  4QUP A;  2WSE J;  3VMH D;  4NBG D;  3GZX A;  4AAY B;  1NYH A;  4HM4 A;  3Q1M A;  3AED C;  3GKE A;  3Q3D A;  1PPJ E;  3O6Q A;  3AE1 C;  2ZT9 C;  1EXJ A;  2BEZ F;  4AIV A;  3AE2 C;  4OGQ D;  3L75 E;  2JZA A;  4H0L D;  1ZP0 C;  1G8K B;  1NTM E;  1SQB E;  2DE7 D;  4H13 C;  1UUV A;  1FQT A;  1O7N A;  2JO6 A;  4I7Z B;  1BE3 E;  2WPV B;  3GLM A;  4HKV A;  2HMJ A;  2ZT9 B;  1ULI A;  4H13 D;  3SFD C;  4Z1M H;  2K9Y A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...