5AEUA

Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
442
structure length
433
Chain Sequence
b'NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Enhanced Pollutant-Degrading Capabilities of an Engineered Biphenyl Dioxygenase
pubmed doi rcsb
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
source organism Burkholderia xenovorans lb400
molecule tags Oxidoreductase
total genus 139
structure length 433
sequence length 442
chains with identical sequence C, E, G
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5aeuA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5aeuA01
1KYOE 1O7WA 2B1XA 2FYNC 5KKZC 4HM7A 4QUQA 1SQQE 2XR8A 3L72E 3L74E 1BE3E 4HM1A 2YIUC 5KLVE 4NBAD 1UUVA 2NWFA 4AAYB 4NBFA 4NBCD 4QDFB 2HMNA 1O7GA 3VMHA 2QPZA 4PD4E 3TGUE 4NBEA 2GBWA 2BMRA 2E74D 4NBHA 2ZT9D 1Z01A 4HM5A 2B24A 5KLIC 2YFLA 2Q3WA 4AIVA 1PPJE 4OGQD 1SJGA 1NU1E 2CKFA 4HM2A 3H1KE 4P1CH 3AZCA 1P84E 1JM1A 2ZYLA 1WW9A 5CXMA 3GL0A 3L75E 2HMLA 2E75D 2FYUE 1O7HA 3VMGD 4EMJB 4NBGA 1G8JB 4NBFD 4NBDD 2D2CD 2E4QA 2I7FA 3VMHD 4NB8A 3GKQA 3GB4A 3EQQA 3GL2A 4PV1D 5BOKA 1VF5D 4NBED 1L0LE 1NDOA 1SQPE 3H1IE 4QURA 4NBHD 5AEUA 1PP9E 2E4PA 3C0DA 3GOBA 2NVEA 1EG9A 4QDCA 2YFIA 4NBBA 4HM0A 3GCEA 4QDDA 3N0QA 1NTZE 1RFSA 1SQXE 4HM3A 1VM9A 2HMJA 1O7NA 3GZXA 3CX5E 1Z02A 4U3FE 2NUKA 3GTEA 5AEWA 4NBGD 3GZYA 4H0LD 1SQBE 1NTME 2NVGA 1RIEA 2A06E 3GKEA 1Q90C 3L73E 5HL4A 2DE5A 1EZVE 1ZRTE 2HMMA 1Z03A 4NBAA 1G8KB 3H1JE 4NBBD 4NBCA 1NYKA 2XRXA 2DE7A 2NUMA 4HM6A 1O7PA 2BMOA 4HM8A 3CWBE 1UUWA 3VCAA 2BCCE 2DE6A 4QDFA 3GCFA 1O7MA 3D89A 4NB9A 4P1BH 1KB9E 2HMOA 3CXHE 1NTKE 3FOUA 1ULIA 1SQVE 3GTSA 3VMIA 3H1LE 4QUPA 1BCCE 2GBXA 3BCCE 2DE5D 3EN1A 4NB8D 2JO6A 3VMGA 2QJPC 4H44D 1ULJA 2HMKA 3VCPA 1FQTA 4NBDA 2XSOA 1WQLA 4HJLA 2DE7D 2NVFA 3L71E 2DE6D 1L0NE 2QJYC 4HM4A 4NB9D 2YVJB 2YFJA 2BMQA 4H13D 2E76D 1VCKA 2XSHA 3H1HE 3DQYA 2IBZE 2JZAA 4QCKA 3L70E 3VMID 2QJKC 4HKVA
chains in the Genus database with same CATH superfamily
1KYOE 1O7WA 2B1XA 2FYNC 5KKZC 4HM7A 4QUQA 1SQQE 2XR8A 3L72E 3L74E 1BE3E 4HM1A 2YIUC 5KLVE 4NBAD 1UUVA 2NWFA 4AAYB 4NBFA 4NBCD 4QDFB 2HMNA 1O7GA 3VMHA 2QPZA 4PD4E 3TGUE 4NBEA 2GBWA 2BMRA 2E74D 4NBHA 2ZT9D 1Z01A 4HM5A 2B24A 5KLIC 2YFLA 2Q3WA 4AIVA 1PPJE 4OGQD 1SJGA 1NU1E 2CKFA 4HM2A 3H1KE 4P1CH 3AZCA 1P84E 1JM1A 2ZYLA 1WW9A 5CXMA 3GL0A 3L75E 2HMLA 2E75D 2FYUE 1O7HA 3VMGD 4EMJB 4NBGA 1G8JB 4NBFD 4NBDD 2D2CD 2E4QA 2I7FA 3VMHD 4NB8A 3GKQA 3GB4A 3EQQA 3GL2A 4PV1D 5BOKA 1VF5D 4NBED 1L0LE 1NDOA 1SQPE 3H1IE 4QURA 4NBHD 5AEUA 1PP9E 2E4PA 3C0DA 3GOBA 2NVEA 1EG9A 4QDCA 2YFIA 4NBBA 4HM0A 3GCEA 4QDDA 3N0QA 1NTZE 1RFSA 1SQXE 4HM3A 1VM9A 2HMJA 1O7NA 3GZXA 3CX5E 1Z02A 4U3FE 2NUKA 3GTEA 5AEWA 4NBGD 3GZYA 4H0LD 1SQBE 1NTME 2NVGA 1RIEA 2A06E 3GKEA 1Q90C 3L73E 5HL4A 2DE5A 1EZVE 1ZRTE 2HMMA 1Z03A 4NBAA 1G8KB 3H1JE 4NBBD 4NBCA 1NYKA 2XRXA 2DE7A 2NUMA 4HM6A 1O7PA 2BMOA 4HM8A 3CWBE 1UUWA 3VCAA 2BCCE 2DE6A 4QDFA 3GCFA 1O7MA 3D89A 4NB9A 4P1BH 1KB9E 2HMOA 3CXHE 1NTKE 3FOUA 1ULIA 1SQVE 3GTSA 3VMIA 3H1LE 4QUPA 1BCCE 2GBXA 3BCCE 2DE5D 3EN1A 4NB8D 2JO6A 3VMGA 2QJPC 4H44D 1ULJA 2HMKA 3VCPA 1FQTA 4NBDA 2XSOA 1WQLA 4HJLA 2DE7D 2NVFA 3L71E 2DE6D 1L0NE 2QJYC 4HM4A 4NB9D 2YVJB 2YFJA 2BMQA 4H13D 2E76D 1VCKA 2XSHA 3H1HE 3DQYA 2IBZE 2JZAA 4QCKA 3L70E 3VMID 2QJKC 4HKVA
chains in the Genus database with same CATH topology
1KYOE 1O7WA 2B1XA 2FYNC 5KKZC 4HM7A 4QUQA 1SQQE 2XR8A 3L72E 3L74E 1BE3E 4HM1A 2YIUC 5KLVE 4NBAD 1UUVA 2NWFA 4AAYB 4NBFA 4NBCD 4QDFB 2HMNA 1O7GA 3VMHA 2QPZA 4PD4E 3TGUE 4NBEA 2GBWA 2BMRA 2E74D 4NBHA 2ZT9D 1Z01A 4HM5A 2B24A 5KLIC 2YFLA 2Q3WA 4AIVA 1PPJE 4OGQD 1SJGA 1NU1E 2CKFA 4HM2A 3H1KE 4P1CH 3AZCA 1P84E 1JM1A 2ZYLA 1WW9A 5CXMA 3GL0A 3L75E 2HMLA 2E75D 2FYUE 1O7HA 3VMGD 4EMJB 4NBGA 1G8JB 4NBFD 4NBDD 2D2CD 2E4QA 2I7FA 3VMHD 4NB8A 3GKQA 3GB4A 3EQQA 3GL2A 4PV1D 5BOKA 1VF5D 4NBED 1L0LE 1NDOA 1SQPE 3H1IE 4QURA 4NBHD 5AEUA 1PP9E 2E4PA 3C0DA 3GOBA 2NVEA 1EG9A 4QDCA 2YFIA 4NBBA 4HM0A 3GCEA 4QDDA 3N0QA 1NTZE 1RFSA 1SQXE 4HM3A 1VM9A 2HMJA 1O7NA 3GZXA 3CX5E 1Z02A 4U3FE 2NUKA 3GTEA 5AEWA 4NBGD 3GZYA 4H0LD 1SQBE 1NTME 2NVGA 1RIEA 2A06E 3GKEA 1Q90C 3L73E 5HL4A 2DE5A 1EZVE 1ZRTE 2HMMA 1Z03A 4NBAA 1G8KB 3H1JE 4NBBD 4NBCA 1NYKA 2XRXA 2DE7A 2NUMA 4HM6A 1O7PA 2BMOA 4HM8A 3CWBE 1UUWA 3VCAA 2BCCE 2DE6A 4QDFA 3GCFA 1O7MA 3D89A 4NB9A 4P1BH 1KB9E 2HMOA 3CXHE 1NTKE 3FOUA 1ULIA 1SQVE 3GTSA 3VMIA 3H1LE 4QUPA 1BCCE 2GBXA 3BCCE 2DE5D 3EN1A 4NB8D 2JO6A 3VMGA 2QJPC 4H44D 1ULJA 2HMKA 3VCPA 1FQTA 4NBDA 2XSOA 1WQLA 4HJLA 2DE7D 2NVFA 3L71E 2DE6D 1L0NE 2QJYC 4HM4A 4NB9D 2YVJB 2YFJA 2BMQA 4H13D 2E76D 1VCKA 2XSHA 3H1HE 3DQYA 2IBZE 2JZAA 4QCKA 3L70E 3VMID 2QJKC 4HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO E;  1O7W A;  2B1X A;  2FYN C;  5KKZ C;  4HM7 A;  4QUQ A;  1SQQ E;  2XR8 A;  3L72 E;  3L74 E;  1BE3 E;  4HM1 A;  2YIU C;  5KLV E;  4NBA D;  1UUV A;  2NWF A;  4AAY B;  4NBF A;  4NBC D;  4QDF B;  2HMN A;  1O7G A;  3VMH A;  2QPZ A;  4PD4 E;  3TGU E;  4NBE A;  2GBW A;  2BMR A;  2E74 D;  4NBH A;  2ZT9 D;  1Z01 A;  4HM5 A;  2B24 A;  5KLI C;  2YFL A;  2Q3W A;  4AIV A;  1PPJ E;  4OGQ D;  1SJG A;  1NU1 E;  2CKF A;  4HM2 A;  3H1K E;  4P1C H;  3AZC A;  1P84 E;  1JM1 A;  2ZYL A;  1WW9 A;  5CXM A;  3GL0 A;  3L75 E;  2HML A;  2E75 D;  2FYU E;  1O7H A;  3VMG D;  4EMJ B;  4NBG A;  1G8J B;  4NBF D;  4NBD D;  2D2C D;  2E4Q A;  2I7F A;  3VMH D;  4NB8 A;  3GKQ A;  3GB4 A;  3EQQ A;  3GL2 A;  4PV1 D;  5BOK A;  1VF5 D;  4NBE D;  1L0L E;  1NDO A;  1SQP E;  3H1I E;  4QUR A;  4NBH D;  5AEU A;  1PP9 E;  2E4P A;  3C0D A;  3GOB A;  2NVE A;  1EG9 A;  4QDC A;  2YFI A;  4NBB A;  4HM0 A;  3GCE A;  4QDD A;  3N0Q A;  1NTZ E;  1RFS A;  1SQX E;  4HM3 A;  1VM9 A;  2HMJ A;  1O7N A;  3GZX A;  3CX5 E;  1Z02 A;  4U3F E;  2NUK A;  3GTE A;  5AEW A;  4NBG D;  3GZY A;  4H0L D;  1SQB E;  1NTM E;  2NVG A;  1RIE A;  2A06 E;  3GKE A;  1Q90 C;  3L73 E;  5HL4 A;  2DE5 A;  1EZV E;  1ZRT E;  2HMM A;  1Z03 A;  4NBA A;  1G8K B;  3H1J E;  4NBB D;  4NBC A;  1NYK A;  2XRX A;  2DE7 A;  2NUM A;  4HM6 A;  1O7P A;  2BMO A;  4HM8 A;  3CWB E;  1UUW A;  3VCA A;  2BCC E;  2DE6 A;  4QDF A;  3GCF A;  1O7M A;  3D89 A;  4NB9 A;  4P1B H;  1KB9 E;  2HMO A;  3CXH E;  1NTK E;  3FOU A;  1ULI A;  1SQV E;  3GTS A;  3VMI A;  3H1L E;  4QUP A;  1BCC E;  2GBX A;  3BCC E;  2DE5 D;  3EN1 A;  4NB8 D;  2JO6 A;  3VMG A;  2QJP C;  4H44 D;  1ULJ A;  2HMK A;  3VCP A;  1FQT A;  4NBD A;  2XSO A;  1WQL A;  4HJL A;  2DE7 D;  2NVF A;  3L71 E;  2DE6 D;  1L0N E;  2QJY C;  4HM4 A;  4NB9 D;  2YVJ B;  2YFJ A;  2BMQ A;  4H13 D;  2E76 D;  1VCK A;  2XSH A;  3H1H E;  3DQY A;  2IBZ E;  2JZA A;  4QCK A;  3L70 E;  3VMI D;  2QJK C;  4HKV A; 
#chains in the Genus database with same CATH topology
 1KYO E;  1O7W A;  2B1X A;  2FYN C;  5KKZ C;  4HM7 A;  4QUQ A;  1SQQ E;  2XR8 A;  3L72 E;  3L74 E;  1BE3 E;  4HM1 A;  2YIU C;  5KLV E;  4NBA D;  1UUV A;  2NWF A;  4AAY B;  4NBF A;  4NBC D;  4QDF B;  2HMN A;  1O7G A;  3VMH A;  2QPZ A;  4PD4 E;  3TGU E;  4NBE A;  2GBW A;  2BMR A;  2E74 D;  4NBH A;  2ZT9 D;  1Z01 A;  4HM5 A;  2B24 A;  5KLI C;  2YFL A;  2Q3W A;  4AIV A;  1PPJ E;  4OGQ D;  1SJG A;  1NU1 E;  2CKF A;  4HM2 A;  3H1K E;  4P1C H;  3AZC A;  1P84 E;  1JM1 A;  2ZYL A;  1WW9 A;  5CXM A;  3GL0 A;  3L75 E;  2HML A;  2E75 D;  2FYU E;  1O7H A;  3VMG D;  4EMJ B;  4NBG A;  1G8J B;  4NBF D;  4NBD D;  2D2C D;  2E4Q A;  2I7F A;  3VMH D;  4NB8 A;  3GKQ A;  3GB4 A;  3EQQ A;  3GL2 A;  4PV1 D;  5BOK A;  1VF5 D;  4NBE D;  1L0L E;  1NDO A;  1SQP E;  3H1I E;  4QUR A;  4NBH D;  5AEU A;  1PP9 E;  2E4P A;  3C0D A;  3GOB A;  2NVE A;  1EG9 A;  4QDC A;  2YFI A;  4NBB A;  4HM0 A;  3GCE A;  4QDD A;  3N0Q A;  1NTZ E;  1RFS A;  1SQX E;  4HM3 A;  1VM9 A;  2HMJ A;  1O7N A;  3GZX A;  3CX5 E;  1Z02 A;  4U3F E;  2NUK A;  3GTE A;  5AEW A;  4NBG D;  3GZY A;  4H0L D;  1SQB E;  1NTM E;  2NVG A;  1RIE A;  2A06 E;  3GKE A;  1Q90 C;  3L73 E;  5HL4 A;  2DE5 A;  1EZV E;  1ZRT E;  2HMM A;  1Z03 A;  4NBA A;  1G8K B;  3H1J E;  4NBB D;  4NBC A;  1NYK A;  2XRX A;  2DE7 A;  2NUM A;  4HM6 A;  1O7P A;  2BMO A;  4HM8 A;  3CWB E;  1UUW A;  3VCA A;  2BCC E;  2DE6 A;  4QDF A;  3GCF A;  1O7M A;  3D89 A;  4NB9 A;  4P1B H;  1KB9 E;  2HMO A;  3CXH E;  1NTK E;  3FOU A;  1ULI A;  1SQV E;  3GTS A;  3VMI A;  3H1L E;  4QUP A;  1BCC E;  2GBX A;  3BCC E;  2DE5 D;  3EN1 A;  4NB8 D;  2JO6 A;  3VMG A;  2QJP C;  4H44 D;  1ULJ A;  2HMK A;  3VCP A;  1FQT A;  4NBD A;  2XSO A;  1WQL A;  4HJL A;  2DE7 D;  2NVF A;  3L71 E;  2DE6 D;  1L0N E;  2QJY C;  4HM4 A;  4NB9 D;  2YVJ B;  2YFJ A;  2BMQ A;  4H13 D;  2E76 D;  1VCK A;  2XSH A;  3H1H E;  3DQY A;  2IBZ E;  2JZA A;  4QCK A;  3L70 E;  3VMI D;  2QJK C;  4HKV A; 
#chains in the Genus database with same CATH homology
 1KYO E;  1O7W A;  2B1X A;  2FYN C;  5KKZ C;  4HM7 A;  4QUQ A;  1SQQ E;  2XR8 A;  3L72 E;  3L74 E;  1BE3 E;  4HM1 A;  2YIU C;  5KLV E;  4NBA D;  1UUV A;  2NWF A;  4AAY B;  4NBF A;  4NBC D;  4QDF B;  2HMN A;  1O7G A;  3VMH A;  2QPZ A;  4PD4 E;  3TGU E;  4NBE A;  2GBW A;  2BMR A;  2E74 D;  4NBH A;  2ZT9 D;  1Z01 A;  4HM5 A;  2B24 A;  5KLI C;  2YFL A;  2Q3W A;  4AIV A;  1PPJ E;  4OGQ D;  1SJG A;  1NU1 E;  2CKF A;  4HM2 A;  3H1K E;  4P1C H;  3AZC A;  1P84 E;  1JM1 A;  2ZYL A;  1WW9 A;  5CXM A;  3GL0 A;  3L75 E;  2HML A;  2E75 D;  2FYU E;  1O7H A;  3VMG D;  4EMJ B;  4NBG A;  1G8J B;  4NBF D;  4NBD D;  2D2C D;  2E4Q A;  2I7F A;  3VMH D;  4NB8 A;  3GKQ A;  3GB4 A;  3EQQ A;  3GL2 A;  4PV1 D;  5BOK A;  1VF5 D;  4NBE D;  1L0L E;  1NDO A;  1SQP E;  3H1I E;  4QUR A;  4NBH D;  5AEU A;  1PP9 E;  2E4P A;  3C0D A;  3GOB A;  2NVE A;  1EG9 A;  4QDC A;  2YFI A;  4NBB A;  4HM0 A;  3GCE A;  4QDD A;  3N0Q A;  1NTZ E;  1RFS A;  1SQX E;  4HM3 A;  1VM9 A;  2HMJ A;  1O7N A;  3GZX A;  3CX5 E;  1Z02 A;  4U3F E;  2NUK A;  3GTE A;  5AEW A;  4NBG D;  3GZY A;  4H0L D;  1SQB E;  1NTM E;  2NVG A;  1RIE A;  2A06 E;  3GKE A;  1Q90 C;  3L73 E;  5HL4 A;  2DE5 A;  1EZV E;  1ZRT E;  2HMM A;  1Z03 A;  4NBA A;  1G8K B;  3H1J E;  4NBB D;  4NBC A;  1NYK A;  2XRX A;  2DE7 A;  2NUM A;  4HM6 A;  1O7P A;  2BMO A;  4HM8 A;  3CWB E;  1UUW A;  3VCA A;  2BCC E;  2DE6 A;  4QDF A;  3GCF A;  1O7M A;  3D89 A;  4NB9 A;  4P1B H;  1KB9 E;  2HMO A;  3CXH E;  1NTK E;  3FOU A;  1ULI A;  1SQV E;  3GTS A;  3VMI A;  3H1L E;  4QUP A;  1BCC E;  2GBX A;  3BCC E;  2DE5 D;  3EN1 A;  4NB8 D;  2JO6 A;  3VMG A;  2QJP C;  4H44 D;  1ULJ A;  2HMK A;  3VCP A;  1FQT A;  4NBD A;  2XSO A;  1WQL A;  4HJL A;  2DE7 D;  2NVF A;  3L71 E;  2DE6 D;  1L0N E;  2QJY C;  4HM4 A;  4NB9 D;  2YVJ B;  2YFJ A;  2BMQ A;  4H13 D;  2E76 D;  1VCK A;  2XSH A;  3H1H E;  3DQY A;  2IBZ E;  2JZA A;  4QCK A;  3L70 E;  3VMI D;  2QJK C;  4HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...