5AEUA

Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of the Enhanced Pollutant-Degrading Capabilities of an Engineered Biphenyl Dioxygenase
pubmed doi rcsb
source organism Burkholderia xenovorans lb400
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 139
structure length 433
sequence length 442
chains with identical sequence C, E, G
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5aeuA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5aeuA01
4PV1D 1FQTA 1WW9A 4QDCA 4NBFA 2DE7D 2NWFA 3AZCA 2NUMA 4NBFD 1BE3E 2D2CD 3GTEA 4HM4A 2XR8A 1PPJE 1NDOA 4NBDD 2HMMA 1SQBE 2NVEA 3H1KE 2YFJA 3L73E 1O7HA 2A06E 4NBDA 4H0LD 2E74D 3GTSA 1ULIA 4QUPA 4NBHD 2HMKA 4QDDA 3L74E 3GL2A 4NBCA 3GKQA 3H1HE 4U3FE 1UUWA 4PD4E 4NBHA 4NBCD 3EQQA 1NU1E 1SQQE 4HM6A 2JZAA 3CX5E 4H44D 4HM5A 3VCPA 1NTME 1SQPE 1UUVA 3FOUA 1NTKE 4P1CH 3D89A 2HMLA 4NB9D 2BCCE 1ZRTE 3BCCE 2I7FA 1EZVE 2XSHA 3C0DA 1SJGA 2BMRA 4QURA 3VMHD 2E76D 1Z02A 1O7WA 1NYKA 2DE6A 4NBGA 5KKZC 4NB8A 4NBAA 2YVJB 3VMIA 2DE5D 4QDFB 2ZT9D 4NBBD 1WQLA 4NBGD 5CXMA 3VMGA 2FYNC 4NBAD 3VMID 2IBZE 2QJYC 2JO6A 2YFLA 3H1JE 2DE7A 4HM7A 3GKEA 5AEWA 4HM2A 4NBEA 4AAYB 2XRXA 1Z01A 2FYUE 1VF5D 2QJKC 2HMJA 3N0QA 2CKFA 4EMJB 1RFSA 1Z03A 1O7MA 1PP9E 1G8JB 4HM0A 3H1LE 3GZYA 3GOBA 4OGQD 1KB9E 1P84E 3VCAA 2HMOA 1O7GA 4HKVA 2B24A 2GBXA 3L70E 4QCKA 4H13D 5KLVE 1SQXE 4AIVA 1RIEA 5HL4A 2E4QA 1VCKA 2QPZA 3TGUE 1EG9A 1BCCE 2GBWA 1JM1A 2HMNA 4NB9A 3EN1A 3GB4A 5KLIC 1L0LE 1O7NA 2NVGA 4HM8A 2NVFA 3VMHA 2QJPC 3CXHE 2YIUC 4HJLA 1G8KB 2DE6D 5AEUA 2XSOA 3L71E 4HM3A 2E4PA 2Q3WA 2NUKA 1O7PA 2YFIA 1SQVE 4HM1A 2ZYLA 3GCFA 1VM9A 3CWBE 4QUQA 2B1XA 1L0NE 3L72E 4NBED 3DQYA 3GCEA 1KYOE 1NTZE 3GL0A 3H1IE 2BMOA 3GZXA 3L75E 2BMQA 4NB8D 4P1BH 2DE5A 1ULJA 2E75D 3VMGD 4NBBA 4QDFA 1Q90C 5BOKA
chains in the Genus database with same CATH superfamily
4PV1D 1FQTA 1WW9A 4QDCA 4NBFA 2DE7D 2NWFA 3AZCA 2NUMA 4NBFD 1BE3E 2D2CD 3GTEA 4HM4A 2XR8A 1PPJE 1NDOA 4NBDD 2HMMA 1SQBE 2NVEA 3H1KE 2YFJA 3L73E 1O7HA 2A06E 4NBDA 4H0LD 2E74D 3GTSA 1ULIA 4QUPA 4NBHD 2HMKA 4QDDA 3L74E 3GL2A 4NBCA 3GKQA 3H1HE 4U3FE 1UUWA 4PD4E 4NBHA 4NBCD 3EQQA 1NU1E 1SQQE 4HM6A 2JZAA 3CX5E 4H44D 4HM5A 3VCPA 1NTME 1SQPE 1UUVA 3FOUA 1NTKE 4P1CH 3D89A 2HMLA 4NB9D 2BCCE 1ZRTE 3BCCE 2I7FA 1EZVE 2XSHA 3C0DA 1SJGA 2BMRA 4QURA 3VMHD 2E76D 1Z02A 1O7WA 1NYKA 2DE6A 4NBGA 5KKZC 4NB8A 4NBAA 2YVJB 3VMIA 2DE5D 4QDFB 2ZT9D 4NBBD 1WQLA 4NBGD 5CXMA 3VMGA 2FYNC 4NBAD 3VMID 2IBZE 2QJYC 2JO6A 2YFLA 3H1JE 2DE7A 4HM7A 3GKEA 5AEWA 4HM2A 4NBEA 4AAYB 2XRXA 1Z01A 2FYUE 1VF5D 2QJKC 2HMJA 3N0QA 2CKFA 4EMJB 1RFSA 1Z03A 1O7MA 1PP9E 1G8JB 4HM0A 3H1LE 3GZYA 3GOBA 4OGQD 1KB9E 1P84E 3VCAA 2HMOA 1O7GA 4HKVA 2B24A 2GBXA 3L70E 4QCKA 4H13D 5KLVE 1SQXE 4AIVA 1RIEA 5HL4A 2E4QA 1VCKA 2QPZA 3TGUE 1EG9A 1BCCE 2GBWA 1JM1A 2HMNA 4NB9A 3EN1A 3GB4A 5KLIC 1L0LE 1O7NA 2NVGA 4HM8A 2NVFA 3VMHA 2QJPC 3CXHE 2YIUC 4HJLA 1G8KB 2DE6D 5AEUA 2XSOA 3L71E 4HM3A 2E4PA 2Q3WA 2NUKA 1O7PA 2YFIA 1SQVE 4HM1A 2ZYLA 3GCFA 1VM9A 3CWBE 4QUQA 2B1XA 1L0NE 3L72E 4NBED 3DQYA 3GCEA 1KYOE 1NTZE 3GL0A 3H1IE 2BMOA 3GZXA 3L75E 2BMQA 4NB8D 4P1BH 2DE5A 1ULJA 2E75D 3VMGD 4NBBA 4QDFA 1Q90C 5BOKA
chains in the Genus database with same CATH topology
4PV1D 1FQTA 1WW9A 4QDCA 4NBFA 2DE7D 2NWFA 3AZCA 2NUMA 4NBFD 1BE3E 2D2CD 3GTEA 4HM4A 2XR8A 1PPJE 1NDOA 4NBDD 2HMMA 1SQBE 2NVEA 3H1KE 2YFJA 3L73E 1O7HA 2A06E 4NBDA 4H0LD 2E74D 3GTSA 1ULIA 4QUPA 4NBHD 2HMKA 4QDDA 3L74E 3GL2A 4NBCA 3GKQA 3H1HE 4U3FE 1UUWA 4PD4E 4NBHA 4NBCD 3EQQA 1NU1E 1SQQE 4HM6A 2JZAA 3CX5E 4H44D 4HM5A 3VCPA 1NTME 1SQPE 1UUVA 3FOUA 1NTKE 4P1CH 3D89A 2HMLA 4NB9D 2BCCE 1ZRTE 3BCCE 2I7FA 1EZVE 2XSHA 3C0DA 1SJGA 2BMRA 4QURA 3VMHD 2E76D 1Z02A 1O7WA 1NYKA 2DE6A 4NBGA 5KKZC 4NB8A 4NBAA 2YVJB 3VMIA 2DE5D 4QDFB 2ZT9D 4NBBD 1WQLA 4NBGD 5CXMA 3VMGA 2FYNC 4NBAD 3VMID 2IBZE 2QJYC 2JO6A 2YFLA 3H1JE 2DE7A 4HM7A 3GKEA 5AEWA 4HM2A 4NBEA 4AAYB 2XRXA 1Z01A 2FYUE 1VF5D 2QJKC 2HMJA 3N0QA 2CKFA 4EMJB 1RFSA 1Z03A 1O7MA 1PP9E 1G8JB 4HM0A 3H1LE 3GZYA 3GOBA 4OGQD 1KB9E 1P84E 3VCAA 2HMOA 1O7GA 4HKVA 2B24A 2GBXA 3L70E 4QCKA 4H13D 5KLVE 1SQXE 4AIVA 1RIEA 5HL4A 2E4QA 1VCKA 2QPZA 3TGUE 1EG9A 1BCCE 2GBWA 1JM1A 2HMNA 4NB9A 3EN1A 3GB4A 5KLIC 1L0LE 1O7NA 2NVGA 4HM8A 2NVFA 3VMHA 2QJPC 3CXHE 2YIUC 4HJLA 1G8KB 2DE6D 5AEUA 2XSOA 3L71E 4HM3A 2E4PA 2Q3WA 2NUKA 1O7PA 2YFIA 1SQVE 4HM1A 2ZYLA 3GCFA 1VM9A 3CWBE 4QUQA 2B1XA 1L0NE 3L72E 4NBED 3DQYA 3GCEA 1KYOE 1NTZE 3GL0A 3H1IE 2BMOA 3GZXA 3L75E 2BMQA 4NB8D 4P1BH 2DE5A 1ULJA 2E75D 3VMGD 4NBBA 4QDFA 1Q90C 5BOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV1 D;  1FQT A;  1WW9 A;  4QDC A;  4NBF A;  2DE7 D;  2NWF A;  3AZC A;  2NUM A;  4NBF D;  1BE3 E;  2D2C D;  3GTE A;  4HM4 A;  2XR8 A;  1PPJ E;  1NDO A;  4NBD D;  2HMM A;  1SQB E;  2NVE A;  3H1K E;  2YFJ A;  3L73 E;  1O7H A;  2A06 E;  4NBD A;  4H0L D;  2E74 D;  3GTS A;  1ULI A;  4QUP A;  4NBH D;  2HMK A;  4QDD A;  3L74 E;  3GL2 A;  4NBC A;  3GKQ A;  3H1H E;  4U3F E;  1UUW A;  4PD4 E;  4NBH A;  4NBC D;  3EQQ A;  1NU1 E;  1SQQ E;  4HM6 A;  2JZA A;  3CX5 E;  4H44 D;  4HM5 A;  3VCP A;  1NTM E;  1SQP E;  1UUV A;  3FOU A;  1NTK E;  4P1C H;  3D89 A;  2HML A;  4NB9 D;  2BCC E;  1ZRT E;  3BCC E;  2I7F A;  1EZV E;  2XSH A;  3C0D A;  1SJG A;  2BMR A;  4QUR A;  3VMH D;  2E76 D;  1Z02 A;  1O7W A;  1NYK A;  2DE6 A;  4NBG A;  5KKZ C;  4NB8 A;  4NBA A;  2YVJ B;  3VMI A;  2DE5 D;  4QDF B;  2ZT9 D;  4NBB D;  1WQL A;  4NBG D;  5CXM A;  3VMG A;  2FYN C;  4NBA D;  3VMI D;  2IBZ E;  2QJY C;  2JO6 A;  2YFL A;  3H1J E;  2DE7 A;  4HM7 A;  3GKE A;  5AEW A;  4HM2 A;  4NBE A;  4AAY B;  2XRX A;  1Z01 A;  2FYU E;  1VF5 D;  2QJK C;  2HMJ A;  3N0Q A;  2CKF A;  4EMJ B;  1RFS A;  1Z03 A;  1O7M A;  1PP9 E;  1G8J B;  4HM0 A;  3H1L E;  3GZY A;  3GOB A;  4OGQ D;  1KB9 E;  1P84 E;  3VCA A;  2HMO A;  1O7G A;  4HKV A;  2B24 A;  2GBX A;  3L70 E;  4QCK A;  4H13 D;  5KLV E;  1SQX E;  4AIV A;  1RIE A;  5HL4 A;  2E4Q A;  1VCK A;  2QPZ A;  3TGU E;  1EG9 A;  1BCC E;  2GBW A;  1JM1 A;  2HMN A;  4NB9 A;  3EN1 A;  3GB4 A;  5KLI C;  1L0L E;  1O7N A;  2NVG A;  4HM8 A;  2NVF A;  3VMH A;  2QJP C;  3CXH E;  2YIU C;  4HJL A;  1G8K B;  2DE6 D;  5AEU A;  2XSO A;  3L71 E;  4HM3 A;  2E4P A;  2Q3W A;  2NUK A;  1O7P A;  2YFI A;  1SQV E;  4HM1 A;  2ZYL A;  3GCF A;  1VM9 A;  3CWB E;  4QUQ A;  2B1X A;  1L0N E;  3L72 E;  4NBE D;  3DQY A;  3GCE A;  1KYO E;  1NTZ E;  3GL0 A;  3H1I E;  2BMO A;  3GZX A;  3L75 E;  2BMQ A;  4NB8 D;  4P1B H;  2DE5 A;  1ULJ A;  2E75 D;  3VMG D;  4NBB A;  4QDF A;  1Q90 C;  5BOK A; 
#chains in the Genus database with same CATH topology
 4PV1 D;  1FQT A;  1WW9 A;  4QDC A;  4NBF A;  2DE7 D;  2NWF A;  3AZC A;  2NUM A;  4NBF D;  1BE3 E;  2D2C D;  3GTE A;  4HM4 A;  2XR8 A;  1PPJ E;  1NDO A;  4NBD D;  2HMM A;  1SQB E;  2NVE A;  3H1K E;  2YFJ A;  3L73 E;  1O7H A;  2A06 E;  4NBD A;  4H0L D;  2E74 D;  3GTS A;  1ULI A;  4QUP A;  4NBH D;  2HMK A;  4QDD A;  3L74 E;  3GL2 A;  4NBC A;  3GKQ A;  3H1H E;  4U3F E;  1UUW A;  4PD4 E;  4NBH A;  4NBC D;  3EQQ A;  1NU1 E;  1SQQ E;  4HM6 A;  2JZA A;  3CX5 E;  4H44 D;  4HM5 A;  3VCP A;  1NTM E;  1SQP E;  1UUV A;  3FOU A;  1NTK E;  4P1C H;  3D89 A;  2HML A;  4NB9 D;  2BCC E;  1ZRT E;  3BCC E;  2I7F A;  1EZV E;  2XSH A;  3C0D A;  1SJG A;  2BMR A;  4QUR A;  3VMH D;  2E76 D;  1Z02 A;  1O7W A;  1NYK A;  2DE6 A;  4NBG A;  5KKZ C;  4NB8 A;  4NBA A;  2YVJ B;  3VMI A;  2DE5 D;  4QDF B;  2ZT9 D;  4NBB D;  1WQL A;  4NBG D;  5CXM A;  3VMG A;  2FYN C;  4NBA D;  3VMI D;  2IBZ E;  2QJY C;  2JO6 A;  2YFL A;  3H1J E;  2DE7 A;  4HM7 A;  3GKE A;  5AEW A;  4HM2 A;  4NBE A;  4AAY B;  2XRX A;  1Z01 A;  2FYU E;  1VF5 D;  2QJK C;  2HMJ A;  3N0Q A;  2CKF A;  4EMJ B;  1RFS A;  1Z03 A;  1O7M A;  1PP9 E;  1G8J B;  4HM0 A;  3H1L E;  3GZY A;  3GOB A;  4OGQ D;  1KB9 E;  1P84 E;  3VCA A;  2HMO A;  1O7G A;  4HKV A;  2B24 A;  2GBX A;  3L70 E;  4QCK A;  4H13 D;  5KLV E;  1SQX E;  4AIV A;  1RIE A;  5HL4 A;  2E4Q A;  1VCK A;  2QPZ A;  3TGU E;  1EG9 A;  1BCC E;  2GBW A;  1JM1 A;  2HMN A;  4NB9 A;  3EN1 A;  3GB4 A;  5KLI C;  1L0L E;  1O7N A;  2NVG A;  4HM8 A;  2NVF A;  3VMH A;  2QJP C;  3CXH E;  2YIU C;  4HJL A;  1G8K B;  2DE6 D;  5AEU A;  2XSO A;  3L71 E;  4HM3 A;  2E4P A;  2Q3W A;  2NUK A;  1O7P A;  2YFI A;  1SQV E;  4HM1 A;  2ZYL A;  3GCF A;  1VM9 A;  3CWB E;  4QUQ A;  2B1X A;  1L0N E;  3L72 E;  4NBE D;  3DQY A;  3GCE A;  1KYO E;  1NTZ E;  3GL0 A;  3H1I E;  2BMO A;  3GZX A;  3L75 E;  2BMQ A;  4NB8 D;  4P1B H;  2DE5 A;  1ULJ A;  2E75 D;  3VMG D;  4NBB A;  4QDF A;  1Q90 C;  5BOK A; 
#chains in the Genus database with same CATH homology
 4PV1 D;  1FQT A;  1WW9 A;  4QDC A;  4NBF A;  2DE7 D;  2NWF A;  3AZC A;  2NUM A;  4NBF D;  1BE3 E;  2D2C D;  3GTE A;  4HM4 A;  2XR8 A;  1PPJ E;  1NDO A;  4NBD D;  2HMM A;  1SQB E;  2NVE A;  3H1K E;  2YFJ A;  3L73 E;  1O7H A;  2A06 E;  4NBD A;  4H0L D;  2E74 D;  3GTS A;  1ULI A;  4QUP A;  4NBH D;  2HMK A;  4QDD A;  3L74 E;  3GL2 A;  4NBC A;  3GKQ A;  3H1H E;  4U3F E;  1UUW A;  4PD4 E;  4NBH A;  4NBC D;  3EQQ A;  1NU1 E;  1SQQ E;  4HM6 A;  2JZA A;  3CX5 E;  4H44 D;  4HM5 A;  3VCP A;  1NTM E;  1SQP E;  1UUV A;  3FOU A;  1NTK E;  4P1C H;  3D89 A;  2HML A;  4NB9 D;  2BCC E;  1ZRT E;  3BCC E;  2I7F A;  1EZV E;  2XSH A;  3C0D A;  1SJG A;  2BMR A;  4QUR A;  3VMH D;  2E76 D;  1Z02 A;  1O7W A;  1NYK A;  2DE6 A;  4NBG A;  5KKZ C;  4NB8 A;  4NBA A;  2YVJ B;  3VMI A;  2DE5 D;  4QDF B;  2ZT9 D;  4NBB D;  1WQL A;  4NBG D;  5CXM A;  3VMG A;  2FYN C;  4NBA D;  3VMI D;  2IBZ E;  2QJY C;  2JO6 A;  2YFL A;  3H1J E;  2DE7 A;  4HM7 A;  3GKE A;  5AEW A;  4HM2 A;  4NBE A;  4AAY B;  2XRX A;  1Z01 A;  2FYU E;  1VF5 D;  2QJK C;  2HMJ A;  3N0Q A;  2CKF A;  4EMJ B;  1RFS A;  1Z03 A;  1O7M A;  1PP9 E;  1G8J B;  4HM0 A;  3H1L E;  3GZY A;  3GOB A;  4OGQ D;  1KB9 E;  1P84 E;  3VCA A;  2HMO A;  1O7G A;  4HKV A;  2B24 A;  2GBX A;  3L70 E;  4QCK A;  4H13 D;  5KLV E;  1SQX E;  4AIV A;  1RIE A;  5HL4 A;  2E4Q A;  1VCK A;  2QPZ A;  3TGU E;  1EG9 A;  1BCC E;  2GBW A;  1JM1 A;  2HMN A;  4NB9 A;  3EN1 A;  3GB4 A;  5KLI C;  1L0L E;  1O7N A;  2NVG A;  4HM8 A;  2NVF A;  3VMH A;  2QJP C;  3CXH E;  2YIU C;  4HJL A;  1G8K B;  2DE6 D;  5AEU A;  2XSO A;  3L71 E;  4HM3 A;  2E4P A;  2Q3W A;  2NUK A;  1O7P A;  2YFI A;  1SQV E;  4HM1 A;  2ZYL A;  3GCF A;  1VM9 A;  3CWB E;  4QUQ A;  2B1X A;  1L0N E;  3L72 E;  4NBE D;  3DQY A;  3GCE A;  1KYO E;  1NTZ E;  3GL0 A;  3H1I E;  2BMO A;  3GZX A;  3L75 E;  2BMQ A;  4NB8 D;  4P1B H;  2DE5 A;  1ULJ A;  2E75 D;  3VMG D;  4NBB A;  4QDF A;  1Q90 C;  5BOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...