5AEUA

Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Basis of the Enhanced Pollutant-Degrading Capabilities of an Engineered Biphenyl Dioxygenase
pubmed doi rcsb
source organism Burkholderia xenovorans lb400
total genus 139
structure length 433
sequence length 442
chains with identical sequence C, E, G
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2015-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5aeuA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5aeuA01
3DQYA 2HMJA 2DE6D 4NBBD 3GZXA 5CXMA 1WQLA 1BCCE 3VMGD 4AAYB 2XRXA 3FOUA 2DE7D 4NBFD 4HM1A 2QJKC 3GCEA 1O7PA 4HM4A 2DE5A 3GCFA 4NBEA 1O7HA 2QJYC 2ZT9D 2E74D 4PD4E 4NB9A 4EMJB 1O7NA 1EG9A 2HMKA 2JZAA 3H1IE 2ZYLA 4H0LD 1RFSA 1JM1A 2YFJA 3VMIA 3GOBA 4QUPA 1BE3E 2XR8A 2JO6A 4NBAD 3D89A 1VF5D 3GL2A 1VM9A 2NVFA 5AEUA 1NU1E 3TGUE 4HM3A 3EN1A 1UUVA 2BMQA 4HM6A 3EQQA 2XSHA 3CXHE 4PV1D 4NBCA 4NBDA 2B1XA 3H1KE 2IBZE 1FQTA 1Z02A 2D2CD 4HM7A 1NTKE 2Q3WA 4AIVA 1NTME 1ZRTE 1NTZE 4H44D 4P1CH 4U3FE 2NVGA 4NBGA 2E4QA 5BOKA 1O7GA 2HMNA 4NBED 1SQVE 4NBHD 2YFIA 2YFLA 4P1BH 1Z01A 1NDOA 2E76D 1RIEA 1UUWA 2I7FA 4HKVA 1SQPE 1PP9E 2CKFA 2HMOA 3VMHD 4NB8D 4QUQA 3GL0A 5KLIC 4QDDA 4HM8A 2DE6A 1KB9E 4NBBA 4QCKA 2HMLA 4HM2A 1KYOE 2NUKA 3H1JE 1PPJE 1SQXE 3VMGA 3GKEA 2NVEA 4QDFA 3C0DA 4NBFA 2DE7A 5AEWA 3L71E 2YIUC 4QDFB 3AZCA 3VCAA 2DE5D 2A06E 1P84E 1VCKA 3GZYA 1ULIA 3N0QA 4NB9D 5KKZC 4NBAA 3L72E 2GBXA 3L74E 3VMID 1Q90C 4HM5A 1ULJA 1L0NE 1SQQE 2NUMA 1O7WA 2BMOA 4NBCD 4NBDD 1G8JB 2QJPC 3BCCE 4QDCA 3CWBE 3L70E 3VCPA 3GKQA 5KLVE 1EZVE 2BMRA 1WW9A 2E4PA 1G8KB 4HM0A 2B24A 3GTEA 5HL4A 3L73E 4QURA 3CX5E 4NBGD 4NBHA 1SQBE 3GTSA 3L75E 1L0LE 4H13D 1SJGA 1O7MA 2HMMA 2BCCE 2FYUE 2YVJB 3GB4A 3H1HE 2GBWA 3H1LE 2XSOA 1NYKA 1Z03A 2E75D 3VMHA 2NWFA 4NB8A 2FYNC 4OGQD 4HJLA 2QPZA
chains in the Genus database with same CATH superfamily
3DQYA 2HMJA 2DE6D 4NBBD 3GZXA 5CXMA 1WQLA 1BCCE 3VMGD 4AAYB 2XRXA 3FOUA 2DE7D 4NBFD 4HM1A 2QJKC 3GCEA 1O7PA 4HM4A 2DE5A 3GCFA 4NBEA 1O7HA 2QJYC 2ZT9D 2E74D 4PD4E 4NB9A 4EMJB 1O7NA 1EG9A 2HMKA 2JZAA 3H1IE 2ZYLA 4H0LD 1RFSA 1JM1A 2YFJA 3VMIA 3GOBA 4QUPA 1BE3E 2XR8A 2JO6A 4NBAD 3D89A 1VF5D 3GL2A 1VM9A 2NVFA 5AEUA 1NU1E 3TGUE 4HM3A 3EN1A 1UUVA 2BMQA 4HM6A 3EQQA 2XSHA 3CXHE 4PV1D 4NBCA 4NBDA 2B1XA 3H1KE 2IBZE 1FQTA 1Z02A 2D2CD 4HM7A 1NTKE 2Q3WA 4AIVA 1NTME 1ZRTE 1NTZE 4H44D 4P1CH 4U3FE 2NVGA 4NBGA 2E4QA 5BOKA 1O7GA 2HMNA 4NBED 1SQVE 4NBHD 2YFIA 2YFLA 4P1BH 1Z01A 1NDOA 2E76D 1RIEA 1UUWA 2I7FA 4HKVA 1SQPE 1PP9E 2CKFA 2HMOA 3VMHD 4NB8D 4QUQA 3GL0A 5KLIC 4QDDA 4HM8A 2DE6A 1KB9E 4NBBA 4QCKA 2HMLA 4HM2A 1KYOE 2NUKA 3H1JE 1PPJE 1SQXE 3VMGA 3GKEA 2NVEA 4QDFA 3C0DA 4NBFA 2DE7A 5AEWA 3L71E 2YIUC 4QDFB 3AZCA 3VCAA 2DE5D 2A06E 1P84E 1VCKA 3GZYA 1ULIA 3N0QA 4NB9D 5KKZC 4NBAA 3L72E 2GBXA 3L74E 3VMID 1Q90C 4HM5A 1ULJA 1L0NE 1SQQE 2NUMA 1O7WA 2BMOA 4NBCD 4NBDD 1G8JB 2QJPC 3BCCE 4QDCA 3CWBE 3L70E 3VCPA 3GKQA 5KLVE 1EZVE 2BMRA 1WW9A 2E4PA 1G8KB 4HM0A 2B24A 3GTEA 5HL4A 3L73E 4QURA 3CX5E 4NBGD 4NBHA 1SQBE 3GTSA 3L75E 1L0LE 4H13D 1SJGA 1O7MA 2HMMA 2BCCE 2FYUE 2YVJB 3GB4A 3H1HE 2GBWA 3H1LE 2XSOA 1NYKA 1Z03A 2E75D 3VMHA 2NWFA 4NB8A 2FYNC 4OGQD 4HJLA 2QPZA
chains in the Genus database with same CATH topology
3DQYA 2HMJA 2DE6D 4NBBD 3GZXA 5CXMA 1WQLA 1BCCE 3VMGD 4AAYB 2XRXA 3FOUA 2DE7D 4NBFD 4HM1A 2QJKC 3GCEA 1O7PA 4HM4A 2DE5A 3GCFA 4NBEA 1O7HA 2QJYC 2ZT9D 2E74D 4PD4E 4NB9A 4EMJB 1O7NA 1EG9A 2HMKA 2JZAA 3H1IE 2ZYLA 4H0LD 1RFSA 1JM1A 2YFJA 3VMIA 3GOBA 4QUPA 1BE3E 2XR8A 2JO6A 4NBAD 3D89A 1VF5D 3GL2A 1VM9A 2NVFA 5AEUA 1NU1E 3TGUE 4HM3A 3EN1A 1UUVA 2BMQA 4HM6A 3EQQA 2XSHA 3CXHE 4PV1D 4NBCA 4NBDA 2B1XA 3H1KE 2IBZE 1FQTA 1Z02A 2D2CD 4HM7A 1NTKE 2Q3WA 4AIVA 1NTME 1ZRTE 1NTZE 4H44D 4P1CH 4U3FE 2NVGA 4NBGA 2E4QA 5BOKA 1O7GA 2HMNA 4NBED 1SQVE 4NBHD 2YFIA 2YFLA 4P1BH 1Z01A 1NDOA 2E76D 1RIEA 1UUWA 2I7FA 4HKVA 1SQPE 1PP9E 2CKFA 2HMOA 3VMHD 4NB8D 4QUQA 3GL0A 5KLIC 4QDDA 4HM8A 2DE6A 1KB9E 4NBBA 4QCKA 2HMLA 4HM2A 1KYOE 2NUKA 3H1JE 1PPJE 1SQXE 3VMGA 3GKEA 2NVEA 4QDFA 3C0DA 4NBFA 2DE7A 5AEWA 3L71E 2YIUC 4QDFB 3AZCA 3VCAA 2DE5D 2A06E 1P84E 1VCKA 3GZYA 1ULIA 3N0QA 4NB9D 5KKZC 4NBAA 3L72E 2GBXA 3L74E 3VMID 1Q90C 4HM5A 1ULJA 1L0NE 1SQQE 2NUMA 1O7WA 2BMOA 4NBCD 4NBDD 1G8JB 2QJPC 3BCCE 4QDCA 3CWBE 3L70E 3VCPA 3GKQA 5KLVE 1EZVE 2BMRA 1WW9A 2E4PA 1G8KB 4HM0A 2B24A 3GTEA 5HL4A 3L73E 4QURA 3CX5E 4NBGD 4NBHA 1SQBE 3GTSA 3L75E 1L0LE 4H13D 1SJGA 1O7MA 2HMMA 2BCCE 2FYUE 2YVJB 3GB4A 3H1HE 2GBWA 3H1LE 2XSOA 1NYKA 1Z03A 2E75D 3VMHA 2NWFA 4NB8A 2FYNC 4OGQD 4HJLA 2QPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  2HMJ A;  2DE6 D;  4NBB D;  3GZX A;  5CXM A;  1WQL A;  1BCC E;  3VMG D;  4AAY B;  2XRX A;  3FOU A;  2DE7 D;  4NBF D;  4HM1 A;  2QJK C;  3GCE A;  1O7P A;  4HM4 A;  2DE5 A;  3GCF A;  4NBE A;  1O7H A;  2QJY C;  2ZT9 D;  2E74 D;  4PD4 E;  4NB9 A;  4EMJ B;  1O7N A;  1EG9 A;  2HMK A;  2JZA A;  3H1I E;  2ZYL A;  4H0L D;  1RFS A;  1JM1 A;  2YFJ A;  3VMI A;  3GOB A;  4QUP A;  1BE3 E;  2XR8 A;  2JO6 A;  4NBA D;  3D89 A;  1VF5 D;  3GL2 A;  1VM9 A;  2NVF A;  5AEU A;  1NU1 E;  3TGU E;  4HM3 A;  3EN1 A;  1UUV A;  2BMQ A;  4HM6 A;  3EQQ A;  2XSH A;  3CXH E;  4PV1 D;  4NBC A;  4NBD A;  2B1X A;  3H1K E;  2IBZ E;  1FQT A;  1Z02 A;  2D2C D;  4HM7 A;  1NTK E;  2Q3W A;  4AIV A;  1NTM E;  1ZRT E;  1NTZ E;  4H44 D;  4P1C H;  4U3F E;  2NVG A;  4NBG A;  2E4Q A;  5BOK A;  1O7G A;  2HMN A;  4NBE D;  1SQV E;  4NBH D;  2YFI A;  2YFL A;  4P1B H;  1Z01 A;  1NDO A;  2E76 D;  1RIE A;  1UUW A;  2I7F A;  4HKV A;  1SQP E;  1PP9 E;  2CKF A;  2HMO A;  3VMH D;  4NB8 D;  4QUQ A;  3GL0 A;  5KLI C;  4QDD A;  4HM8 A;  2DE6 A;  1KB9 E;  4NBB A;  4QCK A;  2HML A;  4HM2 A;  1KYO E;  2NUK A;  3H1J E;  1PPJ E;  1SQX E;  3VMG A;  3GKE A;  2NVE A;  4QDF A;  3C0D A;  4NBF A;  2DE7 A;  5AEW A;  3L71 E;  2YIU C;  4QDF B;  3AZC A;  3VCA A;  2DE5 D;  2A06 E;  1P84 E;  1VCK A;  3GZY A;  1ULI A;  3N0Q A;  4NB9 D;  5KKZ C;  4NBA A;  3L72 E;  2GBX A;  3L74 E;  3VMI D;  1Q90 C;  4HM5 A;  1ULJ A;  1L0N E;  1SQQ E;  2NUM A;  1O7W A;  2BMO A;  4NBC D;  4NBD D;  1G8J B;  2QJP C;  3BCC E;  4QDC A;  3CWB E;  3L70 E;  3VCP A;  3GKQ A;  5KLV E;  1EZV E;  2BMR A;  1WW9 A;  2E4P A;  1G8K B;  4HM0 A;  2B24 A;  3GTE A;  5HL4 A;  3L73 E;  4QUR A;  3CX5 E;  4NBG D;  4NBH A;  1SQB E;  3GTS A;  3L75 E;  1L0L E;  4H13 D;  1SJG A;  1O7M A;  2HMM A;  2BCC E;  2FYU E;  2YVJ B;  3GB4 A;  3H1H E;  2GBW A;  3H1L E;  2XSO A;  1NYK A;  1Z03 A;  2E75 D;  3VMH A;  2NWF A;  4NB8 A;  2FYN C;  4OGQ D;  4HJL A;  2QPZ A; 
#chains in the Genus database with same CATH topology
 3DQY A;  2HMJ A;  2DE6 D;  4NBB D;  3GZX A;  5CXM A;  1WQL A;  1BCC E;  3VMG D;  4AAY B;  2XRX A;  3FOU A;  2DE7 D;  4NBF D;  4HM1 A;  2QJK C;  3GCE A;  1O7P A;  4HM4 A;  2DE5 A;  3GCF A;  4NBE A;  1O7H A;  2QJY C;  2ZT9 D;  2E74 D;  4PD4 E;  4NB9 A;  4EMJ B;  1O7N A;  1EG9 A;  2HMK A;  2JZA A;  3H1I E;  2ZYL A;  4H0L D;  1RFS A;  1JM1 A;  2YFJ A;  3VMI A;  3GOB A;  4QUP A;  1BE3 E;  2XR8 A;  2JO6 A;  4NBA D;  3D89 A;  1VF5 D;  3GL2 A;  1VM9 A;  2NVF A;  5AEU A;  1NU1 E;  3TGU E;  4HM3 A;  3EN1 A;  1UUV A;  2BMQ A;  4HM6 A;  3EQQ A;  2XSH A;  3CXH E;  4PV1 D;  4NBC A;  4NBD A;  2B1X A;  3H1K E;  2IBZ E;  1FQT A;  1Z02 A;  2D2C D;  4HM7 A;  1NTK E;  2Q3W A;  4AIV A;  1NTM E;  1ZRT E;  1NTZ E;  4H44 D;  4P1C H;  4U3F E;  2NVG A;  4NBG A;  2E4Q A;  5BOK A;  1O7G A;  2HMN A;  4NBE D;  1SQV E;  4NBH D;  2YFI A;  2YFL A;  4P1B H;  1Z01 A;  1NDO A;  2E76 D;  1RIE A;  1UUW A;  2I7F A;  4HKV A;  1SQP E;  1PP9 E;  2CKF A;  2HMO A;  3VMH D;  4NB8 D;  4QUQ A;  3GL0 A;  5KLI C;  4QDD A;  4HM8 A;  2DE6 A;  1KB9 E;  4NBB A;  4QCK A;  2HML A;  4HM2 A;  1KYO E;  2NUK A;  3H1J E;  1PPJ E;  1SQX E;  3VMG A;  3GKE A;  2NVE A;  4QDF A;  3C0D A;  4NBF A;  2DE7 A;  5AEW A;  3L71 E;  2YIU C;  4QDF B;  3AZC A;  3VCA A;  2DE5 D;  2A06 E;  1P84 E;  1VCK A;  3GZY A;  1ULI A;  3N0Q A;  4NB9 D;  5KKZ C;  4NBA A;  3L72 E;  2GBX A;  3L74 E;  3VMI D;  1Q90 C;  4HM5 A;  1ULJ A;  1L0N E;  1SQQ E;  2NUM A;  1O7W A;  2BMO A;  4NBC D;  4NBD D;  1G8J B;  2QJP C;  3BCC E;  4QDC A;  3CWB E;  3L70 E;  3VCP A;  3GKQ A;  5KLV E;  1EZV E;  2BMR A;  1WW9 A;  2E4P A;  1G8K B;  4HM0 A;  2B24 A;  3GTE A;  5HL4 A;  3L73 E;  4QUR A;  3CX5 E;  4NBG D;  4NBH A;  1SQB E;  3GTS A;  3L75 E;  1L0L E;  4H13 D;  1SJG A;  1O7M A;  2HMM A;  2BCC E;  2FYU E;  2YVJ B;  3GB4 A;  3H1H E;  2GBW A;  3H1L E;  2XSO A;  1NYK A;  1Z03 A;  2E75 D;  3VMH A;  2NWF A;  4NB8 A;  2FYN C;  4OGQ D;  4HJL A;  2QPZ A; 
#chains in the Genus database with same CATH homology
 3DQY A;  2HMJ A;  2DE6 D;  4NBB D;  3GZX A;  5CXM A;  1WQL A;  1BCC E;  3VMG D;  4AAY B;  2XRX A;  3FOU A;  2DE7 D;  4NBF D;  4HM1 A;  2QJK C;  3GCE A;  1O7P A;  4HM4 A;  2DE5 A;  3GCF A;  4NBE A;  1O7H A;  2QJY C;  2ZT9 D;  2E74 D;  4PD4 E;  4NB9 A;  4EMJ B;  1O7N A;  1EG9 A;  2HMK A;  2JZA A;  3H1I E;  2ZYL A;  4H0L D;  1RFS A;  1JM1 A;  2YFJ A;  3VMI A;  3GOB A;  4QUP A;  1BE3 E;  2XR8 A;  2JO6 A;  4NBA D;  3D89 A;  1VF5 D;  3GL2 A;  1VM9 A;  2NVF A;  5AEU A;  1NU1 E;  3TGU E;  4HM3 A;  3EN1 A;  1UUV A;  2BMQ A;  4HM6 A;  3EQQ A;  2XSH A;  3CXH E;  4PV1 D;  4NBC A;  4NBD A;  2B1X A;  3H1K E;  2IBZ E;  1FQT A;  1Z02 A;  2D2C D;  4HM7 A;  1NTK E;  2Q3W A;  4AIV A;  1NTM E;  1ZRT E;  1NTZ E;  4H44 D;  4P1C H;  4U3F E;  2NVG A;  4NBG A;  2E4Q A;  5BOK A;  1O7G A;  2HMN A;  4NBE D;  1SQV E;  4NBH D;  2YFI A;  2YFL A;  4P1B H;  1Z01 A;  1NDO A;  2E76 D;  1RIE A;  1UUW A;  2I7F A;  4HKV A;  1SQP E;  1PP9 E;  2CKF A;  2HMO A;  3VMH D;  4NB8 D;  4QUQ A;  3GL0 A;  5KLI C;  4QDD A;  4HM8 A;  2DE6 A;  1KB9 E;  4NBB A;  4QCK A;  2HML A;  4HM2 A;  1KYO E;  2NUK A;  3H1J E;  1PPJ E;  1SQX E;  3VMG A;  3GKE A;  2NVE A;  4QDF A;  3C0D A;  4NBF A;  2DE7 A;  5AEW A;  3L71 E;  2YIU C;  4QDF B;  3AZC A;  3VCA A;  2DE5 D;  2A06 E;  1P84 E;  1VCK A;  3GZY A;  1ULI A;  3N0Q A;  4NB9 D;  5KKZ C;  4NBA A;  3L72 E;  2GBX A;  3L74 E;  3VMI D;  1Q90 C;  4HM5 A;  1ULJ A;  1L0N E;  1SQQ E;  2NUM A;  1O7W A;  2BMO A;  4NBC D;  4NBD D;  1G8J B;  2QJP C;  3BCC E;  4QDC A;  3CWB E;  3L70 E;  3VCP A;  3GKQ A;  5KLV E;  1EZV E;  2BMR A;  1WW9 A;  2E4P A;  1G8K B;  4HM0 A;  2B24 A;  3GTE A;  5HL4 A;  3L73 E;  4QUR A;  3CX5 E;  4NBG D;  4NBH A;  1SQB E;  3GTS A;  3L75 E;  1L0L E;  4H13 D;  1SJG A;  1O7M A;  2HMM A;  2BCC E;  2FYU E;  2YVJ B;  3GB4 A;  3H1H E;  2GBW A;  3H1L E;  2XSO A;  1NYK A;  1Z03 A;  2E75 D;  3VMH A;  2NWF A;  4NB8 A;  2FYN C;  4OGQ D;  4HJL A;  2QPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...