2FYNC

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 50
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fynC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fynC02
1Q90D 1NU1E 1SQXE 4NB9D 4QDDA 4Y28J 1RIEA 1ULIA 4P1CH 2QIWA 4NBAD 4H44D 2QJYC 3GL0A 2QJKC 1WQLA 4PV1B 3CXHE 1SJGA 2FYNC 1RFSA 2NUMA 2D2CD 2E75D 1ULJA 3GB4A 4PD4E 1SQPE 1O7GA 1EZVE 4HJLA 2BMOA 4HM1A 3H1HE 4AIVA 3GTSA 4H13D 4RKUJ 5KLIC 4OGQD 1FQTA 4QURA 5HL4A 1NYKA 1NTKE 1PPJE 1UUVA 3L71E 2XR8A 3LW5J 2HMOA 1G8JB 2BCCE 2IBZE 5AEUA 4NBBD 2BMRA 2NVFA 2E4PA 3BCCE 4NBDD 1SQQE 2E76B 2I7FA 2Q3WA 1L0NE 4P1BH 4HKVA 2XSHA 2B24A 2E74D 3VCPA 2GBWA 2BMQA 2O01J 3L73E 1BE3E 4NBCD 1NTZE 4QDCA 3GCEA 5BOKA 4PV1D 2NVGA 2GBXA 3CX5E 1O7HA 4HM2A 4NB8D 4I7ZB 3CWBE 3DQYA 2ZYLA 3N0QA 3GZYA 3FOUA 5CXMA 2A06E 2JZAA 2ZT9B 1KB9E 2E4QA 3VCAA 4H0LD 1SQBE 1NTME 3H1KE 3L74E 3C8VA 1O7WA 4NBED 2D2CB 2E75B 1SQVE 2XSOA 2HMNA 2WSFJ 3GL2A 2WSEJ 4EMJB 1S5LX 5L8RJ 1VCKA 2WPVB 1JM1A 2YFJA 4H13B 2HMKA 4HM6A 2DE5D 1VF5B 1O7NA 2DE7D 1BCCE 3TGUE 2JO6A 3VMHD 2K9YA 5AEWA 3H1JE 4QDFA 2YIUC 5KLVE 2DE6D 2YVJB 1JB0J 1ZRTE 4KT0J 1O7MA 1KYOE 3GTEA 3D89A 3H1IE 4IL6X 1PP9E 1EG9A 4H44B 2QJPC 3L72E 1VM9A 2YFIA 4NBGD 2NWFA 1NDOA 1L0LE 2CKFA 3GKEA 4QCKA 3H1LE 2E74B 4AAYB 2NUKA 2XRXA 2ZT9D 4QUQA 2WSCJ 2B1XA 1G8KB 2QPZA 4HM5A 1P84E 4HM4A 4HM0A 4HM7A 3VMGD 4NBFD 4OGQB 2YFLA 3EN1A 3L75E 4U3FE 1UUWA 2QSIA 2E76D 3AZCA 3VMID 4HM8A 3L70E 1O7PA 4H0LB 1VF5D 2NVEA 4QDFB 2HMLA 1Q90C 2HMMA 2FYUE 3EQQA 4HM3A 5KKZC 3GZXA 4NBHD 3C0DA 2HMJA 4QUPA 3GOBA
chains in the Genus database with same CATH superfamily
4L74A 1QL2A 2QIWA 5APYA 1KQSO 1Y9BA 2IZ0A 2K9JA 1RFSA 2WTYA 2BMOA 3GTSA 2KK7A 1S9KE 3M91A 3F89A 1NYKA 4IFMA 2ZYAA 4ZKUA 1FJKA 1M56D 2Q6QA 4W80A 3MIWA 5AW3B 2IBZD 3I56P 2PFXA 5AW8B 1KFMA 2VRSA 2W6AA 2YO2A 2MKVA 3GCEA 3QH9A 1VPCA 3CX5E 4N78D 3DQYA 3FOUA 2A06E 3V4WA 1VQMP 1NTZK 1PIXA 2O01H 2M5AB 2M3BA 1LTSC 3H1KG 3HD7C 5B5EH 3GF7A 1JM0A 1BGYD 3CD6P 4LC1A 1EQ7A 1L0LE 1DD4A 5E79E 3CC2P 3UIAA 3L70J 1YQ3C 4GT1A 2OYIA 1YITP 2BEQD 4U3FD 4HM8A 3C1LA 2P7JA 3KHUA 3KXDA 1JEKA 2KI7B 1NGMB 1NU1J 5AVUB 2HMMA 3PLNA 3RL0B 1ULIA 1SQXD 3GG2A 1IFMA 2FYUK 1LT9A 1IFIA 1PZQA 5BVZA 5B66E 1AQ5A 3CXHD 4I2LC 1E5WA 1BDCA 4HM1A 2O01N 1USEA 4PD4H 1G1IA 4Y99C 3LW5J 1M1JB 2IBZE 1IJDB 2OYHC 1S2EA 1YHQP 2NVFA 1NTKK 2E4PA 2OYOA 2ITAA 2B89A 1HBWA 1SQQG 5AVZB 2XSHA 1N7SB 3AE9C 5CHXA 3IF4A 4WY4B 1AVYA 4N78E 4ZMDA 3RK2D 5CXMA 3HRNA 4D6TD 2WPSA 2B88A 1FZEA 2ZXEB 3GL2A 1T3JA 4O9BA 2YFJA 4DJGA 2DE5D 3B5NA 3AE7C 3NTNA 5KLVJ 1WMKA 3EQ2A 1MKMA 2H89C 1ZLLA 4IFDK 1YJ9P 1BGYE 3AEBC 1L4AC 3KDPB 1JB0J 2WVRA 1YYCA 3Q5SA 1T6AA 2O1JA 5AVYB 3L72D 2P10A 1K04A 5CJ4A 3U1CA 4HM0A 4U3FE 4OGQB 2QSIA 3VMID 1P84H 5CMZA 2KZIA 3R2PA 3AE6C 2NVEA 1UIIA 3HUSC 3V5BA 3H1ID 1SQXE 3D6YA 3HD7A 3AEEC 3PJSK 2R5DA 4MN4C 2N1TC 3CXHE 2D2CD 1SQPE 1FOSE 2Q7CA 2LXBA 1NHLA 2I1KA 2IDBA 2Q9IA 4D6TG 1A02F 2AEMA 1USDA 1IFDA 5H2FH 1LWUB 4NPEA 2IPPA 1SQPJ 1L0ND 1KILD 3BVHA 3VCPA 2PP6A 5APUA 1VQ4P 2GBXA 1LTJB 1SFCC 2C0WA 3V2PA 3I55P 1RF1B 3WUVA 4D6TE 1SQVJ 2GM4A 3L72G 1M57D 4OVNF 1H0TB 3TDKA 1EC5A 4ZKPA 1W5CE 5AW4B 3RGUA 3BCCD 1DX7A 3GHGC 1YJNP 1N73C 3H1JG 1JCCA 1JY2N 1J1EC 1PGJA 3CWBD 3L72E 2OYHA 3H1IG 5AW7B 5KAIH 1SS1A 4HM4A 2N9YB 5TJHA 4XA4A 3CCEP 1HTLC 2WSCH 5KJ7C 1NKZB 4PD4I 3H32A 1K05A 1U7MA 1PL5A 1FE6A 2XNXA 1SJGA 1FZCA 3L35A 1KMIZ 4AUWA 2FFDB 1FQTA 3N4XA 2HPCA 1AFOA 4TLFA 1U7JA 1KFNA 2E76B 1L0NE 1KILE 3BCCG 1GW3A 2KS1A 1KC8Q 2I1JA 3L73D 1SQQK 3TNUB 2UWJE 1VQ8P 4ZNCA 3CWBG 3HUSA 4ASVA 1FZGA 3L4FA 1L0NJ 3ITKA 2E75B 3CCMP 2FXPA 2WSEJ 2N1TA 1FC2C 3RL0D 2P2UA 1NH4A 1VQ9P 2WWWA 4I7ZC 1GL2D 1GZLA 1P84I 1VQKP 3O6QA 1T2KC 2GUVA 1YTZI 3VMGD 5APWA 4RJTA 3P8CD 1GD2E 3L75G 1SFCA 4H0LB 2HMLA 3EQQA 2HLOA 2K37A 5CCHC 3CPWO 2HODB 1Q90D 1M90Q 3Q2YA 4K3AA 3GHGA 3CCRP 2YKPA 4C7NA 1N73A 5B66H 3VMYA 5KLIC 5HL4A 3H1HD 1CZQA 3L71D 5CJ0A 4NBBD 2W90A 2YO3A 4KJMA 2LXCB 1FZBA 1JCDA 3L73E 1VQPP 1NJIQ 1G2CA 5KTBA 2WITA 1JY2P 2K1AA 2JZAA 3WU2E 1JOCA 2V7QH 1O7WA 4BRYA 5L8RJ 3TGUJ 1KYOI 2FKWB 3L73J 1MV8A 2HMKA 4HM6A 3U59A 2OYIC 2CPBA 3JSVC 2OQQA 3CL3D 3AEFC 2JWDA 3A2AA 3G71P 3CX5D 4DZOA 3D89A 1RE4A 2V4HA 4IL6X 2YKQA 2ZT9C 2P1JA 2A06D 3V2NA 3G3ZA 2POHA 4QUQA 3FX0A 4WWIA 3Q5RA 2KYVA 2H43A 4NBFD 2E5TA 2RH0A 1KQLA 2FYUJ 4PJ0E 3L70D 1Q2NA 2WQYC 1DH3A 1PFIA 1NO4A 4H44C 1SLQA 4QUPA 5TISE 4Y28J 1KILB 1NU1D 3LIDA 2MJZA 3A0HE 2FYNC 4GDOA 3RL0g 4B86A 1NTKJ 1O7GA 4JYBA 3CXHH 1X0TA 3H1HE 1HVVA 4K35A 1GU5A 3L71E 1HF9A 2NPSC 1URQC 2PRRA 3CX5I 2WT7B 1ZOYC 2FBWC 3H1HJ 2QE7H 3VN0A 5BOKA 4N3YB 3B5NC 1JY3N 3RK3D 3MZWB 1OIPA 3L71J 4YTPC 1FDOA 3L74J 5DJTB 3AE3C 1KB9E 5CCHA 2A06G 4GODA 1JNMA 3M06A 1Q7YQ 1S5LX 1BCCJ 2DW3A 3OAKA 1AQTA 3K5BA 3Q3DA 3AE2C 1LGHB 3II6A 3VMHD 3L70G 4Y99B 4C7RA 2YVJB 3HE5A 5KLVD 3GTEA 3CCLP 4AYCA 2QJPC 2OTJP 1NDOA 3MD0A 1L0LG 2NUKA 2QJYB 2QJKB 1XTCC 3U1AA 2W6JH 1VF5C 3NXSA 2K88A 3M9BA 2QA4P 2E76D 5CCGC 3L70E 5AVQB 4C46A 1K9MQ 3A0BE 4NPDA 4ASWA 1UIXA 4LGDE 2YXQB 3GOBA 1NU1E 4QDDA 4DCKA 4P1CH 1MFZA 1NWQA 3RBXA 4WBAA 1GK6A 2IBZI 1RH5B 2E75D 1S72P 2FYZA 1L4AB 2R44A 1GK4A 4HYTB 5GTIE 4DOJA 4EYYQ 1YBKA 3A5TA 2IBZG 2BMRA 2E74C 1FBMA 3P8MC 2ZVNB 4P1BH 2SPZA 1FZFA 3RK3E 1GL2B 1RY3A 4PV1D 3AEDC 1VQNP 1O7HA 1LTGC 1SQPD 3G4SP 2ZYLA 1N2DC 5KLVG 3GZYA 3H1KJ 4XFJA 3GW6A 1ZMEC 4H0LD 2KNCB 3T97A 5AVSB 2N1TB 1VCKA 1SQVD 3AE4C 2ZXXA 2Z5IA 3HTKB 1QL1A 3HE4A 1O7NA 3E1RA 5AEWA 4QDFA 5KLVE 1QVFO 2WPRA 2KLUA 2JWAA 1O7MA 1BGYG 4HKZH 2NPSA 1URQA 3IAOA 1H89A 2G8YA 4EDFA 1G8KB 4OH8B 2QPZA 4L76A 1N86A 3SWFA 2YFLA 1FZCC 3JCUE 4U3FG 4KHXA 1SFCB 1LTBC 3CXHI 2NZ2A 3AE8C 2B87A 4UB6E 1SQXG 4WVZA 1J2JB 1N7LA 1D7MA 1CI6A 3ABVC 4HB1A 3GB4A 1R5LA 3KZIE 1EZVE 1NVOA 1QLED 1JY3P 1SQPG 4L73A 1EXJA 2YXRB 5AW0B 1J1EB 3AEGC 2XR8A 5CBOA 1DIPA 2HMOA 1G8JB 3W68A 3EFGA 2H8PD 3AE5C 1E79H 2I7FA 2AXCA 4QDCA 5CCGA 4NBCD 1OZHA 3N0QA 2A45I 4LLHA 3VCAA 4EOTA 1NTME 1M1KQ 2KLVA 1SQBD 1SQVE 3WU2H 5EFWB 5APSA 2W83C 2A45G 3HD7D 1N7SC 2Q3EA 4WY4C 2K9YA 5K5GB 2H88C 3IR9A 2WSFH 1NTMJ 2R5BA 2AEJA 2GA1A 4L75A 2B9BA 1IO4A 1LP1B 1J1DC 1VQ5P 1L0LK 4GOEA 3IN6A 1RQUA 4XE5B 4NPFX 4HM3A 1JY2O 4NBHD 2ZYGA 3SSUA 1KYOH 1ZR4A 1AJYA 5TISH 3RK3B 3N7NA 4OGQC 1ULJA 3QWOC 1OW7A 1VQLP 3A0HH 1VQ6P 4AIVA 1R5SA 2JR8A 4IL6E 1HGZA 1KD1Q 1JTHB 4N6JA 2QVAA 2OARA 2BCCE 2ZAEB 2M5AA 3NFQA 3VMZA 2N9BA 3GMAA 1ZN5A 2IFNA 4R4LA 2K9JB 1L0NG 1SVFA 1RHZB 2BMQA 2O01J 2JP3A 2WPQA 4UB8E 1NTZD 2YIUB 1DEEG 2BCCJ 3S4RA 2M0BA 2E4QA 5M1BA 1RE4C 3CC7P 1SQBE 4AQRD 2FXMA 2YMYA 2XSOA 1IK9A 4H13B 3PH0A 2KUBA 3H1JJ 3PTZA 1LNQA 3TGUD 1LTJC 3V2RA 1U57A 3Q1MA 1SQBJ 3TK1A 2PGDA 1OVRA 3H1LJ 1L4AD 3CX5H 2YFIA 4R4MA 1AV1A 2Q3IA 1HJBA 4DT0A 5AW5B 2C0XA 2QM8A 2IYOA 3CCJP 5KKZC 1M1JA 1LTIC 2FYUD 3WUUA 3O8ZA 5AEUA 2K3RA 4NB9D 1S5LE 2AXTE 4PV1B 1N7SA 3MGNA 5E79H 2OYIB 4WY4A 1SQXK 1Y47A 2N1TD 2ZJSE 1BDDA 3VMAA 3A3YB 5C39A 2Z5HA 1PPJD 1NTKD 3TF5A 2RKLA 1SQPK 2AEFA 1X8YA 5GTIH 4JBZA 4NBDD 3JC22 3CMAP 1LT9B 1OW8A 3BRVB 1YJWP 3LW5H 1KN7A 1NTZE 1QX8A 3L73G 1NAFA 2LKMA 3V4QA 2RMZA 3G9RA 2Q5UA 1OVUA 1HUCA 1SFCD 2Y0CA 3C8VA 2E42A 3L74D 2CPSA 1NTZJ 3FWLA 3TGUE 2JEEA 1BCCD 3BRTB 1YTZT 3OA7A 3RBZA 4QCKA 1GDTA 1KB9D 2XV5A 3D70A 3L75J 3LIEA 1PGQA 3VOPA 3SWYA 2IZ1A 3B5NB 5AW1B 1GU4A 2FY8A 2XDJA 1KQGB 1PPJG 1NTKG 2FYUE 1VDFA 5KJ7D 2L5GB 1LWUA 1X22A 3CCVP 1WQLA 2NUMA 2ZYDA 4UB6H 1L2PA 3CMEP 1S1CX 2KP8A 1LTJA 4H0LC 3H1HG 1PPJE 1NTKE 3KZIH 1RF1A 2E5YA 1UUVA 2QJPB 2WSSH 3L71G 1KV4A 1IFJA 1H0TA 3HD7B 1BE3J 2HG5D 1EDLA 4HKVA 1IFPA 1KB9I 1OFCX 2J59M 1BCCG 4YXDC 3RK2C 1FAVA 2OGUA 4NB8D 1L0NK 1QGKB 3V6IA 3EWKA 4W7ZA 2W8ZA 2KSEA 1TU3F 1CSBA 4JF7A 3L74E 4M3LA 2E43A 3H1KD 1JO5A 3AEAC 3CLQA 1JM1A 1EDIA 4YPCA 1BCCE 5AVVB 3TYYA 1PP9J 1JY3O 1LTTC 2QEXP 2Y0DA 3B71A 2J5UA 2XKMA 1VM9A 1NKNA 2Z4EA 2E74B 2WSCJ 1Q82Q 1T2KD 1RE3C 3EN1A 4EI2A 2A45H 2ZVOB 2FFDA 3F5HA 1Q81Q 3GZXA 4JQ0D 2OYHB 2HMJA 5AVWB 1DEBA 1IFNA 4NBAD 1NU1G 2D2CC 5CCHD 4GOFA 3GF3A 1H88A 1NAYA 2M3EA 1IZNB 4HJLA 1MUUA 2R3SA 3TNUA 4H13D 2Y9YA 2H7HA 4Z1MH 1KORA 4IL6H 3H32B 2WMMA 1KILC 2Q3WA 1ZV8A 1K8AQ 1SQQD 2B24A 1FZCB 3AE1C 1EZVD 3MTUE 1FDIA 2R32A 4UB8H 2HPCB 1MZ9A 3MUDC 3H1KE 1KQFB 2BEZF 2KS1B 2NRGA 3M0DC 2WSEH 1L0LJ 1YIJP 3HUSB 2YMKA 4U7JA 2GUSA 2HODA 2NWFA 4CPGA 3PHLA 5BU8B 2ZT9D 3BATA 1NTMD 2IX7C 1X79B 5AVRB 4HM5A 3L36A 4HM7A 5AVTB 3D6ZA 2OTLP 4IOIH 1O7PA 1MFTA 1JMMA 1FS0E 3TSIA 1IC2A 3V2QA 3O6QB 1EZVI 1IK7A 1CW5A 1HGVA 4H44D 2QJYC 3GL0A 2QJKC 4QMAA 1S5LH 2QG4A 1ZXGA 2AXTH 5GTHE 1EZVG 3C9IA 4RKUJ 3VP8A 1SP4A 1W2BO 2QRXA 2JKVA 1ZP0C 2Y0EA 1NYHA 1OWAA 3AECC 1H8AA 1SQQE 2NPSD 1URQD 1J1DB 1W2EA 1RE3A 2KIKA 2GBWA 3GHGB 2V7QJ 4C7NB 1N73B 1A02J 3B5ND 5KAFE 3SWKA 4YXWH 2JO1A 1SQQJ 1NTMG 2BCCD 3RL0C 2R3CA 1SQVG 1WRGA 2P67A 1VQOP 1PGPA 1S3JA 1BGYJ 1GL2C 3M9HA 2FXOA 1G2CB 2DE6D 3M0AA 3H1JD 4KT0J 1T8ZA 1ZR2A 1ZRTD 3WMM0 1NOHA 1EG9A 1M1JC 2CKFA 5APVA 1KILA 4BRYB 4EIJA 2XRXA 1M8OB 3H1LD 4U3FJ 2B1XA 1QEXA 4RESB 5APXA 3WUTA 3AZCA 3P32A 1BSHA 3MP7B 2XNDH 4JYCA 1VF5D 5CCGD 3NMDA 1JUNA 1Q90C 2HFED 1SQXJ 3MUDA 2L91A 1T3UA 4JPZB 2YKOA 1RIEA 3MHVA 2WT7A 1BSNA 2G3AA 1NU1K 2KZJA 1RQVA 3M0DA 1FU1A 5AVXB 2W6BA 4PD4D 5AW2B 4QURA 3H6PA 4GKGA 2I8DA 1S4XA 4PJ0H 2BCCG 1YQ4C 2QM7A 4BXLA 1QVGO 2RN0A 1VL2A 1HH0A 2E74D 3E1IA 1EDJA 4WB4A 3VYIA 2NVGA 3R4YA 4I7ZB 4D6TJ 1RF0C 1AA0A 5KKZB 1LTAC 5B5EE 2LR2A 1OVVA 2IYPA 4NBED 1SQBG 2CK3H 1FZAA 3H1LG 4I6MC 3M9QA 3S9OA 1FOSF 5CBNA 1FJPA 3H1JE 3L72J 1OX3A 1ZRTE 1EXIA 3H1IE 1HJ0A 4NBGD 3Q5PA 3E7KA 3H1LE 4TT3H 3BASA 5KLVK 2KB7P 1LWUC 1KB9H 1KZUB 2HYNA 1PV3A 5BU5A 1Y8AA 1P84D 3H25A 4HJGH 3L75D 1L4AA 5KLIB 3H1IJ 3HE5B 1KTMA 3PRJA 3VTPC 1RF1C 5AW9B 3C0DA 1GTWA 2YNYA 2JJLA 3SFDC 1GL2A 4PD4E 5APQA 5APTA 3B4SA 2KNCA 2OTKE 2C9NY 3BCCE 3EFFK 1YI2P 2KXPB 3A0BH 2O3JA 3RK3C 3HTKA 3I5CA 1BE3D 2C9LY 1NTZG 3CWBE 1R8EA 3FXEA 2Y9ZA 1K73Q 1VQ7P 2ZT9B 3OJAB 3USSA 3BCCJ 1DD3A 4OWFA 2HMNA 1XTGB 4EMJB 2P58A 3OW2O 1NTMK 1OMIA 3CWBJ 1SQVK 3TGUG 1N7SD 3IFMA 2YIUC 2FFDC 1OXZA 4WY4D 1WT6A 4GIFA 4H44B 1KYOD 4A7PA 1PP9D 1JMBA 3T97B 4AAYB 4IFFA 2BASA 4HH2A 2E76C 5DJUB 3CCSP 1P84E 2FYNB 4H13C 3P7KA 1G1JA 3L75E 3HE4B 3RK2B 4BWNA 4QDFB 1RF0A 3G6EP 1X9VA 3PP5A 1EDKA 2KOGA 1LJ2A 2FYUG 2NPSB 1URQB 2W27A 3S1KA 1PGOA 3VP9A 2E75C 3KPEA 1FDMA 2Q1KA 2XU6A 3FGAD 1BE3G 3ZDMA 5KJ7A 4OGQD 2O1KA 5H2FE 1S9KD 5GTHH 1M7LA 3FWNA 3JCUH 3KYQA 2M8RA 2B87B 2IFMA 5AW6B 1OW6A 4I1LA 4PV1C 1CI6B 1BE3E 1HWTC 3B8EB 1LT1A 4HM2A 2KSJA 3CCQP 1PP9G 2D2CB 3L74G 5KAFH 2WSFJ 1LP1A 3CC4P 3VMXA 2PAJA 2WPVB 1LT9C 3KQGA 3P8CE 1SQBK 1VF5B 1Z56A 2HR3A 2DE7D 2WZ7A 2JO6A 1ZW0A 1AVOA 2J58A 5KAIE 4RO0A 3GLMA 1KYOE 3CI9A 1PP9E 3GKEA 3CCUP 1L0LD 3SFEC 3W67A 3D71A 1Q86Q 4W7YA 1UUWA 3L37A 1GMJA 2XZRA 2ZFCA 2JDIH 1JTHA 3A7OA 3FXDA 1N8RQ 1GW4A
chains in the Genus database with same CATH topology
1Q90D 3Q2YA 2QIWA 4H44D 2QJYC 3GL0A 2QJKC 1Y9BA 1AJYA 1RFSA 4OGQC 1ULJA 1OW7A 2BMOA 4AIVA 3GTSA 4RKUJ 5KLIC 5HL4A 1NYKA 2BCCE 1ZP0C 1NYHA 4NBBD 3AECC 3GMAA 1SQQE 4R4LA 2GBWA 2BMQA 2O01J 3L73E 2V7QJ 2MKVA 2JP3A 3GCEA 3CX5E 3DQYA 3FOUA 2A06E 2JZAA 2E4QA 1PIXA 5M1BA 2JO1A 1SQBE 1O7WA 2XSOA 5L8RJ 3GF7A 4H13B 2HMKA 4HM6A 2OQQA 3AEFC 2DE6D 4KT0J 1U57A 3Q1MA 3D89A 4IL6X 2ZT9C 1EG9A 2YFIA 1L0LE 2CKFA 1DD4A 4R4MA 2XRXA 4QUQA 2B1XA 3Q5RA 1YQ3C 4NBFD 2BEQD 3AZCA 4HM8A 1VF5D 2WQYC 1Q90C 1NGMB 2HMMA 5KKZC 4H44C 4QUPA 5AEUA 4NB9D 4Y28J 1RIEA 1ULIA 4PV1B 2FYNC 4GDOA 3RL0g 2G3AA 1RQVA 1O7GA 4HM1A 3H1HE 4QURA 3L71E 3LW5J 1HF9A 2IBZE 1YQ4C 2NVFA 2E4PA 4NBDD 1OW8A 1ZOYC 2XSHA 2FBWC 1VL2A 2E74D 3AE9C 1NTZE 5BOKA 2NVGA 3R4YA 4I7ZB 4YTPC 1FDOA 3G9RA 5CXMA 3AE3C 1KB9E 3C8VA 4NBED 3GL2A 1S5LX 2YFJA 3Q3DA 2DE5D 3S9OA 3AE7C 3TGUE 1WMKA 3AE2C 1MKMA 2H89C 3VMHD 3H1JE 3AEBC 2YVJB 1JB0J 1ZRTE 1EXIA 3Q5SA 3GTEA 3H1IE 1HJ0A 2QJPC 4NBGD 3Q5PA 1NDOA 4QCKA 4TT3H 3H1LE 2NUKA 3D70A 1PV3A 1K04A 2P10A 4HM0A 4U3FE 1VF5C 4OGQB 3H25A 2E76D 2QSIA 3VMID 3L70E 3AE6C 2NVEA 1KQGB 1KTMA 2FYUE 1UIXA 3C0DA 3GOBA 1NU1E 1SQXE 4QDDA 3D6YA 4P1CH 3AEEC 1WQLA 3CXHE 3SFDC 2NUMA 2D2CD 2E75D 4PD4E 1SQPE 1S1CX 4H0LC 1PPJE 1NTKE 1UUVA 2IDBA 2BMRA 2E74C 3BCCE 4P1BH 4HKVA 3VCPA 3RK3E 4YXDC 4PV1D 3AEDC 2GBXA 1O7HA 4NB8D 3CWBE 1R8EA 3EWKA 2ZYLA 3GZYA 2ZT9B 4XFJA 1TU3F 1ZMEC 4H0LD 3L74E 1DD3A 2HMNA 4EMJB 3AEAC 1VCKA 3AE4C 1JM1A 1O7NA 1OMIA 1BCCE 5AEWA 4QDFA 2YIUC 5KLVE 3B71A 2J5UA 1O7MA 4H44B 3IAOA 3L72E 1VM9A 3T97B 2E74B 2G8YA 4AAYB 2WSCJ 1G8KB 2QPZA 2E76C 1P84E 4HM4A 4H13C 2YFLA 3EN1A 3L75E 4QDFB 2NZ2A 3GZXA 3AE8C 2HMJA 1K05A 1PL5A 4NBAD 2D2CC 2E75C 3GF3A 1SJGA 3ABVC 3GB4A 3FGAD 1EZVE 4HJLA 1KMIZ 4H13D 1EXJA 4OGQD 1FQTA 3AEGC 2XR8A 1DIPA 2HMOA 4Z1MH 1G8JB 1KORA 3AE5C 2Q3WA 2E76B 2I7FA 1L0NE 1OW6A 1KILE 4PV1C 2B24A 4QDCA 1BE3E 4NBCD 3AE1C 4HM2A 1FDIA 3N0QA 3VCAA 1NTME 3H1KE 2D2CB 1KQFB 2E75B 1SQVE 2WSFJ 2FXPA 2WSEJ 2WPVB 1VF5B 2DE7D 2BEZF 2JO6A 2K9YA 2H88C 4I7ZC 3GLMA 1KYOE 2YMKA 1PP9E 4U7JA 3O6QA 2NWFA 3GKEA 2ZT9D 3SFEC 4HM5A 3D71A 4HM7A 3VMGD 1UUWA 3D6ZA 1O7PA 1GMJA 3IN6A 4H0LB 1RQUA 2HMLA 3EQQA 4HM3A 4NBHD 1IK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  1NU1 E;  1SQX E;  4NB9 D;  4QDD A;  4Y28 J;  1RIE A;  1ULI A;  4P1C H;  2QIW A;  4NBA D;  4H44 D;  2QJY C;  3GL0 A;  2QJK C;  1WQL A;  4PV1 B;  3CXH E;  1SJG A;  2FYN C;  1RFS A;  2NUM A;  2D2C D;  2E75 D;  1ULJ A;  3GB4 A;  4PD4 E;  1SQP E;  1O7G A;  1EZV E;  4HJL A;  2BMO A;  4HM1 A;  3H1H E;  4AIV A;  3GTS A;  4H13 D;  4RKU J;  5KLI C;  4OGQ D;  1FQT A;  4QUR A;  5HL4 A;  1NYK A;  1NTK E;  1PPJ E;  1UUV A;  3L71 E;  2XR8 A;  3LW5 J;  2HMO A;  1G8J B;  2BCC E;  2IBZ E;  5AEU A;  4NBB D;  2BMR A;  2NVF A;  2E4P A;  3BCC E;  4NBD D;  1SQQ E;  2E76 B;  2I7F A;  2Q3W A;  1L0N E;  4P1B H;  4HKV A;  2XSH A;  2B24 A;  2E74 D;  3VCP A;  2GBW A;  2BMQ A;  2O01 J;  3L73 E;  1BE3 E;  4NBC D;  1NTZ E;  4QDC A;  3GCE A;  5BOK A;  4PV1 D;  2NVG A;  2GBX A;  3CX5 E;  1O7H A;  4HM2 A;  4NB8 D;  4I7Z B;  3CWB E;  3DQY A;  2ZYL A;  3N0Q A;  3GZY A;  3FOU A;  5CXM A;  2A06 E;  2JZA A;  2ZT9 B;  1KB9 E;  2E4Q A;  3VCA A;  4H0L D;  1SQB E;  1NTM E;  3H1K E;  3L74 E;  3C8V A;  1O7W A;  4NBE D;  2D2C B;  2E75 B;  1SQV E;  2XSO A;  2HMN A;  2WSF J;  3GL2 A;  2WSE J;  4EMJ B;  1S5L X;  5L8R J;  1VCK A;  2WPV B;  1JM1 A;  2YFJ A;  4H13 B;  2HMK A;  4HM6 A;  2DE5 D;  1VF5 B;  1O7N A;  2DE7 D;  1BCC E;  3TGU E;  2JO6 A;  3VMH D;  2K9Y A;  5AEW A;  3H1J E;  4QDF A;  2YIU C;  5KLV E;  2DE6 D;  2YVJ B;  1JB0 J;  1ZRT E;  4KT0 J;  1O7M A;  1KYO E;  3GTE A;  3D89 A;  3H1I E;  4IL6 X;  1PP9 E;  1EG9 A;  4H44 B;  2QJP C;  3L72 E;  1VM9 A;  2YFI A;  4NBG D;  2NWF A;  1NDO A;  1L0L E;  2CKF A;  3GKE A;  4QCK A;  3H1L E;  2E74 B;  4AAY B;  2NUK A;  2XRX A;  2ZT9 D;  4QUQ A;  2WSC J;  2B1X A;  1G8K B;  2QPZ A;  4HM5 A;  1P84 E;  4HM4 A;  4HM0 A;  4HM7 A;  3VMG D;  4NBF D;  4OGQ B;  2YFL A;  3EN1 A;  3L75 E;  4U3F E;  1UUW A;  2QSI A;  2E76 D;  3AZC A;  3VMI D;  4HM8 A;  3L70 E;  1O7P A;  4H0L B;  1VF5 D;  2NVE A;  4QDF B;  2HML A;  1Q90 C;  2HMM A;  2FYU E;  3EQQ A;  4HM3 A;  5KKZ C;  3GZX A;  4NBH D;  3C0D A;  2HMJ A;  4QUP A;  3GOB A; 
#chains in the Genus database with same CATH topology
 4L74 A;  1QL2 A;  2QIW A;  5APY A;  1KQS O;  1Y9B A;  2IZ0 A;  2K9J A;  1RFS A;  2WTY A;  2BMO A;  3GTS A;  2KK7 A;  1S9K E;  3M91 A;  3F89 A;  1NYK A;  4IFM A;  2ZYA A;  4ZKU A;  1FJK A;  1M56 D;  2Q6Q A;  4W80 A;  3MIW A;  5AW3 B;  2IBZ D;  3I56 P;  2PFX A;  5AW8 B;  1KFM A;  2VRS A;  2W6A A;  2YO2 A;  2MKV A;  3GCE A;  3QH9 A;  1VPC A;  3CX5 E;  4N78 D;  3DQY A;  3FOU A;  2A06 E;  3V4W A;  1VQM P;  1NTZ K;  1PIX A;  2O01 H;  2M5A B;  2M3B A;  1LTS C;  3H1K G;  3HD7 C;  5B5E H;  3GF7 A;  1JM0 A;  1BGY D;  3CD6 P;  4LC1 A;  1EQ7 A;  1L0L E;  1DD4 A;  5E79 E;  3CC2 P;  3UIA A;  3L70 J;  1YQ3 C;  4GT1 A;  2OYI A;  1YIT P;  2BEQ D;  4U3F D;  4HM8 A;  3C1L A;  2P7J A;  3KHU A;  3KXD A;  1JEK A;  2KI7 B;  1NGM B;  1NU1 J;  5AVU B;  2HMM A;  3PLN A;  3RL0 B;  1ULI A;  1SQX D;  3GG2 A;  1IFM A;  2FYU K;  1LT9 A;  1IFI A;  1PZQ A;  5BVZ A;  5B66 E;  1AQ5 A;  3CXH D;  4I2L C;  1E5W A;  1BDC A;  4HM1 A;  2O01 N;  1USE A;  4PD4 H;  1G1I A;  4Y99 C;  3LW5 J;  1M1J B;  2IBZ E;  1IJD B;  2OYH C;  1S2E A;  1YHQ P;  2NVF A;  1NTK K;  2E4P A;  2OYO A;  2ITA A;  2B89 A;  1HBW A;  1SQQ G;  5AVZ B;  2XSH A;  1N7S B;  3AE9 C;  5CHX A;  3IF4 A;  4WY4 B;  1AVY A;  4N78 E;  4ZMD A;  3RK2 D;  5CXM A;  3HRN A;  4D6T D;  2WPS A;  2B88 A;  1FZE A;  2ZXE B;  3GL2 A;  1T3J A;  4O9B A;  2YFJ A;  4DJG A;  2DE5 D;  3B5N A;  3AE7 C;  3NTN A;  5KLV J;  1WMK A;  3EQ2 A;  1MKM A;  2H89 C;  1ZLL A;  4IFD K;  1YJ9 P;  1BGY E;  3AEB C;  1L4A C;  3KDP B;  1JB0 J;  2WVR A;  1YYC A;  3Q5S A;  1T6A A;  2O1J A;  5AVY B;  3L72 D;  2P10 A;  1K04 A;  5CJ4 A;  3U1C A;  4HM0 A;  4U3F E;  4OGQ B;  2QSI A;  3VMI D;  1P84 H;  5CMZ A;  2KZI A;  3R2P A;  3AE6 C;  2NVE A;  1UII A;  3HUS C;  3V5B A;  3H1I D;  1SQX E;  3D6Y A;  3HD7 A;  3AEE C;  3PJS K;  2R5D A;  4MN4 C;  2N1T C;  3CXH E;  2D2C D;  1SQP E;  1FOS E;  2Q7C A;  2LXB A;  1NHL A;  2I1K A;  2IDB A;  2Q9I A;  4D6T G;  1A02 F;  2AEM A;  1USD A;  1IFD A;  5H2F H;  1LWU B;  4NPE A;  2IPP A;  1SQP J;  1L0N D;  1KIL D;  3BVH A;  3VCP A;  2PP6 A;  5APU A;  1VQ4 P;  2GBX A;  1LTJ B;  1SFC C;  2C0W A;  3V2P A;  3I55 P;  1RF1 B;  3WUV A;  4D6T E;  1SQV J;  2GM4 A;  3L72 G;  1M57 D;  4OVN F;  1H0T B;  3TDK A;  1EC5 A;  4ZKP A;  1W5C E;  5AW4 B;  3RGU A;  3BCC D;  1DX7 A;  3GHG C;  1YJN P;  1N73 C;  3H1J G;  1JCC A;  1JY2 N;  1J1E C;  1PGJ A;  3CWB D;  3L72 E;  2OYH A;  3H1I G;  5AW7 B;  5KAI H;  1SS1 A;  4HM4 A;  2N9Y B;  5TJH A;  4XA4 A;  3CCE P;  1HTL C;  2WSC H;  5KJ7 C;  1NKZ B;  4PD4 I;  3H32 A;  1K05 A;  1U7M A;  1PL5 A;  1FE6 A;  2XNX A;  1SJG A;  1FZC A;  3L35 A;  1KMI Z;  4AUW A;  2FFD B;  1FQT A;  3N4X A;  2HPC A;  1AFO A;  4TLF A;  1U7J A;  1KFN A;  2E76 B;  1L0N E;  1KIL E;  3BCC G;  1GW3 A;  2KS1 A;  1KC8 Q;  2I1J A;  3L73 D;  1SQQ K;  3TNU B;  2UWJ E;  1VQ8 P;  4ZNC A;  3CWB G;  3HUS A;  4ASV A;  1FZG A;  3L4F A;  1L0N J;  3ITK A;  2E75 B;  3CCM P;  2FXP A;  2WSE J;  2N1T A;  1FC2 C;  3RL0 D;  2P2U A;  1NH4 A;  1VQ9 P;  2WWW A;  4I7Z C;  1GL2 D;  1GZL A;  1P84 I;  1VQK P;  3O6Q A;  1T2K C;  2GUV A;  1YTZ I;  3VMG D;  5APW A;  4RJT A;  3P8C D;  1GD2 E;  3L75 G;  1SFC A;  4H0L B;  2HML A;  3EQQ A;  2HLO A;  2K37 A;  5CCH C;  3CPW O;  2HOD B;  1Q90 D;  1M90 Q;  3Q2Y A;  4K3A A;  3GHG A;  3CCR P;  2YKP A;  4C7N A;  1N73 A;  5B66 H;  3VMY A;  5KLI C;  5HL4 A;  3H1H D;  1CZQ A;  3L71 D;  5CJ0 A;  4NBB D;  2W90 A;  2YO3 A;  4KJM A;  2LXC B;  1FZB A;  1JCD A;  3L73 E;  1VQP P;  1NJI Q;  1G2C A;  5KTB A;  2WIT A;  1JY2 P;  2K1A A;  2JZA A;  3WU2 E;  1JOC A;  2V7Q H;  1O7W A;  4BRY A;  5L8R J;  3TGU J;  1KYO I;  2FKW B;  3L73 J;  1MV8 A;  2HMK A;  4HM6 A;  3U59 A;  2OYI C;  2CPB A;  3JSV C;  2OQQ A;  3CL3 D;  3AEF C;  2JWD A;  3A2A A;  3G71 P;  3CX5 D;  4DZO A;  3D89 A;  1RE4 A;  2V4H A;  4IL6 X;  2YKQ A;  2ZT9 C;  2P1J A;  2A06 D;  3V2N A;  3G3Z A;  2POH A;  4QUQ A;  3FX0 A;  4WWI A;  3Q5R A;  2KYV A;  2H43 A;  4NBF D;  2E5T A;  2RH0 A;  1KQL A;  2FYU J;  4PJ0 E;  3L70 D;  1Q2N A;  2WQY C;  1DH3 A;  1PFI A;  1NO4 A;  4H44 C;  1SLQ A;  4QUP A;  5TIS E;  4Y28 J;  1KIL B;  1NU1 D;  3LID A;  2MJZ A;  3A0H E;  2FYN C;  4GDO A;  3RL0 g;  4B86 A;  1NTK J;  1O7G A;  4JYB A;  3CXH H;  1X0T A;  3H1H E;  1HVV A;  4K35 A;  1GU5 A;  3L71 E;  1HF9 A;  2NPS C;  1URQ C;  2PRR A;  3CX5 I;  2WT7 B;  1ZOY C;  2FBW C;  3H1H J;  2QE7 H;  3VN0 A;  5BOK A;  4N3Y B;  3B5N C;  1JY3 N;  3RK3 D;  3MZW B;  1OIP A;  3L71 J;  4YTP C;  1FDO A;  3L74 J;  5DJT B;  3AE3 C;  1KB9 E;  5CCH A;  2A06 G;  4GOD A;  1JNM A;  3M06 A;  1Q7Y Q;  1S5L X;  1BCC J;  2DW3 A;  3OAK A;  1AQT A;  3K5B A;  3Q3D A;  3AE2 C;  1LGH B;  3II6 A;  3VMH D;  3L70 G;  4Y99 B;  4C7R A;  2YVJ B;  3HE5 A;  5KLV D;  3GTE A;  3CCL P;  4AYC A;  2QJP C;  2OTJ P;  1NDO A;  3MD0 A;  1L0L G;  2NUK A;  2QJY B;  2QJK B;  1XTC C;  3U1A A;  2W6J H;  1VF5 C;  3NXS A;  2K88 A;  3M9B A;  2QA4 P;  2E76 D;  5CCG C;  3L70 E;  5AVQ B;  4C46 A;  1K9M Q;  3A0B E;  4NPD A;  4ASW A;  1UIX A;  4LGD E;  2YXQ B;  3GOB A;  1NU1 E;  4QDD A;  4DCK A;  4P1C H;  1MFZ A;  1NWQ A;  3RBX A;  4WBA A;  1GK6 A;  2IBZ I;  1RH5 B;  2E75 D;  1S72 P;  2FYZ A;  1L4A B;  2R44 A;  1GK4 A;  4HYT B;  5GTI E;  4DOJ A;  4EYY Q;  1YBK A;  3A5T A;  2IBZ G;  2BMR A;  2E74 C;  1FBM A;  3P8M C;  2ZVN B;  4P1B H;  2SPZ A;  1FZF A;  3RK3 E;  1GL2 B;  1RY3 A;  4PV1 D;  3AED C;  1VQN P;  1O7H A;  1LTG C;  1SQP D;  3G4S P;  2ZYL A;  1N2D C;  5KLV G;  3GZY A;  3H1K J;  4XFJ A;  3GW6 A;  1ZME C;  4H0L D;  2KNC B;  3T97 A;  5AVS B;  2N1T B;  1VCK A;  1SQV D;  3AE4 C;  2ZXX A;  2Z5I A;  3HTK B;  1QL1 A;  3HE4 A;  1O7N A;  3E1R A;  5AEW A;  4QDF A;  5KLV E;  1QVF O;  2WPR A;  2KLU A;  2JWA A;  1O7M A;  1BGY G;  4HKZ H;  2NPS A;  1URQ A;  3IAO A;  1H89 A;  2G8Y A;  4EDF A;  1G8K B;  4OH8 B;  2QPZ A;  4L76 A;  1N86 A;  3SWF A;  2YFL A;  1FZC C;  3JCU E;  4U3F G;  4KHX A;  1SFC B;  1LTB C;  3CXH I;  2NZ2 A;  3AE8 C;  2B87 A;  4UB6 E;  1SQX G;  4WVZ A;  1J2J B;  1N7L A;  1D7M A;  1CI6 A;  3ABV C;  4HB1 A;  3GB4 A;  1R5L A;  3KZI E;  1EZV E;  1NVO A;  1QLE D;  1JY3 P;  1SQP G;  4L73 A;  1EXJ A;  2YXR B;  5AW0 B;  1J1E B;  3AEG C;  2XR8 A;  5CBO A;  1DIP A;  2HMO A;  1G8J B;  3W68 A;  3EFG A;  2H8P D;  3AE5 C;  1E79 H;  2I7F A;  2AXC A;  4QDC A;  5CCG A;  4NBC D;  1OZH A;  3N0Q A;  2A45 I;  4LLH A;  3VCA A;  4EOT A;  1NTM E;  1M1K Q;  2KLV A;  1SQB D;  1SQV E;  3WU2 H;  5EFW B;  5APS A;  2W83 C;  2A45 G;  3HD7 D;  1N7S C;  2Q3E A;  4WY4 C;  2K9Y A;  5K5G B;  2H88 C;  3IR9 A;  2WSF H;  1NTM J;  2R5B A;  2AEJ A;  2GA1 A;  4L75 A;  2B9B A;  1IO4 A;  1LP1 B;  1J1D C;  1VQ5 P;  1L0L K;  4GOE A;  3IN6 A;  1RQU A;  4XE5 B;  4NPF X;  4HM3 A;  1JY2 O;  4NBH D;  2ZYG A;  3SSU A;  1KYO H;  1ZR4 A;  1AJY A;  5TIS H;  3RK3 B;  3N7N A;  4OGQ C;  1ULJ A;  3QWO C;  1OW7 A;  1VQL P;  3A0H H;  1VQ6 P;  4AIV A;  1R5S A;  2JR8 A;  4IL6 E;  1HGZ A;  1KD1 Q;  1JTH B;  4N6J A;  2QVA A;  2OAR A;  2BCC E;  2ZAE B;  2M5A A;  3NFQ A;  3VMZ A;  2N9B A;  3GMA A;  1ZN5 A;  2IFN A;  4R4L A;  2K9J B;  1L0N G;  1SVF A;  1RHZ B;  2BMQ A;  2O01 J;  2JP3 A;  2WPQ A;  4UB8 E;  1NTZ D;  2YIU B;  1DEE G;  2BCC J;  3S4R A;  2M0B A;  2E4Q A;  5M1B A;  1RE4 C;  3CC7 P;  1SQB E;  4AQR D;  2FXM A;  2YMY A;  2XSO A;  1IK9 A;  4H13 B;  3PH0 A;  2KUB A;  3H1J J;  3PTZ A;  1LNQ A;  3TGU D;  1LTJ C;  3V2R A;  1U57 A;  3Q1M A;  1SQB J;  3TK1 A;  2PGD A;  1OVR A;  3H1L J;  1L4A D;  3CX5 H;  2YFI A;  4R4M A;  1AV1 A;  2Q3I A;  1HJB A;  4DT0 A;  5AW5 B;  2C0X A;  2QM8 A;  2IYO A;  3CCJ P;  5KKZ C;  1M1J A;  1LTI C;  2FYU D;  3WUU A;  3O8Z A;  5AEU A;  2K3R A;  4NB9 D;  1S5L E;  2AXT E;  4PV1 B;  1N7S A;  3MGN A;  5E79 H;  2OYI B;  4WY4 A;  1SQX K;  1Y47 A;  2N1T D;  2ZJS E;  1BDD A;  3VMA A;  3A3Y B;  5C39 A;  2Z5H A;  1PPJ D;  1NTK D;  3TF5 A;  2RKL A;  1SQP K;  2AEF A;  1X8Y A;  5GTI H;  4JBZ A;  4NBD D;  3JC2 2;  3CMA P;  1LT9 B;  1OW8 A;  3BRV B;  1YJW P;  3LW5 H;  1KN7 A;  1NTZ E;  1QX8 A;  3L73 G;  1NAF A;  2LKM A;  3V4Q A;  2RMZ A;  3G9R A;  2Q5U A;  1OVU A;  1HUC A;  1SFC D;  2Y0C A;  3C8V A;  2E42 A;  3L74 D;  2CPS A;  1NTZ J;  3FWL A;  3TGU E;  2JEE A;  1BCC D;  3BRT B;  1YTZ T;  3OA7 A;  3RBZ A;  4QCK A;  1GDT A;  1KB9 D;  2XV5 A;  3D70 A;  3L75 J;  3LIE A;  1PGQ A;  3VOP A;  3SWY A;  2IZ1 A;  3B5N B;  5AW1 B;  1GU4 A;  2FY8 A;  2XDJ A;  1KQG B;  1PPJ G;  1NTK G;  2FYU E;  1VDF A;  5KJ7 D;  2L5G B;  1LWU A;  1X22 A;  3CCV P;  1WQL A;  2NUM A;  2ZYD A;  4UB6 H;  1L2P A;  3CME P;  1S1C X;  2KP8 A;  1LTJ A;  4H0L C;  3H1H G;  1PPJ E;  1NTK E;  3KZI H;  1RF1 A;  2E5Y A;  1UUV A;  2QJP B;  2WSS H;  3L71 G;  1KV4 A;  1IFJ A;  1H0T A;  3HD7 B;  1BE3 J;  2HG5 D;  1EDL A;  4HKV A;  1IFP A;  1KB9 I;  1OFC X;  2J59 M;  1BCC G;  4YXD C;  3RK2 C;  1FAV A;  2OGU A;  4NB8 D;  1L0N K;  1QGK B;  3V6I A;  3EWK A;  4W7Z A;  2W8Z A;  2KSE A;  1TU3 F;  1CSB A;  4JF7 A;  3L74 E;  4M3L A;  2E43 A;  3H1K D;  1JO5 A;  3AEA C;  3CLQ A;  1JM1 A;  1EDI A;  4YPC A;  1BCC E;  5AVV B;  3TYY A;  1PP9 J;  1JY3 O;  1LTT C;  2QEX P;  2Y0D A;  3B71 A;  2J5U A;  2XKM A;  1VM9 A;  1NKN A;  2Z4E A;  2E74 B;  2WSC J;  1Q82 Q;  1T2K D;  1RE3 C;  3EN1 A;  4EI2 A;  2A45 H;  2ZVO B;  2FFD A;  3F5H A;  1Q81 Q;  3GZX A;  4JQ0 D;  2OYH B;  2HMJ A;  5AVW B;  1DEB A;  1IFN A;  4NBA D;  1NU1 G;  2D2C C;  5CCH D;  4GOF A;  3GF3 A;  1H88 A;  1NAY A;  2M3E A;  1IZN B;  4HJL A;  1MUU A;  2R3S A;  3TNU A;  4H13 D;  2Y9Y A;  2H7H A;  4Z1M H;  1KOR A;  4IL6 H;  3H32 B;  2WMM A;  1KIL C;  2Q3W A;  1ZV8 A;  1K8A Q;  1SQQ D;  2B24 A;  1FZC B;  3AE1 C;  1EZV D;  3MTU E;  1FDI A;  2R32 A;  4UB8 H;  2HPC B;  1MZ9 A;  3MUD C;  3H1K E;  1KQF B;  2BEZ F;  2KS1 B;  2NRG A;  3M0D C;  2WSE H;  1L0L J;  1YIJ P;  3HUS B;  2YMK A;  4U7J A;  2GUS A;  2HOD A;  2NWF A;  4CPG A;  3PHL A;  5BU8 B;  2ZT9 D;  3BAT A;  1NTM D;  2IX7 C;  1X79 B;  5AVR B;  4HM5 A;  3L36 A;  4HM7 A;  5AVT B;  3D6Z A;  2OTL P;  4IOI H;  1O7P A;  1MFT A;  1JMM A;  1FS0 E;  3TSI A;  1IC2 A;  3V2Q A;  3O6Q B;  1EZV I;  1IK7 A;  1CW5 A;  1HGV A;  4H44 D;  2QJY C;  3GL0 A;  2QJK C;  4QMA A;  1S5L H;  2QG4 A;  1ZXG A;  2AXT H;  5GTH E;  1EZV G;  3C9I A;  4RKU J;  3VP8 A;  1SP4 A;  1W2B O;  2QRX A;  2JKV A;  1ZP0 C;  2Y0E A;  1NYH A;  1OWA A;  3AEC C;  1H8A A;  1SQQ E;  2NPS D;  1URQ D;  1J1D B;  1W2E A;  1RE3 A;  2KIK A;  2GBW A;  3GHG B;  2V7Q J;  4C7N B;  1N73 B;  1A02 J;  3B5N D;  5KAF E;  3SWK A;  4YXW H;  2JO1 A;  1SQQ J;  1NTM G;  2BCC D;  3RL0 C;  2R3C A;  1SQV G;  1WRG A;  2P67 A;  1VQO P;  1PGP A;  1S3J A;  1BGY J;  1GL2 C;  3M9H A;  2FXO A;  1G2C B;  2DE6 D;  3M0A A;  3H1J D;  4KT0 J;  1T8Z A;  1ZR2 A;  1ZRT D;  3WMM 0;  1NOH A;  1EG9 A;  1M1J C;  2CKF A;  5APV A;  1KIL A;  4BRY B;  4EIJ A;  2XRX A;  1M8O B;  3H1L D;  4U3F J;  2B1X A;  1QEX A;  4RES B;  5APX A;  3WUT A;  3AZC A;  3P32 A;  1BSH A;  3MP7 B;  2XND H;  4JYC A;  1VF5 D;  5CCG D;  3NMD A;  1JUN A;  1Q90 C;  2HFE D;  1SQX J;  3MUD A;  2L91 A;  1T3U A;  4JPZ B;  2YKO A;  1RIE A;  3MHV A;  2WT7 A;  1BSN A;  2G3A A;  1NU1 K;  2KZJ A;  1RQV A;  3M0D A;  1FU1 A;  5AVX B;  2W6B A;  4PD4 D;  5AW2 B;  4QUR A;  3H6P A;  4GKG A;  2I8D A;  1S4X A;  4PJ0 H;  2BCC G;  1YQ4 C;  2QM7 A;  4BXL A;  1QVG O;  2RN0 A;  1VL2 A;  1HH0 A;  2E74 D;  3E1I A;  1EDJ A;  4WB4 A;  3VYI A;  2NVG A;  3R4Y A;  4I7Z B;  4D6T J;  1RF0 C;  1AA0 A;  5KKZ B;  1LTA C;  5B5E E;  2LR2 A;  1OVV A;  2IYP A;  4NBE D;  1SQB G;  2CK3 H;  1FZA A;  3H1L G;  4I6M C;  3M9Q A;  3S9O A;  1FOS F;  5CBN A;  1FJP A;  3H1J E;  3L72 J;  1OX3 A;  1ZRT E;  1EXI A;  3H1I E;  1HJ0 A;  4NBG D;  3Q5P A;  3E7K A;  3H1L E;  4TT3 H;  3BAS A;  5KLV K;  2KB7 P;  1LWU C;  1KB9 H;  1KZU B;  2HYN A;  1PV3 A;  5BU5 A;  1Y8A A;  1P84 D;  3H25 A;  4HJG H;  3L75 D;  1L4A A;  5KLI B;  3H1I J;  3HE5 B;  1KTM A;  3PRJ A;  3VTP C;  1RF1 C;  5AW9 B;  3C0D A;  1GTW A;  2YNY A;  2JJL A;  3SFD C;  1GL2 A;  4PD4 E;  5APQ A;  5APT A;  3B4S A;  2KNC A;  2OTK E;  2C9N Y;  3BCC E;  3EFF K;  1YI2 P;  2KXP B;  3A0B H;  2O3J A;  3RK3 C;  3HTK A;  3I5C A;  1BE3 D;  2C9L Y;  1NTZ G;  3CWB E;  1R8E A;  3FXE A;  2Y9Z A;  1K73 Q;  1VQ7 P;  2ZT9 B;  3OJA B;  3USS A;  3BCC J;  1DD3 A;  4OWF A;  2HMN A;  1XTG B;  4EMJ B;  2P58 A;  3OW2 O;  1NTM K;  1OMI A;  3CWB J;  1SQV K;  3TGU G;  1N7S D;  3IFM A;  2YIU C;  2FFD C;  1OXZ A;  4WY4 D;  1WT6 A;  4GIF A;  4H44 B;  1KYO D;  4A7P A;  1PP9 D;  1JMB A;  3T97 B;  4AAY B;  4IFF A;  2BAS A;  4HH2 A;  2E76 C;  5DJU B;  3CCS P;  1P84 E;  2FYN B;  4H13 C;  3P7K A;  1G1J A;  3L75 E;  3HE4 B;  3RK2 B;  4BWN A;  4QDF B;  1RF0 A;  3G6E P;  1X9V A;  3PP5 A;  1EDK A;  2KOG A;  1LJ2 A;  2FYU G;  2NPS B;  1URQ B;  2W27 A;  3S1K A;  1PGO A;  3VP9 A;  2E75 C;  3KPE A;  1FDM A;  2Q1K A;  2XU6 A;  3FGA D;  1BE3 G;  3ZDM A;  5KJ7 A;  4OGQ D;  2O1K A;  5H2F E;  1S9K D;  5GTH H;  1M7L A;  3FWN A;  3JCU H;  3KYQ A;  2M8R A;  2B87 B;  2IFM A;  5AW6 B;  1OW6 A;  4I1L A;  4PV1 C;  1CI6 B;  1BE3 E;  1HWT C;  3B8E B;  1LT1 A;  4HM2 A;  2KSJ A;  3CCQ P;  1PP9 G;  2D2C B;  3L74 G;  5KAF H;  2WSF J;  1LP1 A;  3CC4 P;  3VMX A;  2PAJ A;  2WPV B;  1LT9 C;  3KQG A;  3P8C E;  1SQB K;  1VF5 B;  1Z56 A;  2HR3 A;  2DE7 D;  2WZ7 A;  2JO6 A;  1ZW0 A;  1AVO A;  2J58 A;  5KAI E;  4RO0 A;  3GLM A;  1KYO E;  3CI9 A;  1PP9 E;  3GKE A;  3CCU P;  1L0L D;  3SFE C;  3W67 A;  3D71 A;  1Q86 Q;  4W7Y A;  1UUW A;  3L37 A;  1GMJ A;  2XZR A;  2ZFC A;  2JDI H;  1JTH A;  3A7O A;  3FXD A;  1N8R Q;  1GW4 A; 
#chains in the Genus database with same CATH homology
 1Q90 D;  3Q2Y A;  2QIW A;  4H44 D;  2QJY C;  3GL0 A;  2QJK C;  1Y9B A;  1AJY A;  1RFS A;  4OGQ C;  1ULJ A;  1OW7 A;  2BMO A;  4AIV A;  3GTS A;  4RKU J;  5KLI C;  5HL4 A;  1NYK A;  2BCC E;  1ZP0 C;  1NYH A;  4NBB D;  3AEC C;  3GMA A;  1SQQ E;  4R4L A;  2GBW A;  2BMQ A;  2O01 J;  3L73 E;  2V7Q J;  2MKV A;  2JP3 A;  3GCE A;  3CX5 E;  3DQY A;  3FOU A;  2A06 E;  2JZA A;  2E4Q A;  1PIX A;  5M1B A;  2JO1 A;  1SQB E;  1O7W A;  2XSO A;  5L8R J;  3GF7 A;  4H13 B;  2HMK A;  4HM6 A;  2OQQ A;  3AEF C;  2DE6 D;  4KT0 J;  1U57 A;  3Q1M A;  3D89 A;  4IL6 X;  2ZT9 C;  1EG9 A;  2YFI A;  1L0L E;  2CKF A;  1DD4 A;  4R4M A;  2XRX A;  4QUQ A;  2B1X A;  3Q5R A;  1YQ3 C;  4NBF D;  2BEQ D;  3AZC A;  4HM8 A;  1VF5 D;  2WQY C;  1Q90 C;  1NGM B;  2HMM A;  5KKZ C;  4H44 C;  4QUP A;  5AEU A;  4NB9 D;  4Y28 J;  1RIE A;  1ULI A;  4PV1 B;  2FYN C;  4GDO A;  3RL0 g;  2G3A A;  1RQV A;  1O7G A;  4HM1 A;  3H1H E;  4QUR A;  3L71 E;  3LW5 J;  1HF9 A;  2IBZ E;  1YQ4 C;  2NVF A;  2E4P A;  4NBD D;  1OW8 A;  1ZOY C;  2XSH A;  2FBW C;  1VL2 A;  2E74 D;  3AE9 C;  1NTZ E;  5BOK A;  2NVG A;  3R4Y A;  4I7Z B;  4YTP C;  1FDO A;  3G9R A;  5CXM A;  3AE3 C;  1KB9 E;  3C8V A;  4NBE D;  3GL2 A;  1S5L X;  2YFJ A;  3Q3D A;  2DE5 D;  3S9O A;  3AE7 C;  3TGU E;  1WMK A;  3AE2 C;  1MKM A;  2H89 C;  3VMH D;  3H1J E;  3AEB C;  2YVJ B;  1JB0 J;  1ZRT E;  1EXI A;  3Q5S A;  3GTE A;  3H1I E;  1HJ0 A;  2QJP C;  4NBG D;  3Q5P A;  1NDO A;  4QCK A;  4TT3 H;  3H1L E;  2NUK A;  3D70 A;  1PV3 A;  1K04 A;  2P10 A;  4HM0 A;  4U3F E;  1VF5 C;  4OGQ B;  3H25 A;  2E76 D;  2QSI A;  3VMI D;  3L70 E;  3AE6 C;  2NVE A;  1KQG B;  1KTM A;  2FYU E;  1UIX A;  3C0D A;  3GOB A;  1NU1 E;  1SQX E;  4QDD A;  3D6Y A;  4P1C H;  3AEE C;  1WQL A;  3CXH E;  3SFD C;  2NUM A;  2D2C D;  2E75 D;  4PD4 E;  1SQP E;  1S1C X;  4H0L C;  1PPJ E;  1NTK E;  1UUV A;  2IDB A;  2BMR A;  2E74 C;  3BCC E;  4P1B H;  4HKV A;  3VCP A;  3RK3 E;  4YXD C;  4PV1 D;  3AED C;  2GBX A;  1O7H A;  4NB8 D;  3CWB E;  1R8E A;  3EWK A;  2ZYL A;  3GZY A;  2ZT9 B;  4XFJ A;  1TU3 F;  1ZME C;  4H0L D;  3L74 E;  1DD3 A;  2HMN A;  4EMJ B;  3AEA C;  1VCK A;  3AE4 C;  1JM1 A;  1O7N A;  1OMI A;  1BCC E;  5AEW A;  4QDF A;  2YIU C;  5KLV E;  3B71 A;  2J5U A;  1O7M A;  4H44 B;  3IAO A;  3L72 E;  1VM9 A;  3T97 B;  2E74 B;  2G8Y A;  4AAY B;  2WSC J;  1G8K B;  2QPZ A;  2E76 C;  1P84 E;  4HM4 A;  4H13 C;  2YFL A;  3EN1 A;  3L75 E;  4QDF B;  2NZ2 A;  3GZX A;  3AE8 C;  2HMJ A;  1K05 A;  1PL5 A;  4NBA D;  2D2C C;  2E75 C;  3GF3 A;  1SJG A;  3ABV C;  3GB4 A;  3FGA D;  1EZV E;  4HJL A;  1KMI Z;  4H13 D;  1EXJ A;  4OGQ D;  1FQT A;  3AEG C;  2XR8 A;  1DIP A;  2HMO A;  4Z1M H;  1G8J B;  1KOR A;  3AE5 C;  2Q3W A;  2E76 B;  2I7F A;  1L0N E;  1OW6 A;  1KIL E;  4PV1 C;  2B24 A;  4QDC A;  1BE3 E;  4NBC D;  3AE1 C;  4HM2 A;  1FDI A;  3N0Q A;  3VCA A;  1NTM E;  3H1K E;  2D2C B;  1KQF B;  2E75 B;  1SQV E;  2WSF J;  2FXP A;  2WSE J;  2WPV B;  1VF5 B;  2DE7 D;  2BEZ F;  2JO6 A;  2K9Y A;  2H88 C;  4I7Z C;  3GLM A;  1KYO E;  2YMK A;  1PP9 E;  4U7J A;  3O6Q A;  2NWF A;  3GKE A;  2ZT9 D;  3SFE C;  4HM5 A;  3D71 A;  4HM7 A;  3VMG D;  1UUW A;  3D6Z A;  1O7P A;  1GMJ A;  3IN6 A;  4H0L B;  1RQU A;  2HML A;  3EQQ A;  4HM3 A;  4NBH D;  1IK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...