2FYNC

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 50
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fynC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fynC02
4NB9D 4H44B 1ZRTE 4QURA 5HL4A 4HM5A 4P1CH 1SQPE 1O7WA 3GZXA 2E76D 2YIUC 2I7FA 3CWBE 2E4PA 1RIEA 3BCCE 4H0LB 3GTSA 4HM7A 1SQVE 2JO6A 3AZCA 2YFJA 1G8KB 4HM1A 2GBXA 1NTKE 2ZYLA 4HM2A 4QDDA 3VMGD 2E4QA 2FYNC 2E75B 3CXHE 2DE5D 3LW5J 3GL0A 2BMOA 3H1KE 2WSEJ 1BCCE 1PPJE 4KT0J 1KB9E 4HKVA 2HMKA 2NUKA 3VCPA 2YFLA 2ZT9D 2QSIA 1EG9A 3L71E 2E76B 2FYUE 2QJYC 4HM0A 2CKFA 1VCKA 1P84E 1SQXE 1NU1E 1PP9E 4HJLA 3GKEA 1O7NA 2D2CD 2QJKC 2HMNA 2B24A 3DQYA 3VMID 1NYKA 3FOUA 1L0LE 4PV1D 5AEWA 4I7ZB 2HMOA 2XRXA 1SJGA 4QUPA 2DE6D 2NWFA 3C0DA 2NUMA 3H1HE 1ULJA 3L73E 3L72E 4RKUJ 4QDFB 2K9YA 1RFSA 1VF5D 2GBWA 4NB8D 4HM6A 5BOKA 2ZT9B 3C8VA 2BMRA 2E74D 4AAYB 1NDOA 1SQQE 2WPVB 4NBCD 4P1BH 4QDFA 1G8JB 4NBAD 3H1JE 3EN1A 1NTME 4HM4A 2D2CB 1O7PA 2YFIA 2IBZE 2WSFJ 2BCCE 3D89A 2QPZA 4U3FE 4NBGD 4NBDD 4PV1B 1JM1A 2B1XA 3GOBA 2NVEA 3CX5E 5KLVE 2NVGA 1JB0J 4QUQA 2QJPC 2YVJB 1Q90C 1VF5B 2HMMA 4NBED 5CXMA 1O7HA 1WQLA 4H13D 2E74B 2Q3WA 4OGQD 4EMJB 1Q90D 3EQQA 1ULIA 3L70E 4H44D 5AEUA 4NBBD 3L74E 2QIWA 1BE3E 1KYOE 5L8RJ 2O01J 2XR8A 2WSCJ 2HMLA 3GL2A 1FQTA 2JZAA 3H1IE 3L75E 2A06E 2BMQA 4HM3A 4HM8A 4NBFD 3VMHD 4Y28J 2DE7D 4H0LD 4QDCA 4QCKA 4AIVA 4PD4E 3GCEA 1S5LX 1UUWA 3VCAA 5KKZC 1EZVE 2XSHA 3N0QA 2HMJA 4NBHD 1VM9A 2E75D 4H13B 4IL6X 4OGQB 2NVFA 3H1LE 1L0NE 1NTZE 1O7MA 1UUVA 3TGUE 2XSOA 3GB4A 1SQBE 1O7GA 5KLIC 3GZYA 3GTEA
chains in the Genus database with same CATH superfamily
2ZFCA 3CXHI 2FYUJ 3HRNA 1BSNA 3HD7C 4ZMDA 3RGUA 2N1TB 1K04A 3FWNA 3AEEC 1MKMA 2C0WA 1J1EB 2BMOA 1K73Q 1FJPA 1CI6A 5CCHA 2BEQD 4KT0J 1KB9E 5CBNA 1YJ9P 5AVRB 1KYOH 5AVYB 3Q5PA 2FYUD 2HYNA 2OYIC 1YTZI 2KOGA 4R4LA 1Q2NA 3NMDA 2O1KA 5KTBA 3A0BH 2XRXA 3VP9A 4WVZA 1KMIZ 1GD2E 1RFSA 4K3AA 2JJLA 3PJSK 1KORA 1FBMA 3KZIE 3U1AA 4UB6E 1RF1C 4HM4A 5CCGD 5CCGA 1FDIA 3RK2C 2LR2A 1X8YA 1Q90C 3CCUP 4EMJB 4UB8H 3TSIA 3S1KA 2XR8A 1SQXJ 2KP8A 3L75E 3KXDA 3IF4A 3KPEA 1N7SA 1IFDA 5KLVK 3VN0A 2R3SA 3KHUA 1YQ3C 4HB1A 2OYOA 5HL4A 1M7LA 5GTHH 3E1IA 1FZAA 4JYCA 3H1JJ 1SQXD 5TJHA 2P10A 2H43A 1IC2A 2XU6A 4Y99B 2AEMA 1LTGC 2QA4P 1S9KE 1E5WA 5EFWB 4HYTB 5AW0B 2YKQA 4U7JA 2LKMA 3G9RA 1L4AC 2XKMA 2YFLA 2Z5IA 4YXWH 2Y0CA 2FFDC 3AEAC 2MJZA 2R3CA 1NO4A 2M8RA 3G3ZA 5DJTB 4QUPA 2H8PD 1JNMA 1UIXA 2PRRA 3L73E 1VQLP 5APWA 1L0NJ 3HUSB 2V7QJ 1IK7A 3P7KA 1OFCX 5APVA 3CC2P 4C7NB 1BCCG 3RL0B 5AVZB 5KAFH 2K37A 5AVSB 5BVZA 2Y9YA 1JCDA 2GUVA 4NPFX 1K8AQ 1EDIA 4IFMA 1RE4C 3NXSA 4PJ0H 1P84H 3MP7B 5AEUA 1OMIA 3M0DC 5AW8B 2FYUK 1PP9J 3H1IE 1SQQG 3IAOA 4H0LD 3JCUH 1OIPA 1EXIA 1NTZD 1PPJD 1JCCA 1EC5A 1LTSC 2ZVNB 3H1HG 1OX3A 1OVVA 3GZXA 4DOJA 1VQ6P 1IFIA 2YKOA 2I8DA 4H0LB 2Y0DA 2N1TC 2LXCB 2Q3EA 1J1EC 3E1RA 2WSEH 3LW5J 4LC1A 5KJ7D 5KJ7A 3VCPA 1JY3P 1LT9B 3L70J 4HM0A 3L74J 3AE8C 4PD4H 2D2CD 3FOUA 4DJGA 1IK9A 3CPWO 1A02J 1HTLC 2JR8A 3TGUJ 2VRSA 1U7JA 4HM6A 2QEXP 1MUUA 1NTKG 1SQBJ 4IL6H 3PRJA 3L70D 3L74D 1WMKA 4BWNA 2D2CB 1LWUA 5AW6B 2QG4A 1AVYA 1SQXK 5H2FE 4NBDD 1JM0A 1NU1G 2NPSD 3M91A 1JB0J 1Y47A 3TGUD 2K3RA 2M3EA 1SQBD 2RKLA 1NGMB 3JSVC 1LWUB 1KYOE 1BE3E 1KTMA 2HMLA 1Q81Q 4DZOA 2BMQA 2A06D 5APQA 1PGOA 4QDCA 3GCEA 1S5LX 2NPSB 1L2PA 1H88A 3AE9C 3A0BE 1SS1A 2NVFA 2FBWC 3WU2H 1KB9D 1W2EA 1H89A 1KV4A 1NH4A 4NBAD 2C9LY 3SFEC 1AQTA 5AVXB 2OYHA 5GTIH 1FE6A 3ABVC 3AE3C 3R2PA 4Y99C 2YFJA 1G8KB 1NYHA 3H6PA 3I5CA 1FZFA 1LTJA 1RH5B 2DE5D 1BCCE 2G3AA 2PP6A 1H8AA 2OYHB 4UB8E 2QJYB 1VPCA 3TNUB 3L75J 4N78D 2HMNA 3U1CA 1LTJB 2OYIA 2FXPA 2HMOA 2AEJA 1M8OB 4I2LC 3CL3D 3L72E 4NB8D 1GU5A 1EDLA 3HUSC 2E74D 1NTZK 1X9VA 1SQQE 1G1JA 2YO3A 3RL0C 1O7PA 2OYIB 2YFIA 2BCCE 4HKZH 3TK1A 3CXHH 1JM1A 1X0TA 3CX5E 1LJ2A 2QJPC 2HMMA 2E74B 1GW3A 1Q90D 3GW6A 3EQQA 3HE4A 1MFZA 2FYZA 1LP1B 3P8CE 2M3BA 2O01J 1PGJA 1JY2N 2JZAA 1FC2C 2GUSA 2O01N 3O8ZA 4TT3H 4NBHD 3HE4B 1ZN5A 3L73J 1FOSE 1Y9BA 3VMAA 4W80A 4NB9D 1ZRTE 5K5GB 2E5TA 1RIEA 4H0LC 1EQ7A 1SQVE 3I55P 1JMBA 1OVUA 5KAFE 1NTKE 2FYNB 4RESB 3L73D 3GF7A 3B71A 4HKVA 5B66H 4JF7A 3CCMP 1SQBK 1LT9C 2NRGA 1EG9A 4PJ0E 1P84E 1NU1E 1O7NA 3QWOC 2IDBA 1H0TA 1RHZB 1VQ4P 1K9MQ 4I7ZB 2H88C 2YMKA 2FFDA 2L5GB 2I1JA 3BRTB 5KJ7C 2NUMA 2CPSA 5APYA 2Z5HA 3Q3DA 5CHXA 1KILD 2KLVA 1KILA 1JO5A 1H0TB 2D2CC 2IBZE 1HUCA 2KB7P 1M57D 4B86A 2WPSA 1FOSF 1Q86Q 3PTZA 4H13D 3VMXA 1BSHA 1KILB 1MZ9A 2B87A 1LT1A 1BGYG 3USSA 4HM3A 1YJNP 4Y28J 2KZIA 2NPSC 4PD4E 3GF3A 3D70A 5E79H 1JTHB 4H13B 2B87B 3OJAB 3A7OA 3GTEA 1D7MA 4QURA 4IL6E 1G1IA 3FWLA 2W83C 2QM7A 2JP3A 1T6AA 3CCLP 4HM1A 1IO4A 4WB4A 2W6JH 5AW4B 3AECC 3M06A 3V2NA 4GT1A 4DCKA 3SWYA 2MKVA 2HMKA 2OYHC 2QJYC 2P7JA 1NWQA 2ZAEB 4HJLA 1LTJC 2LXBA 1G2CA 3CWBG 1W5CE 3H1IG 4EOTA 2WPRA 4O9BA 3CCVP 1WT6A 2WPQA 1GZLA 5TISE 4AAYB 4GOFA 2E42A 1KYOD 1G8JB 2JKVA 1YBKA 3EN1A 1ZR2A 3AE5C 4WWIA 1G2CB 3L71G 1BDDA 1CW5A 2BASA 1DIPA 2YKPA 2A45I 3KYQA 2E74C 1BCCJ 1L0LG 4EIJA 4TLFA 2V4HA 2KI7B 4L74A 1FJKA 2WSCH 1J1DB 4L75A 2DW3A 2OTJP 3BASA 3GL2A 3V6IA 4HM8A 1AQ5A 1EXJA 1A02F 1SFCD 3T97A 1FZCC 4D6TG 1N73C 4MN4C 3N0QA 1ZV8A 2KZJA 3AE4C 1FDOA 1BCCD 1BDCA 4AYCA 2R5DA 3D6YA 1SQQJ 2PGDA 2QRXA 3T97B 2E4PA 1SFCB 5KAIH 3RK3E 3CXHE 2FYNC 3B4SA 3H1HJ 1GU4A 1SQQD 2JWDA 2WZ7A 3CLQA 3S9OA 3AE6C 1KQLA 3DQYA 1BE3G 3CX5D 3NTNA 1E79H 4PV1D 4I7ZC 3V2QA 1DD3A 1SQBE 3WUUA 3H1HD 3CCEP 2AEFA 2KUBA 3EQ2A 1BGYE 1X22A 1VQMP 3AE1C 3H1JD 3HUSA 1J2JB 3RL0D 3MIWA 2FYUG 2IX7C 4C7NA 4PV1B 1NTKJ 1PIXA 2NVGA 1R5SA 2Q7CA 1KILC 3CCSP 1ZRTD 5AVQB 2GM4A 5B66E 2W27A 1S3JA 2FKWB 1FZBA 2O1JA 2B88A 1NU1J 1N8RQ 2JWAA 3R4YA 2XSHA 3TF5A 1GL2D 1XTCC 5CMZA 2OTKE 1VM9A 4H13C 2QJPB 1L0ND 3V2RA 2I1KA 3QH9A 2Q9IA 4LLHA 4P1CH 1PZQA 1P84D 5AW3B 3L72G 3CWBE 4HM7A 2CPBA 2KNCA 1GL2B 2OQQA 2BCCG 2JEEA 3H1KE 1EZVG 3RL0g 2WSEJ 4KJMA 2KXPB 2IYOA 3L71E 2KNCB 1PP9D 1LT9A 1LTAC 3AEDC 4C46A 1L0LE 1KC8Q 1SJGA 1S5LH 2KSJA 5E79E 1ULJA 1VQ7P 5BOKA 1NDOA 2Y0EA 4D6TE 2FXOA 4I1LA 5AW7B 4CPGA 3FGAD 4GDOA 4PD4D 3P32A 2ZYDA 3GOBA 1QLED 1VQ8P 3AE2C 1SQVG 3AEBC 1ZW0A 1WQLA 2XZRA 2Q5UA 1NKZB 1OW8A 1J1DC 1SQQK 2FXMA 3VMHD 1SP4A 2B89A 2K1AA 4XFJA 5AW1B 1HBWA 4K35A 2G8YA 2NPSA 4QDDA 2ZYAA 4HM5A 3D6ZA 1VQ9P 2I7FA 2YIUB 1SFCC 2KSEA 3O6QB 1HH0A 3OA7A 4HM2A 1RQVA 3CC7P 2IBZG 5APSA 1M90Q 2FYUE 1NTZG 2RMZA 3VP8A 2R44A 3HTKB 2J58A 3TNUA 3Q2YA 3PHLA 3BCCG 4GKGA 2DE6D 4A7PA 4RKUJ 2K9YA 5B5EH 1T3JA 1L0NK 3FX0A 2Q1KA 2W90A 3RBXA 2ZJSE 2K9JB 2WQYC 3Q5RA 4PV1C 5KAIE 1T2KD 4JQ0D 1RE3C 2CK3H 5M1BA 4NBED 2Q3WA 1AV1A 2KS1A 2WVRA 4NBBD 1QL1A 5GTHE 3L75D 1LP1A 1EZVE 1NTMG 2HODA 1PV3A 2HMJA 2E75D 4DT0A 1FZCA 2P1JA 1N73A 4GIFA 2KS1B 3KQGA 1BGYJ 2KYVA 2IZ1A 4IFDK 1CZQA 1N7LA 1RF0C 1K05A 3LIEA 2HODB 3MZWB 3E7KA 1JY3N 1GL2C 1FZCB 1S9KD 1GMJA 1N73B 2A06G 2E75B 1UIIA 4JPZB 1M56D 2HLOA 1GK6A 1BGYD 1PFIA 2NUKA 1URQD 3HE5A 2A45H 1IJDB 1JMMA 1GTWA 2W6BA 2H7HA 1QVFO 1SQPG 2QJKB 2Q3IA 1NYKA 2OTLP 4ASVA 3MD0A 2YXQB 1VF5D 2GBWA 3HE5B 2BMRA 2O01H 1IFPA 1URQB 3A3YB 3P8MC 3PLNA 2M5AA 3CWBJ 2WSFJ 3OW2O 3H1IJ 3OAKA 3GLMA 1T3UA 2B1XA 1YHQP 3JCUE 3GHGA 1VF5B 3W67A 1FZEA 2M5AB 4BXLA 4H44D 3L71J 5L8RJ 3CWBD 3V4WA 1FQTA 3H1ID 5CBOA 3GHGB 4AIVA 1SLQA 4W7ZA 3IFMA 3M9QA 1KFNA 1L0LJ 1JEKA 3JC22 1S5LE 1NTZE 1O7MA 1TU3F 2XSOA 2OARA 3N7NA 3B5ND 5CJ0A 1JTHA 4H44B 3L71D 1ZLLA 1O7WA 2E76D 4D6TJ 1VQKP 2YIUC 2XNXA 1ZOYC 3BCCE 2JDIH 1KB9I 3M9HA 1L0LD 3I56P 2A45G 2E43A 5AVTB 1VQNP 3GL0A 1YQ4C 3B5NB 2WTYA 5DJUB 2WMMA 3V2PA 2E76B 1DX7A 1LGHB 1VCKA 1FZGA 4M3LA 3SSUA 2B9BA 3VMID 2E5YA 1IFJA 3IR9A 1NAFA 2QE7H 4QDFB 4RJTA 3CC4P 1QX8A 1NHLA 1NKNA 1NTME 1BE3J 3W68A 1Y8AA 1YITP 3L4FA 1OVRA 2AXCA 5AW9B 1DEBA 2SPZA 1M1JB 2AXTH 4OGQD 4OH8B 2WT7A 3WU2E 2YXRB 3H1KG 1BE3D 1YIJP 2WITA 2WSCJ 5H2FH 2A06E 1HWTC 4NPDA 3WMM0 3AEFC 1T2KC 4N3YB 3CCRP 4OWFA 5GTIE 5CCHD 1JOCA 1AJYA 4U3FG 2WT7B 4OGQB 2GA1A 3U59A 2ZXEB 4NBFD 3M9BA 5KLVG 5B5EE 2YNYA 1SQPE 4JBZA 3AZCA 3RK3C 1FDMA 1CI6B 1SFCA 2E75C 1ZR4A 2HFED 5APUA 2W6AA 3II6A 3L72J 3CCJP 2ZT9D 3H1LG 1MFTA 4IFFA 1HJBA 4N78E 5C39A 3ZDMA 2BCCJ 2WWWA 2QJKC 1YJWP 2XV5A 3A5TA 2Q6QA 1EDKA 3L72D 3IN6A 2QVAA 2ZT9B 1URQC 4P1BH 1MV8A 2W8ZA 3A0HH 1HVVA 3TYYA 2BCCD 3VOPA 2QPZA 1N7SD 4WY4C 5AW5B 1EZVD 1GDTA 2POHA 3GMAA 1L0LK 1VF5C 4EI2A 3EFGA 1SVFA 1ULIA 2H89C 1RE3A 2HR3A 3L37A 3P8CD 2QIWA 1JUNA 1OW6A 3L36A 3MTUE 1N7SB 3CX5H 4R4MA 1SQVJ 3GHGC 5KKZB 2PFXA 3F5HA 3Q1MA 2NZ2A 1LNQA 4XA4A 3CMAP 4ZKPA 2RN0A 4H44C 4KHXA 1AFOA 3SWFA 1LTTC 3PP5A 3SFDC 3GTSA 1SQVD 1RF0A 2GBXA 1KQGB 4L76A 2ZYLA 1FAVA 1NTKD 2N9YB 1GL2A 3RBZA 3B5NC 4YXDC 2QSIA 1VL2A 2E76C 2ZXXA 4HJGH 3EFFK 2HG5D 2ZVOB 3M0AA 1NOHA 1NU1D 3AEGC 1OW7A 5AW2B 3KDPB 5AEWA 2IFNA 4ZKUA 2NWFA 2V7QH 1NTZJ 3C8VA 1R5LA 1N86A 1KILE 1OZHA 3MUDA 2M0BA 4WBAA 2R32A 2IBZD 3BCCJ 3D89A 4U3FE 3C1LA 1QGKB 1SQXG 1KYOI 5KLVE 1LTBC 1M1JC 1W2BO 3BRVB 4BRYA 2PAJA 4AQRD 1RY3A 1XTGB 3BCCD 3WUTA 2O3JA 2DE7D 3H1JG 1UUWA 4BRYB 2N9BA 3C9IA 4EDFA 4OGQC 1JY2P 3H1LE 1KQFB 1KFMA 3V4QA 4ASWA 3FXDA 2Z4EA 1ZP0C 1NTMJ 1LTIC 1YI2P 3WUVA 3CI9A 2Y9ZA 2JO6A 1KD1Q 2IZ0A 2IPPA 3LW5H 5CCHC 4AUWA 3VMGD 1VQPP 5APXA 3O6QA 1VDFA 2AXTE 4L73A 2YO2A 3B8EB 1L0NG 1NTMD 1U57A 5APTA 2ZYGA 3GKEA 2XDJA 1S72P 3HTKA 1KZUB 3C0DA 5BU8B 2ZT9C 3PH0A 4LGDE 1EZVI 4YTPC 1QL2A 3CX5I 1SQPJ 1PGQA 4NPEA 5CCGC 3G4SP 1USEA 1PPJG 3CCQP 2J5UA 3VMZA 3L35A 1Q82Q 1SQVK 2UWJE 1PP9G 2K9JA 1DH3A 4QUQA 1NTKK 5TISH 1KB9H 5CXMA 1SQPD 5CJ4A 3EWKA 1N7SC 4RO0A 1NU1K 1QEXA 1T8ZA 3HD7D 3FXEA 3VCAA 4I6MC 4W7YA 3HD7A 5KKZC 3A2AA 3S4RA 1HF9A 4EYYQ 1R8EA 4IL6X 2JO1A 1AVOA 3G6EP 5KLIB 3KZIH 4UB6H 4XE5B 3VMYA 1Q7YQ 4JYBA 1M1KQ 2YMYA 1FS0E 3HD7B 1JY2O 3L70G 2XNDH 3L74G 3A0HE 1IFMA 1JY3O 2C9NY 1HGVA 1S1CX 2RH0A 3RK3D 2E4QA 1Z56A 3CXHD 1P84I 2P2UA 4ZNCA 2WSSH 1HGZA 3VYIA 2KIKA 3D71A 3TGUG 3NFQA 1SQXE 1SQBG 1YYCA 1RF1A 3VTPC 3RK3B 3RK2D 3N4XA 2IBZI 3H1HE 1KN7A 4Z1MH 3MGNA 4NBCD 3H1JE 1RF1B 1URQA 1PGPA 3BATA 1VQOP 3RK2B 1VQ5P 2L91A 4WY4D 4QMAA 2YVJB 4WY4A 1ZMEC 1O7HA 4PD4I 3MUDC 2IFMA 1DD4A 4N6JA 1NTMK 2BEZF 1OXZA 1NAYA 4QCKA 4WY4B 1FU1A 1DEEG 2KLUA 1L0NE 3H1KJ 1UUVA 3GB4A 3SWKA 1OWAA 2P58A 2C0XA 3GZYA 1U7MA 1L4AD 4IOIH 4OVNF 1WRGA 1L4AA 4HH2A 3BVHA 1X79B 1GK4A 1RQUA 5AVWB 2HPCA 4U3FJ 5BU5A 3L75G 3TDKA 5KLVJ 3ITKA 3MHVA 1IZNB 4GODA 3H1KD 5AVUB 2R5BA 1PPJE 1L4AB 3LIDA 3Q5SA 2WSFH 1QVGO 2CKFA 1SQPK 3B5NA 2HPCB 1ZXGA 1PP9E 2FFDB 3F89A 4U3FD 2B24A 1KQSO 5KLVD 3CD6P 3G71P 3H1LJ 3H25A 1PL5A 1HJ0A 1LWUC 1USDA 4C7RA 2WPVB 1NVOA 4QDFA 5AVVB 1RE4A 4D6TD 3AE7C 3GG2A 2OGUA 2QM8A 3M0DA 2J59M 4NBGD 2P67A 3UIAA 2NVEA 1S4XA 2FY8A 4GOEA 1YTZT 3H1LD 3K5BA 3V5BA 1AA0A 1IFNA 3H32A 1M1JA 2KK7A 3L70E 3L73G 3L74E 1GW4A 2ITAA 1EDJA 3CMEP 1N2DC 2K88A 2N1TD 2N1TA 1NJIQ 3H32B 3TGUE 2IYPA 4YPCA 1S2EA 1CSBA 1O7GA 5KLIC
chains in the Genus database with same CATH topology
4H44C 4NB9D 1ZRTE 4HM5A 3D6ZA 2I7FA 1RIEA 4H0LC 3SFDC 3GTSA 1SQVE 1K04A 2GBXA 1KQGB 3AEEC 1NTKE 2ZYLA 4HM2A 1MKMA 1RQVA 2BMOA 3GF7A 3B71A 2BEQD 4KT0J 4YXDC 1KB9E 4HKVA 2QSIA 1VL2A 2E76C 3Q5PA 1EG9A 2FYUE 1P84E 1NU1E 3AEGC 4R4LA 1OW7A 1O7NA 2IDBA 5AEWA 3Q2YA 4I7ZB 2XRXA 2H88C 2DE6D 2YMKA 1KMIZ 2NWFA 2NUMA 4RKUJ 2K9YA 1RFSA 3C8VA 3Q3DA 1KILE 1KORA 4HM4A 2D2CC 2IBZE 2WQYC 3Q5RA 3D89A 1FDIA 4U3FE 4PV1C 5KLVE 1Q90C 5M1BA 4NBED 4H13D 2Q3WA 4EMJB 4NBBD 2XR8A 3L75E 4HM3A 4Y28J 2DE7D 4PD4E 1UUWA 1EZVE 3GF3A 1PV3A 3D70A 2HMJA 2E75D 4H13B 4OGQC 3H1LE 1KQFB 3GTEA 1YQ3C 5HL4A 4QURA 1ZP0C 1K05A 2P10A 2JO6A 2JP3A 4HM1A 1GMJA 3VMGD 2E75B 3O6QA 3AECC 4U7JA 3G9RA 2MKVA 2HMKA 2NUKA 2YFLA 2QJYC 1U57A 4HJLA 3GKEA 3AEAC 1NYKA 4QUPA 3C0DA 1UIXA 3L73E 1VF5D 2GBWA 2ZT9C 2BMRA 2V7QJ 1IK7A 4AAYB 4YTPC 1G8JB 3EN1A 3AE5C 2J5UA 2WSFJ 3GLMA 2B1XA 1DIPA 4QUQA 1VF5B 5CXMA 2E74C 3EWKA 4H44D 5AEUA 1OMIA 5L8RJ 3GL2A 1FQTA 3H1IE 4HM8A 3IAOA 1EXJA 4H0LD 4AIVA 3VCAA 5KKZC 3N0QA 1HF9A 1R8EA 1EXIA 4IL6X 3AE4C 2JO1A 1FDOA 1NTZE 1O7MA 1TU3F 2XSOA 3D6YA 4H44B 1O7WA 3GZXA 2E76D 3T97B 2YIUC 2E4PA 1ZOYC 3BCCE 4H0LB 1S1CX 3RK3E 2E4QA 2FYNC 3CXHE 3LW5J 3GL0A 1YQ4C 3VCPA 2E76B 4HM0A 3D71A 1VCKA 3S9OA 1SQXE 3AE8C 3AE6C 2D2CD 3VMID 3DQYA 3FOUA 4PV1D 4I7ZC 1DD3A 3H1HE 4QDFB 4HM6A 4Z1MH 4NBCD 3AE1C 1WMKA 3H1JE 1NTME 2D2CB 4NBDD 4PV1B 1PIXA 2NVGA 1JB0J 2YVJB 1ZMEC 1O7HA 4OGQD 1NGMB 1KYOE 1BE3E 1KTMA 2WSCJ 2HMLA 1DD4A 2BEZF 2A06E 2BMQA 4QDCA 4QCKA 3AEFC 3GCEA 1S5LX 3R4YA 2XSHA 3AE9C 1VM9A 4H13C 1AJYA 4OGQB 2NVFA 1L0NE 1UUVA 2FBWC 3GB4A 4NBAD 3GZYA 4NBFD 4P1CH 3SFEC 1SQPE 3CWBE 4HM7A 1RQUA 3ABVC 3AE3C 3AZCA 2YFJA 1G8KB 1NYHA 2OQQA 2E75C 2DE5D 3H1KE 3RL0g 2WSEJ 1BCCE 1PPJE 2G3AA 3Q5SA 2ZT9D 3L71E 2CKFA 1PP9E 3AEDC 2QJKC 2HMNA 2B24A 2FXPA 1L0LE 2HMOA 1SJGA 1ULJA 3L72E 3IN6A 4NB8D 3H25A 5BOKA 2ZT9B 2E74D 1PL5A 1HJ0A 1NDOA 1SQQE 2WPVB 4P1BH 4QDFA 3AE7C 1O7PA 2YFIA 2BCCE 2QPZA 3FGAD 4GDOA 4NBGD 1JM1A 3GOBA 2NVEA 3CX5E 3GMAA 2QJPC 3AE2C 1VF5C 2HMMA 3AEBC 1WQLA 2E74B 1Q90D 3EQQA 1ULIA 2H89C 1OW8A 3L70E 3L74E 2QIWA 2O01J 1OW6A 2JZAA 3VMHD 4R4MA 4XFJA 4TT3H 4NBHD 3Q1MA 2G8YA 2NZ2A 1Y9BA 3TGUE 4QDDA 1SQBE 1O7GA 5KLIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NB9 D;  4H44 B;  1ZRT E;  4QUR A;  5HL4 A;  4HM5 A;  4P1C H;  1SQP E;  1O7W A;  3GZX A;  2E76 D;  2YIU C;  2I7F A;  3CWB E;  2E4P A;  1RIE A;  3BCC E;  4H0L B;  3GTS A;  4HM7 A;  1SQV E;  2JO6 A;  3AZC A;  2YFJ A;  1G8K B;  4HM1 A;  2GBX A;  1NTK E;  2ZYL A;  4HM2 A;  4QDD A;  3VMG D;  2E4Q A;  2FYN C;  2E75 B;  3CXH E;  2DE5 D;  3LW5 J;  3GL0 A;  2BMO A;  3H1K E;  2WSE J;  1BCC E;  1PPJ E;  4KT0 J;  1KB9 E;  4HKV A;  2HMK A;  2NUK A;  3VCP A;  2YFL A;  2ZT9 D;  2QSI A;  1EG9 A;  3L71 E;  2E76 B;  2FYU E;  2QJY C;  4HM0 A;  2CKF A;  1VCK A;  1P84 E;  1SQX E;  1NU1 E;  1PP9 E;  4HJL A;  3GKE A;  1O7N A;  2D2C D;  2QJK C;  2HMN A;  2B24 A;  3DQY A;  3VMI D;  1NYK A;  3FOU A;  1L0L E;  4PV1 D;  5AEW A;  4I7Z B;  2HMO A;  2XRX A;  1SJG A;  4QUP A;  2DE6 D;  2NWF A;  3C0D A;  2NUM A;  3H1H E;  1ULJ A;  3L73 E;  3L72 E;  4RKU J;  4QDF B;  2K9Y A;  1RFS A;  1VF5 D;  2GBW A;  4NB8 D;  4HM6 A;  5BOK A;  2ZT9 B;  3C8V A;  2BMR A;  2E74 D;  4AAY B;  1NDO A;  1SQQ E;  2WPV B;  4NBC D;  4P1B H;  4QDF A;  1G8J B;  4NBA D;  3H1J E;  3EN1 A;  1NTM E;  4HM4 A;  2D2C B;  1O7P A;  2YFI A;  2IBZ E;  2WSF J;  2BCC E;  3D89 A;  2QPZ A;  4U3F E;  4NBG D;  4NBD D;  4PV1 B;  1JM1 A;  2B1X A;  3GOB A;  2NVE A;  3CX5 E;  5KLV E;  2NVG A;  1JB0 J;  4QUQ A;  2QJP C;  2YVJ B;  1Q90 C;  1VF5 B;  2HMM A;  4NBE D;  5CXM A;  1O7H A;  1WQL A;  4H13 D;  2E74 B;  2Q3W A;  4OGQ D;  4EMJ B;  1Q90 D;  3EQQ A;  1ULI A;  3L70 E;  4H44 D;  5AEU A;  4NBB D;  3L74 E;  2QIW A;  1BE3 E;  1KYO E;  5L8R J;  2O01 J;  2XR8 A;  2WSC J;  2HML A;  3GL2 A;  1FQT A;  2JZA A;  3H1I E;  3L75 E;  2A06 E;  2BMQ A;  4HM3 A;  4HM8 A;  4NBF D;  3VMH D;  4Y28 J;  2DE7 D;  4H0L D;  4QDC A;  4QCK A;  4AIV A;  4PD4 E;  3GCE A;  1S5L X;  1UUW A;  3VCA A;  5KKZ C;  1EZV E;  2XSH A;  3N0Q A;  2HMJ A;  4NBH D;  1VM9 A;  2E75 D;  4H13 B;  4IL6 X;  4OGQ B;  2NVF A;  3H1L E;  1L0N E;  1NTZ E;  1O7M A;  1UUV A;  3TGU E;  2XSO A;  3GB4 A;  1SQB E;  1O7G A;  5KLI C;  3GZY A;  3GTE A; 
#chains in the Genus database with same CATH topology
 2ZFC A;  3CXH I;  2FYU J;  3HRN A;  1BSN A;  3HD7 C;  4ZMD A;  3RGU A;  2N1T B;  1K04 A;  3FWN A;  3AEE C;  1MKM A;  2C0W A;  1J1E B;  2BMO A;  1K73 Q;  1FJP A;  1CI6 A;  5CCH A;  2BEQ D;  4KT0 J;  1KB9 E;  5CBN A;  1YJ9 P;  5AVR B;  1KYO H;  5AVY B;  3Q5P A;  2FYU D;  2HYN A;  2OYI C;  1YTZ I;  2KOG A;  4R4L A;  1Q2N A;  3NMD A;  2O1K A;  5KTB A;  3A0B H;  2XRX A;  3VP9 A;  4WVZ A;  1KMI Z;  1GD2 E;  1RFS A;  4K3A A;  2JJL A;  3PJS K;  1KOR A;  1FBM A;  3KZI E;  3U1A A;  4UB6 E;  1RF1 C;  4HM4 A;  5CCG D;  5CCG A;  1FDI A;  3RK2 C;  2LR2 A;  1X8Y A;  1Q90 C;  3CCU P;  4EMJ B;  4UB8 H;  3TSI A;  3S1K A;  2XR8 A;  1SQX J;  2KP8 A;  3L75 E;  3KXD A;  3IF4 A;  3KPE A;  1N7S A;  1IFD A;  5KLV K;  3VN0 A;  2R3S A;  3KHU A;  1YQ3 C;  4HB1 A;  2OYO A;  5HL4 A;  1M7L A;  5GTH H;  3E1I A;  1FZA A;  4JYC A;  3H1J J;  1SQX D;  5TJH A;  2P10 A;  2H43 A;  1IC2 A;  2XU6 A;  4Y99 B;  2AEM A;  1LTG C;  2QA4 P;  1S9K E;  1E5W A;  5EFW B;  4HYT B;  5AW0 B;  2YKQ A;  4U7J A;  2LKM A;  3G9R A;  1L4A C;  2XKM A;  2YFL A;  2Z5I A;  4YXW H;  2Y0C A;  2FFD C;  3AEA C;  2MJZ A;  2R3C A;  1NO4 A;  2M8R A;  3G3Z A;  5DJT B;  4QUP A;  2H8P D;  1JNM A;  1UIX A;  2PRR A;  3L73 E;  1VQL P;  5APW A;  1L0N J;  3HUS B;  2V7Q J;  1IK7 A;  3P7K A;  1OFC X;  5APV A;  3CC2 P;  4C7N B;  1BCC G;  3RL0 B;  5AVZ B;  5KAF H;  2K37 A;  5AVS B;  5BVZ A;  2Y9Y A;  1JCD A;  2GUV A;  4NPF X;  1K8A Q;  1EDI A;  4IFM A;  1RE4 C;  3NXS A;  4PJ0 H;  1P84 H;  3MP7 B;  5AEU A;  1OMI A;  3M0D C;  5AW8 B;  2FYU K;  1PP9 J;  3H1I E;  1SQQ G;  3IAO A;  4H0L D;  3JCU H;  1OIP A;  1EXI A;  1NTZ D;  1PPJ D;  1JCC A;  1EC5 A;  1LTS C;  2ZVN B;  3H1H G;  1OX3 A;  1OVV A;  3GZX A;  4DOJ A;  1VQ6 P;  1IFI A;  2YKO A;  2I8D A;  4H0L B;  2Y0D A;  2N1T C;  2LXC B;  2Q3E A;  1J1E C;  3E1R A;  2WSE H;  3LW5 J;  4LC1 A;  5KJ7 D;  5KJ7 A;  3VCP A;  1JY3 P;  1LT9 B;  3L70 J;  4HM0 A;  3L74 J;  3AE8 C;  4PD4 H;  2D2C D;  3FOU A;  4DJG A;  1IK9 A;  3CPW O;  1A02 J;  1HTL C;  2JR8 A;  3TGU J;  2VRS A;  1U7J A;  4HM6 A;  2QEX P;  1MUU A;  1NTK G;  1SQB J;  4IL6 H;  3PRJ A;  3L70 D;  3L74 D;  1WMK A;  4BWN A;  2D2C B;  1LWU A;  5AW6 B;  2QG4 A;  1AVY A;  1SQX K;  5H2F E;  4NBD D;  1JM0 A;  1NU1 G;  2NPS D;  3M91 A;  1JB0 J;  1Y47 A;  3TGU D;  2K3R A;  2M3E A;  1SQB D;  2RKL A;  1NGM B;  3JSV C;  1LWU B;  1KYO E;  1BE3 E;  1KTM A;  2HML A;  1Q81 Q;  4DZO A;  2BMQ A;  2A06 D;  5APQ A;  1PGO A;  4QDC A;  3GCE A;  1S5L X;  2NPS B;  1L2P A;  1H88 A;  3AE9 C;  3A0B E;  1SS1 A;  2NVF A;  2FBW C;  3WU2 H;  1KB9 D;  1W2E A;  1H89 A;  1KV4 A;  1NH4 A;  4NBA D;  2C9L Y;  3SFE C;  1AQT A;  5AVX B;  2OYH A;  5GTI H;  1FE6 A;  3ABV C;  3AE3 C;  3R2P A;  4Y99 C;  2YFJ A;  1G8K B;  1NYH A;  3H6P A;  3I5C A;  1FZF A;  1LTJ A;  1RH5 B;  2DE5 D;  1BCC E;  2G3A A;  2PP6 A;  1H8A A;  2OYH B;  4UB8 E;  2QJY B;  1VPC A;  3TNU B;  3L75 J;  4N78 D;  2HMN A;  3U1C A;  1LTJ B;  2OYI A;  2FXP A;  2HMO A;  2AEJ A;  1M8O B;  4I2L C;  3CL3 D;  3L72 E;  4NB8 D;  1GU5 A;  1EDL A;  3HUS C;  2E74 D;  1NTZ K;  1X9V A;  1SQQ E;  1G1J A;  2YO3 A;  3RL0 C;  1O7P A;  2OYI B;  2YFI A;  2BCC E;  4HKZ H;  3TK1 A;  3CXH H;  1JM1 A;  1X0T A;  3CX5 E;  1LJ2 A;  2QJP C;  2HMM A;  2E74 B;  1GW3 A;  1Q90 D;  3GW6 A;  3EQQ A;  3HE4 A;  1MFZ A;  2FYZ A;  1LP1 B;  3P8C E;  2M3B A;  2O01 J;  1PGJ A;  1JY2 N;  2JZA A;  1FC2 C;  2GUS A;  2O01 N;  3O8Z A;  4TT3 H;  4NBH D;  3HE4 B;  1ZN5 A;  3L73 J;  1FOS E;  1Y9B A;  3VMA A;  4W80 A;  4NB9 D;  1ZRT E;  5K5G B;  2E5T A;  1RIE A;  4H0L C;  1EQ7 A;  1SQV E;  3I55 P;  1JMB A;  1OVU A;  5KAF E;  1NTK E;  2FYN B;  4RES B;  3L73 D;  3GF7 A;  3B71 A;  4HKV A;  5B66 H;  4JF7 A;  3CCM P;  1SQB K;  1LT9 C;  2NRG A;  1EG9 A;  4PJ0 E;  1P84 E;  1NU1 E;  1O7N A;  3QWO C;  2IDB A;  1H0T A;  1RHZ B;  1VQ4 P;  1K9M Q;  4I7Z B;  2H88 C;  2YMK A;  2FFD A;  2L5G B;  2I1J A;  3BRT B;  5KJ7 C;  2NUM A;  2CPS A;  5APY A;  2Z5H A;  3Q3D A;  5CHX A;  1KIL D;  2KLV A;  1KIL A;  1JO5 A;  1H0T B;  2D2C C;  2IBZ E;  1HUC A;  2KB7 P;  1M57 D;  4B86 A;  2WPS A;  1FOS F;  1Q86 Q;  3PTZ A;  4H13 D;  3VMX A;  1BSH A;  1KIL B;  1MZ9 A;  2B87 A;  1LT1 A;  1BGY G;  3USS A;  4HM3 A;  1YJN P;  4Y28 J;  2KZI A;  2NPS C;  4PD4 E;  3GF3 A;  3D70 A;  5E79 H;  1JTH B;  4H13 B;  2B87 B;  3OJA B;  3A7O A;  3GTE A;  1D7M A;  4QUR A;  4IL6 E;  1G1I A;  3FWL A;  2W83 C;  2QM7 A;  2JP3 A;  1T6A A;  3CCL P;  4HM1 A;  1IO4 A;  4WB4 A;  2W6J H;  5AW4 B;  3AEC C;  3M06 A;  3V2N A;  4GT1 A;  4DCK A;  3SWY A;  2MKV A;  2HMK A;  2OYH C;  2QJY C;  2P7J A;  1NWQ A;  2ZAE B;  4HJL A;  1LTJ C;  2LXB A;  1G2C A;  3CWB G;  1W5C E;  3H1I G;  4EOT A;  2WPR A;  4O9B A;  3CCV P;  1WT6 A;  2WPQ A;  1GZL A;  5TIS E;  4AAY B;  4GOF A;  2E42 A;  1KYO D;  1G8J B;  2JKV A;  1YBK A;  3EN1 A;  1ZR2 A;  3AE5 C;  4WWI A;  1G2C B;  3L71 G;  1BDD A;  1CW5 A;  2BAS A;  1DIP A;  2YKP A;  2A45 I;  3KYQ A;  2E74 C;  1BCC J;  1L0L G;  4EIJ A;  4TLF A;  2V4H A;  2KI7 B;  4L74 A;  1FJK A;  2WSC H;  1J1D B;  4L75 A;  2DW3 A;  2OTJ P;  3BAS A;  3GL2 A;  3V6I A;  4HM8 A;  1AQ5 A;  1EXJ A;  1A02 F;  1SFC D;  3T97 A;  1FZC C;  4D6T G;  1N73 C;  4MN4 C;  3N0Q A;  1ZV8 A;  2KZJ A;  3AE4 C;  1FDO A;  1BCC D;  1BDC A;  4AYC A;  2R5D A;  3D6Y A;  1SQQ J;  2PGD A;  2QRX A;  3T97 B;  2E4P A;  1SFC B;  5KAI H;  3RK3 E;  3CXH E;  2FYN C;  3B4S A;  3H1H J;  1GU4 A;  1SQQ D;  2JWD A;  2WZ7 A;  3CLQ A;  3S9O A;  3AE6 C;  1KQL A;  3DQY A;  1BE3 G;  3CX5 D;  3NTN A;  1E79 H;  4PV1 D;  4I7Z C;  3V2Q A;  1DD3 A;  1SQB E;  3WUU A;  3H1H D;  3CCE P;  2AEF A;  2KUB A;  3EQ2 A;  1BGY E;  1X22 A;  1VQM P;  3AE1 C;  3H1J D;  3HUS A;  1J2J B;  3RL0 D;  3MIW A;  2FYU G;  2IX7 C;  4C7N A;  4PV1 B;  1NTK J;  1PIX A;  2NVG A;  1R5S A;  2Q7C A;  1KIL C;  3CCS P;  1ZRT D;  5AVQ B;  2GM4 A;  5B66 E;  2W27 A;  1S3J A;  2FKW B;  1FZB A;  2O1J A;  2B88 A;  1NU1 J;  1N8R Q;  2JWA A;  3R4Y A;  2XSH A;  3TF5 A;  1GL2 D;  1XTC C;  5CMZ A;  2OTK E;  1VM9 A;  4H13 C;  2QJP B;  1L0N D;  3V2R A;  2I1K A;  3QH9 A;  2Q9I A;  4LLH A;  4P1C H;  1PZQ A;  1P84 D;  5AW3 B;  3L72 G;  3CWB E;  4HM7 A;  2CPB A;  2KNC A;  1GL2 B;  2OQQ A;  2BCC G;  2JEE A;  3H1K E;  1EZV G;  3RL0 g;  2WSE J;  4KJM A;  2KXP B;  2IYO A;  3L71 E;  2KNC B;  1PP9 D;  1LT9 A;  1LTA C;  3AED C;  4C46 A;  1L0L E;  1KC8 Q;  1SJG A;  1S5L H;  2KSJ A;  5E79 E;  1ULJ A;  1VQ7 P;  5BOK A;  1NDO A;  2Y0E A;  4D6T E;  2FXO A;  4I1L A;  5AW7 B;  4CPG A;  3FGA D;  4GDO A;  4PD4 D;  3P32 A;  2ZYD A;  3GOB A;  1QLE D;  1VQ8 P;  3AE2 C;  1SQV G;  3AEB C;  1ZW0 A;  1WQL A;  2XZR A;  2Q5U A;  1NKZ B;  1OW8 A;  1J1D C;  1SQQ K;  2FXM A;  3VMH D;  1SP4 A;  2B89 A;  2K1A A;  4XFJ A;  5AW1 B;  1HBW A;  4K35 A;  2G8Y A;  2NPS A;  4QDD A;  2ZYA A;  4HM5 A;  3D6Z A;  1VQ9 P;  2I7F A;  2YIU B;  1SFC C;  2KSE A;  3O6Q B;  1HH0 A;  3OA7 A;  4HM2 A;  1RQV A;  3CC7 P;  2IBZ G;  5APS A;  1M90 Q;  2FYU E;  1NTZ G;  2RMZ A;  3VP8 A;  2R44 A;  3HTK B;  2J58 A;  3TNU A;  3Q2Y A;  3PHL A;  3BCC G;  4GKG A;  2DE6 D;  4A7P A;  4RKU J;  2K9Y A;  5B5E H;  1T3J A;  1L0N K;  3FX0 A;  2Q1K A;  2W90 A;  3RBX A;  2ZJS E;  2K9J B;  2WQY C;  3Q5R A;  4PV1 C;  5KAI E;  1T2K D;  4JQ0 D;  1RE3 C;  2CK3 H;  5M1B A;  4NBE D;  2Q3W A;  1AV1 A;  2KS1 A;  2WVR A;  4NBB D;  1QL1 A;  5GTH E;  3L75 D;  1LP1 A;  1EZV E;  1NTM G;  2HOD A;  1PV3 A;  2HMJ A;  2E75 D;  4DT0 A;  1FZC A;  2P1J A;  1N73 A;  4GIF A;  2KS1 B;  3KQG A;  1BGY J;  2KYV A;  2IZ1 A;  4IFD K;  1CZQ A;  1N7L A;  1RF0 C;  1K05 A;  3LIE A;  2HOD B;  3MZW B;  3E7K A;  1JY3 N;  1GL2 C;  1FZC B;  1S9K D;  1GMJ A;  1N73 B;  2A06 G;  2E75 B;  1UII A;  4JPZ B;  1M56 D;  2HLO A;  1GK6 A;  1BGY D;  1PFI A;  2NUK A;  1URQ D;  3HE5 A;  2A45 H;  1IJD B;  1JMM A;  1GTW A;  2W6B A;  2H7H A;  1QVF O;  1SQP G;  2QJK B;  2Q3I A;  1NYK A;  2OTL P;  4ASV A;  3MD0 A;  2YXQ B;  1VF5 D;  2GBW A;  3HE5 B;  2BMR A;  2O01 H;  1IFP A;  1URQ B;  3A3Y B;  3P8M C;  3PLN A;  2M5A A;  3CWB J;  2WSF J;  3OW2 O;  3H1I J;  3OAK A;  3GLM A;  1T3U A;  2B1X A;  1YHQ P;  3JCU E;  3GHG A;  1VF5 B;  3W67 A;  1FZE A;  2M5A B;  4BXL A;  4H44 D;  3L71 J;  5L8R J;  3CWB D;  3V4W A;  1FQT A;  3H1I D;  5CBO A;  3GHG B;  4AIV A;  1SLQ A;  4W7Z A;  3IFM A;  3M9Q A;  1KFN A;  1L0L J;  1JEK A;  3JC2 2;  1S5L E;  1NTZ E;  1O7M A;  1TU3 F;  2XSO A;  2OAR A;  3N7N A;  3B5N D;  5CJ0 A;  1JTH A;  4H44 B;  3L71 D;  1ZLL A;  1O7W A;  2E76 D;  4D6T J;  1VQK P;  2YIU C;  2XNX A;  1ZOY C;  3BCC E;  2JDI H;  1KB9 I;  3M9H A;  1L0L D;  3I56 P;  2A45 G;  2E43 A;  5AVT B;  1VQN P;  3GL0 A;  1YQ4 C;  3B5N B;  2WTY A;  5DJU B;  2WMM A;  3V2P A;  2E76 B;  1DX7 A;  1LGH B;  1VCK A;  1FZG A;  4M3L A;  3SSU A;  2B9B A;  3VMI D;  2E5Y A;  1IFJ A;  3IR9 A;  1NAF A;  2QE7 H;  4QDF B;  4RJT A;  3CC4 P;  1QX8 A;  1NHL A;  1NKN A;  1NTM E;  1BE3 J;  3W68 A;  1Y8A A;  1YIT P;  3L4F A;  1OVR A;  2AXC A;  5AW9 B;  1DEB A;  2SPZ A;  1M1J B;  2AXT H;  4OGQ D;  4OH8 B;  2WT7 A;  3WU2 E;  2YXR B;  3H1K G;  1BE3 D;  1YIJ P;  2WIT A;  2WSC J;  5H2F H;  2A06 E;  1HWT C;  4NPD A;  3WMM 0;  3AEF C;  1T2K C;  4N3Y B;  3CCR P;  4OWF A;  5GTI E;  5CCH D;  1JOC A;  1AJY A;  4U3F G;  2WT7 B;  4OGQ B;  2GA1 A;  3U59 A;  2ZXE B;  4NBF D;  3M9B A;  5KLV G;  5B5E E;  2YNY A;  1SQP E;  4JBZ A;  3AZC A;  3RK3 C;  1FDM A;  1CI6 B;  1SFC A;  2E75 C;  1ZR4 A;  2HFE D;  5APU A;  2W6A A;  3II6 A;  3L72 J;  3CCJ P;  2ZT9 D;  3H1L G;  1MFT A;  4IFF A;  1HJB A;  4N78 E;  5C39 A;  3ZDM A;  2BCC J;  2WWW A;  2QJK C;  1YJW P;  2XV5 A;  3A5T A;  2Q6Q A;  1EDK A;  3L72 D;  3IN6 A;  2QVA A;  2ZT9 B;  1URQ C;  4P1B H;  1MV8 A;  2W8Z A;  3A0H H;  1HVV A;  3TYY A;  2BCC D;  3VOP A;  2QPZ A;  1N7S D;  4WY4 C;  5AW5 B;  1EZV D;  1GDT A;  2POH A;  3GMA A;  1L0L K;  1VF5 C;  4EI2 A;  3EFG A;  1SVF A;  1ULI A;  2H89 C;  1RE3 A;  2HR3 A;  3L37 A;  3P8C D;  2QIW A;  1JUN A;  1OW6 A;  3L36 A;  3MTU E;  1N7S B;  3CX5 H;  4R4M A;  1SQV J;  3GHG C;  5KKZ B;  2PFX A;  3F5H A;  3Q1M A;  2NZ2 A;  1LNQ A;  4XA4 A;  3CMA P;  4ZKP A;  2RN0 A;  4H44 C;  4KHX A;  1AFO A;  3SWF A;  1LTT C;  3PP5 A;  3SFD C;  3GTS A;  1SQV D;  1RF0 A;  2GBX A;  1KQG B;  4L76 A;  2ZYL A;  1FAV A;  1NTK D;  2N9Y B;  1GL2 A;  3RBZ A;  3B5N C;  4YXD C;  2QSI A;  1VL2 A;  2E76 C;  2ZXX A;  4HJG H;  3EFF K;  2HG5 D;  2ZVO B;  3M0A A;  1NOH A;  1NU1 D;  3AEG C;  1OW7 A;  5AW2 B;  3KDP B;  5AEW A;  2IFN A;  4ZKU A;  2NWF A;  2V7Q H;  1NTZ J;  3C8V A;  1R5L A;  1N86 A;  1KIL E;  1OZH A;  3MUD A;  2M0B A;  4WBA A;  2R32 A;  2IBZ D;  3BCC J;  3D89 A;  4U3F E;  3C1L A;  1QGK B;  1SQX G;  1KYO I;  5KLV E;  1LTB C;  1M1J C;  1W2B O;  3BRV B;  4BRY A;  2PAJ A;  4AQR D;  1RY3 A;  1XTG B;  3BCC D;  3WUT A;  2O3J A;  2DE7 D;  3H1J G;  1UUW A;  4BRY B;  2N9B A;  3C9I A;  4EDF A;  4OGQ C;  1JY2 P;  3H1L E;  1KQF B;  1KFM A;  3V4Q A;  4ASW A;  3FXD A;  2Z4E A;  1ZP0 C;  1NTM J;  1LTI C;  1YI2 P;  3WUV A;  3CI9 A;  2Y9Z A;  2JO6 A;  1KD1 Q;  2IZ0 A;  2IPP A;  3LW5 H;  5CCH C;  4AUW A;  3VMG D;  1VQP P;  5APX A;  3O6Q A;  1VDF A;  2AXT E;  4L73 A;  2YO2 A;  3B8E B;  1L0N G;  1NTM D;  1U57 A;  5APT A;  2ZYG A;  3GKE A;  2XDJ A;  1S72 P;  3HTK A;  1KZU B;  3C0D A;  5BU8 B;  2ZT9 C;  3PH0 A;  4LGD E;  1EZV I;  4YTP C;  1QL2 A;  3CX5 I;  1SQP J;  1PGQ A;  4NPE A;  5CCG C;  3G4S P;  1USE A;  1PPJ G;  3CCQ P;  2J5U A;  3VMZ A;  3L35 A;  1Q82 Q;  1SQV K;  2UWJ E;  1PP9 G;  2K9J A;  1DH3 A;  4QUQ A;  1NTK K;  5TIS H;  1KB9 H;  5CXM A;  1SQP D;  5CJ4 A;  3EWK A;  1N7S C;  4RO0 A;  1NU1 K;  1QEX A;  1T8Z A;  3HD7 D;  3FXE A;  3VCA A;  4I6M C;  4W7Y A;  3HD7 A;  5KKZ C;  3A2A A;  3S4R A;  1HF9 A;  4EYY Q;  1R8E A;  4IL6 X;  2JO1 A;  1AVO A;  3G6E P;  5KLI B;  3KZI H;  4UB6 H;  4XE5 B;  3VMY A;  1Q7Y Q;  4JYB A;  1M1K Q;  2YMY A;  1FS0 E;  3HD7 B;  1JY2 O;  3L70 G;  2XND H;  3L74 G;  3A0H E;  1IFM A;  1JY3 O;  2C9N Y;  1HGV A;  1S1C X;  2RH0 A;  3RK3 D;  2E4Q A;  1Z56 A;  3CXH D;  1P84 I;  2P2U A;  4ZNC A;  2WSS H;  1HGZ A;  3VYI A;  2KIK A;  3D71 A;  3TGU G;  3NFQ A;  1SQX E;  1SQB G;  1YYC A;  1RF1 A;  3VTP C;  3RK3 B;  3RK2 D;  3N4X A;  2IBZ I;  3H1H E;  1KN7 A;  4Z1M H;  3MGN A;  4NBC D;  3H1J E;  1RF1 B;  1URQ A;  1PGP A;  3BAT A;  1VQO P;  3RK2 B;  1VQ5 P;  2L91 A;  4WY4 D;  4QMA A;  2YVJ B;  4WY4 A;  1ZME C;  1O7H A;  4PD4 I;  3MUD C;  2IFM A;  1DD4 A;  4N6J A;  1NTM K;  2BEZ F;  1OXZ A;  1NAY A;  4QCK A;  4WY4 B;  1FU1 A;  1DEE G;  2KLU A;  1L0N E;  3H1K J;  1UUV A;  3GB4 A;  3SWK A;  1OWA A;  2P58 A;  2C0X A;  3GZY A;  1U7M A;  1L4A D;  4IOI H;  4OVN F;  1WRG A;  1L4A A;  4HH2 A;  3BVH A;  1X79 B;  1GK4 A;  1RQU A;  5AVW B;  2HPC A;  4U3F J;  5BU5 A;  3L75 G;  3TDK A;  5KLV J;  3ITK A;  3MHV A;  1IZN B;  4GOD A;  3H1K D;  5AVU B;  2R5B A;  1PPJ E;  1L4A B;  3LID A;  3Q5S A;  2WSF H;  1QVG O;  2CKF A;  1SQP K;  3B5N A;  2HPC B;  1ZXG A;  1PP9 E;  2FFD B;  3F89 A;  4U3F D;  2B24 A;  1KQS O;  5KLV D;  3CD6 P;  3G71 P;  3H1L J;  3H25 A;  1PL5 A;  1HJ0 A;  1LWU C;  1USD A;  4C7R A;  2WPV B;  1NVO A;  4QDF A;  5AVV B;  1RE4 A;  4D6T D;  3AE7 C;  3GG2 A;  2OGU A;  2QM8 A;  3M0D A;  2J59 M;  4NBG D;  2P67 A;  3UIA A;  2NVE A;  1S4X A;  2FY8 A;  4GOE A;  1YTZ T;  3H1L D;  3K5B A;  3V5B A;  1AA0 A;  1IFN A;  3H32 A;  1M1J A;  2KK7 A;  3L70 E;  3L73 G;  3L74 E;  1GW4 A;  2ITA A;  1EDJ A;  3CME P;  1N2D C;  2K88 A;  2N1T D;  2N1T A;  1NJI Q;  3H32 B;  3TGU E;  2IYP A;  4YPC A;  1S2E A;  1CSB A;  1O7G A;  5KLI C; 
#chains in the Genus database with same CATH homology
 4H44 C;  4NB9 D;  1ZRT E;  4HM5 A;  3D6Z A;  2I7F A;  1RIE A;  4H0L C;  3SFD C;  3GTS A;  1SQV E;  1K04 A;  2GBX A;  1KQG B;  3AEE C;  1NTK E;  2ZYL A;  4HM2 A;  1MKM A;  1RQV A;  2BMO A;  3GF7 A;  3B71 A;  2BEQ D;  4KT0 J;  4YXD C;  1KB9 E;  4HKV A;  2QSI A;  1VL2 A;  2E76 C;  3Q5P A;  1EG9 A;  2FYU E;  1P84 E;  1NU1 E;  3AEG C;  4R4L A;  1OW7 A;  1O7N A;  2IDB A;  5AEW A;  3Q2Y A;  4I7Z B;  2XRX A;  2H88 C;  2DE6 D;  2YMK A;  1KMI Z;  2NWF A;  2NUM A;  4RKU J;  2K9Y A;  1RFS A;  3C8V A;  3Q3D A;  1KIL E;  1KOR A;  4HM4 A;  2D2C C;  2IBZ E;  2WQY C;  3Q5R A;  3D89 A;  1FDI A;  4U3F E;  4PV1 C;  5KLV E;  1Q90 C;  5M1B A;  4NBE D;  4H13 D;  2Q3W A;  4EMJ B;  4NBB D;  2XR8 A;  3L75 E;  4HM3 A;  4Y28 J;  2DE7 D;  4PD4 E;  1UUW A;  1EZV E;  3GF3 A;  1PV3 A;  3D70 A;  2HMJ A;  2E75 D;  4H13 B;  4OGQ C;  3H1L E;  1KQF B;  3GTE A;  1YQ3 C;  5HL4 A;  4QUR A;  1ZP0 C;  1K05 A;  2P10 A;  2JO6 A;  2JP3 A;  4HM1 A;  1GMJ A;  3VMG D;  2E75 B;  3O6Q A;  3AEC C;  4U7J A;  3G9R A;  2MKV A;  2HMK A;  2NUK A;  2YFL A;  2QJY C;  1U57 A;  4HJL A;  3GKE A;  3AEA C;  1NYK A;  4QUP A;  3C0D A;  1UIX A;  3L73 E;  1VF5 D;  2GBW A;  2ZT9 C;  2BMR A;  2V7Q J;  1IK7 A;  4AAY B;  4YTP C;  1G8J B;  3EN1 A;  3AE5 C;  2J5U A;  2WSF J;  3GLM A;  2B1X A;  1DIP A;  4QUQ A;  1VF5 B;  5CXM A;  2E74 C;  3EWK A;  4H44 D;  5AEU A;  1OMI A;  5L8R J;  3GL2 A;  1FQT A;  3H1I E;  4HM8 A;  3IAO A;  1EXJ A;  4H0L D;  4AIV A;  3VCA A;  5KKZ C;  3N0Q A;  1HF9 A;  1R8E A;  1EXI A;  4IL6 X;  3AE4 C;  2JO1 A;  1FDO A;  1NTZ E;  1O7M A;  1TU3 F;  2XSO A;  3D6Y A;  4H44 B;  1O7W A;  3GZX A;  2E76 D;  3T97 B;  2YIU C;  2E4P A;  1ZOY C;  3BCC E;  4H0L B;  1S1C X;  3RK3 E;  2E4Q A;  2FYN C;  3CXH E;  3LW5 J;  3GL0 A;  1YQ4 C;  3VCP A;  2E76 B;  4HM0 A;  3D71 A;  1VCK A;  3S9O A;  1SQX E;  3AE8 C;  3AE6 C;  2D2C D;  3VMI D;  3DQY A;  3FOU A;  4PV1 D;  4I7Z C;  1DD3 A;  3H1H E;  4QDF B;  4HM6 A;  4Z1M H;  4NBC D;  3AE1 C;  1WMK A;  3H1J E;  1NTM E;  2D2C B;  4NBD D;  4PV1 B;  1PIX A;  2NVG A;  1JB0 J;  2YVJ B;  1ZME C;  1O7H A;  4OGQ D;  1NGM B;  1KYO E;  1BE3 E;  1KTM A;  2WSC J;  2HML A;  1DD4 A;  2BEZ F;  2A06 E;  2BMQ A;  4QDC A;  4QCK A;  3AEF C;  3GCE A;  1S5L X;  3R4Y A;  2XSH A;  3AE9 C;  1VM9 A;  4H13 C;  1AJY A;  4OGQ B;  2NVF A;  1L0N E;  1UUV A;  2FBW C;  3GB4 A;  4NBA D;  3GZY A;  4NBF D;  4P1C H;  3SFE C;  1SQP E;  3CWB E;  4HM7 A;  1RQU A;  3ABV C;  3AE3 C;  3AZC A;  2YFJ A;  1G8K B;  1NYH A;  2OQQ A;  2E75 C;  2DE5 D;  3H1K E;  3RL0 g;  2WSE J;  1BCC E;  1PPJ E;  2G3A A;  3Q5S A;  2ZT9 D;  3L71 E;  2CKF A;  1PP9 E;  3AED C;  2QJK C;  2HMN A;  2B24 A;  2FXP A;  1L0L E;  2HMO A;  1SJG A;  1ULJ A;  3L72 E;  3IN6 A;  4NB8 D;  3H25 A;  5BOK A;  2ZT9 B;  2E74 D;  1PL5 A;  1HJ0 A;  1NDO A;  1SQQ E;  2WPV B;  4P1B H;  4QDF A;  3AE7 C;  1O7P A;  2YFI A;  2BCC E;  2QPZ A;  3FGA D;  4GDO A;  4NBG D;  1JM1 A;  3GOB A;  2NVE A;  3CX5 E;  3GMA A;  2QJP C;  3AE2 C;  1VF5 C;  2HMM A;  3AEB C;  1WQL A;  2E74 B;  1Q90 D;  3EQQ A;  1ULI A;  2H89 C;  1OW8 A;  3L70 E;  3L74 E;  2QIW A;  2O01 J;  1OW6 A;  2JZA A;  3VMH D;  4R4M A;  4XFJ A;  4TT3 H;  4NBH D;  3Q1M A;  2G8Y A;  2NZ2 A;  1Y9B A;  3TGU E;  4QDD A;  1SQB E;  1O7G A;  5KLI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...