2FYNC

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
total genus 50
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fynC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fynC02
2NVEA 2XSHA 4NBDD 2ZT9B 1ULIA 4QDFA 4NBHD 1G8KB 1ULJA 2I7FA 3D89A 4NBED 1NU1E 2E75D 1RFSA 2E75B 2JZAA 3L73E 1JM1A 3TGUE 2B1XA 5HL4A 3H1HE 2YFJA 1P84E 4H13B 2GBWA 2HMKA 4HKVA 3L71E 1SQXE 1WQLA 4QDCA 3H1LE 4HM5A 1G8JB 2HMNA 3L70E 4HM1A 4P1BH 1O7HA 5AEWA 1VCKA 3VMGD 3C0DA 3FOUA 3DQYA 4H44B 1NTZE 4QCKA 1O7PA 2B24A 2XRXA 4KT0J 2NVFA 2NWFA 3H1JE 2D2CD 2HMMA 2D2CB 1O7MA 4HM6A 4HM3A 4I7ZB 2BCCE 4IL6X 3C8VA 2YFLA 1O7NA 3BCCE 1Q90D 1L0NE 2A06E 4H13D 5BOKA 2CKFA 4QUPA 2K9YA 1UUWA 2HMOA 1Q90C 1EZVE 1O7WA 2YIUC 1KYOE 2JO6A 2QPZA 5KKZC 2DE5D 3GKEA 2FYNC 4PV1D 2HMLA 4Y28J 4U3FE 1JB0J 3L74E 4H44D 1BCCE 4NBCD 4QDFB 1VM9A 1ZRTE 1NYKA 5KLIC 3GZXA 2YFIA 4HJLA 2WPVB 2YVJB 2WSEJ 1SJGA 3LW5J 3VCPA 3GTEA 3GZYA 3EN1A 2E4QA 2XSOA 2E76B 4HM0A 2QJYC 1SQQE 4OGQB 2E76D 3GL2A 1VF5D 1S5LX 1PPJE 2BMOA 2IBZE 3CXHE 5AEUA 3GTSA 4AIVA 3CX5E 4HM2A 4HM4A 4NBFD 4QDDA 1FQTA 4HM7A 3N0QA 2Q3WA 1PP9E 3EQQA 1SQVE 4NB9D 2XR8A 4PV1B 2O01J 4NB8D 4PD4E 3H1IE 2FYUE 2HMJA 2DE7D 3VCAA 2NUKA 3GOBA 4QURA 3GL0A 2WSFJ 3VMHD 4AAYB 3H1KE 2NUMA 2ZT9D 4H0LB 1BE3E 2DE6D 2QSIA 2BMQA 2GBXA 3AZCA 3GB4A 4H0LD 1NTKE 1SQPE 1SQBE 3GCEA 1KB9E 4EMJB 2WSCJ 4NBAD 1UUVA 2E74D 2E74B 1L0LE 4RKUJ 2E4PA 4OGQD 1VF5B 2QJPC 1RIEA 2BMRA 5L8RJ 3L72E 4HM8A 3L75E 2QIWA 2QJKC 4NBGD 2NVGA 2ZYLA 5KLVE 4NBBD 3CWBE 1NTME 4P1CH 4QUQA 5CXMA 1NDOA 3VMID 1O7GA 1EG9A
chains in the Genus database with same CATH superfamily
3M06A 4JF7A 3VP8A 1VQOP 3CLQA 1JTHB 3CX5H 2KSEA 4WY4B 1VQ6P 3I56P 4DCKA 4Z1MH 2YFJA 2XNDH 1NOHA 1Q82Q 1NYHA 3L70E 2P7JA 5APTA 2E5TA 1NTZE 2N9YB 1SQBD 1SQPD 3Q3DA 1J2JB 1RQVA 1ZR2A 1L2PA 3D71A 2IYOA 3JCUE 2R44A 3II6A 2WQYC 3NMDA 4UB6E 1N86A 1LGHB 2POHA 1W5CE 1G2CA 1JB0J 3KHUA 5AW8B 1NTKK 1BCCE 4RESB 1YTZI 1VPCA 2JDIH 1EZVD 1L0LJ 2IZ0A 1SVFA 4AYCA 3RL0g 3HE4B 4OVNF 3A2AA 4OGQB 1MFTA 1NKZB 2FFDA 1Z56A 2LKMA 2E43A 3OA7A 3Q2YA 4PV1B 1URQD 1LTJC 2HMJA 5DJUB 3H1KE 2XZRA 1BCCG 3M9BA 3H1IG 3RK2C 1SP4A 3AEFC 4RKUJ 5AVWB 3H25A 3CC4P 2AEMA 4EI2A 4PD4H 3CMAP 1KMIZ 1U7MA 4R4LA 1GU5A 2R3CA 3D6YA 2KIKA 2OTLP 2I8DA 1X79B 2FBWC 1ULJA 1HGVA 1JM1A 2GUSA 1N7SD 3JCUH 3CCMP 1EXJA 3L35A 2M5AB 3GHGB 1YI2P 3V4WA 1OMIA 3MZWB 1YQ3C 4QCKA 1N7LA 4JPZB 5KJ7C 4I7ZB 1NAYA 1P84H 3L71D 1GK4A 2A06E 3U1CA 3L75J 5BOKA 4QUPA 2K9YA 2B9BA 1ZLLA 1NTZD 2ZVOB 1N7SA 1SQXJ 4ZMDA 4HJLA 1YJNP 1H89A 2YO3A 5CMZA 4CPGA 2E76B 1NTKD 2QJYC 1LTJA 3G9RA 3F5HA 3GTSA 3Q5PA 1DEEG 1Y47A 4TT3H 3H1JG 4PD4E 1L0LK 3NFQA 3CCRP 1AQTA 2AEFA 1GDTA 5CBNA 2IFNA 2OYOA 4PD4D 2BASA 5B5EE 2E74B 3L75E 1H8AA 4NPDA 2N1TB 4EOTA 2ZYLA 3CWBE 2OYHC 2I1KA 1KD1Q 3T97B 2ZYGA 4C7NB 1T3JA 3B5ND 3B5NC 3W67A 3CCSP 1LTSC 3N4XA 3D89A 4BRYB 2E75B 3L73E 1RY3A 3AEAC 3S4RA 5KKZB 2QG4A 1GU4A 3L70J 1SQXE 1ZOYC 1NKNA 2O01N 5AVZB 1O7HA 1GTWA 1U57A 2JP3A 1KILE 1T2KD 4N6JA 4ZKUA 5CCHC 2WPSA 3L75D 3P7KA 1S9KD 2NVFA 1SFCA 3H1JE 2ZXEB 5EFWB 2E74C 1LT9C 5AW7B 5K5GB 1J1EC 2Y9ZA 2WITA 3AE5C 2DE5D 4GKGA 1VQ4P 1SQPG 1SQBG 1OW7A 1NAFA 4HJGH 1VM9A 1ZN5A 3B4SA 2LXCB 2OTKE 1IK9A 3WMM0 1IK7A 3RK2D 4WB4A 1L4AB 4HM4A 2E5YA 3HE5A 3AEGC 2DE7D 2A45I 2NUKA 3PHLA 3RL0D 2ZT9D 2GBXA 2NPSA 1LP1A 2M3BA 5AVTB 2BCCD 2M8RA 2J5UA 1N2DC 2PP6A 3HD7C 1RIEA 3FGAD 5L8RJ 2QJKC 2C0XA 4IL6E 4R4MA 1G2CB 4EIJA 1S4XA 1KYOI 1IFMA 2NVEA 4U3FG 1USEA 2Y0DA 4H0LC 2KNCB 4IFMA 4QDFA 1FAVA 2H88C 5CBOA 1SQVJ 4I7ZC 1SFCC 1KFMA 1RFSA 2JZAA 4XA4A 3ITKA 4RO0A 1NVOA 3L4FA 4HKVA 4HB1A 1G8JB 5KAIH 1VCKA 1FS0E 1R5SA 4QMAA 4XFJA 3H1LD 2FY8A 1MKMA 3LIEA 3L72G 3KZIH 1FZGA 1FDOA 4YXDC 1URQC 3BATA 1YJ9P 2YKPA 5KJ7D 2OYHB 2HYNA 1W2EA 3VN0A 3JSVC 1L0ND 5AW5B 4IFDK 4L73A 3SFDC 2GA1A 3EWKA 2KP8A 4NBFD 1M90Q 1QX8A 4HH2A 2O01J 4NB8D 2H43A 2FYUE 3PTZA 4QURA 3VMHD 2QSIA 4GIFA 5KLVJ 1OW6A 3PLNA 4OGQD 4OGQC 2OQQA 1T3UA 3AE1C 2K9JB 2Y0CA 3MUDA 2WSEH 3AE4C 4MN4C 2KLUA 2YXQB 4KJMA 2J59M 1AV1A 1NTZG 5KAIE 3V4QA 1FU1A 1HF9A 2BEQD 5APSA 2HPCA 1FZCB 1NTMD 2GBWA 4PD4I 3TGUJ 2B89A 3A3YB 4W7YA 2B87A 3CCEP 3C0DA 2WSCH 1FJKA 1DEBA 1TU3F 2O3JA 4H44B 1G1JA 2BCCJ 1O7PA 4BXLA 2ZT9C 3L71G 4HM6A 1M56D 1LT9A 1Q7YQ 1IFPA 3RBXA 3BCCE 1GL2B 1S72P 2O01H 1ZRTD 1O7WA 4BWNA 1WRGA 1NO4A 3JC22 2KLVA 1NYKA 4D6TD 1EDKA 2WPVB 1HUCA 3GZYA 3MUDC 2KUBA 3E1IA 1VF5D 1SFCD 4DT0A 2KXPB 1GMJA 2G3AA 2Q3WA 2FFDC 3EQQA 2OYIA 2P1JA 4JYCA 1E79H 3H1KG 3SWFA 1LNQA 3RL0B 2W6JH 2WSSH 5APWA 4C46A 2DE6D 2LR2A 1KN7A 1AA0A 2H89C 3PH0A 4NBAD 2WT7A 3FWLA 3AEDC 1ZV8A 3G71P 4QUQA 4N78D 2FYUK 4TLFA 4PV1C 1M7LA 1LTTC 3A0BH 2KZJA 1WT6A 1OZHA 2W8ZA 1CI6A 3E1RA 5TISH 3RK3C 1P84E 3G3ZA 1LTGC 1VQPP 1JY3O 4GOEA 1JMBA 3CCJP 1NTMK 2ZAEB 3HTKB 2W6AA 3F89A 1PGOA 3A0HE 1M1JC 1X22A 2KB7P 5KJ7A 3AEBC 2HG5D 2J58A 1A02J 1NHLA 1Q90C 1SQQG 5KAFE 2WPRA 1KYOE 1NTKG 2JO6A 5KTBA 3MP7B 4ZKPA 2KSJA 4QDFB 3L36A 3L70D 2YVJB 1S5LH 1IJDB 2E76D 1T6AA 1Q86Q 3TGUD 1OW8A 4HM7A 5AVVB 1QL1A 1EDLA 1FOSF 5C39A 1JCDA 1LWUA 3KPEA 2P58A 3H1KD 2E42A 4H0LD 4NPEA 3HUSA 1BDCA 2QJPC 4NBGD 1BGYD 3H32B 3RBZA 1OVVA 3HD7B 3N7NA 1NU1G 4D6TJ 3EQ2A 1MUUA 3GW6A 1GZLA 2M3EA 3B5NB 1RF0A 3VMZA 1OFCX 2E75D 1SQQD 2M5AA 1LTIC 2JEEA 2YMKA 2IBZG 3CC7P 2Q3IA 2Q9IA 3HUSC 2H8PD 2HMMA 2Y0EA 2YFLA 2WTYA 3GF7A 1O7NA 2QRXA 5GTHH 1N7SC 4ASWA 2HMOA 2YIUB 1DD4A 3KYQA 4LGDE 1GK6A 1WMKA 4GT1A 3VMAA 5CCHD 1KQLA 1T2KC 3SFEC 3CCVP 2P10A 5KLVG 5GTIE 1RE3C 5AVQB 5CCGD 4HM2A 2CPBA 4QDDA 3TGUG 1R5LA 3L73G 1FZFA 1N8RQ 3L74D 2YXRB 2ZYAA 3GOBA 2K37A 4IL6H 4GOFA 5H2FE 2FYUJ 1S3JA 2PAJA 1M8OB 2VRSA 4A7PA 5BVZA 1KQFB 4NPFX 1BGYG 3HRNA 3OAKA 2CK3H 2QM8A 1NU1D 3H1JD 1ULIA 1ZXGA 1IFDA 1EDJA 1G8KB 2KI7B 3GLMA 1QL2A 1NTMG 2NZ2A 2E76C 1ZMEC 3UIAA 2LXBA 4M3LA 2OYIB 3TNUA 2K88A 2WPQA 1VL2A 2C9NY 5AEWA 2W90A 3PP5A 1FOSE 1AFOA 2NWFA 3M9QA 4H44C 1O7MA 2BCCE 4AUWA 2Q3EA 1SQVG 1FZCC 1KORA 3Q1MA 1RE3A 2CKFA 1UUWA 3I55P 1RF1A 4PV1D 2HMLA 1NWQA 1HJBA 2MJZA 2R32A 1KILD 1CI6B 5AVRB 1P84I 3KXDA 1QVFO 1N73A 4LLHA 3CX5E 3TF5A 3OJAB 1NTZK 2XR8A 1X9VA 1IFJA 2FFDB 3AE3C 4PJ0H 5E79E 3CWBG 2OTJP 1LTBC 3D70A 1HJ0A 3S9OA 2ZVNB 1L0LE 4WY4C 2E4PA 2M0BA 4ASVA 2BEZF 1BDDA 1RH5B 1K04A 1OXZA 1HH0A 1KQSO 3QH9A 1ZP0C 1EXIA 1JEKA 3KQGA 1NU1K 1KYOD 1L0NJ 3SWYA 2JJLA 5APXA 1SQQK 1X8YA 5CCGC 2HMNA 4P1BH 4DZOA 2FYUD 1BCCJ 1UIXA 1MFZA 3HUSB 1SQXK 2B24A 2XRXA 2ZFCA 1KILB 1PP9G 2Z5HA 1H0TB 4GDOA 2Q7CA 3M0DC 1AVYA 5AVXB 4N3YB 1YTZT 1L0NE 4DJGA 2OYHA 2FYNC 2XU6A 1IZNB 4ZNCA 2OGUA 1QVGO 2RH0A 4L74A 4RJTA 2AXCA 2HODA 1Y9BA 1M1JA 1SQXD 3HD7D 2N1TD 3VP9A 4AAYB 1YITP 3I5CA 2BMQA 1NTKJ 2K9JA 2W27A 1JY2O 1OWAA 5APYA 3NXSA 1J1DC 1RHZB 1HWTC 3P32A 3ZDMA 2JR8A 3P8MC 5B66H 1NTME 4DOJA 5CCGA 1VQLP 2XSHA 1JTHA 3L72J 2JWDA 2YNYA 1JY2N 4D6TG 3T97A 4HYTB 1PV3A 2QEXP 1Y8AA 2Q6QA 3TGUE 5HL4A 4H13B 1J1EB 4QDCA 4HM5A 2Y9YA 1PFIA 1W2BO 3L37A 3L74G 1LP1B 1DX7A 3G4SP 2Z4EA 1OIPA 2D2CD 2D2CB 1VQKP 1RE4C 1L0LD 4IL6X 3AECC 4WY4D 2NPSC 3IAOA 3FWNA 1JY3P 2PFXA 1IFIA 2YFIA 2WSEJ 3H1LG 3VCPA 1PZQA 2KK7A 3QWOC 2E4QA 2HLOA 3TNUB 1DD3A 2V7QJ 3O6QB 1FQTA 2P67A 4W80A 5CHXA 1JY3N 3H1HD 4WVZA 3VCAA 3IFMA 3TK1A 3GL0A 1AVOA 3K5BA 3MIWA 4N78E 4H0LB 2WT7B 3AE6C 1L0NK 3VOPA 2UWJE 1EZVG 3O8ZA 4KHXA 4NBBD 1SS1A 1XTGB 1SQBJ 1SQPJ 1NDOA 1SLQA 2ZT9B 1KB9H 3H1IJ 1KTMA 1AQ5A 1PGJA 4JBZA 3L70G 1JMMA 1BGYJ 1N73B 3CX5I 5AW3B 1VQ8P 1PGPA 1Q2NA 3LW5H 2IBZI 3H1LE 5GTHE 2JKVA 2W6BA 1LWUC 3V5BA 2KS1B 1ZW0A 1R8EA 3WU2E 3DQYA 1JCCA 3M9HA 3WUTA 1T8ZA 5AW1B 3CPWO 2K3RA 5DJTB 1JUNA 3CXHD 2R3SA 3C8VA 1FBMA 3CCLP 2E75C 5CJ4A 2XDJA 2R5BA 2I1JA 3AE8C 1Q90D 1N7SB 1AJYA 3IN6A 1EZVE 2YIUC 2RN0A 1K9MQ 3L72D 1QLED 4Y28J 1PP9D 1HTLC 1DH3A 4NBCD 3A7OA 3MGNA 2QM7A 3B71A 3VMXA 3GF3A 1JY2P 2A06D 1SQQE 2FYZA 2FXOA 3GL2A 1A02F 1VQMP 3N0QA 2B87B 4H13C 2IBZD 2L5GB 3L71J 3H1IE 1IFNA 2K1AA 3Q5RA 2ITAA 3GHGA 3FX0A 4YTPC 2V7QH 3S1KA 2WSCJ 4YXWH 3L75G 1GW3A 3WUUA 1RF1C 1PL5A 1NU1J 1EDIA 2O1JA 5KLVE 3OW2O 1VDFA 5CXMA 2IZ1A 1CSBA 1EG9A 3PRJA 1FZBA 4UB6H 2CPSA 2C9LY 1FZAA 3CX5D 4NBED 1YYCA 2HODB 3CC2P 2WWWA 1M1JB 1LJ2A 3TSIA 2JWAA 3LIDA 3BCCD 2AXTH 3CXHI 2FKWB 4WY4A 3RK3E 1PPJD 3VMGD 5KLIB 2IPPA 3C9IA 3RK3D 1KB9I 2FYNB 5AW2B 2N1TA 1VQ5P 4JQ0D 3D6ZA 3KDPB 1QGKB 1KILC 1FDMA 4PJ0E 3LW5J 5E79H 2HFED 4C7RA 4BRYA 1K73Q 1S5LX 1PPJE 3USSA 3U1AA 3HE4A 1UIIA 1PP9E 1SQVE 2YKOA 1BE3D 3FXEA 4GODA 4O9BA 3NTNA 2O1KA 4OH8B 1BE3E 1YQ4C 2QJYB 3GCEA 1MV8A 3KZIE 1VF5B 2V4HA 3H6PA 4EDFA 4K35A 1L0LG 2QIWA 3R4YA 1PP9J 1YBKA 3TYYA 2NUMA 5AVSB 3IF4A 2AXTE 2KYVA 1DIPA 4NBDD 1KZUB 3L73D 5CJ0A 1USDA 2FYUG 3BRVB 1GL2C 4UB8E 3H1KJ 3H1ID 3CMEP 5KLVK 1OVUA 1WQLA 2ZXXA 1L4AA 1NH4A 1NJIQ 3SSUA 3WUVA 2NPSB 5AW9B 1KB9D 1FC2C 3B8EB 4L76A 3V2PA 3SWKA 2RMZA 4D6TE 3P8CD 3CWBJ 5KKZC 4XE5B 3ABVC 4U3FE 1ZRTE 3B5NA 3H1HJ 3VYIA 2G8YA 2KNCA 1FJPA 2XSOA 1BE3J 3BCCG 2IBZE 2Q1KA 3AE7C 4W7ZA 5AEUA 5AW6B 5APUA 2IDBA 1LTJB 2XV5A 5B66E 2WSFJ 1JNMA 2A45H 5AW4B 3GB4A 3C1LA 1NTKE 2PRRA 2MKVA 3CXHH 4EMJB 3IR9A 1EZVI 4HM8A 1SQVK 3M0AA 4I2LC 3A0HH 2NVGA 1QEXA 4P1CH 2YKQA 3AE9C 2C0WA 2HPCB 1O7GA 3H32A 3W68A 1KV4A 3V2QA 1SQQJ 1URQA 1IC2A 2WMMA 1NTZJ 3M0DA 3G6EP 3VTPC 1NU1E 1FZEA 2FXPA 2QA4P 3CCUP 3H1HE 3RGUA 4Y99B 1NGMB 4HM1A 1X0TA 1JOCA 3EFFK 1LTAC 3H1JJ 2SPZA 4I6MC 1SFCB 1D7MA 3A0BE 3GKEA 1VQ7P 1BSHA 3L74E 4H44D 5TISE 1U7JA 3L73J 3EN1A 1GL2D 2QJPB 2D2CC 3CXHE 2N9BA 5APQA 3GMAA 1JM0A 2OARA 4U3FD 1RQUA 3AE2C 2L91A 2Z5IA 3HE5B 4U7JA 3AZCA 1KB9E 1YHQP 3FXDA 5KAFH 1VF5C 1KYOH 3L72E 3RK2B 4WBAA 1GW4A 2YO2A 3MD0A 1GD2E 1RF1B 2ZYDA 4WWIA 1KQGB 3VMID 1HBWA 1S5LE 1EC5A 5M1BA 3MTUE 3U59A 3V6IA 1G1IA 4U3FJ 3BVHA 5B5EH 3WU2H 2WSFH 2KOGA 2B1XA 3CI9A 2BCCG 5TJHA 2HMKA 3L71E 5GTIH 2QVAA 3FOUA 1BE3G 1E5WA 1EQ7A 2NRGA 1BGYE 4KT0J 2AEJA 1HGZA 2NPSD 2WVRA 3P8CE 2YMYA 3V2RA 1YJWP 4H13D 3M91A 1MZ9A 1YIJP 2QPZA 2GM4A 4LC1A 1PIXA 2XNXA 3CL3D 2W83C 5KLIC 2DW3A 1KC8Q 1P84D 3GTEA 2GUVA 1OX3A 3O6QA 1BCCD 1RE4A 4HM0A 4K3AA 2IFMA 1LWUB 5AW0B 3Q5SA 2IYPA 3PJSK 3BRTB 3AEEC 4L75A 4YPCA 3BASA 4Y99C 2B88A 1SQBK 1SQPK 5AVYB 3HTKA 1H0TA 1OVRA 1SQPE 1SQBE 1FE6A 1KFNA 3HD7A 1BSNA 2R5DA 3CD6P 1CZQA 1M57D 2N1TC 5CCHA 1S9KE 2IX7C 2QJKB 1L0NG 2FXMA 3VMYA 1S2EA 1ZR4A 3MHVA 4B86A 4NBHD 3V2NA 2I7FA 3A5TA 2QE7H 3RL0C 1PGQA 2A45G 3E7KA 3TDKA 2KS1A 1VQNP 1SQVD 1IO4A 3R2PA 2JO1A 1FZCA 5H2FH 1HVVA 3CWBD 5APVA 1LT1A 1RF0C 1FDIA 4HM3A 3RK3B 3GG2A 1SQXG 1KILA 1H88A 1JO5A 4IFFA 1K05A 1Q81Q 2OYIC 1L4AC 1LT9B 1L4AD 2KZIA 1S1CX 1GL2A 4HKZH 5AVUB 1URQB 1K8AQ 3H1LJ 3GHGC 2Q5UA 3GZXA 4JYBA 4C7NA 2P2UA 3CCQP 1SJGA 4I1LA 2H7HA 2XKMA 1N73C 1CW5A 3BCCJ 1J1DB 1M1KQ 2BMOA 2HR3A 4AIVA 4IOIH 5BU8B 4NB9D 2WZ7A 3EFGA 2PGDA 3L74J 4AQRD 2ZJSE 1VQ9P 1XTCC 2E74D 1UUVA 4OWFA 5BU5A 4EYYQ 2BMRA 3H1HG 2A06G 1PPJG 4UB8H 5KLVD 2RKLA 1NTMJ
chains in the Genus database with same CATH topology
1DIPA 4NBDD 1K04A 1HF9A 2BEQD 1ZP0C 1EXIA 4Z1MH 2YFJA 2GBWA 1WQLA 1NYHA 2HMNA 3L70E 4P1BH 3C0DA 1TU3F 4H44B 1NTZE 1UIXA 1O7PA 2B24A 2XRXA 3Q3DA 2ZT9C 4HM6A 1RQVA 4GDOA 3D71A 3BCCE 1L0NE 2WQYC 1O7WA 5KKZC 2FYNC 3ABVC 4U3FE 1JB0J 1BCCE 1ZRTE 1NYKA 2WPVB 2G8YA 3GZYA 3RL0g 2XSOA 4OGQB 1VF5D 2IBZE 3AE7C 5AEUA 1GMJA 1Y9BA 2G3AA 2Q3WA 3EQQA 2IDBA 3Q2YA 4PV1B 2HMJA 2WSFJ 4AAYB 3H1KE 2DE6D 2BMQA 3GB4A 1NTKE 2H89C 2MKVA 4EMJB 4NBAD 3AEFC 4RKUJ 3H25A 4HM8A 3AEDC 2NVGA 1KMIZ 4R4LA 1NTME 4P1CH 4QUQA 3AE9C 1O7GA 3D6YA 2XSHA 4PV1C 2FBWC 1ULJA 1NU1E 1PV3A 2FXPA 1JM1A 3TGUE 5HL4A 3H1HE 1P84E 4H13B 4QDCA 4HM5A 1EXJA 1NGMB 4HM1A 1OMIA 1YQ3C 4QCKA 2D2CD 2D2CB 4I7ZB 4IL6X 3AECC 3AEBC 2A06E 5BOKA 3IAOA 4QUPA 2K9YA 1Q90C 1KYOE 2JO6A 3GKEA 3L74E 4H44D 4QDFB 2YFIA 4HJLA 2YVJB 2WSEJ 3VCPA 3EN1A 2E4QA 2E76B 2QJYC 2E76D 2D2CC 3G9RA 3CXHE 1DD3A 3GTSA 1OW8A 2V7QJ 3GMAA 3Q5PA 4TT3H 4HM7A 1FQTA 1RQUA 3AE2C 4PD4E 3VCAA 3GL0A 4H0LB 4U7JA 4H0LD 3AZCA 3AE6C 1KB9E 2E74B 1VF5C 2QJPC 3L72E 4NBGD 3L75E 2ZYLA 4NBBD 3CWBE 1NDOA 1KQGB 3VMID 3T97B 2ZT9B 5M1BA 1KTMA 3D89A 2E75D 2E75B 3L73E 3AEAC 2B1XA 2YMKA 2HMKA 3L71E 1SQXE 3H1LE 1ZOYC 1O7HA 1U57A 2JP3A 1KILE 1R8EA 3FOUA 3DQYA 4KT0J 2NVFA 3H1JE 2HMMA 2E74C 3C8VA 2YFLA 3GF7A 1O7NA 2E75C 3AE8C 1Q90D 4H13D 1AJYA 3IN6A 2HMOA 1EZVE 2YIUC 3AE5C 2QPZA 1DD4A 2DE5D 4Y28J 1PIXA 1OW7A 1WMKA 4NBCD 1VM9A 5KLIC 3B71A 3GTEA 3GF3A 3SFEC 3O6QA 2P10A 4HM0A 1SQQE 3GL2A 1IK7A 4HM2A 4HM4A 4QDDA 3N0QA 3Q5SA 3AEGC 4H13C 3AEEC 3H1IE 2DE7D 2NUKA 3GOBA 3Q5RA 2ZT9D 2GBXA 4YTPC 1SQPE 1SQBE 2WSCJ 2J5UA 1RIEA 3FGAD 5L8RJ 1PL5A 1KQFB 2QJKC 5KLVE 4R4MA 5CXMA 1EG9A 2NVEA 1ULIA 4H0LC 4QDFA 4NBHD 2H88C 1G8KB 2I7FA 4I7ZC 4NBED 3GLMA 2NZ2A 1RFSA 2E76C 1ZMEC 2JZAA 4HKVA 2JO1A 1VL2A 1G8JB 3RK3E 5AEWA 1VCKA 3VMGD 1FDIA 2NWFA 4H44C 1O7MA 4HM3A 2BCCE 4XFJA 1KORA 3Q1MA 1MKMA 2CKFA 1K05A 1UUWA 1S1CX 4PV1D 1FDOA 4YXDC 2HMLA 3D6ZA 3GZXA 1SJGA 3LW5J 3SFDC 1S5LX 1PPJE 2BMOA 3EWKA 4AIVA 3CX5E 4NBFD 4NB9D 1PP9E 1SQVE 2XR8A 2O01J 4NB8D 2FYUE 3AE3C 4QURA 3VMHD 1BE3E 2QSIA 1YQ4C 3GCEA 1OW6A 2E74D 1UUVA 3D70A 1HJ0A 3S9OA 1L0LE 4OGQD 2E4PA 4OGQC 1VF5B 2OQQA 3AE1C 2BMRA 2BEZF 2QIWA 3R4YA 3AE4C 2NUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVE A;  2XSH A;  4NBD D;  2ZT9 B;  1ULI A;  4QDF A;  4NBH D;  1G8K B;  1ULJ A;  2I7F A;  3D89 A;  4NBE D;  1NU1 E;  2E75 D;  1RFS A;  2E75 B;  2JZA A;  3L73 E;  1JM1 A;  3TGU E;  2B1X A;  5HL4 A;  3H1H E;  2YFJ A;  1P84 E;  4H13 B;  2GBW A;  2HMK A;  4HKV A;  3L71 E;  1SQX E;  1WQL A;  4QDC A;  3H1L E;  4HM5 A;  1G8J B;  2HMN A;  3L70 E;  4HM1 A;  4P1B H;  1O7H A;  5AEW A;  1VCK A;  3VMG D;  3C0D A;  3FOU A;  3DQY A;  4H44 B;  1NTZ E;  4QCK A;  1O7P A;  2B24 A;  2XRX A;  4KT0 J;  2NVF A;  2NWF A;  3H1J E;  2D2C D;  2HMM A;  2D2C B;  1O7M A;  4HM6 A;  4HM3 A;  4I7Z B;  2BCC E;  4IL6 X;  3C8V A;  2YFL A;  1O7N A;  3BCC E;  1Q90 D;  1L0N E;  2A06 E;  4H13 D;  5BOK A;  2CKF A;  4QUP A;  2K9Y A;  1UUW A;  2HMO A;  1Q90 C;  1EZV E;  1O7W A;  2YIU C;  1KYO E;  2JO6 A;  2QPZ A;  5KKZ C;  2DE5 D;  3GKE A;  2FYN C;  4PV1 D;  2HML A;  4Y28 J;  4U3F E;  1JB0 J;  3L74 E;  4H44 D;  1BCC E;  4NBC D;  4QDF B;  1VM9 A;  1ZRT E;  1NYK A;  5KLI C;  3GZX A;  2YFI A;  4HJL A;  2WPV B;  2YVJ B;  2WSE J;  1SJG A;  3LW5 J;  3VCP A;  3GTE A;  3GZY A;  3EN1 A;  2E4Q A;  2XSO A;  2E76 B;  4HM0 A;  2QJY C;  1SQQ E;  4OGQ B;  2E76 D;  3GL2 A;  1VF5 D;  1S5L X;  1PPJ E;  2BMO A;  2IBZ E;  3CXH E;  5AEU A;  3GTS A;  4AIV A;  3CX5 E;  4HM2 A;  4HM4 A;  4NBF D;  4QDD A;  1FQT A;  4HM7 A;  3N0Q A;  2Q3W A;  1PP9 E;  3EQQ A;  1SQV E;  4NB9 D;  2XR8 A;  4PV1 B;  2O01 J;  4NB8 D;  4PD4 E;  3H1I E;  2FYU E;  2HMJ A;  2DE7 D;  3VCA A;  2NUK A;  3GOB A;  4QUR A;  3GL0 A;  2WSF J;  3VMH D;  4AAY B;  3H1K E;  2NUM A;  2ZT9 D;  4H0L B;  1BE3 E;  2DE6 D;  2QSI A;  2BMQ A;  2GBX A;  3AZC A;  3GB4 A;  4H0L D;  1NTK E;  1SQP E;  1SQB E;  3GCE A;  1KB9 E;  4EMJ B;  2WSC J;  4NBA D;  1UUV A;  2E74 D;  2E74 B;  1L0L E;  4RKU J;  2E4P A;  4OGQ D;  1VF5 B;  2QJP C;  1RIE A;  2BMR A;  5L8R J;  3L72 E;  4HM8 A;  3L75 E;  2QIW A;  2QJK C;  4NBG D;  2NVG A;  2ZYL A;  5KLV E;  4NBB D;  3CWB E;  1NTM E;  4P1C H;  4QUQ A;  5CXM A;  1NDO A;  3VMI D;  1O7G A;  1EG9 A; 
#chains in the Genus database with same CATH topology
 3M06 A;  4JF7 A;  3VP8 A;  1VQO P;  3CLQ A;  1JTH B;  3CX5 H;  2KSE A;  4WY4 B;  1VQ6 P;  3I56 P;  4DCK A;  4Z1M H;  2YFJ A;  2XND H;  1NOH A;  1Q82 Q;  1NYH A;  3L70 E;  2P7J A;  5APT A;  2E5T A;  1NTZ E;  2N9Y B;  1SQB D;  1SQP D;  3Q3D A;  1J2J B;  1RQV A;  1ZR2 A;  1L2P A;  3D71 A;  2IYO A;  3JCU E;  2R44 A;  3II6 A;  2WQY C;  3NMD A;  4UB6 E;  1N86 A;  1LGH B;  2POH A;  1W5C E;  1G2C A;  1JB0 J;  3KHU A;  5AW8 B;  1NTK K;  1BCC E;  4RES B;  1YTZ I;  1VPC A;  2JDI H;  1EZV D;  1L0L J;  2IZ0 A;  1SVF A;  4AYC A;  3RL0 g;  3HE4 B;  4OVN F;  3A2A A;  4OGQ B;  1MFT A;  1NKZ B;  2FFD A;  1Z56 A;  2LKM A;  2E43 A;  3OA7 A;  3Q2Y A;  4PV1 B;  1URQ D;  1LTJ C;  2HMJ A;  5DJU B;  3H1K E;  2XZR A;  1BCC G;  3M9B A;  3H1I G;  3RK2 C;  1SP4 A;  3AEF C;  4RKU J;  5AVW B;  3H25 A;  3CC4 P;  2AEM A;  4EI2 A;  4PD4 H;  3CMA P;  1KMI Z;  1U7M A;  4R4L A;  1GU5 A;  2R3C A;  3D6Y A;  2KIK A;  2OTL P;  2I8D A;  1X79 B;  2FBW C;  1ULJ A;  1HGV A;  1JM1 A;  2GUS A;  1N7S D;  3JCU H;  3CCM P;  1EXJ A;  3L35 A;  2M5A B;  3GHG B;  1YI2 P;  3V4W A;  1OMI A;  3MZW B;  1YQ3 C;  4QCK A;  1N7L A;  4JPZ B;  5KJ7 C;  4I7Z B;  1NAY A;  1P84 H;  3L71 D;  1GK4 A;  2A06 E;  3U1C A;  3L75 J;  5BOK A;  4QUP A;  2K9Y A;  2B9B A;  1ZLL A;  1NTZ D;  2ZVO B;  1N7S A;  1SQX J;  4ZMD A;  4HJL A;  1YJN P;  1H89 A;  2YO3 A;  5CMZ A;  4CPG A;  2E76 B;  1NTK D;  2QJY C;  1LTJ A;  3G9R A;  3F5H A;  3GTS A;  3Q5P A;  1DEE G;  1Y47 A;  4TT3 H;  3H1J G;  4PD4 E;  1L0L K;  3NFQ A;  3CCR P;  1AQT A;  2AEF A;  1GDT A;  5CBN A;  2IFN A;  2OYO A;  4PD4 D;  2BAS A;  5B5E E;  2E74 B;  3L75 E;  1H8A A;  4NPD A;  2N1T B;  4EOT A;  2ZYL A;  3CWB E;  2OYH C;  2I1K A;  1KD1 Q;  3T97 B;  2ZYG A;  4C7N B;  1T3J A;  3B5N D;  3B5N C;  3W67 A;  3CCS P;  1LTS C;  3N4X A;  3D89 A;  4BRY B;  2E75 B;  3L73 E;  1RY3 A;  3AEA C;  3S4R A;  5KKZ B;  2QG4 A;  1GU4 A;  3L70 J;  1SQX E;  1ZOY C;  1NKN A;  2O01 N;  5AVZ B;  1O7H A;  1GTW A;  1U57 A;  2JP3 A;  1KIL E;  1T2K D;  4N6J A;  4ZKU A;  5CCH C;  2WPS A;  3L75 D;  3P7K A;  1S9K D;  2NVF A;  1SFC A;  3H1J E;  2ZXE B;  5EFW B;  2E74 C;  1LT9 C;  5AW7 B;  5K5G B;  1J1E C;  2Y9Z A;  2WIT A;  3AE5 C;  2DE5 D;  4GKG A;  1VQ4 P;  1SQP G;  1SQB G;  1OW7 A;  1NAF A;  4HJG H;  1VM9 A;  1ZN5 A;  3B4S A;  2LXC B;  2OTK E;  1IK9 A;  3WMM 0;  1IK7 A;  3RK2 D;  4WB4 A;  1L4A B;  4HM4 A;  2E5Y A;  3HE5 A;  3AEG C;  2DE7 D;  2A45 I;  2NUK A;  3PHL A;  3RL0 D;  2ZT9 D;  2GBX A;  2NPS A;  1LP1 A;  2M3B A;  5AVT B;  2BCC D;  2M8R A;  2J5U A;  1N2D C;  2PP6 A;  3HD7 C;  1RIE A;  3FGA D;  5L8R J;  2QJK C;  2C0X A;  4IL6 E;  4R4M A;  1G2C B;  4EIJ A;  1S4X A;  1KYO I;  1IFM A;  2NVE A;  4U3F G;  1USE A;  2Y0D A;  4H0L C;  2KNC B;  4IFM A;  4QDF A;  1FAV A;  2H88 C;  5CBO A;  1SQV J;  4I7Z C;  1SFC C;  1KFM A;  1RFS A;  2JZA A;  4XA4 A;  3ITK A;  4RO0 A;  1NVO A;  3L4F A;  4HKV A;  4HB1 A;  1G8J B;  5KAI H;  1VCK A;  1FS0 E;  1R5S A;  4QMA A;  4XFJ A;  3H1L D;  2FY8 A;  1MKM A;  3LIE A;  3L72 G;  3KZI H;  1FZG A;  1FDO A;  4YXD C;  1URQ C;  3BAT A;  1YJ9 P;  2YKP A;  5KJ7 D;  2OYH B;  2HYN A;  1W2E A;  3VN0 A;  3JSV C;  1L0N D;  5AW5 B;  4IFD K;  4L73 A;  3SFD C;  2GA1 A;  3EWK A;  2KP8 A;  4NBF D;  1M90 Q;  1QX8 A;  4HH2 A;  2O01 J;  4NB8 D;  2H43 A;  2FYU E;  3PTZ A;  4QUR A;  3VMH D;  2QSI A;  4GIF A;  5KLV J;  1OW6 A;  3PLN A;  4OGQ D;  4OGQ C;  2OQQ A;  1T3U A;  3AE1 C;  2K9J B;  2Y0C A;  3MUD A;  2WSE H;  3AE4 C;  4MN4 C;  2KLU A;  2YXQ B;  4KJM A;  2J59 M;  1AV1 A;  1NTZ G;  5KAI E;  3V4Q A;  1FU1 A;  1HF9 A;  2BEQ D;  5APS A;  2HPC A;  1FZC B;  1NTM D;  2GBW A;  4PD4 I;  3TGU J;  2B89 A;  3A3Y B;  4W7Y A;  2B87 A;  3CCE P;  3C0D A;  2WSC H;  1FJK A;  1DEB A;  1TU3 F;  2O3J A;  4H44 B;  1G1J A;  2BCC J;  1O7P A;  4BXL A;  2ZT9 C;  3L71 G;  4HM6 A;  1M56 D;  1LT9 A;  1Q7Y Q;  1IFP A;  3RBX A;  3BCC E;  1GL2 B;  1S72 P;  2O01 H;  1ZRT D;  1O7W A;  4BWN A;  1WRG A;  1NO4 A;  3JC2 2;  2KLV A;  1NYK A;  4D6T D;  1EDK A;  2WPV B;  1HUC A;  3GZY A;  3MUD C;  2KUB A;  3E1I A;  1VF5 D;  1SFC D;  4DT0 A;  2KXP B;  1GMJ A;  2G3A A;  2Q3W A;  2FFD C;  3EQQ A;  2OYI A;  2P1J A;  4JYC A;  1E79 H;  3H1K G;  3SWF A;  1LNQ A;  3RL0 B;  2W6J H;  2WSS H;  5APW A;  4C46 A;  2DE6 D;  2LR2 A;  1KN7 A;  1AA0 A;  2H89 C;  3PH0 A;  4NBA D;  2WT7 A;  3FWL A;  3AED C;  1ZV8 A;  3G71 P;  4QUQ A;  4N78 D;  2FYU K;  4TLF A;  4PV1 C;  1M7L A;  1LTT C;  3A0B H;  2KZJ A;  1WT6 A;  1OZH A;  2W8Z A;  1CI6 A;  3E1R A;  5TIS H;  3RK3 C;  1P84 E;  3G3Z A;  1LTG C;  1VQP P;  1JY3 O;  4GOE A;  1JMB A;  3CCJ P;  1NTM K;  2ZAE B;  3HTK B;  2W6A A;  3F89 A;  1PGO A;  3A0H E;  1M1J C;  1X22 A;  2KB7 P;  5KJ7 A;  3AEB C;  2HG5 D;  2J58 A;  1A02 J;  1NHL A;  1Q90 C;  1SQQ G;  5KAF E;  2WPR A;  1KYO E;  1NTK G;  2JO6 A;  5KTB A;  3MP7 B;  4ZKP A;  2KSJ A;  4QDF B;  3L36 A;  3L70 D;  2YVJ B;  1S5L H;  1IJD B;  2E76 D;  1T6A A;  1Q86 Q;  3TGU D;  1OW8 A;  4HM7 A;  5AVV B;  1QL1 A;  1EDL A;  1FOS F;  5C39 A;  1JCD A;  1LWU A;  3KPE A;  2P58 A;  3H1K D;  2E42 A;  4H0L D;  4NPE A;  3HUS A;  1BDC A;  2QJP C;  4NBG D;  1BGY D;  3H32 B;  3RBZ A;  1OVV A;  3HD7 B;  3N7N A;  1NU1 G;  4D6T J;  3EQ2 A;  1MUU A;  3GW6 A;  1GZL A;  2M3E A;  3B5N B;  1RF0 A;  3VMZ A;  1OFC X;  2E75 D;  1SQQ D;  2M5A A;  1LTI C;  2JEE A;  2YMK A;  2IBZ G;  3CC7 P;  2Q3I A;  2Q9I A;  3HUS C;  2H8P D;  2HMM A;  2Y0E A;  2YFL A;  2WTY A;  3GF7 A;  1O7N A;  2QRX A;  5GTH H;  1N7S C;  4ASW A;  2HMO A;  2YIU B;  1DD4 A;  3KYQ A;  4LGD E;  1GK6 A;  1WMK A;  4GT1 A;  3VMA A;  5CCH D;  1KQL A;  1T2K C;  3SFE C;  3CCV P;  2P10 A;  5KLV G;  5GTI E;  1RE3 C;  5AVQ B;  5CCG D;  4HM2 A;  2CPB A;  4QDD A;  3TGU G;  1R5L A;  3L73 G;  1FZF A;  1N8R Q;  3L74 D;  2YXR B;  2ZYA A;  3GOB A;  2K37 A;  4IL6 H;  4GOF A;  5H2F E;  2FYU J;  1S3J A;  2PAJ A;  1M8O B;  2VRS A;  4A7P A;  5BVZ A;  1KQF B;  4NPF X;  1BGY G;  3HRN A;  3OAK A;  2CK3 H;  2QM8 A;  1NU1 D;  3H1J D;  1ULI A;  1ZXG A;  1IFD A;  1EDJ A;  1G8K B;  2KI7 B;  3GLM A;  1QL2 A;  1NTM G;  2NZ2 A;  2E76 C;  1ZME C;  3UIA A;  2LXB A;  4M3L A;  2OYI B;  3TNU A;  2K88 A;  2WPQ A;  1VL2 A;  2C9N Y;  5AEW A;  2W90 A;  3PP5 A;  1FOS E;  1AFO A;  2NWF A;  3M9Q A;  4H44 C;  1O7M A;  2BCC E;  4AUW A;  2Q3E A;  1SQV G;  1FZC C;  1KOR A;  3Q1M A;  1RE3 A;  2CKF A;  1UUW A;  3I55 P;  1RF1 A;  4PV1 D;  2HML A;  1NWQ A;  1HJB A;  2MJZ A;  2R32 A;  1KIL D;  1CI6 B;  5AVR B;  1P84 I;  3KXD A;  1QVF O;  1N73 A;  4LLH A;  3CX5 E;  3TF5 A;  3OJA B;  1NTZ K;  2XR8 A;  1X9V A;  1IFJ A;  2FFD B;  3AE3 C;  4PJ0 H;  5E79 E;  3CWB G;  2OTJ P;  1LTB C;  3D70 A;  1HJ0 A;  3S9O A;  2ZVN B;  1L0L E;  4WY4 C;  2E4P A;  2M0B A;  4ASV A;  2BEZ F;  1BDD A;  1RH5 B;  1K04 A;  1OXZ A;  1HH0 A;  1KQS O;  3QH9 A;  1ZP0 C;  1EXI A;  1JEK A;  3KQG A;  1NU1 K;  1KYO D;  1L0N J;  3SWY A;  2JJL A;  5APX A;  1SQQ K;  1X8Y A;  5CCG C;  2HMN A;  4P1B H;  4DZO A;  2FYU D;  1BCC J;  1UIX A;  1MFZ A;  3HUS B;  1SQX K;  2B24 A;  2XRX A;  2ZFC A;  1KIL B;  1PP9 G;  2Z5H A;  1H0T B;  4GDO A;  2Q7C A;  3M0D C;  1AVY A;  5AVX B;  4N3Y B;  1YTZ T;  1L0N E;  4DJG A;  2OYH A;  2FYN C;  2XU6 A;  1IZN B;  4ZNC A;  2OGU A;  1QVG O;  2RH0 A;  4L74 A;  4RJT A;  2AXC A;  2HOD A;  1Y9B A;  1M1J A;  1SQX D;  3HD7 D;  2N1T D;  3VP9 A;  4AAY B;  1YIT P;  3I5C A;  2BMQ A;  1NTK J;  2K9J A;  2W27 A;  1JY2 O;  1OWA A;  5APY A;  3NXS A;  1J1D C;  1RHZ B;  1HWT C;  3P32 A;  3ZDM A;  2JR8 A;  3P8M C;  5B66 H;  1NTM E;  4DOJ A;  5CCG A;  1VQL P;  2XSH A;  1JTH A;  3L72 J;  2JWD A;  2YNY A;  1JY2 N;  4D6T G;  3T97 A;  4HYT B;  1PV3 A;  2QEX P;  1Y8A A;  2Q6Q A;  3TGU E;  5HL4 A;  4H13 B;  1J1E B;  4QDC A;  4HM5 A;  2Y9Y A;  1PFI A;  1W2B O;  3L37 A;  3L74 G;  1LP1 B;  1DX7 A;  3G4S P;  2Z4E A;  1OIP A;  2D2C D;  2D2C B;  1VQK P;  1RE4 C;  1L0L D;  4IL6 X;  3AEC C;  4WY4 D;  2NPS C;  3IAO A;  3FWN A;  1JY3 P;  2PFX A;  1IFI A;  2YFI A;  2WSE J;  3H1L G;  3VCP A;  1PZQ A;  2KK7 A;  3QWO C;  2E4Q A;  2HLO A;  3TNU B;  1DD3 A;  2V7Q J;  3O6Q B;  1FQT A;  2P67 A;  4W80 A;  5CHX A;  1JY3 N;  3H1H D;  4WVZ A;  3VCA A;  3IFM A;  3TK1 A;  3GL0 A;  1AVO A;  3K5B A;  3MIW A;  4N78 E;  4H0L B;  2WT7 B;  3AE6 C;  1L0N K;  3VOP A;  2UWJ E;  1EZV G;  3O8Z A;  4KHX A;  4NBB D;  1SS1 A;  1XTG B;  1SQB J;  1SQP J;  1NDO A;  1SLQ A;  2ZT9 B;  1KB9 H;  3H1I J;  1KTM A;  1AQ5 A;  1PGJ A;  4JBZ A;  3L70 G;  1JMM A;  1BGY J;  1N73 B;  3CX5 I;  5AW3 B;  1VQ8 P;  1PGP A;  1Q2N A;  3LW5 H;  2IBZ I;  3H1L E;  5GTH E;  2JKV A;  2W6B A;  1LWU C;  3V5B A;  2KS1 B;  1ZW0 A;  1R8E A;  3WU2 E;  3DQY A;  1JCC A;  3M9H A;  3WUT A;  1T8Z A;  5AW1 B;  3CPW O;  2K3R A;  5DJT B;  1JUN A;  3CXH D;  2R3S A;  3C8V A;  1FBM A;  3CCL P;  2E75 C;  5CJ4 A;  2XDJ A;  2R5B A;  2I1J A;  3AE8 C;  1Q90 D;  1N7S B;  1AJY A;  3IN6 A;  1EZV E;  2YIU C;  2RN0 A;  1K9M Q;  3L72 D;  1QLE D;  4Y28 J;  1PP9 D;  1HTL C;  1DH3 A;  4NBC D;  3A7O A;  3MGN A;  2QM7 A;  3B71 A;  3VMX A;  3GF3 A;  1JY2 P;  2A06 D;  1SQQ E;  2FYZ A;  2FXO A;  3GL2 A;  1A02 F;  1VQM P;  3N0Q A;  2B87 B;  4H13 C;  2IBZ D;  2L5G B;  3L71 J;  3H1I E;  1IFN A;  2K1A A;  3Q5R A;  2ITA A;  3GHG A;  3FX0 A;  4YTP C;  2V7Q H;  3S1K A;  2WSC J;  4YXW H;  3L75 G;  1GW3 A;  3WUU A;  1RF1 C;  1PL5 A;  1NU1 J;  1EDI A;  2O1J A;  5KLV E;  3OW2 O;  1VDF A;  5CXM A;  2IZ1 A;  1CSB A;  1EG9 A;  3PRJ A;  1FZB A;  4UB6 H;  2CPS A;  2C9L Y;  1FZA A;  3CX5 D;  4NBE D;  1YYC A;  2HOD B;  3CC2 P;  2WWW A;  1M1J B;  1LJ2 A;  3TSI A;  2JWA A;  3LID A;  3BCC D;  2AXT H;  3CXH I;  2FKW B;  4WY4 A;  3RK3 E;  1PPJ D;  3VMG D;  5KLI B;  2IPP A;  3C9I A;  3RK3 D;  1KB9 I;  2FYN B;  5AW2 B;  2N1T A;  1VQ5 P;  4JQ0 D;  3D6Z A;  3KDP B;  1QGK B;  1KIL C;  1FDM A;  4PJ0 E;  3LW5 J;  5E79 H;  2HFE D;  4C7R A;  4BRY A;  1K73 Q;  1S5L X;  1PPJ E;  3USS A;  3U1A A;  3HE4 A;  1UII A;  1PP9 E;  1SQV E;  2YKO A;  1BE3 D;  3FXE A;  4GOD A;  4O9B A;  3NTN A;  2O1K A;  4OH8 B;  1BE3 E;  1YQ4 C;  2QJY B;  3GCE A;  1MV8 A;  3KZI E;  1VF5 B;  2V4H A;  3H6P A;  4EDF A;  4K35 A;  1L0L G;  2QIW A;  3R4Y A;  1PP9 J;  1YBK A;  3TYY A;  2NUM A;  5AVS B;  3IF4 A;  2AXT E;  2KYV A;  1DIP A;  4NBD D;  1KZU B;  3L73 D;  5CJ0 A;  1USD A;  2FYU G;  3BRV B;  1GL2 C;  4UB8 E;  3H1K J;  3H1I D;  3CME P;  5KLV K;  1OVU A;  1WQL A;  2ZXX A;  1L4A A;  1NH4 A;  1NJI Q;  3SSU A;  3WUV A;  2NPS B;  5AW9 B;  1KB9 D;  1FC2 C;  3B8E B;  4L76 A;  3V2P A;  3SWK A;  2RMZ A;  4D6T E;  3P8C D;  3CWB J;  5KKZ C;  4XE5 B;  3ABV C;  4U3F E;  1ZRT E;  3B5N A;  3H1H J;  3VYI A;  2G8Y A;  2KNC A;  1FJP A;  2XSO A;  1BE3 J;  3BCC G;  2IBZ E;  2Q1K A;  3AE7 C;  4W7Z A;  5AEU A;  5AW6 B;  5APU A;  2IDB A;  1LTJ B;  2XV5 A;  5B66 E;  2WSF J;  1JNM A;  2A45 H;  5AW4 B;  3GB4 A;  3C1L A;  1NTK E;  2PRR A;  2MKV A;  3CXH H;  4EMJ B;  3IR9 A;  1EZV I;  4HM8 A;  1SQV K;  3M0A A;  4I2L C;  3A0H H;  2NVG A;  1QEX A;  4P1C H;  2YKQ A;  3AE9 C;  2C0W A;  2HPC B;  1O7G A;  3H32 A;  3W68 A;  1KV4 A;  3V2Q A;  1SQQ J;  1URQ A;  1IC2 A;  2WMM A;  1NTZ J;  3M0D A;  3G6E P;  3VTP C;  1NU1 E;  1FZE A;  2FXP A;  2QA4 P;  3CCU P;  3H1H E;  3RGU A;  4Y99 B;  1NGM B;  4HM1 A;  1X0T A;  1JOC A;  3EFF K;  1LTA C;  3H1J J;  2SPZ A;  4I6M C;  1SFC B;  1D7M A;  3A0B E;  3GKE A;  1VQ7 P;  1BSH A;  3L74 E;  4H44 D;  5TIS E;  1U7J A;  3L73 J;  3EN1 A;  1GL2 D;  2QJP B;  2D2C C;  3CXH E;  2N9B A;  5APQ A;  3GMA A;  1JM0 A;  2OAR A;  4U3F D;  1RQU A;  3AE2 C;  2L91 A;  2Z5I A;  3HE5 B;  4U7J A;  3AZC A;  1KB9 E;  1YHQ P;  3FXD A;  5KAF H;  1VF5 C;  1KYO H;  3L72 E;  3RK2 B;  4WBA A;  1GW4 A;  2YO2 A;  3MD0 A;  1GD2 E;  1RF1 B;  2ZYD A;  4WWI A;  1KQG B;  3VMI D;  1HBW A;  1S5L E;  1EC5 A;  5M1B A;  3MTU E;  3U59 A;  3V6I A;  1G1I A;  4U3F J;  3BVH A;  5B5E H;  3WU2 H;  2WSF H;  2KOG A;  2B1X A;  3CI9 A;  2BCC G;  5TJH A;  2HMK A;  3L71 E;  5GTI H;  2QVA A;  3FOU A;  1BE3 G;  1E5W A;  1EQ7 A;  2NRG A;  1BGY E;  4KT0 J;  2AEJ A;  1HGZ A;  2NPS D;  2WVR A;  3P8C E;  2YMY A;  3V2R A;  1YJW P;  4H13 D;  3M91 A;  1MZ9 A;  1YIJ P;  2QPZ A;  2GM4 A;  4LC1 A;  1PIX A;  2XNX A;  3CL3 D;  2W83 C;  5KLI C;  2DW3 A;  1KC8 Q;  1P84 D;  3GTE A;  2GUV A;  1OX3 A;  3O6Q A;  1BCC D;  1RE4 A;  4HM0 A;  4K3A A;  2IFM A;  1LWU B;  5AW0 B;  3Q5S A;  2IYP A;  3PJS K;  3BRT B;  3AEE C;  4L75 A;  4YPC A;  3BAS A;  4Y99 C;  2B88 A;  1SQB K;  1SQP K;  5AVY B;  3HTK A;  1H0T A;  1OVR A;  1SQP E;  1SQB E;  1FE6 A;  1KFN A;  3HD7 A;  1BSN A;  2R5D A;  3CD6 P;  1CZQ A;  1M57 D;  2N1T C;  5CCH A;  1S9K E;  2IX7 C;  2QJK B;  1L0N G;  2FXM A;  3VMY A;  1S2E A;  1ZR4 A;  3MHV A;  4B86 A;  4NBH D;  3V2N A;  2I7F A;  3A5T A;  2QE7 H;  3RL0 C;  1PGQ A;  2A45 G;  3E7K A;  3TDK A;  2KS1 A;  1VQN P;  1SQV D;  1IO4 A;  3R2P A;  2JO1 A;  1FZC A;  5H2F H;  1HVV A;  3CWB D;  5APV A;  1LT1 A;  1RF0 C;  1FDI A;  4HM3 A;  3RK3 B;  3GG2 A;  1SQX G;  1KIL A;  1H88 A;  1JO5 A;  4IFF A;  1K05 A;  1Q81 Q;  2OYI C;  1L4A C;  1LT9 B;  1L4A D;  2KZI A;  1S1C X;  1GL2 A;  4HKZ H;  5AVU B;  1URQ B;  1K8A Q;  3H1L J;  3GHG C;  2Q5U A;  3GZX A;  4JYB A;  4C7N A;  2P2U A;  3CCQ P;  1SJG A;  4I1L A;  2H7H A;  2XKM A;  1N73 C;  1CW5 A;  3BCC J;  1J1D B;  1M1K Q;  2BMO A;  2HR3 A;  4AIV A;  4IOI H;  5BU8 B;  4NB9 D;  2WZ7 A;  3EFG A;  2PGD A;  3L74 J;  4AQR D;  2ZJS E;  1VQ9 P;  1XTC C;  2E74 D;  1UUV A;  4OWF A;  5BU5 A;  4EYY Q;  2BMR A;  3H1H G;  2A06 G;  1PPJ G;  4UB8 H;  5KLV D;  2RKL A;  1NTM J; 
#chains in the Genus database with same CATH homology
 1DIP A;  4NBD D;  1K04 A;  1HF9 A;  2BEQ D;  1ZP0 C;  1EXI A;  4Z1M H;  2YFJ A;  2GBW A;  1WQL A;  1NYH A;  2HMN A;  3L70 E;  4P1B H;  3C0D A;  1TU3 F;  4H44 B;  1NTZ E;  1UIX A;  1O7P A;  2B24 A;  2XRX A;  3Q3D A;  2ZT9 C;  4HM6 A;  1RQV A;  4GDO A;  3D71 A;  3BCC E;  1L0N E;  2WQY C;  1O7W A;  5KKZ C;  2FYN C;  3ABV C;  4U3F E;  1JB0 J;  1BCC E;  1ZRT E;  1NYK A;  2WPV B;  2G8Y A;  3GZY A;  3RL0 g;  2XSO A;  4OGQ B;  1VF5 D;  2IBZ E;  3AE7 C;  5AEU A;  1GMJ A;  1Y9B A;  2G3A A;  2Q3W A;  3EQQ A;  2IDB A;  3Q2Y A;  4PV1 B;  2HMJ A;  2WSF J;  4AAY B;  3H1K E;  2DE6 D;  2BMQ A;  3GB4 A;  1NTK E;  2H89 C;  2MKV A;  4EMJ B;  4NBA D;  3AEF C;  4RKU J;  3H25 A;  4HM8 A;  3AED C;  2NVG A;  1KMI Z;  4R4L A;  1NTM E;  4P1C H;  4QUQ A;  3AE9 C;  1O7G A;  3D6Y A;  2XSH A;  4PV1 C;  2FBW C;  1ULJ A;  1NU1 E;  1PV3 A;  2FXP A;  1JM1 A;  3TGU E;  5HL4 A;  3H1H E;  1P84 E;  4H13 B;  4QDC A;  4HM5 A;  1EXJ A;  1NGM B;  4HM1 A;  1OMI A;  1YQ3 C;  4QCK A;  2D2C D;  2D2C B;  4I7Z B;  4IL6 X;  3AEC C;  3AEB C;  2A06 E;  5BOK A;  3IAO A;  4QUP A;  2K9Y A;  1Q90 C;  1KYO E;  2JO6 A;  3GKE A;  3L74 E;  4H44 D;  4QDF B;  2YFI A;  4HJL A;  2YVJ B;  2WSE J;  3VCP A;  3EN1 A;  2E4Q A;  2E76 B;  2QJY C;  2E76 D;  2D2C C;  3G9R A;  3CXH E;  1DD3 A;  3GTS A;  1OW8 A;  2V7Q J;  3GMA A;  3Q5P A;  4TT3 H;  4HM7 A;  1FQT A;  1RQU A;  3AE2 C;  4PD4 E;  3VCA A;  3GL0 A;  4H0L B;  4U7J A;  4H0L D;  3AZC A;  3AE6 C;  1KB9 E;  2E74 B;  1VF5 C;  2QJP C;  3L72 E;  4NBG D;  3L75 E;  2ZYL A;  4NBB D;  3CWB E;  1NDO A;  1KQG B;  3VMI D;  3T97 B;  2ZT9 B;  5M1B A;  1KTM A;  3D89 A;  2E75 D;  2E75 B;  3L73 E;  3AEA C;  2B1X A;  2YMK A;  2HMK A;  3L71 E;  1SQX E;  3H1L E;  1ZOY C;  1O7H A;  1U57 A;  2JP3 A;  1KIL E;  1R8E A;  3FOU A;  3DQY A;  4KT0 J;  2NVF A;  3H1J E;  2HMM A;  2E74 C;  3C8V A;  2YFL A;  3GF7 A;  1O7N A;  2E75 C;  3AE8 C;  1Q90 D;  4H13 D;  1AJY A;  3IN6 A;  2HMO A;  1EZV E;  2YIU C;  3AE5 C;  2QPZ A;  1DD4 A;  2DE5 D;  4Y28 J;  1PIX A;  1OW7 A;  1WMK A;  4NBC D;  1VM9 A;  5KLI C;  3B71 A;  3GTE A;  3GF3 A;  3SFE C;  3O6Q A;  2P10 A;  4HM0 A;  1SQQ E;  3GL2 A;  1IK7 A;  4HM2 A;  4HM4 A;  4QDD A;  3N0Q A;  3Q5S A;  3AEG C;  4H13 C;  3AEE C;  3H1I E;  2DE7 D;  2NUK A;  3GOB A;  3Q5R A;  2ZT9 D;  2GBX A;  4YTP C;  1SQP E;  1SQB E;  2WSC J;  2J5U A;  1RIE A;  3FGA D;  5L8R J;  1PL5 A;  1KQF B;  2QJK C;  5KLV E;  4R4M A;  5CXM A;  1EG9 A;  2NVE A;  1ULI A;  4H0L C;  4QDF A;  4NBH D;  2H88 C;  1G8K B;  2I7F A;  4I7Z C;  4NBE D;  3GLM A;  2NZ2 A;  1RFS A;  2E76 C;  1ZME C;  2JZA A;  4HKV A;  2JO1 A;  1VL2 A;  1G8J B;  3RK3 E;  5AEW A;  1VCK A;  3VMG D;  1FDI A;  2NWF A;  4H44 C;  1O7M A;  4HM3 A;  2BCC E;  4XFJ A;  1KOR A;  3Q1M A;  1MKM A;  2CKF A;  1K05 A;  1UUW A;  1S1C X;  4PV1 D;  1FDO A;  4YXD C;  2HML A;  3D6Z A;  3GZX A;  1SJG A;  3LW5 J;  3SFD C;  1S5L X;  1PPJ E;  2BMO A;  3EWK A;  4AIV A;  3CX5 E;  4NBF D;  4NB9 D;  1PP9 E;  1SQV E;  2XR8 A;  2O01 J;  4NB8 D;  2FYU E;  3AE3 C;  4QUR A;  3VMH D;  1BE3 E;  2QSI A;  1YQ4 C;  3GCE A;  1OW6 A;  2E74 D;  1UUV A;  3D70 A;  1HJ0 A;  3S9O A;  1L0L E;  4OGQ D;  2E4P A;  4OGQ C;  1VF5 B;  2OQQ A;  3AE1 C;  2BMR A;  2BEZ F;  2QIW A;  3R4Y A;  3AE4 C;  2NUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...