2FYNC

Crystal structure analysis of the double mutant rhodobacter sphaeroides bc1 complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCSPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 50
structure length 179
sequence length 179
chains with identical sequence F, I, L, O, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2fynC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2fynC02
1RIEA 2WSFJ 2QIWA 2K9YA 4HM6A 1KYOE 3D89A 3CXHE 4HKVA 4AIVA 1SQBE 2BCCE 1G8KB 3H1HE 4H0LD 1ULIA 2E76D 2BMQA 1O7NA 2DE5D 4QDFB 4OGQB 2NVFA 3FOUA 1PPJE 4PD4E 1NTME 1EG9A 1O7MA 1SJGA 1VCKA 2NVGA 1KB9E 3CX5E 1JM1A 3L70E 2E74B 2NUMA 2XSOA 4NBGD 2NWFA 2NUKA 3H1LE 2WSEJ 4QDDA 1Q90D 2ZT9D 4H44B 3VCAA 1O7WA 2A06E 4QURA 2BMOA 4QDCA 3TGUE 4NBFD 4P1CH 1NTZE 2QJKC 3AZCA 4Y28J 4QUPA 3GKEA 2B1XA 2JO6A 1JB0J 1VF5B 1NU1E 3GL0A 3H1KE 2DE7D 2JZAA 3DQYA 4PV1B 3GB4A 2IBZE 1NDOA 1SQPE 2D2CB 3C0DA 3H1IE 1L0LE 4AAYB 4QDFA 2XRXA 3LW5J 4H0LB 2HMMA 2FYNC 2I7FA 1WQLA 2E76B 4I7ZB 2BMRA 4NB9D 4NBED 1SQVE 5L8RJ 2E74D 4H13B 1UUWA 2CKFA 5AEWA 2E75B 4KT0J 3L72E 2QSIA 2XSHA 3L75E 2HMLA 4NBBD 4NBAD 3GL2A 4H44D 3VMID 4HM8A 1NTKE 2Q3WA 3EN1A 3VMHD 2QPZA 2WPVB 4HM7A 2DE6D 4NB8D 4EMJB 2QJYC 2YVJB 2O01J 4QUQA 1Q90C 1NYKA 2HMNA 1EZVE 2NVEA 1O7PA 5AEUA 2QJPC 1PP9E 1VF5D 2YFJA 1RFSA 1VM9A 4NBCD 3GTEA 2XR8A 2YFLA 4OGQD 2ZYLA 3CWBE 4PV1D 5KLVE 4NBDD 3H1JE 5BOKA 1SQXE 3GOBA 3GZYA 1FQTA 2D2CD 3L73E 4HM2A 3GTSA 5CXMA 2FYUE 1O7HA 2GBXA 4HM3A 3VCPA 1ZRTE 2E4QA 1UUVA 3GZXA 4HM0A 4HJLA 2YFIA 3L74E 1SQQE 4QCKA 1BE3E 4HM1A 2WSCJ 4HM5A 4RKUJ 1L0NE 2GBWA 5HL4A 1G8JB 2HMKA 4H13D 5KKZC 1P84E 2E75D 4IL6X 2ZT9B 3N0QA 3GCEA 2E4PA 4HM4A 4NBHD 4U3FE 1ULJA 3EQQA 2YIUC 1BCCE 2HMJA 1O7GA 2HMOA 3C8VA 3L71E 2B24A 3BCCE 3VMGD 4P1BH 5KLIC 1S5LX
chains in the Genus database with same CATH superfamily
2IFNA 2CK3H 3WUTA 2E76D 3ITKA 1FOSF 1ZOYC 1N7SA 3V2RA 2YXRB 1OX3A 1AFOA 2BEQD 1FAVA 1ZR4A 2B87A 4QMAA 1NTZE 3NTNA 1PPJD 1K9MQ 1OVRA 2KIKA 3L71G 1CZQA 1PFIA 3GF7A 1N73B 1X8YA 4N6JA 3TGUD 5AVWB 1TU3F 2N1TB 2WPRA 3TSIA 1YQ4C 2J58A 1T3JA 1NTMJ 1Q82Q 3EFFK 2XSHA 2IBZI 2IBZD 5GTIH 2C9NY 3BRVB 2OYIB 4NB8D 4JPZB 1IJDB 3GW6A 1ZMEC 5M1BA 1ZN5A 1W5CE 1YJ9P 4Y99B 2O01H 4HM2A 1ZXGA 2V4HA 1N7SB 3CC7P 3ZDMA 3S4RA 1LT1A 3PJSK 3H1ID 1LTTC 1JY2N 3GLMA 2B87B 2W6BA 2HMOA 1SQXK 4D6TG 2P58A 1ZRTD 1SQQD 1OXZA 1P84I 3FWLA 2K9YA 1KV4A 2R3SA 4H0LD 2BMQA 1VF5C 1M1KQ 2NVFA 4K35A 1OWAA 3CCJP 1L0NJ 3BRTB 1M8OB 3GF3A 1KQSO 2PFXA 1Q7YQ 2HODA 3TDKA 2JR8A 3MP7B 3C9IA 2PRRA 1SQBJ 3V4WA 1SQPE 2FYUG 1Z56A 3HD7C 2P7JA 3E7KA 1SQVE 4HYTB 1NU1K 3L72E 2K1AA 4NBAD 4HM8A 1KB9D 2O01J 1NTZG 1O7PA 3II6A 1X22A 2XR8A 1KD1Q 1NTKK 5GTHE 3HD7A 1O7HA 3KXDA 2M0BA 3CL3D 1L0LJ 4HM5A 1T6AA 1KILD 3S9OA 3V2QA 1VQ9P 4JBZA 1NGMB 2HODB 3VN0A 1RIEA 3QH9A 4OVNF 4W80A 2NPSD 3AE2C 1OMIA 1O7NA 4JYBA 2FYUJ 3SWKA 3CX5E 1GDTA 2P67A 2E42A 2NUKA 1QVFO 4HKZH 4HB1A 1FDIA 4YPCA 1HTLC 3TNUA 4YXDC 4PD4I 4OWFA 4PD4D 1NTMD 2QVAA 1FOSE 3WU2E 2WQYC 4UB6E 1R5SA 2DE7D 2WSFH 1YYCA 3HD7B 1VQNP 5AVRB 1LTIC 3H1IE 2ZXXA 1QL1A 4I7ZC 5AEWA 1U7JA 2E75B 3L70J 4K3AA 4PJ0E 2Z5IA 1M56D 5APUA 1BGYE 2Q3WA 1K8AQ 1KFNA 3VTPC 3LW5H 4GKGA 1Q90C 5E79H 3T97A 3H6PA 3CMEP 3PP5A 1RQUA 1MFTA 1NAYA 3GMAA 3P8CE 3CWBE 5CCHC 1USDA 4PV1D 2FFDC 1DEBA 1EQ7A 4HJGH 2GBXA 1JMMA 4ZMDA 1PGPA 4HM0A 3M0DC 1UIIA 1JY2O 1N2DC 1G8JB 1SQVG 4U3FE 1ULJA 2SPZA 2ZXEB 2KOGA 1MFZA 3TNUB 2Q3EA 1L0ND 2Q7CA 1GTWA 1HJ0A 2I8DA 5KAFE 3PLNA 2FFDA 1KMIZ 1GMJA 1W2BO 2B89A 2RN0A 3KZIH 1QL2A 3M0DA 1JEKA 1KB9E 3L74J 2NWFA 2WSEJ 1SQBD 2OTLP 4GDOA 4WVZA 4QDCA 1BCCJ 3T97B 3A2AA 2JKVA 3KHUA 1JY2P 4UB8E 3Q1MA 2M5AA 3GB4A 2A06D 5C39A 3IR9A 2I1JA 2D2CC 1U57A 3LW5J 2I7FA 4I7ZB 4IFMA 1OW6A 2XNDH 1N86A 2OYHA 2KUBA 4EOTA 1Q86Q 5B66E 2B88A 1ZP0C 2MKVA 1L0LD 3WUUA 1P84H 5AVXB 2XV5A 1GU4A 1RF0C 5TISE 1GK6A 2ZAEB 5APXA 3H1JE 2FFDB 3AE3C 2RMZA 2N1TD 1G1JA 1BE3E 2P2UA 1FC2C 1NVOA 2E4PA 1J1DC 3RL0C 4ZNCA 5AW7B 4IFDK 3V5BA 2E74C 1BGYG 2ZYGA 1SVFA 2KS1A 3BCCE 4N78D 5B5EE 1RF0A 2QIWA 2XU6A 4WB4A 2M5AB 3NXSA 3JCUE 3BATA 4W7YA 1LT9B 3CWBG 1YQ3C 1N7SD 1RQVA 1X9VA 1KYOI 4NBGD 2OYHB 3LIEA 4H44B 3IN6A 3RK3B 2L91A 4QURA 4U3FG 4Y28J 4DT0A 1NTMK 3BVHA 3G6EP 1M7LA 3CLQA 4HH2A 1E79H 1Q81Q 5EFWB 2BCCJ 1NDOA 2D2CB 3WUVA 1NAFA 1GW4A 4NB9D 1KQLA 4B86A 3AECC 2YXQB 4U7JA 3MUDA 2WPVB 1HUCA 2KS1B 4EYYQ 3LIDA 5KAIH 1EZVE 1MV8A 3CC4P 3GTEA 4OGQD 3H1KJ 1YBKA 2ZFCA 1L4AA 1AJYA 1FE6A 4IL6E 2Q5UA 2LKMA 2K9JA 4QCKA 2M3BA 2RKLA 1IK9A 2IPPA 5K5GB 4LGDE 3RL0B 3P8MC 2H7HA 2GUSA 1O7GA 3C8VA 2H8PD 2WSCH 1LTBC 4U3FJ 1VQPP 1YTZT 1L0NK 3CXHE 3AEGC 1G8KB 1BCCD 1ULIA 5KLVJ 1FZGA 2W90A 1KFMA 3H1JG 3ABVC 2JO1A 2WITA 1FZFA 1O7MA 1NKZB 1JM1A 1LNQA 1BE3G 1IZNB 1SQBK 2VRSA 2M8RA 3GKEA 1FBMA 3BCCG 3NFQA 1S5LH 1L4AB 3RK2C 1VQMP 2K9JB 1IK7A 1G2CA 2XKMA 1X79B 3P7KA 2KZIA 3L75E 1DD4A 1PL5A 4CPGA 3CD6P 5TJHA 2OYOA 1LP1A 2NRGA 3M06A 2YVJB 1YHQP 1L0LK 1VQOP 2LR2A 2WTYA 1WRGA 5APYA 4ASWA 1PP9E 5AVZB 3Q5RA 5AW4B 2HLOA 3HD7D 3Q5PA 1SQXE 3CMAP 2C0XA 1EXJA 1OW7A 2YFIA 2R3CA 4HM1A 2WZ7A 2WSCJ 4YTPC 2M3EA 2OTKE 2E75D 1S9KE 2BASA 2WWWA 1USEA 4BXLA 1VQ6P 2KSEA 3CCQP 2A45G 1S3JA 5BVZA 1BE3J 2QJPB 3VP9A 1LTJC 2FYUK 5CCGC 3CCSP 1E5WA 1H88A 5KLIC 3AEDC 2KP8A 2W6JH 3D89A 1EZVG 3H1HE 3MTUE 1T2KC 4TT3H 4GOFA 2DE5D 2Y0EA 1G2CB 3JC22 2IYPA 3A3YB 5H2FH 3D6ZA 5BU5A 3L73D 3HTKA 3H1LE 1T3UA 2BCCD 4EDFA 3V6IA 1H8AA 1LP1B 1LTJA 2I1KA 5CCGA 1P84D 1Y47A 4RO0A 3L71J 1EDLA 1FZEA 3RBZA 2KLUA 1NU1E 1YI2P 3RK2B 1HGVA 2N9YB 2XDJA 1PV3A 3VMYA 2Q3IA 4L76A 2E76C 1S72P 3H1KD 2HMLA 1U7MA 1NTKE 1BSNA 2JP3A 3H25A 2WVRA 1YJNP 3CCMP 3EFGA 4MN4C 2ZYDA 2YFLA 1RF1C 4NBDD 1RY3A 3H32A 5CXMA 1KYOH 3R2PA 1UUVA 4WWIA 3HTKB 2FYZA 1K05A 1M90Q 3A0BE 3NMDA 5BU8B 4NBHD 5KLVD 1OFCX 2ZT9C 2Z4EA 3N7NA 3EQQA 1LTJB 3TK1A 3L75G 4D6TJ 2YKQA 2B24A 3CC2P 2YO2A 3AE9C 5AW8B 1CW5A 4R4MA 1PP9G 3VMXA 5CHXA 1IFIA 1PPJE 1SQXG 1FU1A 2YMYA 1VQ8P 1SJGA 1UIXA 1NKNA 1JO5A 2NUMA 1DEEG 5KJ7C 4QDDA 2W8ZA 1DIPA 1FDOA 3TGUE 2Y9YA 1VQ7P 4AUWA 2NZ2A 1VF5B 3MZWB 1KORA 3L36A 2IBZE 3H32B 2AXCA 3H1HG 5DJUB 2E76B 4H0LC 3U1AA 5KJ7A 2CKFA 3GL2A 4H44D 1GL2C 3RK3D 3H1LG 3VP8A 2DE6D 5CBOA 2WSEH 3D70A 3L75J 1NTZJ 1EDIA 1BDCA 2HMNA 4IFFA 3VOPA 1EXIA 4Z1MH 5APQA 1NYHA 1NU1G 3A5TA 3L73E 2D2CD 1Y9BA 3I56P 1ZRTE 1SQQE 1JY3P 2QM7A 1SQXJ 1P84E 2ZT9B 5APSA 1GL2A 1NOHA 4GODA 3M9HA 3V2PA 3VMAA 1NTKG 2OTJP 2ZVNB 1VPCA 1M1JC 2MJZA 1FZAA 1IFPA 3OA7A 2R5BA 2AEMA 2Q9IA 1SQPG 5KTBA 3L71D 2IDBA 3FOUA 3IF4A 2FXMA 2CPBA 1URQD 3A0HE 1LTSC 1IFJA 2ZYAA 3L72G 2FXOA 2HYNA 1AV1A 4I2LC 3RL0D 3VCAA 5GTHH 1JOCA 3WMM0 1M1JA 4QUPA 2IZ1A 5CCHA 1WT6A 2AEJA 2AXTE 1Y8AA 2JZAA 2A45I 1Q2NA 2KNCA 3RGUA 2Z5HA 1EC5A 4NPDA 4H0LB 2BMRA 1PPJG 3EQ2A 3L37A 1ZW0A 4C7NA 2FKWB 2FY8A 4H13C 1N8RQ 1GL2B 1EZVI 1T8ZA 3TGUG 3CX5H 2E5YA 2NVEA 1KILE 1J1EC 3RL0g 2KI7B 4D6TD 5AVTB 1NWQA 1A02J 1L4AD 3B5NC 1FDMA 1SQPJ 5CBNA 2IBZG 3WU2H 2IFMA 1DD3A 2WMMA 4UB6H 1SQVJ 3B8EB 2WPSA 3L72J 2POHA 5KLVK 1M1JB 3AE5C 3VMGD 1LWUC 2BEZF 3IAOA 4PJ0H 1DH3A 1AVYA 2QEXP 3B5NA 2KNCB 1AQ5A 3H1IG 4PD4E 1NTME 2GA1A 3GHGC 4I1LA 3B4SA 2WPQA 1OIPA 1JTHA 4C7NB 2FYUD 1SQQG 3I5CA 1PGQA 4XE5B 2UWJE 4EIJA 3KYQA 1SP4A 1LWUA 3D71A 2O01N 2XNXA 2IX7C 3VMZA 3Q5SA 1HF9A 1NTZD 1KYOD 4QDFA 4N3YB 4WY4C 2R32A 3GHGA 3HE5A 3MGNA 4H13B 5KAFH 2CPSA 2QG4A 3L70D 3E1IA 2QE7H 2LXBA 1NYKA 1YITP 2H89C 4L75A 1KB9H 1JCCA 3TF5A 1FJKA 4RJTA 2PAJA 1LTAC 3B5NB 2O1KA 3PHLA 3RK2D 1QVGO 3I55P 4WY4A 3H1IJ 3EWKA 1JTHB 1L0NE 2J5UA 4UB8H 3A7OA 5AW6B 1SLQA 1SQQJ 1BGYJ 4C7RA 2O1JA 1YTZI 4XA4A 1LWUB 1PIXA 1S5LX 3AE7C 2V7QH 1SQBE 2KB7P 5B66H 5GTIE 3CWBJ 4NPEA 1HBWA 4QDFB 2KSJA 4EI2A 3M91A 3GHGB 1S2EA 3HE5B 1J1DB 1N73C 3R4YA 4OH8B 2W83C 2E74B 4A7PA 5TISH 4JQ0D 3G4SP 1OVVA 1R5LA 3L74D 2A06E 2QJKC 1CI6A 3K5BA 3U59A 3GG2A 1IFMA 1J2JB 5AW0B 3F5HA 3JSVC 1L0LE 4WY4B 3V4QA 2HMMA 2ITAA 2OGUA 1BDDA 1SS1A 1XTGB 1NTMG 3L4FA 3VMHD 3JCUH 3VYIA 4EMJB 3IFMA 1QLED 5AW3B 1JY3N 1SQVD 1N7LA 1VF5D 3FWNA 1RFSA 3W68A 2YKPA 1VQKP 5AW5B 1SFCC 2FYUE 4KHXA 3M9BA 1H89A 1QEXA 4N78E 2O3JA 1GU5A 2V7QJ 2FXPA 1CI6B 4P1BH 2KK7A 2A45H 4HM6A 1KYOE 2FBWC 2N9BA 2JJLA 1G1IA 1SFCA 3H1JJ 1VQLP 2PP6A 4OGQC 2WSSH 1VL2A 1EG9A 2IYOA 3L70E 2JWDA 5AW1B 1KTMA 2K3RA 2ZT9D 1BSHA 1L0NG 2OQQA 1ZV8A 2QJKB 4IL6H 4NPFX 4W7ZA 1DX7A 1GD2E 1GK4A 3HUSC 3CX5I 3MHVA 3BCCJ 3CX5D 3CCEP 3OJAB 2RH0A 2L5GB 2JDIH 5AVQB 3UIAA 4ASVA 3KQGA 1WMKA 3G9RA 3DQYA 1HVVA 3MD0A 1SQBG 2H43A 1NTZK 5DJTB 1WQLA 5KJ7D 1M57D 1UUWA 4KT0J 3CXHH 2YO3A 4C46A 2DW3A 2W27A 1AQTA 3HUSA 2A06G 5AEUA 1JMBA 1VM9A 1BGYD 2QRXA 1IFNA 3AE8C 1SFCB 3GOBA 1PGOA 3L74E 1KN7A 2Y0CA 1L0LG 4I6MC 1KZUB 5KKZC 1VQ5P 3P8CD 1GL2D 3CWBD 3AEBC 3HE4A 2IZ0A 2G3AA 1BCCE 2YKOA 2C9LY 1LGHB 1HH0A 4HKVA 4U3FD 4JF7A 4OGQB 1PGJA 4RESB 3CCVP 2PGDA 1X0TA 5E79E 2NVGA 2YNYA 1KC8Q 1VCKA 1RHZB 1Q90D 2K88A 5KLIB 3O6QA 4M3LA 3TYYA 1GZLA 1FS0E 3HUSB 2E75C 1YJWP 3C1LA 1MKMA 1RF1A 5CCHD 1KB9I 2B1XA 2GUVA 2E43A 3MIWA 3GL0A 2B9BA 3KDPB 4DCKA 4R4LA 3M9QA 2Y9ZA 1HWTC 4AAYB 1R8EA 1OVUA 2R5DA 1KQFB 3CCLP 3D6YA 2XZRA 3B71A 4NBBD 3HE4B 3L70G 3OAKA 3QWOC 4HM7A 1JY3O 1SQPK 5AVSB 2LXCB 3KZIE 2KYVA 3CCUP 1SQVK 2OARA 1CSBA 2ZYLA 1D7MA 3G71P 2E5TA 3FXDA 3USSA 3GZYA 3GTSA 5AVVB 4HJLA 1VDFA 5KKZB 2GBWA 4H13D 1HGZA 2G8YA 3O6QB 3H1JD 2AEFA 3SFEC 2HMJA 1AA0A 1RF1B 1JCDA 1BE3D 1AVOA 1PP9J 3B5ND 4AIVA 2BCCE 2HPCA 4AYCA 1FZCC 3F89A 3BCCD 1OW8A 1RE3C 1K04A 3L74G 4LLHA 1L2PA 3CPWO 5AVYB 1JNMA 4P1CH 1BCCG 2P1JA 1JB0J 1VQ4P 3H1KE 3A0BH 2C0WA 4YXWH 3Q3DA 3FGAD 1FZCA 3H1HJ 3C0DA 5AW2B 2XRXA 2GM4A 1RE3A 5AVUB 1NJIQ 1HJBA 4NBED 2E74D 5L8RJ 1EDJA 3KPEA 1KILC 4L74A 3H1LJ 2QPZA 2KZJA 4AQRD 3SWYA 3U1CA 4WBAA 2ZJSE 2P10A 1LJ2A 4BWNA 2YFJA 1EDKA 1NU1J 3G3ZA 1SQQK 3RBXA 5KLVE 2HPCB 3FX0A 2W6AA 1FQTA 2NPSC 4WY4D 2R44A 2E4QA 3GZXA 4ZKUA 3AE1C 2J59M 1EZVD 2HMKA 1K73Q 1KILA 1LT9C 3HRNA 1ZR2A 3BASA 2YIUC 4GT1A 1NTKJ 2OYHC 4DJGA 4H44C 2WSFJ 3RK3C 3S1KA 3P32A 3AE4C 1FZBA 1FZCB 2H88C 2NPSA 3PH0A 5AW9B 4L73A 5KAIE 1NHLA 3PRJA 1KQGB 1LT9A 1FJPA 2XSOA 2YMKA 3CXHI 3CXHD 2BMOA 2Y0DA 4JYCA 2HR3A 3E1RA 4TLFA 4DOJA 2WT7A 2Q1KA 3N4XA 3V2NA 3L73G 4PV1C 3RK3E 4KJMA 2BCCG 2FYNC 3FXEA 1MUUA 1IO4A 1KILB 1PZQA 2QSIA 5APVA 1LTGC 1URQC 3TGUJ 2QJYC 5CMZA 3A0HH 2HG5D 1JM0A 5APTA 3L75D 1QGKB 1NO4A 3H1KG 2NPSB 2KXPB 3VCPA 1RH5B 2JEEA 4RKUJ 1PP9D 3SFDC 2AXTH 1S5LE 2QM8A 2YIUB 1URQA 3AE6C 4GOEA 1SQXD 3AEEC 1J1EB 3L71E 2WT7B 3PTZA 3SWFA 5APWA 3M0AA 3MUDC 2KLVA 2QA4P 1S9KD 1H0TA 3O8ZA 1SFCD 3CI9A 5KLVG 3L73J 3OW2O 3Q2YA 1L4AC 1JUNA 1A02F 2JWAA 2HFED 1MZ9A 3H1HD 1O7WA 5CJ4A 3CCRP 4BRYA 4NBFD 4ZKPA 1RE4C 1IC2A 3AZCA 1IFDA 2JO6A 3H1LD 4PV1B 2FYNB 2N1TC 4GIFA 1GW3A 4IOIH 1NH4A 1NU1D 2Q6QA 3L35A 3W67A 5CCGD 3AEFC 1URQB 3VMID 2ZVOB 4D6TE 3EN1A 1QX8A 2QJYB 1RE4A 2OYIC 4QUQA 1S4XA 4PD4H 5H2FE 1W2EA 1T2KD 2QJPC 4NBCD 1YIJP 1H0TB 1NTKD 1N73A 3SSUA 4Y99C 1XTCC 4XFJA 5BOKA 5B5EH 2K37A 4O9BA 1OZHA 1ZLLA 2N1TA 4HM3A 5CJ0A 1N7SC 5HL4A 1SQPD 1S1CX 4IL6X 4HM4A 3N0QA 3GCEA 4DZOA 4BRYB 3AEAC 2OYIA 3L72D 4LC1A
chains in the Genus database with same CATH topology
2QIWA 4HKVA 2E76D 2IDBA 4OGQB 3FOUA 1YQ3C 1ZOYC 2NVGA 1VCKA 1RQVA 4NBGD 2BEQD 1Q90D 4H44B 3VCAA 3IN6A 3O6QA 4QURA 1NTZE 2E75C 4Y28J 4QUPA 1MKMA 2B1XA 3GL0A 3GF7A 4R4LA 2JZAA 1NDOA 2D2CB 1TU3F 4AAYB 1R8EA 4H0LB 1YQ4C 1KQFB 2BMRA 3D6YA 4NB9D 3B71A 4NBBD 2XSHA 4H13C 3AECC 4U7JA 2WPVB 4HM7A 4NB8D 1EZVE 2NVEA 1ZMEC 5M1BA 1KILE 3RL0g 3GTEA 4OGQD 2ZYLA 1AJYA 3GZYA 4HM2A 3GTSA 4HJLA 4QCKA 2GBWA 1DD3A 4H13D 2G8YA 3GLMA 3SFEC 2HMJA 1O7GA 2HMOA 3C8VA 3AE5C 3VMGD 2BEZF 2K9YA 3IAOA 3CXHE 3AEGC 4AIVA 2BCCE 4H0LD 1G8KB 1ULIA 2BMQA 1VF5C 2NVFA 1OW8A 3ABVC 4PD4E 2JO1A 1NTME 1O7MA 1JM1A 1K04A 3GF3A 4P1CH 3D71A 3GKEA 1JB0J 3H1KE 3Q3DA 3FGAD 3Q5SA 1HF9A 1SQPE 3C0DA 4QDFA 1IK7A 2XRXA 4NBED 1SQVE 2E74D 5L8RJ 4H13B 3L72E 3L75E 1DD4A 4NBAD 1PL5A 4HM8A 2QPZA 2YVJB 2O01J 1NYKA 2H89C 1O7PA 2P10A 1PP9E 2YFJA 2XR8A 3Q5RA 5KLVE 3Q5PA 1SQXE 1FQTA 1O7HA 2E4QA 3GZXA 3AE1C 3EWKA 1OW7A 1EXJA 2YFIA 4HM1A 2WSCJ 4YTPC 4HM5A 1L0NE 2HMKA 2J5UA 3S9OA 2E75D 2YIUC 1NGMB 4H44C 1PIXA 5KLIC 1S5LX 3AEDC 1RIEA 2WSFJ 3AE7C 3D89A 3AE4C 1SQBE 3H1HE 2H88C 3AE2C 1OMIA 4TT3H 1O7NA 2DE5D 4QDFB 3CX5E 3R4YA 1KQGB 2E74B 3D6ZA 2XSOA 2YMKA 2NUKA 3H1LE 2A06E 1FDIA 2BMOA 2QJKC 4YXDC 2WQYC 1NU1E 2DE7D 4PV1C 3RK3E 3H1IE 1L0LE 2HMMA 2FYNC 1PV3A 2E76C 4I7ZC 5AEWA 2E75B 2QSIA 2HMLA 1NTKE 2Q3WA 3VMHD 2JP3A 3H25A 4EMJB 2QJYC 1Q90C 1VF5D 1RFSA 1RQUA 2YFLA 3GMAA 3CWBE 4PV1D 4NBDD 5CXMA 2FYUE 2GBXA 3VCPA 1UUVA 4HM0A 4RKUJ 1G8JB 3SFDC 1K05A 4NBHD 2ZT9C 4U3FE 1ULJA 3AE6C 2V7QJ 3EQQA 3AEEC 3L71E 2B24A 3AE9C 2FXPA 4P1BH 4HM6A 1KYOE 2FBWC 1HJ0A 4R4MA 1KMIZ 1GMJA 1PPJE 4OGQC 3Q2YA 1VL2A 1EG9A 1SJGA 1UIXA 1KB9E 3L70E 2NUMA 2NWFA 2WSEJ 1KTMA 4QDDA 2ZT9D 4GDOA 1DIPA 1O7WA 2OQQA 1FDOA 4QDCA 3TGUE 4NBFD 3AZCA 3T97B 2JO6A 2NZ2A 1VF5B 1KORA 3Q1MA 3DQYA 1WMKA 3G9RA 4PV1B 3GB4A 2IBZE 2D2CC 1U57A 3LW5J 2I7FA 1WQLA 2E76B 4I7ZB 4H0LC 1OW6A 1UUWA 2CKFA 4KT0J 3GL2A 3AEFC 4H44D 3VMID 3EN1A 2DE6D 1ZP0C 2MKVA 3D70A 4QUQA 2HMNA 5AEUA 1EXIA 4Z1MH 2QJPC 1NYHA 1VM9A 4NBCD 4XFJA 3AE8C 3H1JE 5BOKA 3AE3C 3GOBA 3L73E 2D2CD 1Y9BA 4HM3A 1ZRTE 3L74E 1SQQE 1BE3E 5HL4A 5KKZC 1P84E 1S1CX 4IL6X 2ZT9B 3N0QA 3GCEA 2E4PA 4HM4A 3AEBC 2G3AA 1BCCE 3AEAC 2E74C 3BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIE A;  2WSF J;  2QIW A;  2K9Y A;  4HM6 A;  1KYO E;  3D89 A;  3CXH E;  4HKV A;  4AIV A;  1SQB E;  2BCC E;  1G8K B;  3H1H E;  4H0L D;  1ULI A;  2E76 D;  2BMQ A;  1O7N A;  2DE5 D;  4QDF B;  4OGQ B;  2NVF A;  3FOU A;  1PPJ E;  4PD4 E;  1NTM E;  1EG9 A;  1O7M A;  1SJG A;  1VCK A;  2NVG A;  1KB9 E;  3CX5 E;  1JM1 A;  3L70 E;  2E74 B;  2NUM A;  2XSO A;  4NBG D;  2NWF A;  2NUK A;  3H1L E;  2WSE J;  4QDD A;  1Q90 D;  2ZT9 D;  4H44 B;  3VCA A;  1O7W A;  2A06 E;  4QUR A;  2BMO A;  4QDC A;  3TGU E;  4NBF D;  4P1C H;  1NTZ E;  2QJK C;  3AZC A;  4Y28 J;  4QUP A;  3GKE A;  2B1X A;  2JO6 A;  1JB0 J;  1VF5 B;  1NU1 E;  3GL0 A;  3H1K E;  2DE7 D;  2JZA A;  3DQY A;  4PV1 B;  3GB4 A;  2IBZ E;  1NDO A;  1SQP E;  2D2C B;  3C0D A;  3H1I E;  1L0L E;  4AAY B;  4QDF A;  2XRX A;  3LW5 J;  4H0L B;  2HMM A;  2FYN C;  2I7F A;  1WQL A;  2E76 B;  4I7Z B;  2BMR A;  4NB9 D;  4NBE D;  1SQV E;  5L8R J;  2E74 D;  4H13 B;  1UUW A;  2CKF A;  5AEW A;  2E75 B;  4KT0 J;  3L72 E;  2QSI A;  2XSH A;  3L75 E;  2HML A;  4NBB D;  4NBA D;  3GL2 A;  4H44 D;  3VMI D;  4HM8 A;  1NTK E;  2Q3W A;  3EN1 A;  3VMH D;  2QPZ A;  2WPV B;  4HM7 A;  2DE6 D;  4NB8 D;  4EMJ B;  2QJY C;  2YVJ B;  2O01 J;  4QUQ A;  1Q90 C;  1NYK A;  2HMN A;  1EZV E;  2NVE A;  1O7P A;  5AEU A;  2QJP C;  1PP9 E;  1VF5 D;  2YFJ A;  1RFS A;  1VM9 A;  4NBC D;  3GTE A;  2XR8 A;  2YFL A;  4OGQ D;  2ZYL A;  3CWB E;  4PV1 D;  5KLV E;  4NBD D;  3H1J E;  5BOK A;  1SQX E;  3GOB A;  3GZY A;  1FQT A;  2D2C D;  3L73 E;  4HM2 A;  3GTS A;  5CXM A;  2FYU E;  1O7H A;  2GBX A;  4HM3 A;  3VCP A;  1ZRT E;  2E4Q A;  1UUV A;  3GZX A;  4HM0 A;  4HJL A;  2YFI A;  3L74 E;  1SQQ E;  4QCK A;  1BE3 E;  4HM1 A;  2WSC J;  4HM5 A;  4RKU J;  1L0N E;  2GBW A;  5HL4 A;  1G8J B;  2HMK A;  4H13 D;  5KKZ C;  1P84 E;  2E75 D;  4IL6 X;  2ZT9 B;  3N0Q A;  3GCE A;  2E4P A;  4HM4 A;  4NBH D;  4U3F E;  1ULJ A;  3EQQ A;  2YIU C;  1BCC E;  2HMJ A;  1O7G A;  2HMO A;  3C8V A;  3L71 E;  2B24 A;  3BCC E;  3VMG D;  4P1B H;  5KLI C;  1S5L X; 
#chains in the Genus database with same CATH topology
 2IFN A;  2CK3 H;  3WUT A;  2E76 D;  3ITK A;  1FOS F;  1ZOY C;  1N7S A;  3V2R A;  2YXR B;  1OX3 A;  1AFO A;  2BEQ D;  1FAV A;  1ZR4 A;  2B87 A;  4QMA A;  1NTZ E;  3NTN A;  1PPJ D;  1K9M Q;  1OVR A;  2KIK A;  3L71 G;  1CZQ A;  1PFI A;  3GF7 A;  1N73 B;  1X8Y A;  4N6J A;  3TGU D;  5AVW B;  1TU3 F;  2N1T B;  2WPR A;  3TSI A;  1YQ4 C;  2J58 A;  1T3J A;  1NTM J;  1Q82 Q;  3EFF K;  2XSH A;  2IBZ I;  2IBZ D;  5GTI H;  2C9N Y;  3BRV B;  2OYI B;  4NB8 D;  4JPZ B;  1IJD B;  3GW6 A;  1ZME C;  5M1B A;  1ZN5 A;  1W5C E;  1YJ9 P;  4Y99 B;  2O01 H;  4HM2 A;  1ZXG A;  2V4H A;  1N7S B;  3CC7 P;  3ZDM A;  3S4R A;  1LT1 A;  3PJS K;  3H1I D;  1LTT C;  1JY2 N;  3GLM A;  2B87 B;  2W6B A;  2HMO A;  1SQX K;  4D6T G;  2P58 A;  1ZRT D;  1SQQ D;  1OXZ A;  1P84 I;  3FWL A;  2K9Y A;  1KV4 A;  2R3S A;  4H0L D;  2BMQ A;  1VF5 C;  1M1K Q;  2NVF A;  4K35 A;  1OWA A;  3CCJ P;  1L0N J;  3BRT B;  1M8O B;  3GF3 A;  1KQS O;  2PFX A;  1Q7Y Q;  2HOD A;  3TDK A;  2JR8 A;  3MP7 B;  3C9I A;  2PRR A;  1SQB J;  3V4W A;  1SQP E;  2FYU G;  1Z56 A;  3HD7 C;  2P7J A;  3E7K A;  1SQV E;  4HYT B;  1NU1 K;  3L72 E;  2K1A A;  4NBA D;  4HM8 A;  1KB9 D;  2O01 J;  1NTZ G;  1O7P A;  3II6 A;  1X22 A;  2XR8 A;  1KD1 Q;  1NTK K;  5GTH E;  3HD7 A;  1O7H A;  3KXD A;  2M0B A;  3CL3 D;  1L0L J;  4HM5 A;  1T6A A;  1KIL D;  3S9O A;  3V2Q A;  1VQ9 P;  4JBZ A;  1NGM B;  2HOD B;  3VN0 A;  1RIE A;  3QH9 A;  4OVN F;  4W80 A;  2NPS D;  3AE2 C;  1OMI A;  1O7N A;  4JYB A;  2FYU J;  3SWK A;  3CX5 E;  1GDT A;  2P67 A;  2E42 A;  2NUK A;  1QVF O;  4HKZ H;  4HB1 A;  1FDI A;  4YPC A;  1HTL C;  3TNU A;  4YXD C;  4PD4 I;  4OWF A;  4PD4 D;  1NTM D;  2QVA A;  1FOS E;  3WU2 E;  2WQY C;  4UB6 E;  1R5S A;  2DE7 D;  2WSF H;  1YYC A;  3HD7 B;  1VQN P;  5AVR B;  1LTI C;  3H1I E;  2ZXX A;  1QL1 A;  4I7Z C;  5AEW A;  1U7J A;  2E75 B;  3L70 J;  4K3A A;  4PJ0 E;  2Z5I A;  1M56 D;  5APU A;  1BGY E;  2Q3W A;  1K8A Q;  1KFN A;  3VTP C;  3LW5 H;  4GKG A;  1Q90 C;  5E79 H;  3T97 A;  3H6P A;  3CME P;  3PP5 A;  1RQU A;  1MFT A;  1NAY A;  3GMA A;  3P8C E;  3CWB E;  5CCH C;  1USD A;  4PV1 D;  2FFD C;  1DEB A;  1EQ7 A;  4HJG H;  2GBX A;  1JMM A;  4ZMD A;  1PGP A;  4HM0 A;  3M0D C;  1UII A;  1JY2 O;  1N2D C;  1G8J B;  1SQV G;  4U3F E;  1ULJ A;  2SPZ A;  2ZXE B;  2KOG A;  1MFZ A;  3TNU B;  2Q3E A;  1L0N D;  2Q7C A;  1GTW A;  1HJ0 A;  2I8D A;  5KAF E;  3PLN A;  2FFD A;  1KMI Z;  1GMJ A;  1W2B O;  2B89 A;  2RN0 A;  3KZI H;  1QL2 A;  3M0D A;  1JEK A;  1KB9 E;  3L74 J;  2NWF A;  2WSE J;  1SQB D;  2OTL P;  4GDO A;  4WVZ A;  4QDC A;  1BCC J;  3T97 B;  3A2A A;  2JKV A;  3KHU A;  1JY2 P;  4UB8 E;  3Q1M A;  2M5A A;  3GB4 A;  2A06 D;  5C39 A;  3IR9 A;  2I1J A;  2D2C C;  1U57 A;  3LW5 J;  2I7F A;  4I7Z B;  4IFM A;  1OW6 A;  2XND H;  1N86 A;  2OYH A;  2KUB A;  4EOT A;  1Q86 Q;  5B66 E;  2B88 A;  1ZP0 C;  2MKV A;  1L0L D;  3WUU A;  1P84 H;  5AVX B;  2XV5 A;  1GU4 A;  1RF0 C;  5TIS E;  1GK6 A;  2ZAE B;  5APX A;  3H1J E;  2FFD B;  3AE3 C;  2RMZ A;  2N1T D;  1G1J A;  1BE3 E;  2P2U A;  1FC2 C;  1NVO A;  2E4P A;  1J1D C;  3RL0 C;  4ZNC A;  5AW7 B;  4IFD K;  3V5B A;  2E74 C;  1BGY G;  2ZYG A;  1SVF A;  2KS1 A;  3BCC E;  4N78 D;  5B5E E;  1RF0 A;  2QIW A;  2XU6 A;  4WB4 A;  2M5A B;  3NXS A;  3JCU E;  3BAT A;  4W7Y A;  1LT9 B;  3CWB G;  1YQ3 C;  1N7S D;  1RQV A;  1X9V A;  1KYO I;  4NBG D;  2OYH B;  3LIE A;  4H44 B;  3IN6 A;  3RK3 B;  2L91 A;  4QUR A;  4U3F G;  4Y28 J;  4DT0 A;  1NTM K;  3BVH A;  3G6E P;  1M7L A;  3CLQ A;  4HH2 A;  1E79 H;  1Q81 Q;  5EFW B;  2BCC J;  1NDO A;  2D2C B;  3WUV A;  1NAF A;  1GW4 A;  4NB9 D;  1KQL A;  4B86 A;  3AEC C;  2YXQ B;  4U7J A;  3MUD A;  2WPV B;  1HUC A;  2KS1 B;  4EYY Q;  3LID A;  5KAI H;  1EZV E;  1MV8 A;  3CC4 P;  3GTE A;  4OGQ D;  3H1K J;  1YBK A;  2ZFC A;  1L4A A;  1AJY A;  1FE6 A;  4IL6 E;  2Q5U A;  2LKM A;  2K9J A;  4QCK A;  2M3B A;  2RKL A;  1IK9 A;  2IPP A;  5K5G B;  4LGD E;  3RL0 B;  3P8M C;  2H7H A;  2GUS A;  1O7G A;  3C8V A;  2H8P D;  2WSC H;  1LTB C;  4U3F J;  1VQP P;  1YTZ T;  1L0N K;  3CXH E;  3AEG C;  1G8K B;  1BCC D;  1ULI A;  5KLV J;  1FZG A;  2W90 A;  1KFM A;  3H1J G;  3ABV C;  2JO1 A;  2WIT A;  1FZF A;  1O7M A;  1NKZ B;  1JM1 A;  1LNQ A;  1BE3 G;  1IZN B;  1SQB K;  2VRS A;  2M8R A;  3GKE A;  1FBM A;  3BCC G;  3NFQ A;  1S5L H;  1L4A B;  3RK2 C;  1VQM P;  2K9J B;  1IK7 A;  1G2C A;  2XKM A;  1X79 B;  3P7K A;  2KZI A;  3L75 E;  1DD4 A;  1PL5 A;  4CPG A;  3CD6 P;  5TJH A;  2OYO A;  1LP1 A;  2NRG A;  3M06 A;  2YVJ B;  1YHQ P;  1L0L K;  1VQO P;  2LR2 A;  2WTY A;  1WRG A;  5APY A;  4ASW A;  1PP9 E;  5AVZ B;  3Q5R A;  5AW4 B;  2HLO A;  3HD7 D;  3Q5P A;  1SQX E;  3CMA P;  2C0X A;  1EXJ A;  1OW7 A;  2YFI A;  2R3C A;  4HM1 A;  2WZ7 A;  2WSC J;  4YTP C;  2M3E A;  2OTK E;  2E75 D;  1S9K E;  2BAS A;  2WWW A;  1USE A;  4BXL A;  1VQ6 P;  2KSE A;  3CCQ P;  2A45 G;  1S3J A;  5BVZ A;  1BE3 J;  2QJP B;  3VP9 A;  1LTJ C;  2FYU K;  5CCG C;  3CCS P;  1E5W A;  1H88 A;  5KLI C;  3AED C;  2KP8 A;  2W6J H;  3D89 A;  1EZV G;  3H1H E;  3MTU E;  1T2K C;  4TT3 H;  4GOF A;  2DE5 D;  2Y0E A;  1G2C B;  3JC2 2;  2IYP A;  3A3Y B;  5H2F H;  3D6Z A;  5BU5 A;  3L73 D;  3HTK A;  3H1L E;  1T3U A;  2BCC D;  4EDF A;  3V6I A;  1H8A A;  1LP1 B;  1LTJ A;  2I1K A;  5CCG A;  1P84 D;  1Y47 A;  4RO0 A;  3L71 J;  1EDL A;  1FZE A;  3RBZ A;  2KLU A;  1NU1 E;  1YI2 P;  3RK2 B;  1HGV A;  2N9Y B;  2XDJ A;  1PV3 A;  3VMY A;  2Q3I A;  4L76 A;  2E76 C;  1S72 P;  3H1K D;  2HML A;  1U7M A;  1NTK E;  1BSN A;  2JP3 A;  3H25 A;  2WVR A;  1YJN P;  3CCM P;  3EFG A;  4MN4 C;  2ZYD A;  2YFL A;  1RF1 C;  4NBD D;  1RY3 A;  3H32 A;  5CXM A;  1KYO H;  3R2P A;  1UUV A;  4WWI A;  3HTK B;  2FYZ A;  1K05 A;  1M90 Q;  3A0B E;  3NMD A;  5BU8 B;  4NBH D;  5KLV D;  1OFC X;  2ZT9 C;  2Z4E A;  3N7N A;  3EQQ A;  1LTJ B;  3TK1 A;  3L75 G;  4D6T J;  2YKQ A;  2B24 A;  3CC2 P;  2YO2 A;  3AE9 C;  5AW8 B;  1CW5 A;  4R4M A;  1PP9 G;  3VMX A;  5CHX A;  1IFI A;  1PPJ E;  1SQX G;  1FU1 A;  2YMY A;  1VQ8 P;  1SJG A;  1UIX A;  1NKN A;  1JO5 A;  2NUM A;  1DEE G;  5KJ7 C;  4QDD A;  2W8Z A;  1DIP A;  1FDO A;  3TGU E;  2Y9Y A;  1VQ7 P;  4AUW A;  2NZ2 A;  1VF5 B;  3MZW B;  1KOR A;  3L36 A;  2IBZ E;  3H32 B;  2AXC A;  3H1H G;  5DJU B;  2E76 B;  4H0L C;  3U1A A;  5KJ7 A;  2CKF A;  3GL2 A;  4H44 D;  1GL2 C;  3RK3 D;  3H1L G;  3VP8 A;  2DE6 D;  5CBO A;  2WSE H;  3D70 A;  3L75 J;  1NTZ J;  1EDI A;  1BDC A;  2HMN A;  4IFF A;  3VOP A;  1EXI A;  4Z1M H;  5APQ A;  1NYH A;  1NU1 G;  3A5T A;  3L73 E;  2D2C D;  1Y9B A;  3I56 P;  1ZRT E;  1SQQ E;  1JY3 P;  2QM7 A;  1SQX J;  1P84 E;  2ZT9 B;  5APS A;  1GL2 A;  1NOH A;  4GOD A;  3M9H A;  3V2P A;  3VMA A;  1NTK G;  2OTJ P;  2ZVN B;  1VPC A;  1M1J C;  2MJZ A;  1FZA A;  1IFP A;  3OA7 A;  2R5B A;  2AEM A;  2Q9I A;  1SQP G;  5KTB A;  3L71 D;  2IDB A;  3FOU A;  3IF4 A;  2FXM A;  2CPB A;  1URQ D;  3A0H E;  1LTS C;  1IFJ A;  2ZYA A;  3L72 G;  2FXO A;  2HYN A;  1AV1 A;  4I2L C;  3RL0 D;  3VCA A;  5GTH H;  1JOC A;  3WMM 0;  1M1J A;  4QUP A;  2IZ1 A;  5CCH A;  1WT6 A;  2AEJ A;  2AXT E;  1Y8A A;  2JZA A;  2A45 I;  1Q2N A;  2KNC A;  3RGU A;  2Z5H A;  1EC5 A;  4NPD A;  4H0L B;  2BMR A;  1PPJ G;  3EQ2 A;  3L37 A;  1ZW0 A;  4C7N A;  2FKW B;  2FY8 A;  4H13 C;  1N8R Q;  1GL2 B;  1EZV I;  1T8Z A;  3TGU G;  3CX5 H;  2E5Y A;  2NVE A;  1KIL E;  1J1E C;  3RL0 g;  2KI7 B;  4D6T D;  5AVT B;  1NWQ A;  1A02 J;  1L4A D;  3B5N C;  1FDM A;  1SQP J;  5CBN A;  2IBZ G;  3WU2 H;  2IFM A;  1DD3 A;  2WMM A;  4UB6 H;  1SQV J;  3B8E B;  2WPS A;  3L72 J;  2POH A;  5KLV K;  1M1J B;  3AE5 C;  3VMG D;  1LWU C;  2BEZ F;  3IAO A;  4PJ0 H;  1DH3 A;  1AVY A;  2QEX P;  3B5N A;  2KNC B;  1AQ5 A;  3H1I G;  4PD4 E;  1NTM E;  2GA1 A;  3GHG C;  4I1L A;  3B4S A;  2WPQ A;  1OIP A;  1JTH A;  4C7N B;  2FYU D;  1SQQ G;  3I5C A;  1PGQ A;  4XE5 B;  2UWJ E;  4EIJ A;  3KYQ A;  1SP4 A;  1LWU A;  3D71 A;  2O01 N;  2XNX A;  2IX7 C;  3VMZ A;  3Q5S A;  1HF9 A;  1NTZ D;  1KYO D;  4QDF A;  4N3Y B;  4WY4 C;  2R32 A;  3GHG A;  3HE5 A;  3MGN A;  4H13 B;  5KAF H;  2CPS A;  2QG4 A;  3L70 D;  3E1I A;  2QE7 H;  2LXB A;  1NYK A;  1YIT P;  2H89 C;  4L75 A;  1KB9 H;  1JCC A;  3TF5 A;  1FJK A;  4RJT A;  2PAJ A;  1LTA C;  3B5N B;  2O1K A;  3PHL A;  3RK2 D;  1QVG O;  3I55 P;  4WY4 A;  3H1I J;  3EWK A;  1JTH B;  1L0N E;  2J5U A;  4UB8 H;  3A7O A;  5AW6 B;  1SLQ A;  1SQQ J;  1BGY J;  4C7R A;  2O1J A;  1YTZ I;  4XA4 A;  1LWU B;  1PIX A;  1S5L X;  3AE7 C;  2V7Q H;  1SQB E;  2KB7 P;  5B66 H;  5GTI E;  3CWB J;  4NPE A;  1HBW A;  4QDF B;  2KSJ A;  4EI2 A;  3M91 A;  3GHG B;  1S2E A;  3HE5 B;  1J1D B;  1N73 C;  3R4Y A;  4OH8 B;  2W83 C;  2E74 B;  4A7P A;  5TIS H;  4JQ0 D;  3G4S P;  1OVV A;  1R5L A;  3L74 D;  2A06 E;  2QJK C;  1CI6 A;  3K5B A;  3U59 A;  3GG2 A;  1IFM A;  1J2J B;  5AW0 B;  3F5H A;  3JSV C;  1L0L E;  4WY4 B;  3V4Q A;  2HMM A;  2ITA A;  2OGU A;  1BDD A;  1SS1 A;  1XTG B;  1NTM G;  3L4F A;  3VMH D;  3JCU H;  3VYI A;  4EMJ B;  3IFM A;  1QLE D;  5AW3 B;  1JY3 N;  1SQV D;  1N7L A;  1VF5 D;  3FWN A;  1RFS A;  3W68 A;  2YKP A;  1VQK P;  5AW5 B;  1SFC C;  2FYU E;  4KHX A;  3M9B A;  1H89 A;  1QEX A;  4N78 E;  2O3J A;  1GU5 A;  2V7Q J;  2FXP A;  1CI6 B;  4P1B H;  2KK7 A;  2A45 H;  4HM6 A;  1KYO E;  2FBW C;  2N9B A;  2JJL A;  1G1I A;  1SFC A;  3H1J J;  1VQL P;  2PP6 A;  4OGQ C;  2WSS H;  1VL2 A;  1EG9 A;  2IYO A;  3L70 E;  2JWD A;  5AW1 B;  1KTM A;  2K3R A;  2ZT9 D;  1BSH A;  1L0N G;  2OQQ A;  1ZV8 A;  2QJK B;  4IL6 H;  4NPF X;  4W7Z A;  1DX7 A;  1GD2 E;  1GK4 A;  3HUS C;  3CX5 I;  3MHV A;  3BCC J;  3CX5 D;  3CCE P;  3OJA B;  2RH0 A;  2L5G B;  2JDI H;  5AVQ B;  3UIA A;  4ASV A;  3KQG A;  1WMK A;  3G9R A;  3DQY A;  1HVV A;  3MD0 A;  1SQB G;  2H43 A;  1NTZ K;  5DJT B;  1WQL A;  5KJ7 D;  1M57 D;  1UUW A;  4KT0 J;  3CXH H;  2YO3 A;  4C46 A;  2DW3 A;  2W27 A;  1AQT A;  3HUS A;  2A06 G;  5AEU A;  1JMB A;  1VM9 A;  1BGY D;  2QRX A;  1IFN A;  3AE8 C;  1SFC B;  3GOB A;  1PGO A;  3L74 E;  1KN7 A;  2Y0C A;  1L0L G;  4I6M C;  1KZU B;  5KKZ C;  1VQ5 P;  3P8C D;  1GL2 D;  3CWB D;  3AEB C;  3HE4 A;  2IZ0 A;  2G3A A;  1BCC E;  2YKO A;  2C9L Y;  1LGH B;  1HH0 A;  4HKV A;  4U3F D;  4JF7 A;  4OGQ B;  1PGJ A;  4RES B;  3CCV P;  2PGD A;  1X0T A;  5E79 E;  2NVG A;  2YNY A;  1KC8 Q;  1VCK A;  1RHZ B;  1Q90 D;  2K88 A;  5KLI B;  3O6Q A;  4M3L A;  3TYY A;  1GZL A;  1FS0 E;  3HUS B;  2E75 C;  1YJW P;  3C1L A;  1MKM A;  1RF1 A;  5CCH D;  1KB9 I;  2B1X A;  2GUV A;  2E43 A;  3MIW A;  3GL0 A;  2B9B A;  3KDP B;  4DCK A;  4R4L A;  3M9Q A;  2Y9Z A;  1HWT C;  4AAY B;  1R8E A;  1OVU A;  2R5D A;  1KQF B;  3CCL P;  3D6Y A;  2XZR A;  3B71 A;  4NBB D;  3HE4 B;  3L70 G;  3OAK A;  3QWO C;  4HM7 A;  1JY3 O;  1SQP K;  5AVS B;  2LXC B;  3KZI E;  2KYV A;  3CCU P;  1SQV K;  2OAR A;  1CSB A;  2ZYL A;  1D7M A;  3G71 P;  2E5T A;  3FXD A;  3USS A;  3GZY A;  3GTS A;  5AVV B;  4HJL A;  1VDF A;  5KKZ B;  2GBW A;  4H13 D;  1HGZ A;  2G8Y A;  3O6Q B;  3H1J D;  2AEF A;  3SFE C;  2HMJ A;  1AA0 A;  1RF1 B;  1JCD A;  1BE3 D;  1AVO A;  1PP9 J;  3B5N D;  4AIV A;  2BCC E;  2HPC A;  4AYC A;  1FZC C;  3F89 A;  3BCC D;  1OW8 A;  1RE3 C;  1K04 A;  3L74 G;  4LLH A;  1L2P A;  3CPW O;  5AVY B;  1JNM A;  4P1C H;  1BCC G;  2P1J A;  1JB0 J;  1VQ4 P;  3H1K E;  3A0B H;  2C0W A;  4YXW H;  3Q3D A;  3FGA D;  1FZC A;  3H1H J;  3C0D A;  5AW2 B;  2XRX A;  2GM4 A;  1RE3 A;  5AVU B;  1NJI Q;  1HJB A;  4NBE D;  2E74 D;  5L8R J;  1EDJ A;  3KPE A;  1KIL C;  4L74 A;  3H1L J;  2QPZ A;  2KZJ A;  4AQR D;  3SWY A;  3U1C A;  4WBA A;  2ZJS E;  2P10 A;  1LJ2 A;  4BWN A;  2YFJ A;  1EDK A;  1NU1 J;  3G3Z A;  1SQQ K;  3RBX A;  5KLV E;  2HPC B;  3FX0 A;  2W6A A;  1FQT A;  2NPS C;  4WY4 D;  2R44 A;  2E4Q A;  3GZX A;  4ZKU A;  3AE1 C;  2J59 M;  1EZV D;  2HMK A;  1K73 Q;  1KIL A;  1LT9 C;  3HRN A;  1ZR2 A;  3BAS A;  2YIU C;  4GT1 A;  1NTK J;  2OYH C;  4DJG A;  4H44 C;  2WSF J;  3RK3 C;  3S1K A;  3P32 A;  3AE4 C;  1FZB A;  1FZC B;  2H88 C;  2NPS A;  3PH0 A;  5AW9 B;  4L73 A;  5KAI E;  1NHL A;  3PRJ A;  1KQG B;  1LT9 A;  1FJP A;  2XSO A;  2YMK A;  3CXH I;  3CXH D;  2BMO A;  2Y0D A;  4JYC A;  2HR3 A;  3E1R A;  4TLF A;  4DOJ A;  2WT7 A;  2Q1K A;  3N4X A;  3V2N A;  3L73 G;  4PV1 C;  3RK3 E;  4KJM A;  2BCC G;  2FYN C;  3FXE A;  1MUU A;  1IO4 A;  1KIL B;  1PZQ A;  2QSI A;  5APV A;  1LTG C;  1URQ C;  3TGU J;  2QJY C;  5CMZ A;  3A0H H;  2HG5 D;  1JM0 A;  5APT A;  3L75 D;  1QGK B;  1NO4 A;  3H1K G;  2NPS B;  2KXP B;  3VCP A;  1RH5 B;  2JEE A;  4RKU J;  1PP9 D;  3SFD C;  2AXT H;  1S5L E;  2QM8 A;  2YIU B;  1URQ A;  3AE6 C;  4GOE A;  1SQX D;  3AEE C;  1J1E B;  3L71 E;  2WT7 B;  3PTZ A;  3SWF A;  5APW A;  3M0A A;  3MUD C;  2KLV A;  2QA4 P;  1S9K D;  1H0T A;  3O8Z A;  1SFC D;  3CI9 A;  5KLV G;  3L73 J;  3OW2 O;  3Q2Y A;  1L4A C;  1JUN A;  1A02 F;  2JWA A;  2HFE D;  1MZ9 A;  3H1H D;  1O7W A;  5CJ4 A;  3CCR P;  4BRY A;  4NBF D;  4ZKP A;  1RE4 C;  1IC2 A;  3AZC A;  1IFD A;  2JO6 A;  3H1L D;  4PV1 B;  2FYN B;  2N1T C;  4GIF A;  1GW3 A;  4IOI H;  1NH4 A;  1NU1 D;  2Q6Q A;  3L35 A;  3W67 A;  5CCG D;  3AEF C;  1URQ B;  3VMI D;  2ZVO B;  4D6T E;  3EN1 A;  1QX8 A;  2QJY B;  1RE4 A;  2OYI C;  4QUQ A;  1S4X A;  4PD4 H;  5H2F E;  1W2E A;  1T2K D;  2QJP C;  4NBC D;  1YIJ P;  1H0T B;  1NTK D;  1N73 A;  3SSU A;  4Y99 C;  1XTC C;  4XFJ A;  5BOK A;  5B5E H;  2K37 A;  4O9B A;  1OZH A;  1ZLL A;  2N1T A;  4HM3 A;  5CJ0 A;  1N7S C;  5HL4 A;  1SQP D;  1S1C X;  4IL6 X;  4HM4 A;  3N0Q A;  3GCE A;  4DZO A;  4BRY B;  3AEA C;  2OYI A;  3L72 D;  4LC1 A; 
#chains in the Genus database with same CATH homology
 2QIW A;  4HKV A;  2E76 D;  2IDB A;  4OGQ B;  3FOU A;  1YQ3 C;  1ZOY C;  2NVG A;  1VCK A;  1RQV A;  4NBG D;  2BEQ D;  1Q90 D;  4H44 B;  3VCA A;  3IN6 A;  3O6Q A;  4QUR A;  1NTZ E;  2E75 C;  4Y28 J;  4QUP A;  1MKM A;  2B1X A;  3GL0 A;  3GF7 A;  4R4L A;  2JZA A;  1NDO A;  2D2C B;  1TU3 F;  4AAY B;  1R8E A;  4H0L B;  1YQ4 C;  1KQF B;  2BMR A;  3D6Y A;  4NB9 D;  3B71 A;  4NBB D;  2XSH A;  4H13 C;  3AEC C;  4U7J A;  2WPV B;  4HM7 A;  4NB8 D;  1EZV E;  2NVE A;  1ZME C;  5M1B A;  1KIL E;  3RL0 g;  3GTE A;  4OGQ D;  2ZYL A;  1AJY A;  3GZY A;  4HM2 A;  3GTS A;  4HJL A;  4QCK A;  2GBW A;  1DD3 A;  4H13 D;  2G8Y A;  3GLM A;  3SFE C;  2HMJ A;  1O7G A;  2HMO A;  3C8V A;  3AE5 C;  3VMG D;  2BEZ F;  2K9Y A;  3IAO A;  3CXH E;  3AEG C;  4AIV A;  2BCC E;  4H0L D;  1G8K B;  1ULI A;  2BMQ A;  1VF5 C;  2NVF A;  1OW8 A;  3ABV C;  4PD4 E;  2JO1 A;  1NTM E;  1O7M A;  1JM1 A;  1K04 A;  3GF3 A;  4P1C H;  3D71 A;  3GKE A;  1JB0 J;  3H1K E;  3Q3D A;  3FGA D;  3Q5S A;  1HF9 A;  1SQP E;  3C0D A;  4QDF A;  1IK7 A;  2XRX A;  4NBE D;  1SQV E;  2E74 D;  5L8R J;  4H13 B;  3L72 E;  3L75 E;  1DD4 A;  4NBA D;  1PL5 A;  4HM8 A;  2QPZ A;  2YVJ B;  2O01 J;  1NYK A;  2H89 C;  1O7P A;  2P10 A;  1PP9 E;  2YFJ A;  2XR8 A;  3Q5R A;  5KLV E;  3Q5P A;  1SQX E;  1FQT A;  1O7H A;  2E4Q A;  3GZX A;  3AE1 C;  3EWK A;  1OW7 A;  1EXJ A;  2YFI A;  4HM1 A;  2WSC J;  4YTP C;  4HM5 A;  1L0N E;  2HMK A;  2J5U A;  3S9O A;  2E75 D;  2YIU C;  1NGM B;  4H44 C;  1PIX A;  5KLI C;  1S5L X;  3AED C;  1RIE A;  2WSF J;  3AE7 C;  3D89 A;  3AE4 C;  1SQB E;  3H1H E;  2H88 C;  3AE2 C;  1OMI A;  4TT3 H;  1O7N A;  2DE5 D;  4QDF B;  3CX5 E;  3R4Y A;  1KQG B;  2E74 B;  3D6Z A;  2XSO A;  2YMK A;  2NUK A;  3H1L E;  2A06 E;  1FDI A;  2BMO A;  2QJK C;  4YXD C;  2WQY C;  1NU1 E;  2DE7 D;  4PV1 C;  3RK3 E;  3H1I E;  1L0L E;  2HMM A;  2FYN C;  1PV3 A;  2E76 C;  4I7Z C;  5AEW A;  2E75 B;  2QSI A;  2HML A;  1NTK E;  2Q3W A;  3VMH D;  2JP3 A;  3H25 A;  4EMJ B;  2QJY C;  1Q90 C;  1VF5 D;  1RFS A;  1RQU A;  2YFL A;  3GMA A;  3CWB E;  4PV1 D;  4NBD D;  5CXM A;  2FYU E;  2GBX A;  3VCP A;  1UUV A;  4HM0 A;  4RKU J;  1G8J B;  3SFD C;  1K05 A;  4NBH D;  2ZT9 C;  4U3F E;  1ULJ A;  3AE6 C;  2V7Q J;  3EQQ A;  3AEE C;  3L71 E;  2B24 A;  3AE9 C;  2FXP A;  4P1B H;  4HM6 A;  1KYO E;  2FBW C;  1HJ0 A;  4R4M A;  1KMI Z;  1GMJ A;  1PPJ E;  4OGQ C;  3Q2Y A;  1VL2 A;  1EG9 A;  1SJG A;  1UIX A;  1KB9 E;  3L70 E;  2NUM A;  2NWF A;  2WSE J;  1KTM A;  4QDD A;  2ZT9 D;  4GDO A;  1DIP A;  1O7W A;  2OQQ A;  1FDO A;  4QDC A;  3TGU E;  4NBF D;  3AZC A;  3T97 B;  2JO6 A;  2NZ2 A;  1VF5 B;  1KOR A;  3Q1M A;  3DQY A;  1WMK A;  3G9R A;  4PV1 B;  3GB4 A;  2IBZ E;  2D2C C;  1U57 A;  3LW5 J;  2I7F A;  1WQL A;  2E76 B;  4I7Z B;  4H0L C;  1OW6 A;  1UUW A;  2CKF A;  4KT0 J;  3GL2 A;  3AEF C;  4H44 D;  3VMI D;  3EN1 A;  2DE6 D;  1ZP0 C;  2MKV A;  3D70 A;  4QUQ A;  2HMN A;  5AEU A;  1EXI A;  4Z1M H;  2QJP C;  1NYH A;  1VM9 A;  4NBC D;  4XFJ A;  3AE8 C;  3H1J E;  5BOK A;  3AE3 C;  3GOB A;  3L73 E;  2D2C D;  1Y9B A;  4HM3 A;  1ZRT E;  3L74 E;  1SQQ E;  1BE3 E;  5HL4 A;  5KKZ C;  1P84 E;  1S1C X;  4IL6 X;  2ZT9 B;  3N0Q A;  3GCE A;  2E4P A;  4HM4 A;  3AEB C;  2G3A A;  1BCC E;  3AEA C;  2E74 C;  3BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...