4P1CH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SFEKISSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 25
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1cH00
1EZVE 3L72E 2QJKC 4H44D 2I7FA 2QJPC 1FQTA 3GCEA 3GKEA 4NBAD 1KYOE 1SQPE 2ZT9D 5HL4A 2FYNC 4NB9D 1L0NE 4P1BH 2NVFA 1SQXE 2YFJA 2XRXA 3GZXA 2HMMA 3H1KE 4P1CH 2BMOA 2XSHA 1SQVE 2YFLA 5AEUA 4EMJB 2IBZE 3VMID 1NU1E 4HM2A 2B24A 1O7GA 5CXMA 2E76D 4H0LD 4NBFD 1Q90C 1NTME 1G8KB 3BCCE 3L70E 2HMKA 4HM5A 2YIUC 2BMQA 1O7NA 4QUQA 3GL0A 3L74E 1BCCE 4HM4A 4AIVA 4HM3A 1PP9E 4NBED 3N0QA 2XSOA 1VCKA 2YFIA 2NWFA 2ZYLA 3AZCA 2CKFA 3TGUE 5KLIC 4AAYB 1UUWA 2HMLA 4QDDA 3L73E 3VMHD 2Q3WA 2JO6A 4HKVA 2HMOA 2A06E 1SQBE 2D2CD 2QPZA 1JM1A 1PPJE 2XR8A 2NVGA 1RIEA 4QCKA 2E4PA 3EN1A 2FYUE 1G8JB 3GOBA 1SJGA 3GB4A 4NBCD 4QDFA 4NBBD 4NBGD 3GTEA 1KB9E 1RFSA 3FOUA 3H1IE 3VCAA 2GBWA 3L75E 1NTZE 2E75D 1O7WA 3GZYA 3C0DA 1UUVA 1NYKA 1P84E 3DQYA 4NB8D 2NUMA 3D89A 1VM9A 3L71E 4HM6A 2JZAA 4H13D 2HMJA 4U3FE 2DE5D 4HM7A 1O7MA 3GTSA 2YVJB 3H1LE 4QUPA 2BCCE 3VMGD 5BOKA 1BE3E 4QURA 4HM0A 1O7HA 4NBHD 1NTKE 3H1JE 2DE7D 3GL2A 1WQLA 4HM8A 4HJLA 4OGQD 1VF5D 4NBDD 4HM1A 1ULIA 1O7PA 5AEWA 2BMRA 1NDOA 2QJYC 3CX5E 2NVEA 1ULJA 4PD4E 3VCPA 4QDFB 2E4QA 1ZRTE 2HMNA 1EG9A 1L0LE 3EQQA 4PV1D 3H1HE 3CXHE 4QDCA 5KKZC 2DE6D 1SQQE 2E74D 2NUKA 2B1XA 2GBXA 3CWBE 5KLVE
chains in the Genus database with same CATH superfamily
1EZVE 3L72E 2QJKC 4H44D 2I7FA 2QJPC 1FQTA 3GCEA 3GKEA 4NBAD 1KYOE 1SQPE 2ZT9D 5HL4A 2FYNC 4NB9D 1L0NE 4P1BH 2NVFA 1SQXE 2YFJA 2XRXA 3GZXA 2HMMA 3H1KE 4P1CH 2BMOA 2XSHA 1SQVE 2YFLA 5AEUA 4EMJB 2IBZE 3VMID 1NU1E 4HM2A 2B24A 1O7GA 5CXMA 2E76D 4H0LD 4NBFD 1Q90C 1NTME 1G8KB 3BCCE 3L70E 2HMKA 4HM5A 2YIUC 2BMQA 1O7NA 4QUQA 3GL0A 3L74E 1BCCE 4HM4A 4AIVA 4HM3A 1PP9E 4NBED 3N0QA 2XSOA 1VCKA 2YFIA 2NWFA 2ZYLA 3AZCA 2CKFA 3TGUE 5KLIC 4AAYB 1UUWA 2HMLA 4QDDA 3L73E 3VMHD 2Q3WA 2JO6A 4HKVA 2HMOA 2A06E 1SQBE 2D2CD 2QPZA 1JM1A 1PPJE 2XR8A 2NVGA 1RIEA 4QCKA 2E4PA 3EN1A 2FYUE 1G8JB 3GOBA 1SJGA 3GB4A 4NBCD 4QDFA 4NBBD 4NBGD 3GTEA 1KB9E 1RFSA 3FOUA 3H1IE 3VCAA 2GBWA 3L75E 1NTZE 2E75D 1O7WA 3GZYA 3C0DA 1UUVA 1NYKA 1P84E 3DQYA 4NB8D 2NUMA 3D89A 1VM9A 3L71E 4HM6A 2JZAA 4H13D 2HMJA 4U3FE 2DE5D 4HM7A 1O7MA 3GTSA 2YVJB 3H1LE 4QUPA 2BCCE 3VMGD 5BOKA 1BE3E 4QURA 4HM0A 1O7HA 4NBHD 1NTKE 3H1JE 2DE7D 3GL2A 1WQLA 4HM8A 4HJLA 4OGQD 1VF5D 4NBDD 4HM1A 1ULIA 1O7PA 5AEWA 2BMRA 1NDOA 2QJYC 3CX5E 2NVEA 1ULJA 4PD4E 3VCPA 4QDFB 2E4QA 1ZRTE 2HMNA 1EG9A 1L0LE 3EQQA 4PV1D 3H1HE 3CXHE 4QDCA 5KKZC 2DE6D 1SQQE 2E74D 2NUKA 2B1XA 2GBXA 3CWBE 5KLVE
chains in the Genus database with same CATH topology
1EZVE 3L72E 2QJKC 4H44D 2I7FA 2QJPC 1FQTA 3GCEA 3GKEA 4NBAD 1KYOE 1SQPE 2ZT9D 5HL4A 2FYNC 4NB9D 1L0NE 4P1BH 2NVFA 1SQXE 2YFJA 2XRXA 3GZXA 2HMMA 3H1KE 4P1CH 2BMOA 2XSHA 1SQVE 2YFLA 5AEUA 4EMJB 2IBZE 3VMID 1NU1E 4HM2A 2B24A 1O7GA 5CXMA 2E76D 4H0LD 4NBFD 1Q90C 1NTME 1G8KB 3BCCE 3L70E 2HMKA 4HM5A 2YIUC 2BMQA 1O7NA 4QUQA 3GL0A 3L74E 1BCCE 4HM4A 4AIVA 4HM3A 1PP9E 4NBED 3N0QA 2XSOA 1VCKA 2YFIA 2NWFA 2ZYLA 3AZCA 2CKFA 3TGUE 5KLIC 4AAYB 1UUWA 2HMLA 4QDDA 3L73E 3VMHD 2Q3WA 2JO6A 4HKVA 2HMOA 2A06E 1SQBE 2D2CD 2QPZA 1JM1A 1PPJE 2XR8A 2NVGA 1RIEA 4QCKA 2E4PA 3EN1A 2FYUE 1G8JB 3GOBA 1SJGA 3GB4A 4NBCD 4QDFA 4NBBD 4NBGD 3GTEA 1KB9E 1RFSA 3FOUA 3H1IE 3VCAA 2GBWA 3L75E 1NTZE 2E75D 1O7WA 3GZYA 3C0DA 1UUVA 1NYKA 1P84E 3DQYA 4NB8D 2NUMA 3D89A 1VM9A 3L71E 4HM6A 2JZAA 4H13D 2HMJA 4U3FE 2DE5D 4HM7A 1O7MA 3GTSA 2YVJB 3H1LE 4QUPA 2BCCE 3VMGD 5BOKA 1BE3E 4QURA 4HM0A 1O7HA 4NBHD 1NTKE 3H1JE 2DE7D 3GL2A 1WQLA 4HM8A 4HJLA 4OGQD 1VF5D 4NBDD 4HM1A 1ULIA 1O7PA 5AEWA 2BMRA 1NDOA 2QJYC 3CX5E 2NVEA 1ULJA 4PD4E 3VCPA 4QDFB 2E4QA 1ZRTE 2HMNA 1EG9A 1L0LE 3EQQA 4PV1D 3H1HE 3CXHE 4QDCA 5KKZC 2DE6D 1SQQE 2E74D 2NUKA 2B1XA 2GBXA 3CWBE 5KLVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV E;  3L72 E;  2QJK C;  4H44 D;  2I7F A;  2QJP C;  1FQT A;  3GCE A;  3GKE A;  4NBA D;  1KYO E;  1SQP E;  2ZT9 D;  5HL4 A;  2FYN C;  4NB9 D;  1L0N E;  4P1B H;  2NVF A;  1SQX E;  2YFJ A;  2XRX A;  3GZX A;  2HMM A;  3H1K E;  4P1C H;  2BMO A;  2XSH A;  1SQV E;  2YFL A;  5AEU A;  4EMJ B;  2IBZ E;  3VMI D;  1NU1 E;  4HM2 A;  2B24 A;  1O7G A;  5CXM A;  2E76 D;  4H0L D;  4NBF D;  1Q90 C;  1NTM E;  1G8K B;  3BCC E;  3L70 E;  2HMK A;  4HM5 A;  2YIU C;  2BMQ A;  1O7N A;  4QUQ A;  3GL0 A;  3L74 E;  1BCC E;  4HM4 A;  4AIV A;  4HM3 A;  1PP9 E;  4NBE D;  3N0Q A;  2XSO A;  1VCK A;  2YFI A;  2NWF A;  2ZYL A;  3AZC A;  2CKF A;  3TGU E;  5KLI C;  4AAY B;  1UUW A;  2HML A;  4QDD A;  3L73 E;  3VMH D;  2Q3W A;  2JO6 A;  4HKV A;  2HMO A;  2A06 E;  1SQB E;  2D2C D;  2QPZ A;  1JM1 A;  1PPJ E;  2XR8 A;  2NVG A;  1RIE A;  4QCK A;  2E4P A;  3EN1 A;  2FYU E;  1G8J B;  3GOB A;  1SJG A;  3GB4 A;  4NBC D;  4QDF A;  4NBB D;  4NBG D;  3GTE A;  1KB9 E;  1RFS A;  3FOU A;  3H1I E;  3VCA A;  2GBW A;  3L75 E;  1NTZ E;  2E75 D;  1O7W A;  3GZY A;  3C0D A;  1UUV A;  1NYK A;  1P84 E;  3DQY A;  4NB8 D;  2NUM A;  3D89 A;  1VM9 A;  3L71 E;  4HM6 A;  2JZA A;  4H13 D;  2HMJ A;  4U3F E;  2DE5 D;  4HM7 A;  1O7M A;  3GTS A;  2YVJ B;  3H1L E;  4QUP A;  2BCC E;  3VMG D;  5BOK A;  1BE3 E;  4QUR A;  4HM0 A;  1O7H A;  4NBH D;  1NTK E;  3H1J E;  2DE7 D;  3GL2 A;  1WQL A;  4HM8 A;  4HJL A;  4OGQ D;  1VF5 D;  4NBD D;  4HM1 A;  1ULI A;  1O7P A;  5AEW A;  2BMR A;  1NDO A;  2QJY C;  3CX5 E;  2NVE A;  1ULJ A;  4PD4 E;  3VCP A;  4QDF B;  2E4Q A;  1ZRT E;  2HMN A;  1EG9 A;  1L0L E;  3EQQ A;  4PV1 D;  3H1H E;  3CXH E;  4QDC A;  5KKZ C;  2DE6 D;  1SQQ E;  2E74 D;  2NUK A;  2B1X A;  2GBX A;  3CWB E;  5KLV E; 
#chains in the Genus database with same CATH topology
 1EZV E;  3L72 E;  2QJK C;  4H44 D;  2I7F A;  2QJP C;  1FQT A;  3GCE A;  3GKE A;  4NBA D;  1KYO E;  1SQP E;  2ZT9 D;  5HL4 A;  2FYN C;  4NB9 D;  1L0N E;  4P1B H;  2NVF A;  1SQX E;  2YFJ A;  2XRX A;  3GZX A;  2HMM A;  3H1K E;  4P1C H;  2BMO A;  2XSH A;  1SQV E;  2YFL A;  5AEU A;  4EMJ B;  2IBZ E;  3VMI D;  1NU1 E;  4HM2 A;  2B24 A;  1O7G A;  5CXM A;  2E76 D;  4H0L D;  4NBF D;  1Q90 C;  1NTM E;  1G8K B;  3BCC E;  3L70 E;  2HMK A;  4HM5 A;  2YIU C;  2BMQ A;  1O7N A;  4QUQ A;  3GL0 A;  3L74 E;  1BCC E;  4HM4 A;  4AIV A;  4HM3 A;  1PP9 E;  4NBE D;  3N0Q A;  2XSO A;  1VCK A;  2YFI A;  2NWF A;  2ZYL A;  3AZC A;  2CKF A;  3TGU E;  5KLI C;  4AAY B;  1UUW A;  2HML A;  4QDD A;  3L73 E;  3VMH D;  2Q3W A;  2JO6 A;  4HKV A;  2HMO A;  2A06 E;  1SQB E;  2D2C D;  2QPZ A;  1JM1 A;  1PPJ E;  2XR8 A;  2NVG A;  1RIE A;  4QCK A;  2E4P A;  3EN1 A;  2FYU E;  1G8J B;  3GOB A;  1SJG A;  3GB4 A;  4NBC D;  4QDF A;  4NBB D;  4NBG D;  3GTE A;  1KB9 E;  1RFS A;  3FOU A;  3H1I E;  3VCA A;  2GBW A;  3L75 E;  1NTZ E;  2E75 D;  1O7W A;  3GZY A;  3C0D A;  1UUV A;  1NYK A;  1P84 E;  3DQY A;  4NB8 D;  2NUM A;  3D89 A;  1VM9 A;  3L71 E;  4HM6 A;  2JZA A;  4H13 D;  2HMJ A;  4U3F E;  2DE5 D;  4HM7 A;  1O7M A;  3GTS A;  2YVJ B;  3H1L E;  4QUP A;  2BCC E;  3VMG D;  5BOK A;  1BE3 E;  4QUR A;  4HM0 A;  1O7H A;  4NBH D;  1NTK E;  3H1J E;  2DE7 D;  3GL2 A;  1WQL A;  4HM8 A;  4HJL A;  4OGQ D;  1VF5 D;  4NBD D;  4HM1 A;  1ULI A;  1O7P A;  5AEW A;  2BMR A;  1NDO A;  2QJY C;  3CX5 E;  2NVE A;  1ULJ A;  4PD4 E;  3VCP A;  4QDF B;  2E4Q A;  1ZRT E;  2HMN A;  1EG9 A;  1L0L E;  3EQQ A;  4PV1 D;  3H1H E;  3CXH E;  4QDC A;  5KKZ C;  2DE6 D;  1SQQ E;  2E74 D;  2NUK A;  2B1X A;  2GBX A;  3CWB E;  5KLV E; 
#chains in the Genus database with same CATH homology
 1EZV E;  3L72 E;  2QJK C;  4H44 D;  2I7F A;  2QJP C;  1FQT A;  3GCE A;  3GKE A;  4NBA D;  1KYO E;  1SQP E;  2ZT9 D;  5HL4 A;  2FYN C;  4NB9 D;  1L0N E;  4P1B H;  2NVF A;  1SQX E;  2YFJ A;  2XRX A;  3GZX A;  2HMM A;  3H1K E;  4P1C H;  2BMO A;  2XSH A;  1SQV E;  2YFL A;  5AEU A;  4EMJ B;  2IBZ E;  3VMI D;  1NU1 E;  4HM2 A;  2B24 A;  1O7G A;  5CXM A;  2E76 D;  4H0L D;  4NBF D;  1Q90 C;  1NTM E;  1G8K B;  3BCC E;  3L70 E;  2HMK A;  4HM5 A;  2YIU C;  2BMQ A;  1O7N A;  4QUQ A;  3GL0 A;  3L74 E;  1BCC E;  4HM4 A;  4AIV A;  4HM3 A;  1PP9 E;  4NBE D;  3N0Q A;  2XSO A;  1VCK A;  2YFI A;  2NWF A;  2ZYL A;  3AZC A;  2CKF A;  3TGU E;  5KLI C;  4AAY B;  1UUW A;  2HML A;  4QDD A;  3L73 E;  3VMH D;  2Q3W A;  2JO6 A;  4HKV A;  2HMO A;  2A06 E;  1SQB E;  2D2C D;  2QPZ A;  1JM1 A;  1PPJ E;  2XR8 A;  2NVG A;  1RIE A;  4QCK A;  2E4P A;  3EN1 A;  2FYU E;  1G8J B;  3GOB A;  1SJG A;  3GB4 A;  4NBC D;  4QDF A;  4NBB D;  4NBG D;  3GTE A;  1KB9 E;  1RFS A;  3FOU A;  3H1I E;  3VCA A;  2GBW A;  3L75 E;  1NTZ E;  2E75 D;  1O7W A;  3GZY A;  3C0D A;  1UUV A;  1NYK A;  1P84 E;  3DQY A;  4NB8 D;  2NUM A;  3D89 A;  1VM9 A;  3L71 E;  4HM6 A;  2JZA A;  4H13 D;  2HMJ A;  4U3F E;  2DE5 D;  4HM7 A;  1O7M A;  3GTS A;  2YVJ B;  3H1L E;  4QUP A;  2BCC E;  3VMG D;  5BOK A;  1BE3 E;  4QUR A;  4HM0 A;  1O7H A;  4NBH D;  1NTK E;  3H1J E;  2DE7 D;  3GL2 A;  1WQL A;  4HM8 A;  4HJL A;  4OGQ D;  1VF5 D;  4NBD D;  4HM1 A;  1ULI A;  1O7P A;  5AEW A;  2BMR A;  1NDO A;  2QJY C;  3CX5 E;  2NVE A;  1ULJ A;  4PD4 E;  3VCP A;  4QDF B;  2E4Q A;  1ZRT E;  2HMN A;  1EG9 A;  1L0L E;  3EQQ A;  4PV1 D;  3H1H E;  3CXH E;  4QDC A;  5KKZ C;  2DE6 D;  1SQQ E;  2E74 D;  2NUK A;  2B1X A;  2GBX A;  3CWB E;  5KLV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...