4P1CH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
b'SFEKISSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1cH00
1L0NE 2E76D 2NUKA 2BCCE 3C0DA 2YIUC 1O7PA 1O7WA 1ULJA 2BMRA 5KLVE 2DE6D 3FOUA 1VM9A 2GBXA 2QJKC 1ULIA 3AZCA 2B1XA 2B24A 2XRXA 1L0LE 2QJPC 3GL0A 2JO6A 1O7HA 3L74E 1NTKE 2E4PA 3CX5E 3H1KE 4H13D 1NYKA 3EN1A 5AEWA 3VCPA 1UUWA 3GZXA 4NBGD 4QDCA 2BMQA 1Q90C 2CKFA 2QJYC 2IBZE 4QDDA 2HMLA 1O7MA 1O7NA 2HMKA 3GCEA 3GOBA 2XSHA 3L70E 2FYUE 3EQQA 4NBBD 3GTSA 1NTZE 4HM5A 3D89A 2BMOA 4HM1A 2FYNC 1PPJE 1SQXE 1G8JB 4H44D 1ZRTE 4NBCD 1G8KB 3VMID 1KYOE 4U3FE 2D2CD 2HMMA 4NBDD 4QDFB 2YFLA 5KLIC 1O7GA 1EZVE 3GKEA 4NB9D 5BOKA 4QDFA 2E4QA 3N0QA 1SQBE 2Q3WA 2YFJA 4H0LD 1NDOA 4HM4A 4HM7A 4AAYB 5CXMA 1VF5D 3CWBE 1SQPE 4HJLA 2YVJB 3L75E 4PV1D 2E75D 2A06E 3H1LE 1NU1E 1SQQE 3L72E 3VCAA 1WQLA 3H1HE 1PP9E 4HKVA 4HM0A 3GL2A 1RIEA 1P84E 1BCCE 1VCKA 4HM8A 3CXHE 2HMNA 3H1IE 1SJGA 1KB9E 5KKZC 1EG9A 3L73E 4NBFD 2NVEA 1NTME 4P1BH 2YFIA 4HM2A 5AEUA 4P1CH 4AIVA 2I7FA 2ZYLA 4HM3A 3GZYA 3DQYA 1UUVA 2E74D 4QURA 5HL4A 1RFSA 4NBAD 4QCKA 4EMJB 2HMOA 1FQTA 4OGQD 4NB8D 2NUMA 3L71E 4NBED 4QUPA 2NVGA 3GTEA 2QPZA 1BE3E 2ZT9D 3BCCE 3TGUE 1SQVE 4QUQA 2JZAA 2XR8A 3VMHD 4HM6A 2NVFA 4PD4E 2DE7D 2XSOA 2HMJA 2DE5D 1JM1A 3GB4A 4NBHD 2GBWA 3H1JE 2NWFA 3VMGD
chains in the Genus database with same CATH superfamily
1L0NE 2E76D 2NUKA 2BCCE 3C0DA 2YIUC 1O7PA 1O7WA 1ULJA 2BMRA 5KLVE 2DE6D 3FOUA 1VM9A 2GBXA 2QJKC 1ULIA 3AZCA 2B1XA 2B24A 2XRXA 1L0LE 2QJPC 3GL0A 2JO6A 1O7HA 3L74E 1NTKE 2E4PA 3CX5E 3H1KE 4H13D 1NYKA 3EN1A 5AEWA 3VCPA 1UUWA 3GZXA 4NBGD 4QDCA 2BMQA 1Q90C 2CKFA 2QJYC 2IBZE 4QDDA 2HMLA 1O7MA 1O7NA 2HMKA 3GCEA 3GOBA 2XSHA 3L70E 2FYUE 3EQQA 4NBBD 3GTSA 1NTZE 4HM5A 3D89A 2BMOA 4HM1A 2FYNC 1PPJE 1SQXE 1G8JB 4H44D 1ZRTE 4NBCD 1G8KB 3VMID 1KYOE 4U3FE 2D2CD 2HMMA 4NBDD 4QDFB 2YFLA 5KLIC 1O7GA 1EZVE 3GKEA 4NB9D 5BOKA 4QDFA 2E4QA 3N0QA 1SQBE 2Q3WA 2YFJA 4H0LD 1NDOA 4HM4A 4HM7A 4AAYB 5CXMA 1VF5D 3CWBE 1SQPE 4HJLA 2YVJB 3L75E 4PV1D 2E75D 2A06E 3H1LE 1NU1E 1SQQE 3L72E 3VCAA 1WQLA 3H1HE 1PP9E 4HKVA 4HM0A 3GL2A 1RIEA 1P84E 1BCCE 1VCKA 4HM8A 3CXHE 2HMNA 3H1IE 1SJGA 1KB9E 5KKZC 1EG9A 3L73E 4NBFD 2NVEA 1NTME 4P1BH 2YFIA 4HM2A 5AEUA 4P1CH 4AIVA 2I7FA 2ZYLA 4HM3A 3GZYA 3DQYA 1UUVA 2E74D 4QURA 5HL4A 1RFSA 4NBAD 4QCKA 4EMJB 2HMOA 1FQTA 4OGQD 4NB8D 2NUMA 3L71E 4NBED 4QUPA 2NVGA 3GTEA 2QPZA 1BE3E 2ZT9D 3BCCE 3TGUE 1SQVE 4QUQA 2JZAA 2XR8A 3VMHD 4HM6A 2NVFA 4PD4E 2DE7D 2XSOA 2HMJA 2DE5D 1JM1A 3GB4A 4NBHD 2GBWA 3H1JE 2NWFA 3VMGD
chains in the Genus database with same CATH topology
1L0NE 2E76D 2NUKA 2BCCE 3C0DA 2YIUC 1O7PA 1O7WA 1ULJA 2BMRA 5KLVE 2DE6D 3FOUA 1VM9A 2GBXA 2QJKC 1ULIA 3AZCA 2B1XA 2B24A 2XRXA 1L0LE 2QJPC 3GL0A 2JO6A 1O7HA 3L74E 1NTKE 2E4PA 3CX5E 3H1KE 4H13D 1NYKA 3EN1A 5AEWA 3VCPA 1UUWA 3GZXA 4NBGD 4QDCA 2BMQA 1Q90C 2CKFA 2QJYC 2IBZE 4QDDA 2HMLA 1O7MA 1O7NA 2HMKA 3GCEA 3GOBA 2XSHA 3L70E 2FYUE 3EQQA 4NBBD 3GTSA 1NTZE 4HM5A 3D89A 2BMOA 4HM1A 2FYNC 1PPJE 1SQXE 1G8JB 4H44D 1ZRTE 4NBCD 1G8KB 3VMID 1KYOE 4U3FE 2D2CD 2HMMA 4NBDD 4QDFB 2YFLA 5KLIC 1O7GA 1EZVE 3GKEA 4NB9D 5BOKA 4QDFA 2E4QA 3N0QA 1SQBE 2Q3WA 2YFJA 4H0LD 1NDOA 4HM4A 4HM7A 4AAYB 5CXMA 1VF5D 3CWBE 1SQPE 4HJLA 2YVJB 3L75E 4PV1D 2E75D 2A06E 3H1LE 1NU1E 1SQQE 3L72E 3VCAA 1WQLA 3H1HE 1PP9E 4HKVA 4HM0A 3GL2A 1RIEA 1P84E 1BCCE 1VCKA 4HM8A 3CXHE 2HMNA 3H1IE 1SJGA 1KB9E 5KKZC 1EG9A 3L73E 4NBFD 2NVEA 1NTME 4P1BH 2YFIA 4HM2A 5AEUA 4P1CH 4AIVA 2I7FA 2ZYLA 4HM3A 3GZYA 3DQYA 1UUVA 2E74D 4QURA 5HL4A 1RFSA 4NBAD 4QCKA 4EMJB 2HMOA 1FQTA 4OGQD 4NB8D 2NUMA 3L71E 4NBED 4QUPA 2NVGA 3GTEA 2QPZA 1BE3E 2ZT9D 3BCCE 3TGUE 1SQVE 4QUQA 2JZAA 2XR8A 3VMHD 4HM6A 2NVFA 4PD4E 2DE7D 2XSOA 2HMJA 2DE5D 1JM1A 3GB4A 4NBHD 2GBWA 3H1JE 2NWFA 3VMGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N E;  2E76 D;  2NUK A;  2BCC E;  3C0D A;  2YIU C;  1O7P A;  1O7W A;  1ULJ A;  2BMR A;  5KLV E;  2DE6 D;  3FOU A;  1VM9 A;  2GBX A;  2QJK C;  1ULI A;  3AZC A;  2B1X A;  2B24 A;  2XRX A;  1L0L E;  2QJP C;  3GL0 A;  2JO6 A;  1O7H A;  3L74 E;  1NTK E;  2E4P A;  3CX5 E;  3H1K E;  4H13 D;  1NYK A;  3EN1 A;  5AEW A;  3VCP A;  1UUW A;  3GZX A;  4NBG D;  4QDC A;  2BMQ A;  1Q90 C;  2CKF A;  2QJY C;  2IBZ E;  4QDD A;  2HML A;  1O7M A;  1O7N A;  2HMK A;  3GCE A;  3GOB A;  2XSH A;  3L70 E;  2FYU E;  3EQQ A;  4NBB D;  3GTS A;  1NTZ E;  4HM5 A;  3D89 A;  2BMO A;  4HM1 A;  2FYN C;  1PPJ E;  1SQX E;  1G8J B;  4H44 D;  1ZRT E;  4NBC D;  1G8K B;  3VMI D;  1KYO E;  4U3F E;  2D2C D;  2HMM A;  4NBD D;  4QDF B;  2YFL A;  5KLI C;  1O7G A;  1EZV E;  3GKE A;  4NB9 D;  5BOK A;  4QDF A;  2E4Q A;  3N0Q A;  1SQB E;  2Q3W A;  2YFJ A;  4H0L D;  1NDO A;  4HM4 A;  4HM7 A;  4AAY B;  5CXM A;  1VF5 D;  3CWB E;  1SQP E;  4HJL A;  2YVJ B;  3L75 E;  4PV1 D;  2E75 D;  2A06 E;  3H1L E;  1NU1 E;  1SQQ E;  3L72 E;  3VCA A;  1WQL A;  3H1H E;  1PP9 E;  4HKV A;  4HM0 A;  3GL2 A;  1RIE A;  1P84 E;  1BCC E;  1VCK A;  4HM8 A;  3CXH E;  2HMN A;  3H1I E;  1SJG A;  1KB9 E;  5KKZ C;  1EG9 A;  3L73 E;  4NBF D;  2NVE A;  1NTM E;  4P1B H;  2YFI A;  4HM2 A;  5AEU A;  4P1C H;  4AIV A;  2I7F A;  2ZYL A;  4HM3 A;  3GZY A;  3DQY A;  1UUV A;  2E74 D;  4QUR A;  5HL4 A;  1RFS A;  4NBA D;  4QCK A;  4EMJ B;  2HMO A;  1FQT A;  4OGQ D;  4NB8 D;  2NUM A;  3L71 E;  4NBE D;  4QUP A;  2NVG A;  3GTE A;  2QPZ A;  1BE3 E;  2ZT9 D;  3BCC E;  3TGU E;  1SQV E;  4QUQ A;  2JZA A;  2XR8 A;  3VMH D;  4HM6 A;  2NVF A;  4PD4 E;  2DE7 D;  2XSO A;  2HMJ A;  2DE5 D;  1JM1 A;  3GB4 A;  4NBH D;  2GBW A;  3H1J E;  2NWF A;  3VMG D; 
#chains in the Genus database with same CATH topology
 1L0N E;  2E76 D;  2NUK A;  2BCC E;  3C0D A;  2YIU C;  1O7P A;  1O7W A;  1ULJ A;  2BMR A;  5KLV E;  2DE6 D;  3FOU A;  1VM9 A;  2GBX A;  2QJK C;  1ULI A;  3AZC A;  2B1X A;  2B24 A;  2XRX A;  1L0L E;  2QJP C;  3GL0 A;  2JO6 A;  1O7H A;  3L74 E;  1NTK E;  2E4P A;  3CX5 E;  3H1K E;  4H13 D;  1NYK A;  3EN1 A;  5AEW A;  3VCP A;  1UUW A;  3GZX A;  4NBG D;  4QDC A;  2BMQ A;  1Q90 C;  2CKF A;  2QJY C;  2IBZ E;  4QDD A;  2HML A;  1O7M A;  1O7N A;  2HMK A;  3GCE A;  3GOB A;  2XSH A;  3L70 E;  2FYU E;  3EQQ A;  4NBB D;  3GTS A;  1NTZ E;  4HM5 A;  3D89 A;  2BMO A;  4HM1 A;  2FYN C;  1PPJ E;  1SQX E;  1G8J B;  4H44 D;  1ZRT E;  4NBC D;  1G8K B;  3VMI D;  1KYO E;  4U3F E;  2D2C D;  2HMM A;  4NBD D;  4QDF B;  2YFL A;  5KLI C;  1O7G A;  1EZV E;  3GKE A;  4NB9 D;  5BOK A;  4QDF A;  2E4Q A;  3N0Q A;  1SQB E;  2Q3W A;  2YFJ A;  4H0L D;  1NDO A;  4HM4 A;  4HM7 A;  4AAY B;  5CXM A;  1VF5 D;  3CWB E;  1SQP E;  4HJL A;  2YVJ B;  3L75 E;  4PV1 D;  2E75 D;  2A06 E;  3H1L E;  1NU1 E;  1SQQ E;  3L72 E;  3VCA A;  1WQL A;  3H1H E;  1PP9 E;  4HKV A;  4HM0 A;  3GL2 A;  1RIE A;  1P84 E;  1BCC E;  1VCK A;  4HM8 A;  3CXH E;  2HMN A;  3H1I E;  1SJG A;  1KB9 E;  5KKZ C;  1EG9 A;  3L73 E;  4NBF D;  2NVE A;  1NTM E;  4P1B H;  2YFI A;  4HM2 A;  5AEU A;  4P1C H;  4AIV A;  2I7F A;  2ZYL A;  4HM3 A;  3GZY A;  3DQY A;  1UUV A;  2E74 D;  4QUR A;  5HL4 A;  1RFS A;  4NBA D;  4QCK A;  4EMJ B;  2HMO A;  1FQT A;  4OGQ D;  4NB8 D;  2NUM A;  3L71 E;  4NBE D;  4QUP A;  2NVG A;  3GTE A;  2QPZ A;  1BE3 E;  2ZT9 D;  3BCC E;  3TGU E;  1SQV E;  4QUQ A;  2JZA A;  2XR8 A;  3VMH D;  4HM6 A;  2NVF A;  4PD4 E;  2DE7 D;  2XSO A;  2HMJ A;  2DE5 D;  1JM1 A;  3GB4 A;  4NBH D;  2GBW A;  3H1J E;  2NWF A;  3VMG D; 
#chains in the Genus database with same CATH homology
 1L0N E;  2E76 D;  2NUK A;  2BCC E;  3C0D A;  2YIU C;  1O7P A;  1O7W A;  1ULJ A;  2BMR A;  5KLV E;  2DE6 D;  3FOU A;  1VM9 A;  2GBX A;  2QJK C;  1ULI A;  3AZC A;  2B1X A;  2B24 A;  2XRX A;  1L0L E;  2QJP C;  3GL0 A;  2JO6 A;  1O7H A;  3L74 E;  1NTK E;  2E4P A;  3CX5 E;  3H1K E;  4H13 D;  1NYK A;  3EN1 A;  5AEW A;  3VCP A;  1UUW A;  3GZX A;  4NBG D;  4QDC A;  2BMQ A;  1Q90 C;  2CKF A;  2QJY C;  2IBZ E;  4QDD A;  2HML A;  1O7M A;  1O7N A;  2HMK A;  3GCE A;  3GOB A;  2XSH A;  3L70 E;  2FYU E;  3EQQ A;  4NBB D;  3GTS A;  1NTZ E;  4HM5 A;  3D89 A;  2BMO A;  4HM1 A;  2FYN C;  1PPJ E;  1SQX E;  1G8J B;  4H44 D;  1ZRT E;  4NBC D;  1G8K B;  3VMI D;  1KYO E;  4U3F E;  2D2C D;  2HMM A;  4NBD D;  4QDF B;  2YFL A;  5KLI C;  1O7G A;  1EZV E;  3GKE A;  4NB9 D;  5BOK A;  4QDF A;  2E4Q A;  3N0Q A;  1SQB E;  2Q3W A;  2YFJ A;  4H0L D;  1NDO A;  4HM4 A;  4HM7 A;  4AAY B;  5CXM A;  1VF5 D;  3CWB E;  1SQP E;  4HJL A;  2YVJ B;  3L75 E;  4PV1 D;  2E75 D;  2A06 E;  3H1L E;  1NU1 E;  1SQQ E;  3L72 E;  3VCA A;  1WQL A;  3H1H E;  1PP9 E;  4HKV A;  4HM0 A;  3GL2 A;  1RIE A;  1P84 E;  1BCC E;  1VCK A;  4HM8 A;  3CXH E;  2HMN A;  3H1I E;  1SJG A;  1KB9 E;  5KKZ C;  1EG9 A;  3L73 E;  4NBF D;  2NVE A;  1NTM E;  4P1B H;  2YFI A;  4HM2 A;  5AEU A;  4P1C H;  4AIV A;  2I7F A;  2ZYL A;  4HM3 A;  3GZY A;  3DQY A;  1UUV A;  2E74 D;  4QUR A;  5HL4 A;  1RFS A;  4NBA D;  4QCK A;  4EMJ B;  2HMO A;  1FQT A;  4OGQ D;  4NB8 D;  2NUM A;  3L71 E;  4NBE D;  4QUP A;  2NVG A;  3GTE A;  2QPZ A;  1BE3 E;  2ZT9 D;  3BCC E;  3TGU E;  1SQV E;  4QUQ A;  2JZA A;  2XR8 A;  3VMH D;  4HM6 A;  2NVF A;  4PD4 E;  2DE7 D;  2XSO A;  2HMJ A;  2DE5 D;  1JM1 A;  3GB4 A;  4NBH D;  2GBW A;  3H1J E;  2NWF A;  3VMG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...