4P1CH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SFEKISSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 25
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1cH00
4AAYB 2JZAA 4QDDA 1NU1E 1UUWA 1O7MA 4PD4E 3L72E 4HM1A 4HM8A 2NUMA 1O7NA 1RFSA 1WQLA 1VF5D 1SQBE 2I7FA 4HM2A 4QUPA 5KLVE 3TGUE 2YFLA 2B1XA 5KLIC 4H0LD 2HMNA 3VCPA 1Q90C 5BOKA 3AZCA 3H1JE 4HM6A 1EG9A 1P84E 4H13D 1O7HA 3CX5E 3N0QA 3GL2A 2QJKC 3H1LE 1ULIA 2E74D 2ZYLA 1UUVA 3VMGD 1SJGA 1NTZE 2XRXA 2HMJA 2Q3WA 3C0DA 4PV1D 2NWFA 3H1IE 2XSOA 2HMMA 1JM1A 1KYOE 4QDFB 1KB9E 3GTEA 3GTSA 1NYKA 2A06E 2YFIA 1SQPE 4NB9D 2DE7D 4QCKA 3GKEA 3EN1A 1SQXE 4NBFD 3GB4A 3H1HE 4H44D 1BE3E 2CKFA 2NVEA 4NB8D 2NVFA 1G8JB 2BMOA 2YVJB 2QJPC 2NVGA 1BCCE 4NBGD 3CXHE 1NTKE 4P1BH 1O7WA 5AEWA 2JO6A 2FYUE 3VMHD 2E4QA 1RIEA 2XR8A 5HL4A 2E4PA 2YIUC 3D89A 3GZYA 3VMID 2BMQA 4HM5A 1PP9E 2NUKA 4HM3A 4HM0A 2QPZA 1O7PA 2E75D 1PPJE 2FYNC 2ZT9D 4HM4A 2B24A 1L0LE 3VCAA 2GBWA 4QUQA 1FQTA 4EMJB 4NBED 5CXMA 1VM9A 2HMOA 4HM7A 3L70E 1ULJA 3GL0A 2HMLA 4NBHD 2YFJA 1NDOA 1VCKA 1SQQE 2DE5D 4NBCD 4QURA 3EQQA 3L73E 1SQVE 3GZXA 3L71E 2HMKA 4QDFA 3GCEA 4U3FE 2XSHA 2E76D 3GOBA 4P1CH 2DE6D 1EZVE 2BMRA 4NBAD 4QDCA 3L74E 4NBDD 1ZRTE 4NBBD 2D2CD 1O7GA 2IBZE 3L75E 2QJYC 2GBXA 3CWBE 2BCCE 3DQYA 4AIVA 3FOUA 1G8KB 1NTME 4HKVA 5AEUA 4HJLA 3BCCE 4OGQD 1L0NE 5KKZC 3H1KE
chains in the Genus database with same CATH superfamily
4AAYB 2JZAA 4QDDA 1NU1E 1UUWA 1O7MA 4PD4E 3L72E 4HM1A 4HM8A 2NUMA 1O7NA 1RFSA 1WQLA 1VF5D 1SQBE 2I7FA 4HM2A 4QUPA 5KLVE 3TGUE 2YFLA 2B1XA 5KLIC 4H0LD 2HMNA 3VCPA 1Q90C 5BOKA 3AZCA 3H1JE 4HM6A 1EG9A 1P84E 4H13D 1O7HA 3CX5E 3N0QA 3GL2A 2QJKC 3H1LE 1ULIA 2E74D 2ZYLA 1UUVA 3VMGD 1SJGA 1NTZE 2XRXA 2HMJA 2Q3WA 3C0DA 4PV1D 2NWFA 3H1IE 2XSOA 2HMMA 1JM1A 1KYOE 4QDFB 1KB9E 3GTEA 3GTSA 1NYKA 2A06E 2YFIA 1SQPE 4NB9D 2DE7D 4QCKA 3GKEA 3EN1A 1SQXE 4NBFD 3GB4A 3H1HE 4H44D 1BE3E 2CKFA 2NVEA 4NB8D 2NVFA 1G8JB 2BMOA 2YVJB 2QJPC 2NVGA 1BCCE 4NBGD 3CXHE 1NTKE 4P1BH 1O7WA 5AEWA 2JO6A 2FYUE 3VMHD 2E4QA 1RIEA 2XR8A 5HL4A 2E4PA 2YIUC 3D89A 3GZYA 3VMID 2BMQA 4HM5A 1PP9E 2NUKA 4HM3A 4HM0A 2QPZA 1O7PA 2E75D 1PPJE 2FYNC 2ZT9D 4HM4A 2B24A 1L0LE 3VCAA 2GBWA 4QUQA 1FQTA 4EMJB 4NBED 5CXMA 1VM9A 2HMOA 4HM7A 3L70E 1ULJA 3GL0A 2HMLA 4NBHD 2YFJA 1NDOA 1VCKA 1SQQE 2DE5D 4NBCD 4QURA 3EQQA 3L73E 1SQVE 3GZXA 3L71E 2HMKA 4QDFA 3GCEA 4U3FE 2XSHA 2E76D 3GOBA 4P1CH 2DE6D 1EZVE 2BMRA 4NBAD 4QDCA 3L74E 4NBDD 1ZRTE 4NBBD 2D2CD 1O7GA 2IBZE 3L75E 2QJYC 2GBXA 3CWBE 2BCCE 3DQYA 4AIVA 3FOUA 1G8KB 1NTME 4HKVA 5AEUA 4HJLA 3BCCE 4OGQD 1L0NE 5KKZC 3H1KE
chains in the Genus database with same CATH topology
4AAYB 2JZAA 4QDDA 1NU1E 1UUWA 1O7MA 4PD4E 3L72E 4HM1A 4HM8A 2NUMA 1O7NA 1RFSA 1WQLA 1VF5D 1SQBE 2I7FA 4HM2A 4QUPA 5KLVE 3TGUE 2YFLA 2B1XA 5KLIC 4H0LD 2HMNA 3VCPA 1Q90C 5BOKA 3AZCA 3H1JE 4HM6A 1EG9A 1P84E 4H13D 1O7HA 3CX5E 3N0QA 3GL2A 2QJKC 3H1LE 1ULIA 2E74D 2ZYLA 1UUVA 3VMGD 1SJGA 1NTZE 2XRXA 2HMJA 2Q3WA 3C0DA 4PV1D 2NWFA 3H1IE 2XSOA 2HMMA 1JM1A 1KYOE 4QDFB 1KB9E 3GTEA 3GTSA 1NYKA 2A06E 2YFIA 1SQPE 4NB9D 2DE7D 4QCKA 3GKEA 3EN1A 1SQXE 4NBFD 3GB4A 3H1HE 4H44D 1BE3E 2CKFA 2NVEA 4NB8D 2NVFA 1G8JB 2BMOA 2YVJB 2QJPC 2NVGA 1BCCE 4NBGD 3CXHE 1NTKE 4P1BH 1O7WA 5AEWA 2JO6A 2FYUE 3VMHD 2E4QA 1RIEA 2XR8A 5HL4A 2E4PA 2YIUC 3D89A 3GZYA 3VMID 2BMQA 4HM5A 1PP9E 2NUKA 4HM3A 4HM0A 2QPZA 1O7PA 2E75D 1PPJE 2FYNC 2ZT9D 4HM4A 2B24A 1L0LE 3VCAA 2GBWA 4QUQA 1FQTA 4EMJB 4NBED 5CXMA 1VM9A 2HMOA 4HM7A 3L70E 1ULJA 3GL0A 2HMLA 4NBHD 2YFJA 1NDOA 1VCKA 1SQQE 2DE5D 4NBCD 4QURA 3EQQA 3L73E 1SQVE 3GZXA 3L71E 2HMKA 4QDFA 3GCEA 4U3FE 2XSHA 2E76D 3GOBA 4P1CH 2DE6D 1EZVE 2BMRA 4NBAD 4QDCA 3L74E 4NBDD 1ZRTE 4NBBD 2D2CD 1O7GA 2IBZE 3L75E 2QJYC 2GBXA 3CWBE 2BCCE 3DQYA 4AIVA 3FOUA 1G8KB 1NTME 4HKVA 5AEUA 4HJLA 3BCCE 4OGQD 1L0NE 5KKZC 3H1KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AAY B;  2JZA A;  4QDD A;  1NU1 E;  1UUW A;  1O7M A;  4PD4 E;  3L72 E;  4HM1 A;  4HM8 A;  2NUM A;  1O7N A;  1RFS A;  1WQL A;  1VF5 D;  1SQB E;  2I7F A;  4HM2 A;  4QUP A;  5KLV E;  3TGU E;  2YFL A;  2B1X A;  5KLI C;  4H0L D;  2HMN A;  3VCP A;  1Q90 C;  5BOK A;  3AZC A;  3H1J E;  4HM6 A;  1EG9 A;  1P84 E;  4H13 D;  1O7H A;  3CX5 E;  3N0Q A;  3GL2 A;  2QJK C;  3H1L E;  1ULI A;  2E74 D;  2ZYL A;  1UUV A;  3VMG D;  1SJG A;  1NTZ E;  2XRX A;  2HMJ A;  2Q3W A;  3C0D A;  4PV1 D;  2NWF A;  3H1I E;  2XSO A;  2HMM A;  1JM1 A;  1KYO E;  4QDF B;  1KB9 E;  3GTE A;  3GTS A;  1NYK A;  2A06 E;  2YFI A;  1SQP E;  4NB9 D;  2DE7 D;  4QCK A;  3GKE A;  3EN1 A;  1SQX E;  4NBF D;  3GB4 A;  3H1H E;  4H44 D;  1BE3 E;  2CKF A;  2NVE A;  4NB8 D;  2NVF A;  1G8J B;  2BMO A;  2YVJ B;  2QJP C;  2NVG A;  1BCC E;  4NBG D;  3CXH E;  1NTK E;  4P1B H;  1O7W A;  5AEW A;  2JO6 A;  2FYU E;  3VMH D;  2E4Q A;  1RIE A;  2XR8 A;  5HL4 A;  2E4P A;  2YIU C;  3D89 A;  3GZY A;  3VMI D;  2BMQ A;  4HM5 A;  1PP9 E;  2NUK A;  4HM3 A;  4HM0 A;  2QPZ A;  1O7P A;  2E75 D;  1PPJ E;  2FYN C;  2ZT9 D;  4HM4 A;  2B24 A;  1L0L E;  3VCA A;  2GBW A;  4QUQ A;  1FQT A;  4EMJ B;  4NBE D;  5CXM A;  1VM9 A;  2HMO A;  4HM7 A;  3L70 E;  1ULJ A;  3GL0 A;  2HML A;  4NBH D;  2YFJ A;  1NDO A;  1VCK A;  1SQQ E;  2DE5 D;  4NBC D;  4QUR A;  3EQQ A;  3L73 E;  1SQV E;  3GZX A;  3L71 E;  2HMK A;  4QDF A;  3GCE A;  4U3F E;  2XSH A;  2E76 D;  3GOB A;  4P1C H;  2DE6 D;  1EZV E;  2BMR A;  4NBA D;  4QDC A;  3L74 E;  4NBD D;  1ZRT E;  4NBB D;  2D2C D;  1O7G A;  2IBZ E;  3L75 E;  2QJY C;  2GBX A;  3CWB E;  2BCC E;  3DQY A;  4AIV A;  3FOU A;  1G8K B;  1NTM E;  4HKV A;  5AEU A;  4HJL A;  3BCC E;  4OGQ D;  1L0N E;  5KKZ C;  3H1K E; 
#chains in the Genus database with same CATH topology
 4AAY B;  2JZA A;  4QDD A;  1NU1 E;  1UUW A;  1O7M A;  4PD4 E;  3L72 E;  4HM1 A;  4HM8 A;  2NUM A;  1O7N A;  1RFS A;  1WQL A;  1VF5 D;  1SQB E;  2I7F A;  4HM2 A;  4QUP A;  5KLV E;  3TGU E;  2YFL A;  2B1X A;  5KLI C;  4H0L D;  2HMN A;  3VCP A;  1Q90 C;  5BOK A;  3AZC A;  3H1J E;  4HM6 A;  1EG9 A;  1P84 E;  4H13 D;  1O7H A;  3CX5 E;  3N0Q A;  3GL2 A;  2QJK C;  3H1L E;  1ULI A;  2E74 D;  2ZYL A;  1UUV A;  3VMG D;  1SJG A;  1NTZ E;  2XRX A;  2HMJ A;  2Q3W A;  3C0D A;  4PV1 D;  2NWF A;  3H1I E;  2XSO A;  2HMM A;  1JM1 A;  1KYO E;  4QDF B;  1KB9 E;  3GTE A;  3GTS A;  1NYK A;  2A06 E;  2YFI A;  1SQP E;  4NB9 D;  2DE7 D;  4QCK A;  3GKE A;  3EN1 A;  1SQX E;  4NBF D;  3GB4 A;  3H1H E;  4H44 D;  1BE3 E;  2CKF A;  2NVE A;  4NB8 D;  2NVF A;  1G8J B;  2BMO A;  2YVJ B;  2QJP C;  2NVG A;  1BCC E;  4NBG D;  3CXH E;  1NTK E;  4P1B H;  1O7W A;  5AEW A;  2JO6 A;  2FYU E;  3VMH D;  2E4Q A;  1RIE A;  2XR8 A;  5HL4 A;  2E4P A;  2YIU C;  3D89 A;  3GZY A;  3VMI D;  2BMQ A;  4HM5 A;  1PP9 E;  2NUK A;  4HM3 A;  4HM0 A;  2QPZ A;  1O7P A;  2E75 D;  1PPJ E;  2FYN C;  2ZT9 D;  4HM4 A;  2B24 A;  1L0L E;  3VCA A;  2GBW A;  4QUQ A;  1FQT A;  4EMJ B;  4NBE D;  5CXM A;  1VM9 A;  2HMO A;  4HM7 A;  3L70 E;  1ULJ A;  3GL0 A;  2HML A;  4NBH D;  2YFJ A;  1NDO A;  1VCK A;  1SQQ E;  2DE5 D;  4NBC D;  4QUR A;  3EQQ A;  3L73 E;  1SQV E;  3GZX A;  3L71 E;  2HMK A;  4QDF A;  3GCE A;  4U3F E;  2XSH A;  2E76 D;  3GOB A;  4P1C H;  2DE6 D;  1EZV E;  2BMR A;  4NBA D;  4QDC A;  3L74 E;  4NBD D;  1ZRT E;  4NBB D;  2D2C D;  1O7G A;  2IBZ E;  3L75 E;  2QJY C;  2GBX A;  3CWB E;  2BCC E;  3DQY A;  4AIV A;  3FOU A;  1G8K B;  1NTM E;  4HKV A;  5AEU A;  4HJL A;  3BCC E;  4OGQ D;  1L0N E;  5KKZ C;  3H1K E; 
#chains in the Genus database with same CATH homology
 4AAY B;  2JZA A;  4QDD A;  1NU1 E;  1UUW A;  1O7M A;  4PD4 E;  3L72 E;  4HM1 A;  4HM8 A;  2NUM A;  1O7N A;  1RFS A;  1WQL A;  1VF5 D;  1SQB E;  2I7F A;  4HM2 A;  4QUP A;  5KLV E;  3TGU E;  2YFL A;  2B1X A;  5KLI C;  4H0L D;  2HMN A;  3VCP A;  1Q90 C;  5BOK A;  3AZC A;  3H1J E;  4HM6 A;  1EG9 A;  1P84 E;  4H13 D;  1O7H A;  3CX5 E;  3N0Q A;  3GL2 A;  2QJK C;  3H1L E;  1ULI A;  2E74 D;  2ZYL A;  1UUV A;  3VMG D;  1SJG A;  1NTZ E;  2XRX A;  2HMJ A;  2Q3W A;  3C0D A;  4PV1 D;  2NWF A;  3H1I E;  2XSO A;  2HMM A;  1JM1 A;  1KYO E;  4QDF B;  1KB9 E;  3GTE A;  3GTS A;  1NYK A;  2A06 E;  2YFI A;  1SQP E;  4NB9 D;  2DE7 D;  4QCK A;  3GKE A;  3EN1 A;  1SQX E;  4NBF D;  3GB4 A;  3H1H E;  4H44 D;  1BE3 E;  2CKF A;  2NVE A;  4NB8 D;  2NVF A;  1G8J B;  2BMO A;  2YVJ B;  2QJP C;  2NVG A;  1BCC E;  4NBG D;  3CXH E;  1NTK E;  4P1B H;  1O7W A;  5AEW A;  2JO6 A;  2FYU E;  3VMH D;  2E4Q A;  1RIE A;  2XR8 A;  5HL4 A;  2E4P A;  2YIU C;  3D89 A;  3GZY A;  3VMI D;  2BMQ A;  4HM5 A;  1PP9 E;  2NUK A;  4HM3 A;  4HM0 A;  2QPZ A;  1O7P A;  2E75 D;  1PPJ E;  2FYN C;  2ZT9 D;  4HM4 A;  2B24 A;  1L0L E;  3VCA A;  2GBW A;  4QUQ A;  1FQT A;  4EMJ B;  4NBE D;  5CXM A;  1VM9 A;  2HMO A;  4HM7 A;  3L70 E;  1ULJ A;  3GL0 A;  2HML A;  4NBH D;  2YFJ A;  1NDO A;  1VCK A;  1SQQ E;  2DE5 D;  4NBC D;  4QUR A;  3EQQ A;  3L73 E;  1SQV E;  3GZX A;  3L71 E;  2HMK A;  4QDF A;  3GCE A;  4U3F E;  2XSH A;  2E76 D;  3GOB A;  4P1C H;  2DE6 D;  1EZV E;  2BMR A;  4NBA D;  4QDC A;  3L74 E;  4NBD D;  1ZRT E;  4NBB D;  2D2C D;  1O7G A;  2IBZ E;  3L75 E;  2QJY C;  2GBX A;  3CWB E;  2BCC E;  3DQY A;  4AIV A;  3FOU A;  1G8K B;  1NTM E;  4HKV A;  5AEU A;  4HJL A;  3BCC E;  4OGQ D;  1L0N E;  5KKZ C;  3H1K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...