4P1CH

Crystal structure of the toluene 4-monooxygenase hydroxylase-ferredoxin c7s, c84a, c85a variant electron-transfer complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SFEKISSLDDIWVGEMETFETSDGTEVLIVNSEEHGVKAYQAMCPHQEILLSEGSYEGGVITCRAHLWTFNDGTGHGINPDDAALAEYPVEVKGDDIYVSTKGILPNKAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Structural basis for biomolecular recognition in overlapping binding sites in a diiron enzyme system.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 25
structure length 111
sequence length 111
chains with identical sequence I
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4p1cH00
4HKVA 3TGUE 2GBWA 2HMOA 4QCKA 1NTZE 1RFSA 3L70E 3GCEA 4OGQD 2NUMA 4HM6A 4NBAD 3DQYA 2B1XA 4HM1A 1EG9A 3EN1A 2HMNA 4HM8A 1VCKA 4AAYB 2YFLA 1L0LE 2BMOA 4HJLA 3VCPA 4H0LD 2BMQA 1SQVE 3VMID 1G8JB 1NDOA 1O7HA 1ULJA 2YFJA 1VM9A 2YIUC 4QURA 1G8KB 3GL0A 1NYKA 1WQLA 5KKZC 2E76D 2I7FA 5KLVE 2E74D 2HMJA 1RIEA 2QJYC 4HM7A 5AEWA 5HL4A 2JZAA 3GOBA 3VMGD 2DE5D 3H1IE 4QUQA 4HM2A 2HMKA 4QDCA 2E75D 4NB8D 1NTME 1SQPE 4HM5A 2ZYLA 4NBGD 4NBHD 4P1BH 1ZRTE 1PP9E 3VMHD 2XSOA 3L75E 1VF5D 4HM4A 2NVEA 2BCCE 3H1KE 3H1LE 2FYNC 4QDFA 3VCAA 4PV1D 1JM1A 1SQXE 2A06E 5KLIC 1FQTA 1PPJE 1UUVA 2YVJB 3AZCA 2B24A 2CKFA 2XR8A 4AIVA 1P84E 3N0QA 1O7WA 1KB9E 1UUWA 3BCCE 2E4QA 3CXHE 1NTKE 1O7PA 4QUPA 1Q90C 2D2CD 2ZT9D 2BMRA 3H1HE 2Q3WA 5AEUA 1SQQE 2GBXA 3CWBE 3GZYA 2NVFA 3L74E 4PD4E 3FOUA 2YFIA 2QPZA 2DE7D 2FYUE 3EQQA 1NU1E 4HM3A 3L72E 4U3FE 3GL2A 4P1CH 5BOKA 2HMLA 1O7NA 1L0NE 3CX5E 4NBDD 4NBFD 2QJPC 1SJGA 3GTSA 3L71E 1SQBE 1BE3E 4H13D 4NB9D 2HMMA 2E4PA 1O7MA 2IBZE 4NBBD 4HM0A 4NBED 2NWFA 1ULIA 3GKEA 3GB4A 3L73E 5CXMA 2XSHA 4QDDA 3H1JE 1O7GA 4QDFB 2NUKA 3D89A 2DE6D 4EMJB 2JO6A 4NBCD 4H44D 2NVGA 2QJKC 1KYOE 3GTEA 2XRXA 1EZVE 3C0DA 3GZXA 1BCCE
chains in the Genus database with same CATH superfamily
4HKVA 3TGUE 2GBWA 2HMOA 4QCKA 1NTZE 1RFSA 3L70E 3GCEA 4OGQD 2NUMA 4HM6A 4NBAD 3DQYA 2B1XA 4HM1A 1EG9A 3EN1A 2HMNA 4HM8A 1VCKA 4AAYB 2YFLA 1L0LE 2BMOA 4HJLA 3VCPA 4H0LD 2BMQA 1SQVE 3VMID 1G8JB 1NDOA 1O7HA 1ULJA 2YFJA 1VM9A 2YIUC 4QURA 1G8KB 3GL0A 1NYKA 1WQLA 5KKZC 2E76D 2I7FA 5KLVE 2E74D 2HMJA 1RIEA 2QJYC 4HM7A 5AEWA 5HL4A 2JZAA 3GOBA 3VMGD 2DE5D 3H1IE 4QUQA 4HM2A 2HMKA 4QDCA 2E75D 4NB8D 1NTME 1SQPE 4HM5A 2ZYLA 4NBGD 4NBHD 4P1BH 1ZRTE 1PP9E 3VMHD 2XSOA 3L75E 1VF5D 4HM4A 2NVEA 2BCCE 3H1KE 3H1LE 2FYNC 4QDFA 3VCAA 4PV1D 1JM1A 1SQXE 2A06E 5KLIC 1FQTA 1PPJE 1UUVA 2YVJB 3AZCA 2B24A 2CKFA 2XR8A 4AIVA 1P84E 3N0QA 1O7WA 1KB9E 1UUWA 3BCCE 2E4QA 3CXHE 1NTKE 1O7PA 4QUPA 1Q90C 2D2CD 2ZT9D 2BMRA 3H1HE 2Q3WA 5AEUA 1SQQE 2GBXA 3CWBE 3GZYA 2NVFA 3L74E 4PD4E 3FOUA 2YFIA 2QPZA 2DE7D 2FYUE 3EQQA 1NU1E 4HM3A 3L72E 4U3FE 3GL2A 4P1CH 5BOKA 2HMLA 1O7NA 1L0NE 3CX5E 4NBDD 4NBFD 2QJPC 1SJGA 3GTSA 3L71E 1SQBE 1BE3E 4H13D 4NB9D 2HMMA 2E4PA 1O7MA 2IBZE 4NBBD 4HM0A 4NBED 2NWFA 1ULIA 3GKEA 3GB4A 3L73E 5CXMA 2XSHA 4QDDA 3H1JE 1O7GA 4QDFB 2NUKA 3D89A 2DE6D 4EMJB 2JO6A 4NBCD 4H44D 2NVGA 2QJKC 1KYOE 3GTEA 2XRXA 1EZVE 3C0DA 3GZXA 1BCCE
chains in the Genus database with same CATH topology
4HKVA 3TGUE 2GBWA 2HMOA 4QCKA 1NTZE 1RFSA 3L70E 3GCEA 4OGQD 2NUMA 4HM6A 4NBAD 3DQYA 2B1XA 4HM1A 1EG9A 3EN1A 2HMNA 4HM8A 1VCKA 4AAYB 2YFLA 1L0LE 2BMOA 4HJLA 3VCPA 4H0LD 2BMQA 1SQVE 3VMID 1G8JB 1NDOA 1O7HA 1ULJA 2YFJA 1VM9A 2YIUC 4QURA 1G8KB 3GL0A 1NYKA 1WQLA 5KKZC 2E76D 2I7FA 5KLVE 2E74D 2HMJA 1RIEA 2QJYC 4HM7A 5AEWA 5HL4A 2JZAA 3GOBA 3VMGD 2DE5D 3H1IE 4QUQA 4HM2A 2HMKA 4QDCA 2E75D 4NB8D 1NTME 1SQPE 4HM5A 2ZYLA 4NBGD 4NBHD 4P1BH 1ZRTE 1PP9E 3VMHD 2XSOA 3L75E 1VF5D 4HM4A 2NVEA 2BCCE 3H1KE 3H1LE 2FYNC 4QDFA 3VCAA 4PV1D 1JM1A 1SQXE 2A06E 5KLIC 1FQTA 1PPJE 1UUVA 2YVJB 3AZCA 2B24A 2CKFA 2XR8A 4AIVA 1P84E 3N0QA 1O7WA 1KB9E 1UUWA 3BCCE 2E4QA 3CXHE 1NTKE 1O7PA 4QUPA 1Q90C 2D2CD 2ZT9D 2BMRA 3H1HE 2Q3WA 5AEUA 1SQQE 2GBXA 3CWBE 3GZYA 2NVFA 3L74E 4PD4E 3FOUA 2YFIA 2QPZA 2DE7D 2FYUE 3EQQA 1NU1E 4HM3A 3L72E 4U3FE 3GL2A 4P1CH 5BOKA 2HMLA 1O7NA 1L0NE 3CX5E 4NBDD 4NBFD 2QJPC 1SJGA 3GTSA 3L71E 1SQBE 1BE3E 4H13D 4NB9D 2HMMA 2E4PA 1O7MA 2IBZE 4NBBD 4HM0A 4NBED 2NWFA 1ULIA 3GKEA 3GB4A 3L73E 5CXMA 2XSHA 4QDDA 3H1JE 1O7GA 4QDFB 2NUKA 3D89A 2DE6D 4EMJB 2JO6A 4NBCD 4H44D 2NVGA 2QJKC 1KYOE 3GTEA 2XRXA 1EZVE 3C0DA 3GZXA 1BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKV A;  3TGU E;  2GBW A;  2HMO A;  4QCK A;  1NTZ E;  1RFS A;  3L70 E;  3GCE A;  4OGQ D;  2NUM A;  4HM6 A;  4NBA D;  3DQY A;  2B1X A;  4HM1 A;  1EG9 A;  3EN1 A;  2HMN A;  4HM8 A;  1VCK A;  4AAY B;  2YFL A;  1L0L E;  2BMO A;  4HJL A;  3VCP A;  4H0L D;  2BMQ A;  1SQV E;  3VMI D;  1G8J B;  1NDO A;  1O7H A;  1ULJ A;  2YFJ A;  1VM9 A;  2YIU C;  4QUR A;  1G8K B;  3GL0 A;  1NYK A;  1WQL A;  5KKZ C;  2E76 D;  2I7F A;  5KLV E;  2E74 D;  2HMJ A;  1RIE A;  2QJY C;  4HM7 A;  5AEW A;  5HL4 A;  2JZA A;  3GOB A;  3VMG D;  2DE5 D;  3H1I E;  4QUQ A;  4HM2 A;  2HMK A;  4QDC A;  2E75 D;  4NB8 D;  1NTM E;  1SQP E;  4HM5 A;  2ZYL A;  4NBG D;  4NBH D;  4P1B H;  1ZRT E;  1PP9 E;  3VMH D;  2XSO A;  3L75 E;  1VF5 D;  4HM4 A;  2NVE A;  2BCC E;  3H1K E;  3H1L E;  2FYN C;  4QDF A;  3VCA A;  4PV1 D;  1JM1 A;  1SQX E;  2A06 E;  5KLI C;  1FQT A;  1PPJ E;  1UUV A;  2YVJ B;  3AZC A;  2B24 A;  2CKF A;  2XR8 A;  4AIV A;  1P84 E;  3N0Q A;  1O7W A;  1KB9 E;  1UUW A;  3BCC E;  2E4Q A;  3CXH E;  1NTK E;  1O7P A;  4QUP A;  1Q90 C;  2D2C D;  2ZT9 D;  2BMR A;  3H1H E;  2Q3W A;  5AEU A;  1SQQ E;  2GBX A;  3CWB E;  3GZY A;  2NVF A;  3L74 E;  4PD4 E;  3FOU A;  2YFI A;  2QPZ A;  2DE7 D;  2FYU E;  3EQQ A;  1NU1 E;  4HM3 A;  3L72 E;  4U3F E;  3GL2 A;  4P1C H;  5BOK A;  2HML A;  1O7N A;  1L0N E;  3CX5 E;  4NBD D;  4NBF D;  2QJP C;  1SJG A;  3GTS A;  3L71 E;  1SQB E;  1BE3 E;  4H13 D;  4NB9 D;  2HMM A;  2E4P A;  1O7M A;  2IBZ E;  4NBB D;  4HM0 A;  4NBE D;  2NWF A;  1ULI A;  3GKE A;  3GB4 A;  3L73 E;  5CXM A;  2XSH A;  4QDD A;  3H1J E;  1O7G A;  4QDF B;  2NUK A;  3D89 A;  2DE6 D;  4EMJ B;  2JO6 A;  4NBC D;  4H44 D;  2NVG A;  2QJK C;  1KYO E;  3GTE A;  2XRX A;  1EZV E;  3C0D A;  3GZX A;  1BCC E; 
#chains in the Genus database with same CATH topology
 4HKV A;  3TGU E;  2GBW A;  2HMO A;  4QCK A;  1NTZ E;  1RFS A;  3L70 E;  3GCE A;  4OGQ D;  2NUM A;  4HM6 A;  4NBA D;  3DQY A;  2B1X A;  4HM1 A;  1EG9 A;  3EN1 A;  2HMN A;  4HM8 A;  1VCK A;  4AAY B;  2YFL A;  1L0L E;  2BMO A;  4HJL A;  3VCP A;  4H0L D;  2BMQ A;  1SQV E;  3VMI D;  1G8J B;  1NDO A;  1O7H A;  1ULJ A;  2YFJ A;  1VM9 A;  2YIU C;  4QUR A;  1G8K B;  3GL0 A;  1NYK A;  1WQL A;  5KKZ C;  2E76 D;  2I7F A;  5KLV E;  2E74 D;  2HMJ A;  1RIE A;  2QJY C;  4HM7 A;  5AEW A;  5HL4 A;  2JZA A;  3GOB A;  3VMG D;  2DE5 D;  3H1I E;  4QUQ A;  4HM2 A;  2HMK A;  4QDC A;  2E75 D;  4NB8 D;  1NTM E;  1SQP E;  4HM5 A;  2ZYL A;  4NBG D;  4NBH D;  4P1B H;  1ZRT E;  1PP9 E;  3VMH D;  2XSO A;  3L75 E;  1VF5 D;  4HM4 A;  2NVE A;  2BCC E;  3H1K E;  3H1L E;  2FYN C;  4QDF A;  3VCA A;  4PV1 D;  1JM1 A;  1SQX E;  2A06 E;  5KLI C;  1FQT A;  1PPJ E;  1UUV A;  2YVJ B;  3AZC A;  2B24 A;  2CKF A;  2XR8 A;  4AIV A;  1P84 E;  3N0Q A;  1O7W A;  1KB9 E;  1UUW A;  3BCC E;  2E4Q A;  3CXH E;  1NTK E;  1O7P A;  4QUP A;  1Q90 C;  2D2C D;  2ZT9 D;  2BMR A;  3H1H E;  2Q3W A;  5AEU A;  1SQQ E;  2GBX A;  3CWB E;  3GZY A;  2NVF A;  3L74 E;  4PD4 E;  3FOU A;  2YFI A;  2QPZ A;  2DE7 D;  2FYU E;  3EQQ A;  1NU1 E;  4HM3 A;  3L72 E;  4U3F E;  3GL2 A;  4P1C H;  5BOK A;  2HML A;  1O7N A;  1L0N E;  3CX5 E;  4NBD D;  4NBF D;  2QJP C;  1SJG A;  3GTS A;  3L71 E;  1SQB E;  1BE3 E;  4H13 D;  4NB9 D;  2HMM A;  2E4P A;  1O7M A;  2IBZ E;  4NBB D;  4HM0 A;  4NBE D;  2NWF A;  1ULI A;  3GKE A;  3GB4 A;  3L73 E;  5CXM A;  2XSH A;  4QDD A;  3H1J E;  1O7G A;  4QDF B;  2NUK A;  3D89 A;  2DE6 D;  4EMJ B;  2JO6 A;  4NBC D;  4H44 D;  2NVG A;  2QJK C;  1KYO E;  3GTE A;  2XRX A;  1EZV E;  3C0D A;  3GZX A;  1BCC E; 
#chains in the Genus database with same CATH homology
 4HKV A;  3TGU E;  2GBW A;  2HMO A;  4QCK A;  1NTZ E;  1RFS A;  3L70 E;  3GCE A;  4OGQ D;  2NUM A;  4HM6 A;  4NBA D;  3DQY A;  2B1X A;  4HM1 A;  1EG9 A;  3EN1 A;  2HMN A;  4HM8 A;  1VCK A;  4AAY B;  2YFL A;  1L0L E;  2BMO A;  4HJL A;  3VCP A;  4H0L D;  2BMQ A;  1SQV E;  3VMI D;  1G8J B;  1NDO A;  1O7H A;  1ULJ A;  2YFJ A;  1VM9 A;  2YIU C;  4QUR A;  1G8K B;  3GL0 A;  1NYK A;  1WQL A;  5KKZ C;  2E76 D;  2I7F A;  5KLV E;  2E74 D;  2HMJ A;  1RIE A;  2QJY C;  4HM7 A;  5AEW A;  5HL4 A;  2JZA A;  3GOB A;  3VMG D;  2DE5 D;  3H1I E;  4QUQ A;  4HM2 A;  2HMK A;  4QDC A;  2E75 D;  4NB8 D;  1NTM E;  1SQP E;  4HM5 A;  2ZYL A;  4NBG D;  4NBH D;  4P1B H;  1ZRT E;  1PP9 E;  3VMH D;  2XSO A;  3L75 E;  1VF5 D;  4HM4 A;  2NVE A;  2BCC E;  3H1K E;  3H1L E;  2FYN C;  4QDF A;  3VCA A;  4PV1 D;  1JM1 A;  1SQX E;  2A06 E;  5KLI C;  1FQT A;  1PPJ E;  1UUV A;  2YVJ B;  3AZC A;  2B24 A;  2CKF A;  2XR8 A;  4AIV A;  1P84 E;  3N0Q A;  1O7W A;  1KB9 E;  1UUW A;  3BCC E;  2E4Q A;  3CXH E;  1NTK E;  1O7P A;  4QUP A;  1Q90 C;  2D2C D;  2ZT9 D;  2BMR A;  3H1H E;  2Q3W A;  5AEU A;  1SQQ E;  2GBX A;  3CWB E;  3GZY A;  2NVF A;  3L74 E;  4PD4 E;  3FOU A;  2YFI A;  2QPZ A;  2DE7 D;  2FYU E;  3EQQ A;  1NU1 E;  4HM3 A;  3L72 E;  4U3F E;  3GL2 A;  4P1C H;  5BOK A;  2HML A;  1O7N A;  1L0N E;  3CX5 E;  4NBD D;  4NBF D;  2QJP C;  1SJG A;  3GTS A;  3L71 E;  1SQB E;  1BE3 E;  4H13 D;  4NB9 D;  2HMM A;  2E4P A;  1O7M A;  2IBZ E;  4NBB D;  4HM0 A;  4NBE D;  2NWF A;  1ULI A;  3GKE A;  3GB4 A;  3L73 E;  5CXM A;  2XSH A;  4QDD A;  3H1J E;  1O7G A;  4QDF B;  2NUK A;  3D89 A;  2DE6 D;  4EMJ B;  2JO6 A;  4NBC D;  4H44 D;  2NVG A;  2QJK C;  1KYO E;  3GTE A;  2XRX A;  1EZV E;  3C0D A;  3GZX A;  1BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...