3CXHE

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 49
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cxhE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cxhE02
2A06E 2XSOA 2QPZA 4HKVA 2BMOA 2NUKA 1PPJE 5AEWA 3TGUE 5KLIC 2NUMA 1ZRTE 3CXHE 3L75E 2E74D 4AIVA 4AAYB 3AZCA 1Q90C 3CX5E 1L0LE 1NDOA 3FOUA 4HM1A 2BMRA 1UUVA 3N0QA 4HM4A 4NBED 1BGYE 4QDCA 2E4QA 3EN1A 4U3FE 4NBBD 1SQXE 3L74E 1EG9A 1O7NA 4OGQD 5KLVE 4QCKA 1VM9A 2D2CD 4QDDA 4EMJB 4QUPA 1SQBE 3VMGD 1NTZE 2IBZE 2FYNC 1L0NE 3GB4A 2YVJB 4H13D 1SQPE 2HMLA 2HMOA 3GL0A 2B24A 4NBHD 2NWFA 2HMMA 2CKFA 4QURA 2XR8A 4PV1D 1SJGA 3H1KE 1NTME 2Q3WA 2HMKA 3GCEA 3H1IE 4P1CH 3GZYA 1SQQE 2ZT9D 5AEUA 2XSHA 4HM3A 3GTEA 1NU1E 2GBXA 1KYOE 2ZYLA 4QDFA 2BCCE 2QJYC 2YFIA 3GZXA 3L72E 4D6TE 2XRXA 3VCPA 4H44D 2JO6A 1NYKA 2YIUC 3BCCE 4NBDD 2DE5D 3D89A 3GL2A 4NBAD 2JZAA 2FYUE 2QJKC 4HM5A 3DQYA 4HM6A 2BMQA 1UUWA 1PP9E 2E76D 1P84E 2HMJA 3GTSA 1O7MA 1ULJA 3GKEA 1VCKA 2DE7D 4HM0A 5KKZC 2B1XA 4NBCD 1O7PA 3H1LE 5HL4A 1G8KB 3EQQA 2NVGA 1RFSA 2QJPC 4HM7A 2NVEA 2E4PA 1G8JB 2I7FA 4NBFD 1JM1A 2YFLA 3GOBA 1SQVE 1BCCE 1O7GA 3VMHD 1BE3E 4HM2A 1ULIA 1EZVE 2NVFA 3CWBE 4QUQA 5BOKA 2YFJA 3C0DA 2DE6D 1VF5D 2HMNA 3H1JE 1O7WA 4H0LD 1KB9E 4NBGD 4P1BH 5CXMA 4QDFB 1NTKE 3VMID 3VCAA 2GBWA 2E75D 3H1HE 4HM8A 4PD4E 3L73E 3L71E 4HJLA 4NB8D 1WQLA 4NB9D 1O7HA 3L70E 1FQTA 1RIEA
chains in the Genus database with same CATH superfamily
1AQ5A 1S4XA 2KSEA 2K9JA 3JCUH 5AEWA 3CCSP 1WMKA 1N7SB 3TNUA 2KP8A 4A7PA 2BMRA 5AW0B 1G1IA 1MKMA 1HH0A 2NPSC 3H1HJ 1W2EA 2POHA 5AVRB 4EMJB 3E1IA 3U1CA 1NOHA 3VYIA 1SP4A 2E75B 3L74D 3CCMP 2R44A 3CWBJ 2FYUD 2W83C 4JYCA 4NBHD 3NFQA 4OH8B 1ZXGA 1FE6A 2CK3H 4K35A 3GF7A 1L0LJ 3R2PA 1OMIA 5AVVB 2OTLP 1NO4A 2IZ0A 4ZKPA 3Q2YA 5AVQB 3DQYA 1JY2O 2E76D 1PP9E 3L36A 5KAIE 4JPZB 1ULJA 1SQQK 3FWNA 5AW9B 3CX5I 3HD7A 3W67A 3CCRP 4N3YB 4LGDE 1J1EC 3HUSB 1EDKA 2QJPC 1OZHA 1BE3E 1LP1B 3UIAA 1CW5A 1LTJA 3I5CA 4NBGD 5M1BA 4TLFA 2WSFJ 1KYOD 4Z1MH 3CWBG 5KJ7C 1VPCA 3L72D 2QPZA 1YIJP 3RK3B 1OVUA 3TGUE 5AW1B 1JTHB 2H88C 3H1JJ 1SQPJ 2WSEH 1FDMA 3CX5E 3M9QA 2IBZD 1PPJD 1PIXA 2WPQA 3V4QA 1RF1B 4NBBD 3V4WA 4LC1A 1KILC 2D2CD 3CCLP 1NTZE 1IFMA 2E42A 1JEKA 4NPEA 3GL0A 1SQXG 3RGUA 1SQVK 1NKZB 1SJGA 3GZYA 1JCDA 1NH4A 1X8YA 1YQ3C 3IF4A 1NU1E 4R4MA 4EYYQ 2IYOA 1RE4A 4PV1B 3C8VA 2AXTH 1W5CE 2OARA 2H43A 1KORA 3USSA 2FYZA 5CCHC 1KQGB 1Y8AA 3IR9A 2ZT9B 3H1LE 3VN0A 1SFCB 3H1JG 1NWQA 1JMBA 2YXQB 4NBFD 2AEMA 4HM2A 5BOKA 1FZFA 2E74C 1XTGB 3B4SA 3VCAA 1GL2D 1IJDB 3R4YA 1RIEA 2WITA 2WT7A 3GHGB 2C9NY 1Q90C 1AA0A 1LWUC 1YHQP 1KILD 2D2CC 4QDCA 3H1KJ 3L74E 3CCVP 1L0LD 2JP3A 1PV3A 3W68A 4QDDA 1SVFA 3L35A 2OQQA 4U3FD 4XFJA 1ZMEC 3F5HA 3CC4P 2FY8A 1QL1A 4RKUJ 3II6A 1VQ7P 5K5GB 1USEA 3AE1C 3EFGA 3V5BA 1J1DC 2XKMA 3P8CE 1SFCD 2QJYC 2WPSA 5GTIE 2JO6A 2J5UA 2VRSA 2FYUG 3GG2A 3NMDA 1MUUA 4NBAD 2JZAA 3AE8C 4I7ZC 1R8EA 3GHGC 5AW3B 1JY3O 4XA4A 2E76C 1O7GA 3JCUE 1T8ZA 4PV1C 2M3BA 2RKLA 5CJ0A 2JEEA 1BGYJ 3TYYA 2AXTE 1S72P 1DEEG 1SQVD 3AE3C 2GBWA 1LTAC 3P8CD 2I8DA 1FZAA 3L73E 4Y99C 4HJLA 3AE6C 3L70E 1S5LE 1LGHB 1Q90D 3N7NA 3KYQA 2E75C 1IFPA 3L75E 5GTHH 1FDIA 3FX0A 1FZCC 3O6QA 1BGYE 1VQPP 3WMM0 3GW6A 2O01N 2QSIA 1DX7A 4QCKA 2OGUA 3EFFK 5L8RJ 1FC2C 4L75A 4GT1A 3AEEC 4H0LC 3GF3A 3L75D 1X9VA 2WT7B 1ZW0A 2NWFA 3H1KG 1E79H 5KAIH 3L4FA 2RMZA 1KTMA 1NTZG 4W7ZA 4IFMA 3H1KD 2O1JA 2B87A 2N9BA 3IN6A 1IFJA 2OTJP 1IFIA 1RH5B 2DE5D 1PPJG 2HLOA 1URQB 2HMJA 1O7MA 4PD4I 2JJLA 5KKZC 1NAFA 3AEAC 4ASWA 1GL2A 5AW7B 5GTIH 3B5NC 2E4PA 1VQKP 3CPWO 3M0DA 1LJ2A 1NTKK 3H1IJ 3SWFA 1U7MA 2FXOA 1HGZA 2PP6A 1NTKJ 3H1JE 3A7OA 1L4AC 5CXMA 3ZDMA 4C7RA 5AVZB 1PGPA 2IFMA 5KLVK 2WWWA 5KAFH 2N1TC 1O7HA 3BCCE 3G4SP 4YXDC 2RH0A 1IK9A 2WSFH 2QJPB 1L0LE 1GW3A 1MFZA 2LKMA 1GDTA 4NBED 3V2QA 3EN1A 2KLUA 3CX5D 1VQ9P 2HFED 5APSA 2K88A 1DEBA 4GODA 2AXCA 3GLMA 3KHUA 3TDKA 1IZNB 2Q6QA 4RJTA 2NPSD 5GTHE 1Z56A 1NTMJ 2Q3EA 2HODA 1SQQG 2WVRA 2M3EA 3H25A 4YTPC 1SQPG 3E7KA 3GZXA 1BSNA 3RL0B 3RL0g 1NYKA 2NRGA 2J58A 5KJ7A 4H44C 3D89A 3HUSA 1IO4A 4NBCD 3CXHI 2KXPB 1KB9I 5HL4A 1KYOH 3I56P 4U3FG 1VQLP 3GOBA 1JY3N 1SQVE 1Q86Q 1FU1A 2KUBA 2KLVA 2Y9YA 3L73D 4N78D 3Q5RA 1HBWA 1M1JC 1O7WA 1RY3A 2WSSH 2P7JA 2NPSA 1N86A 3M0AA 4ZKUA 3P32A 4KHXA 1OVRA 3L74J 2E43A 2XSOA 3TGUG 1NTKD 3S9OA 3FGAD 3H1HD 1L2PA 2L5GB 4RESB 3L73J 2NPSB 1FS0E 2R32A 2Q3IA 3TGUD 1EQ7A 2KSJA 3VMZA 2L91A 3AE5C 2V4HA 4IFFA 5KAFE 5B66E 2K9YA 1LT1A 1N7SA 1OVVA 2HMLA 3ABVC 1OW6A 3P7KA 1LTTC 4RO0A 5E79E 1A02J 3CMEP 4P1CH 2OYHB 2Y0EA 3D6YA 3BCCD 4D6TE 2IBZI 3HE5B 5BU5A 2HODB 3HUSC 3HTKB 4KT0J 1LT9A 1KB9H 2QM8A 3H1LJ 3V2NA 3H1LG 4UB8H 1R5SA 2IFNA 2WSCJ 5AVYB 1RHZB 3QWOC 3MD0A 1VL2A 1G2CA 2ZXXA 4D6TD 3HRNA 3HTKA 3SFDC 1M90Q 4BWNA 2N1TB 1LNQA 1Y9BA 3G3ZA 3D70A 1K9MQ 3JC22 1SQPK 5KKZB 3Q5SA 2O01J 3CCUP 1GD2E 1BE3D 4YPCA 1PL5A 1L0NG 3U59A 4HM8A 2QJKB 4DZOA 3M91A 1FOSF 1EZVG 3TSIA 4I2LC 1FQTA 1AVOA 2ZAEB 3BRVB 1ZRTE 4AAYB 1NDOA 3M06A 1K05A 3VMAA 3N0QA 2P2UA 5APTA 2ZFCA 1O7NA 1K04A 1X79B 1OW8A 4QUPA 1PGOA 3GB4A 2O1KA 3TGUJ 2YVJB 1Q2NA 1GL2B 2QRXA 2B88A 2CPSA 2OYOA 3CLQA 5KLVG 5AW6B 2IX7C 4PD4D 2H8PD 5CCHD 1N8RQ 4NPFX 1QVGO 1EDIA 4NBDD 3RK2B 1L0LG 3VTPC 1NKNA 1N7LA 4UB6E 4W80A 3MIWA 5E79H 2BMQA 5H2FH 2KS1B 3A3YB 1BE3G 1YBKA 2WSEJ 2A45G 5CMZA 4PD4H 2JWDA 3B8EB 1GK4A 3LIEA 1IFDA 4HM7A 3OA7A 3U1AA 1VQ5P 2XU6A 3Q5PA 1QL2A 1YJWP 1Y47A 1N7SD 1T6AA 3Q1MA 1IFNA 1L0NJ 1BCCD 4UB8E 3VOPA 1M1JA 3A2AA 1T2KC 2LR2A 2BCCD 1IC2A 1NU1G 4H44B 3G6EP 2BMOA 5KLIC 1BGYD 3SFEC 4W7YA 5KLVD 2WZ7A 1U7JA 4GOFA 5B5EH 3L75G 2YMYA 5CHXA 1SQXE 2ZYAA 1BGYG 4OVNF 3T97B 1BDCA 3BATA 2FYNC 2PRRA 1OWAA 2FBWC 1FZBA 3K5BA 4H13D 5KJ7D 4L76A 1XTCC 1P84D 3M9HA 2XR8A 2Q3WA 3GCEA 3H1IE 3KDPB 3MUDA 4CPGA 1M1KQ 5AEUA 5APYA 2FFDB 1L4AD 3L71J 1GW4A 1HF9A 3A0BH 1NTMD 1FJKA 3N4XA 3OJAB 1GK6A 2FYUK 3GTSA 5DJUB 3PHLA 3MP7B 4H13C 1EDLA 3FWLA 2NVGA 1PP9J 2WPRA 1ZN5A 1URQD 2I1JA 1HUCA 3H1JD 2YFLA 5APVA 3RBXA 1URQA 3AEFC 2Y0DA 4JYBA 1KFNA 3VMHD 1NTZK 3A5TA 4QUQA 3CXHH 4UB6H 2B87B 2DE6D 1ZLLA 5H2FE 4I7ZB 4QDFB 5TISH 3GHGA 3AE7C 2G8YA 2KNCB 4JF7A 1GU5A 1LWUB 5AVXB 3FXEA 1T2KD 4EIJA 3PLNA 2IPPA 1EDJA 3B71A 1UUVA 2JKVA 1SQQD 1L0ND 1QX8A 1L4AB 4WWIA 1H0TA 2V7QH 3L70J 3O6QB 1S9KD 1KQSO 3OW2O 4JBZA 1Q82Q 4OWFA 2HMOA 1AQTA 3M9BA 1LTIC 3WUUA 1E5WA 1AFOA 1SQQE 2ZT9D 4TT3H 4AQRD 2ZYLA 3L72E 4H0LB 1RE3C 4Y28J 2FFDA 3CWBD 4I6MC 4N6JA 2BASA 2FKWB 1MZ9A 1NVOA 3L75J 2GUSA 2E74B 3PP5A 3EQQA 1JY2P 1YTZT 4N78E 3MZWB 2MJZA 1SQVG 2YMKA 2J59M 3T97A 3A0BE 3I55P 3MGNA 1RF1A 3PTZA 2P10A 2HMNA 1P84H 4P1BH 4NPDA 3RBZA 5CBNA 3AE9C 1DD4A 4H13B 3L71E 1ZRTD 4EOTA 2FYUJ 1KV4A 5CCHA 1NYHA 1VF5B 4HH2A 1JCCA 2YXRB 4ZMDA 1KMIZ 2JR8A 5TISE 1J1DB 3A0HE 3HE4A 4O9BA 3CC7P 2LXCB 4WVZA 1OW7A 2C0XA 2ZVNB 5KLIB 3BASA 1CZQA 5CCGA 5AVWB 2XNDH 2K3RA 1L0NK 3HD7B 3CCJP 2B24A 2A06G 2KS1A 4DOJA 3M0DC 2HMKA 2JDIH 3H1LD 4AYCA 5CJ4A 3B5ND 4XE5B 3KPEA 1KN7A 1UIXA 4D6TG 4IOIH 3MTUE 1GMJA 1VQNP 4U3FJ 3L71G 4HM6A 2XV5A 1GZLA 1VCKA 1SFCA 3RK2D 1K8AQ 2R5DA 1VQ6P 1G8JB 1IK7A 1BCCE 3CCQP 3NXSA 5AW8B 5APXA 2XZRA 1FDOA 1VF5D 3TNUB 1FZEA 1M8OB 1SQQJ 1EZVD 2WQYC 1AVYA 1NTMG 2DW3A 5KTBA 1SQXJ 4NB9D 2ZYGA 5TJHA 2FXMA 2A06E 2Z4EA 3RK3E 4YXWH 2HG5D 1KZUB 1KFMA 1ZR4A 2NUMA 3PH0A 2YO2A 2Z5IA 3RL0C 3AZCA 4HJGH 1CSBA 2R3CA 1M56D 4LLHA 2N1TA 1SQBE 2M8RA 5C39A 2P58A 5APWA 4ZNCA 4DCKA 1JTHA 1KYOI 1NU1J 1SQPE 3L70G 2B9BA 1HWTC 1LT9B 2Y9ZA 2YO3A 3HE5A 1G1JA 2A45I 2KIKA 1PFIA 3L70D 1NAYA 3G71P 1QEXA 3TF5A 1LTJB 2O3JA 1DD3A 3WUVA 2YIUC 3CMAP 3GL2A 3VP9A 2QJKC 1SFCC 1D7MA 5DJTB 2DE7D 2ZVOB 2Q5UA 2W6AA 1RFSA 3SSUA 3SWYA 3Q3DA 2R5BA 3RK3C 1ZV8A 1FZCB 4IL6X 3B5NA 5AVUB 1JO5A 1R5LA 3HD7D 1KILA 4HKZH 3WU2H 2KZIA 1YI2P 3RL0D 1ZP0C 1ZR2A 4HYTB 1MV8A 1N73C 3PJSK 1DIPA 3V2PA 2E4QA 1FBMA 1KQLA 1J2JB 4PJ0E 2M0BA 3MHVA 1VF5C 1YQ4C 2XDJA 1SQXD 1ZOYC 2K9JB 3BCCG 1YITP 2QA4P 2HMMA 4QURA 1FJPA 2HPCA 3JSVC 2IDBA 1Q7YQ 4HM3A 1VQ4P 1W2BO 2BCCG 3HD7C 1RF0A 3LW5H 2Q1KA 3GMAA 1H8AA 1VQOP 2QVAA 1SQVJ 4EI2A 4C7NB 1PGQA 3CXHD 4GDOA 2N1TD 2IZ1A 1DH3A 3FXDA 1KD1Q 4I1LA 1TU3F 1G8KB 1H89A 3F89A 1EC5A 1LTJC 1BDDA 1EZVE 3L71D 2YFJA 3C0DA 1H88A 1AV1A 2A45H 2QEXP 1RF1C 3VMYA 1LT9C 2G3AA 2E75D 1P84I 3E1RA 5B66H 3CCEP 2NUKA 1WT6A 2E5YA 2AEJA 4WY4C 5AW5B 3PRJA 4QMAA 2HR3A 3L72J 4M3LA 3FOUA 1BE3J 2R3SA 1AJYA 1FZGA 1X0TA 3CD6P 3V2RA 5EFWB 4OGQD 3HE4B 5KLVE 5KLVJ 1GTWA 4WY4D 1BCCJ 3WU2E 4MN4C 2GA1A 2W6JH 3VMGD 2OYIC 2IBZE 1S3JA 1VQMP 1T3UA 1SQBK 2P1JA 2W6BA 3L74G 2OYIA 3EQ2A 2KZJA 1NTME 3SWKA 2W90A 3L72G 3GTEA 2Q7CA 2GBXA 1L0LK 1NGMB 3VCPA 4OGQC 5APUA 3D71A 2V7QJ 3IFMA 1PP9G 2YKOA 1EXJA 4HM5A 3BVHA 1NJIQ 1UUWA 2ITAA 5AW2B 2WMMA 2PAJA 3OAKA 1SQBG 2W8ZA 3AECC 3RK2C 1RE4C 3KZIH 3C1LA 1JOCA 4WB4A 2NVFA 1OXZA 2I1KA 2GM4A 1X22A 4H0LD 2D2CB 4C46A 4IL6E 1M7LA 1N2DC 2CPBA 1WRGA 1QGKB 4WY4B 1CI6B 1SQXK 1N7SC 4HKVA 1CI6A 4WY4A 1GL2C 1JY2N 1JMMA 2Z5HA 4GKGA 2FYNB 4BRYA 1HTLC 1SQBJ 1YYCA 2E74D 2KOGA 3CXHE 2PFXA 2QM7A 2C9LY 2A06D 2W27A 1RF0C 1S9KE 5AVTB 1KB9D 1N73A 4HM4A 1H0TB 1L4AA 3BCCJ 2C0WA 2P67A 1VM9A 3AEDC 3H1IG 1L0NE 1NTMK 2YIUB 3CI9A 2M5AA 1RQVA 1NU1K 1RQUA 2PGDA 2H7HA 1NTZD 2KI7B 5CCGC 4PV1D 1URQC 1LWUA 2KNCA 2KK7A 2XSHA 1NTKG 4QDFA 3H32B 3QH9A 2XRXA 1PP9D 2E76B 4DJGA 4H44D 4D6TJ 1S5LX 2QIWA 3KQGA 1HGVA 5AW4B 4U7JA 2KYVA 2FFDC 5BVZA 4HM0A 2WTYA 2B1XA 2GUVA 1YJNP 2E5TA 1EXIA 4R4LA 3WUTA 5AVSB 1RE3A 1S5LH 4EDFA 2Y0CA 1LTBC 4OGQB 3LIDA 1QLED 1BCCG 1OFCX 1OX3A 2OTKE 5B5EE 4K3AA 3VMXA 3O8ZA 1BSHA 3H32A 3VMID 3RK3D 5BU8B 4NB8D 4PJ0H 2NZ2A 1YTZI 2BEQD 2JWAA 3BRTB 2N9YB 1HJ0A 1PPJE 4Y99B 2XNXA 2M5AB 4AIVA 1LTSC 1K73Q 1USDA 2IYPA 4HM1A 4IL6H 4B86A 2YKPA 5APQA 1EG9A 3AE4C 1LTGC 1N73B 3H6PA 3KXDA 2BCCJ 4BRYB 1QVFO 2OYHC 3L37A 3CX5H 1S2EA 1U57A 1YJ9P 1SQBD 2CKFA 2UWJE 1SS1A 1SQPD 1M1JB 4ASVA 1Q81Q 1PGJA 2KB7P 4L74A 1FOSE 3AEBC 1S1CX 1NU1D 4AUWA 5CBOA 2ZT9C 2FYUE 4L73A 3LW5J 3GKEA 3TK1A 3G9RA 2IBZG 2NVEA 2I7FA 1JM1A 1SLQA 1ULIA 3CWBE 2B89A 1VQ8P 1KB9E 3S4RA 2LXBA 1OIPA 2WSCH 2BEZF 3H1ID 1FAVA 3H1HE 2QE7H 2H89C 3L73G 2OYIB 1KILB 1JM0A 3B5NB 3D6ZA 3AE2C 4BXLA 1FZCA 2MKVA 1HVVA 2QJYB 2Q9IA 2O01H 1NTZJ 2WPVB 1LP1A 4JQ0D 4U3FE 4HB1A 3MUDC 5CCGD 4KJMA 1JB0J 1KILE 1VDFA 3CC2P 1T3JA 3IAOA 2ZYDA 3S1KA 2K37A 3H1KE 3P8MC 1A02F 1PZQA 2YKQA 1JY3P 1KYOE 1GU4A 2ZXEB 2BCCE 2YFIA 3VP8A 2RN0A 1M57D 3KZIE 3NTNA 3CL3D 3ITKA 4GOEA 1MFTA 2SPZA 2YNYA 2QG4A 3H1HG 1G2CB 1P84E 1UIIA 1NHLA 2JO1A 2ZJSE 1O7PA 3C9IA 4DT0A 1KQFB 4GIFA 1JUNA 2AEFA 4WBAA 1HJBA 2K1AA 1KC8Q 1EZVI 3AEGC 4C7NA 3EWKA 4IFDK 1J1EB 3V6IA 1NTKE 2FXPA 3A0HH 2OYHA 4PD4E 2HYNA 2HPCB 1WQLA 1JNMA
chains in the Genus database with same CATH topology
2A06E 2XSOA 2QPZA 4HKVA 2BMOA 2NUKA 1PPJE 5AEWA 3TGUE 5KLIC 2NUMA 1ZRTE 3CXHE 3L75E 2E74D 4AIVA 4AAYB 3AZCA 1Q90C 3CX5E 1L0LE 1NDOA 3FOUA 4HM1A 2BMRA 1UUVA 3N0QA 4HM4A 4NBED 1BGYE 4QDCA 2E4QA 3EN1A 4U3FE 4NBBD 1SQXE 3L74E 1EG9A 1O7NA 4OGQD 5KLVE 4QCKA 1VM9A 2D2CD 4QDDA 4EMJB 4QUPA 1SQBE 3VMGD 1NTZE 2IBZE 2FYNC 1L0NE 3GB4A 2YVJB 4H13D 1SQPE 2HMLA 2HMOA 3GL0A 2B24A 4NBHD 2NWFA 2HMMA 2CKFA 4QURA 2XR8A 4PV1D 1SJGA 3H1KE 1NTME 2Q3WA 2HMKA 3GCEA 3H1IE 4P1CH 3GZYA 1SQQE 2ZT9D 5AEUA 2XSHA 4HM3A 3GTEA 1NU1E 2GBXA 1KYOE 2ZYLA 4QDFA 2BCCE 2QJYC 2YFIA 3GZXA 3L72E 4D6TE 2XRXA 3VCPA 4H44D 2JO6A 1NYKA 2YIUC 3BCCE 4NBDD 2DE5D 3D89A 3GL2A 4NBAD 2JZAA 2FYUE 2QJKC 4HM5A 3DQYA 4HM6A 2BMQA 1UUWA 1PP9E 2E76D 1P84E 2HMJA 3GTSA 1O7MA 1ULJA 3GKEA 1VCKA 2DE7D 4HM0A 5KKZC 2B1XA 4NBCD 1O7PA 3H1LE 5HL4A 1G8KB 3EQQA 2NVGA 1RFSA 2QJPC 4HM7A 2NVEA 2E4PA 1G8JB 2I7FA 4NBFD 1JM1A 2YFLA 3GOBA 1SQVE 1BCCE 1O7GA 3VMHD 1BE3E 4HM2A 1ULIA 1EZVE 2NVFA 3CWBE 4QUQA 5BOKA 2YFJA 3C0DA 2DE6D 1VF5D 2HMNA 3H1JE 1O7WA 4H0LD 1KB9E 4NBGD 4P1BH 5CXMA 4QDFB 1NTKE 3VMID 3VCAA 2GBWA 2E75D 3H1HE 4HM8A 4PD4E 3L73E 3L71E 4HJLA 4NB8D 1WQLA 4NB9D 1O7HA 3L70E 1FQTA 1RIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 E;  2XSO A;  2QPZ A;  4HKV A;  2BMO A;  2NUK A;  1PPJ E;  5AEW A;  3TGU E;  5KLI C;  2NUM A;  1ZRT E;  3CXH E;  3L75 E;  2E74 D;  4AIV A;  4AAY B;  3AZC A;  1Q90 C;  3CX5 E;  1L0L E;  1NDO A;  3FOU A;  4HM1 A;  2BMR A;  1UUV A;  3N0Q A;  4HM4 A;  4NBE D;  1BGY E;  4QDC A;  2E4Q A;  3EN1 A;  4U3F E;  4NBB D;  1SQX E;  3L74 E;  1EG9 A;  1O7N A;  4OGQ D;  5KLV E;  4QCK A;  1VM9 A;  2D2C D;  4QDD A;  4EMJ B;  4QUP A;  1SQB E;  3VMG D;  1NTZ E;  2IBZ E;  2FYN C;  1L0N E;  3GB4 A;  2YVJ B;  4H13 D;  1SQP E;  2HML A;  2HMO A;  3GL0 A;  2B24 A;  4NBH D;  2NWF A;  2HMM A;  2CKF A;  4QUR A;  2XR8 A;  4PV1 D;  1SJG A;  3H1K E;  1NTM E;  2Q3W A;  2HMK A;  3GCE A;  3H1I E;  4P1C H;  3GZY A;  1SQQ E;  2ZT9 D;  5AEU A;  2XSH A;  4HM3 A;  3GTE A;  1NU1 E;  2GBX A;  1KYO E;  2ZYL A;  4QDF A;  2BCC E;  2QJY C;  2YFI A;  3GZX A;  3L72 E;  4D6T E;  2XRX A;  3VCP A;  4H44 D;  2JO6 A;  1NYK A;  2YIU C;  3BCC E;  4NBD D;  2DE5 D;  3D89 A;  3GL2 A;  4NBA D;  2JZA A;  2FYU E;  2QJK C;  4HM5 A;  3DQY A;  4HM6 A;  2BMQ A;  1UUW A;  1PP9 E;  2E76 D;  1P84 E;  2HMJ A;  3GTS A;  1O7M A;  1ULJ A;  3GKE A;  1VCK A;  2DE7 D;  4HM0 A;  5KKZ C;  2B1X A;  4NBC D;  1O7P A;  3H1L E;  5HL4 A;  1G8K B;  3EQQ A;  2NVG A;  1RFS A;  2QJP C;  4HM7 A;  2NVE A;  2E4P A;  1G8J B;  2I7F A;  4NBF D;  1JM1 A;  2YFL A;  3GOB A;  1SQV E;  1BCC E;  1O7G A;  3VMH D;  1BE3 E;  4HM2 A;  1ULI A;  1EZV E;  2NVF A;  3CWB E;  4QUQ A;  5BOK A;  2YFJ A;  3C0D A;  2DE6 D;  1VF5 D;  2HMN A;  3H1J E;  1O7W A;  4H0L D;  1KB9 E;  4NBG D;  4P1B H;  5CXM A;  4QDF B;  1NTK E;  3VMI D;  3VCA A;  2GBW A;  2E75 D;  3H1H E;  4HM8 A;  4PD4 E;  3L73 E;  3L71 E;  4HJL A;  4NB8 D;  1WQL A;  4NB9 D;  1O7H A;  3L70 E;  1FQT A;  1RIE A; 
#chains in the Genus database with same CATH topology
 1AQ5 A;  1S4X A;  2KSE A;  2K9J A;  3JCU H;  5AEW A;  3CCS P;  1WMK A;  1N7S B;  3TNU A;  2KP8 A;  4A7P A;  2BMR A;  5AW0 B;  1G1I A;  1MKM A;  1HH0 A;  2NPS C;  3H1H J;  1W2E A;  2POH A;  5AVR B;  4EMJ B;  3E1I A;  3U1C A;  1NOH A;  3VYI A;  1SP4 A;  2E75 B;  3L74 D;  3CCM P;  2R44 A;  3CWB J;  2FYU D;  2W83 C;  4JYC A;  4NBH D;  3NFQ A;  4OH8 B;  1ZXG A;  1FE6 A;  2CK3 H;  4K35 A;  3GF7 A;  1L0L J;  3R2P A;  1OMI A;  5AVV B;  2OTL P;  1NO4 A;  2IZ0 A;  4ZKP A;  3Q2Y A;  5AVQ B;  3DQY A;  1JY2 O;  2E76 D;  1PP9 E;  3L36 A;  5KAI E;  4JPZ B;  1ULJ A;  1SQQ K;  3FWN A;  5AW9 B;  3CX5 I;  3HD7 A;  3W67 A;  3CCR P;  4N3Y B;  4LGD E;  1J1E C;  3HUS B;  1EDK A;  2QJP C;  1OZH A;  1BE3 E;  1LP1 B;  3UIA A;  1CW5 A;  1LTJ A;  3I5C A;  4NBG D;  5M1B A;  4TLF A;  2WSF J;  1KYO D;  4Z1M H;  3CWB G;  5KJ7 C;  1VPC A;  3L72 D;  2QPZ A;  1YIJ P;  3RK3 B;  1OVU A;  3TGU E;  5AW1 B;  1JTH B;  2H88 C;  3H1J J;  1SQP J;  2WSE H;  1FDM A;  3CX5 E;  3M9Q A;  2IBZ D;  1PPJ D;  1PIX A;  2WPQ A;  3V4Q A;  1RF1 B;  4NBB D;  3V4W A;  4LC1 A;  1KIL C;  2D2C D;  3CCL P;  1NTZ E;  1IFM A;  2E42 A;  1JEK A;  4NPE A;  3GL0 A;  1SQX G;  3RGU A;  1SQV K;  1NKZ B;  1SJG A;  3GZY A;  1JCD A;  1NH4 A;  1X8Y A;  1YQ3 C;  3IF4 A;  1NU1 E;  4R4M A;  4EYY Q;  2IYO A;  1RE4 A;  4PV1 B;  3C8V A;  2AXT H;  1W5C E;  2OAR A;  2H43 A;  1KOR A;  3USS A;  2FYZ A;  5CCH C;  1KQG B;  1Y8A A;  3IR9 A;  2ZT9 B;  3H1L E;  3VN0 A;  1SFC B;  3H1J G;  1NWQ A;  1JMB A;  2YXQ B;  4NBF D;  2AEM A;  4HM2 A;  5BOK A;  1FZF A;  2E74 C;  1XTG B;  3B4S A;  3VCA A;  1GL2 D;  1IJD B;  3R4Y A;  1RIE A;  2WIT A;  2WT7 A;  3GHG B;  2C9N Y;  1Q90 C;  1AA0 A;  1LWU C;  1YHQ P;  1KIL D;  2D2C C;  4QDC A;  3H1K J;  3L74 E;  3CCV P;  1L0L D;  2JP3 A;  1PV3 A;  3W68 A;  4QDD A;  1SVF A;  3L35 A;  2OQQ A;  4U3F D;  4XFJ A;  1ZME C;  3F5H A;  3CC4 P;  2FY8 A;  1QL1 A;  4RKU J;  3II6 A;  1VQ7 P;  5K5G B;  1USE A;  3AE1 C;  3EFG A;  3V5B A;  1J1D C;  2XKM A;  3P8C E;  1SFC D;  2QJY C;  2WPS A;  5GTI E;  2JO6 A;  2J5U A;  2VRS A;  2FYU G;  3GG2 A;  3NMD A;  1MUU A;  4NBA D;  2JZA A;  3AE8 C;  4I7Z C;  1R8E A;  3GHG C;  5AW3 B;  1JY3 O;  4XA4 A;  2E76 C;  1O7G A;  3JCU E;  1T8Z A;  4PV1 C;  2M3B A;  2RKL A;  5CJ0 A;  2JEE A;  1BGY J;  3TYY A;  2AXT E;  1S72 P;  1DEE G;  1SQV D;  3AE3 C;  2GBW A;  1LTA C;  3P8C D;  2I8D A;  1FZA A;  3L73 E;  4Y99 C;  4HJL A;  3AE6 C;  3L70 E;  1S5L E;  1LGH B;  1Q90 D;  3N7N A;  3KYQ A;  2E75 C;  1IFP A;  3L75 E;  5GTH H;  1FDI A;  3FX0 A;  1FZC C;  3O6Q A;  1BGY E;  1VQP P;  3WMM 0;  3GW6 A;  2O01 N;  2QSI A;  1DX7 A;  4QCK A;  2OGU A;  3EFF K;  5L8R J;  1FC2 C;  4L75 A;  4GT1 A;  3AEE C;  4H0L C;  3GF3 A;  3L75 D;  1X9V A;  2WT7 B;  1ZW0 A;  2NWF A;  3H1K G;  1E79 H;  5KAI H;  3L4F A;  2RMZ A;  1KTM A;  1NTZ G;  4W7Z A;  4IFM A;  3H1K D;  2O1J A;  2B87 A;  2N9B A;  3IN6 A;  1IFJ A;  2OTJ P;  1IFI A;  1RH5 B;  2DE5 D;  1PPJ G;  2HLO A;  1URQ B;  2HMJ A;  1O7M A;  4PD4 I;  2JJL A;  5KKZ C;  1NAF A;  3AEA C;  4ASW A;  1GL2 A;  5AW7 B;  5GTI H;  3B5N C;  2E4P A;  1VQK P;  3CPW O;  3M0D A;  1LJ2 A;  1NTK K;  3H1I J;  3SWF A;  1U7M A;  2FXO A;  1HGZ A;  2PP6 A;  1NTK J;  3H1J E;  3A7O A;  1L4A C;  5CXM A;  3ZDM A;  4C7R A;  5AVZ B;  1PGP A;  2IFM A;  5KLV K;  2WWW A;  5KAF H;  2N1T C;  1O7H A;  3BCC E;  3G4S P;  4YXD C;  2RH0 A;  1IK9 A;  2WSF H;  2QJP B;  1L0L E;  1GW3 A;  1MFZ A;  2LKM A;  1GDT A;  4NBE D;  3V2Q A;  3EN1 A;  2KLU A;  3CX5 D;  1VQ9 P;  2HFE D;  5APS A;  2K88 A;  1DEB A;  4GOD A;  2AXC A;  3GLM A;  3KHU A;  3TDK A;  1IZN B;  2Q6Q A;  4RJT A;  2NPS D;  5GTH E;  1Z56 A;  1NTM J;  2Q3E A;  2HOD A;  1SQQ G;  2WVR A;  2M3E A;  3H25 A;  4YTP C;  1SQP G;  3E7K A;  3GZX A;  1BSN A;  3RL0 B;  3RL0 g;  1NYK A;  2NRG A;  2J58 A;  5KJ7 A;  4H44 C;  3D89 A;  3HUS A;  1IO4 A;  4NBC D;  3CXH I;  2KXP B;  1KB9 I;  5HL4 A;  1KYO H;  3I56 P;  4U3F G;  1VQL P;  3GOB A;  1JY3 N;  1SQV E;  1Q86 Q;  1FU1 A;  2KUB A;  2KLV A;  2Y9Y A;  3L73 D;  4N78 D;  3Q5R A;  1HBW A;  1M1J C;  1O7W A;  1RY3 A;  2WSS H;  2P7J A;  2NPS A;  1N86 A;  3M0A A;  4ZKU A;  3P32 A;  4KHX A;  1OVR A;  3L74 J;  2E43 A;  2XSO A;  3TGU G;  1NTK D;  3S9O A;  3FGA D;  3H1H D;  1L2P A;  2L5G B;  4RES B;  3L73 J;  2NPS B;  1FS0 E;  2R32 A;  2Q3I A;  3TGU D;  1EQ7 A;  2KSJ A;  3VMZ A;  2L91 A;  3AE5 C;  2V4H A;  4IFF A;  5KAF E;  5B66 E;  2K9Y A;  1LT1 A;  1N7S A;  1OVV A;  2HML A;  3ABV C;  1OW6 A;  3P7K A;  1LTT C;  4RO0 A;  5E79 E;  1A02 J;  3CME P;  4P1C H;  2OYH B;  2Y0E A;  3D6Y A;  3BCC D;  4D6T E;  2IBZ I;  3HE5 B;  5BU5 A;  2HOD B;  3HUS C;  3HTK B;  4KT0 J;  1LT9 A;  1KB9 H;  2QM8 A;  3H1L J;  3V2N A;  3H1L G;  4UB8 H;  1R5S A;  2IFN A;  2WSC J;  5AVY B;  1RHZ B;  3QWO C;  3MD0 A;  1VL2 A;  1G2C A;  2ZXX A;  4D6T D;  3HRN A;  3HTK A;  3SFD C;  1M90 Q;  4BWN A;  2N1T B;  1LNQ A;  1Y9B A;  3G3Z A;  3D70 A;  1K9M Q;  3JC2 2;  1SQP K;  5KKZ B;  3Q5S A;  2O01 J;  3CCU P;  1GD2 E;  1BE3 D;  4YPC A;  1PL5 A;  1L0N G;  3U59 A;  4HM8 A;  2QJK B;  4DZO A;  3M91 A;  1FOS F;  1EZV G;  3TSI A;  4I2L C;  1FQT A;  1AVO A;  2ZAE B;  3BRV B;  1ZRT E;  4AAY B;  1NDO A;  3M06 A;  1K05 A;  3VMA A;  3N0Q A;  2P2U A;  5APT A;  2ZFC A;  1O7N A;  1K04 A;  1X79 B;  1OW8 A;  4QUP A;  1PGO A;  3GB4 A;  2O1K A;  3TGU J;  2YVJ B;  1Q2N A;  1GL2 B;  2QRX A;  2B88 A;  2CPS A;  2OYO A;  3CLQ A;  5KLV G;  5AW6 B;  2IX7 C;  4PD4 D;  2H8P D;  5CCH D;  1N8R Q;  4NPF X;  1QVG O;  1EDI A;  4NBD D;  3RK2 B;  1L0L G;  3VTP C;  1NKN A;  1N7L A;  4UB6 E;  4W80 A;  3MIW A;  5E79 H;  2BMQ A;  5H2F H;  2KS1 B;  3A3Y B;  1BE3 G;  1YBK A;  2WSE J;  2A45 G;  5CMZ A;  4PD4 H;  2JWD A;  3B8E B;  1GK4 A;  3LIE A;  1IFD A;  4HM7 A;  3OA7 A;  3U1A A;  1VQ5 P;  2XU6 A;  3Q5P A;  1QL2 A;  1YJW P;  1Y47 A;  1N7S D;  1T6A A;  3Q1M A;  1IFN A;  1L0N J;  1BCC D;  4UB8 E;  3VOP A;  1M1J A;  3A2A A;  1T2K C;  2LR2 A;  2BCC D;  1IC2 A;  1NU1 G;  4H44 B;  3G6E P;  2BMO A;  5KLI C;  1BGY D;  3SFE C;  4W7Y A;  5KLV D;  2WZ7 A;  1U7J A;  4GOF A;  5B5E H;  3L75 G;  2YMY A;  5CHX A;  1SQX E;  2ZYA A;  1BGY G;  4OVN F;  3T97 B;  1BDC A;  3BAT A;  2FYN C;  2PRR A;  1OWA A;  2FBW C;  1FZB A;  3K5B A;  4H13 D;  5KJ7 D;  4L76 A;  1XTC C;  1P84 D;  3M9H A;  2XR8 A;  2Q3W A;  3GCE A;  3H1I E;  3KDP B;  3MUD A;  4CPG A;  1M1K Q;  5AEU A;  5APY A;  2FFD B;  1L4A D;  3L71 J;  1GW4 A;  1HF9 A;  3A0B H;  1NTM D;  1FJK A;  3N4X A;  3OJA B;  1GK6 A;  2FYU K;  3GTS A;  5DJU B;  3PHL A;  3MP7 B;  4H13 C;  1EDL A;  3FWL A;  2NVG A;  1PP9 J;  2WPR A;  1ZN5 A;  1URQ D;  2I1J A;  1HUC A;  3H1J D;  2YFL A;  5APV A;  3RBX A;  1URQ A;  3AEF C;  2Y0D A;  4JYB A;  1KFN A;  3VMH D;  1NTZ K;  3A5T A;  4QUQ A;  3CXH H;  4UB6 H;  2B87 B;  2DE6 D;  1ZLL A;  5H2F E;  4I7Z B;  4QDF B;  5TIS H;  3GHG A;  3AE7 C;  2G8Y A;  2KNC B;  4JF7 A;  1GU5 A;  1LWU B;  5AVX B;  3FXE A;  1T2K D;  4EIJ A;  3PLN A;  2IPP A;  1EDJ A;  3B71 A;  1UUV A;  2JKV A;  1SQQ D;  1L0N D;  1QX8 A;  1L4A B;  4WWI A;  1H0T A;  2V7Q H;  3L70 J;  3O6Q B;  1S9K D;  1KQS O;  3OW2 O;  4JBZ A;  1Q82 Q;  4OWF A;  2HMO A;  1AQT A;  3M9B A;  1LTI C;  3WUU A;  1E5W A;  1AFO A;  1SQQ E;  2ZT9 D;  4TT3 H;  4AQR D;  2ZYL A;  3L72 E;  4H0L B;  1RE3 C;  4Y28 J;  2FFD A;  3CWB D;  4I6M C;  4N6J A;  2BAS A;  2FKW B;  1MZ9 A;  1NVO A;  3L75 J;  2GUS A;  2E74 B;  3PP5 A;  3EQQ A;  1JY2 P;  1YTZ T;  4N78 E;  3MZW B;  2MJZ A;  1SQV G;  2YMK A;  2J59 M;  3T97 A;  3A0B E;  3I55 P;  3MGN A;  1RF1 A;  3PTZ A;  2P10 A;  2HMN A;  1P84 H;  4P1B H;  4NPD A;  3RBZ A;  5CBN A;  3AE9 C;  1DD4 A;  4H13 B;  3L71 E;  1ZRT D;  4EOT A;  2FYU J;  1KV4 A;  5CCH A;  1NYH A;  1VF5 B;  4HH2 A;  1JCC A;  2YXR B;  4ZMD A;  1KMI Z;  2JR8 A;  5TIS E;  1J1D B;  3A0H E;  3HE4 A;  4O9B A;  3CC7 P;  2LXC B;  4WVZ A;  1OW7 A;  2C0X A;  2ZVN B;  5KLI B;  3BAS A;  1CZQ A;  5CCG A;  5AVW B;  2XND H;  2K3R A;  1L0N K;  3HD7 B;  3CCJ P;  2B24 A;  2A06 G;  2KS1 A;  4DOJ A;  3M0D C;  2HMK A;  2JDI H;  3H1L D;  4AYC A;  5CJ4 A;  3B5N D;  4XE5 B;  3KPE A;  1KN7 A;  1UIX A;  4D6T G;  4IOI H;  3MTU E;  1GMJ A;  1VQN P;  4U3F J;  3L71 G;  4HM6 A;  2XV5 A;  1GZL A;  1VCK A;  1SFC A;  3RK2 D;  1K8A Q;  2R5D A;  1VQ6 P;  1G8J B;  1IK7 A;  1BCC E;  3CCQ P;  3NXS A;  5AW8 B;  5APX A;  2XZR A;  1FDO A;  1VF5 D;  3TNU B;  1FZE A;  1M8O B;  1SQQ J;  1EZV D;  2WQY C;  1AVY A;  1NTM G;  2DW3 A;  5KTB A;  1SQX J;  4NB9 D;  2ZYG A;  5TJH A;  2FXM A;  2A06 E;  2Z4E A;  3RK3 E;  4YXW H;  2HG5 D;  1KZU B;  1KFM A;  1ZR4 A;  2NUM A;  3PH0 A;  2YO2 A;  2Z5I A;  3RL0 C;  3AZC A;  4HJG H;  1CSB A;  2R3C A;  1M56 D;  4LLH A;  2N1T A;  1SQB E;  2M8R A;  5C39 A;  2P58 A;  5APW A;  4ZNC A;  4DCK A;  1JTH A;  1KYO I;  1NU1 J;  1SQP E;  3L70 G;  2B9B A;  1HWT C;  1LT9 B;  2Y9Z A;  2YO3 A;  3HE5 A;  1G1J A;  2A45 I;  2KIK A;  1PFI A;  3L70 D;  1NAY A;  3G71 P;  1QEX A;  3TF5 A;  1LTJ B;  2O3J A;  1DD3 A;  3WUV A;  2YIU C;  3CMA P;  3GL2 A;  3VP9 A;  2QJK C;  1SFC C;  1D7M A;  5DJT B;  2DE7 D;  2ZVO B;  2Q5U A;  2W6A A;  1RFS A;  3SSU A;  3SWY A;  3Q3D A;  2R5B A;  3RK3 C;  1ZV8 A;  1FZC B;  4IL6 X;  3B5N A;  5AVU B;  1JO5 A;  1R5L A;  3HD7 D;  1KIL A;  4HKZ H;  3WU2 H;  2KZI A;  1YI2 P;  3RL0 D;  1ZP0 C;  1ZR2 A;  4HYT B;  1MV8 A;  1N73 C;  3PJS K;  1DIP A;  3V2P A;  2E4Q A;  1FBM A;  1KQL A;  1J2J B;  4PJ0 E;  2M0B A;  3MHV A;  1VF5 C;  1YQ4 C;  2XDJ A;  1SQX D;  1ZOY C;  2K9J B;  3BCC G;  1YIT P;  2QA4 P;  2HMM A;  4QUR A;  1FJP A;  2HPC A;  3JSV C;  2IDB A;  1Q7Y Q;  4HM3 A;  1VQ4 P;  1W2B O;  2BCC G;  3HD7 C;  1RF0 A;  3LW5 H;  2Q1K A;  3GMA A;  1H8A A;  1VQO P;  2QVA A;  1SQV J;  4EI2 A;  4C7N B;  1PGQ A;  3CXH D;  4GDO A;  2N1T D;  2IZ1 A;  1DH3 A;  3FXD A;  1KD1 Q;  4I1L A;  1TU3 F;  1G8K B;  1H89 A;  3F89 A;  1EC5 A;  1LTJ C;  1BDD A;  1EZV E;  3L71 D;  2YFJ A;  3C0D A;  1H88 A;  1AV1 A;  2A45 H;  2QEX P;  1RF1 C;  3VMY A;  1LT9 C;  2G3A A;  2E75 D;  1P84 I;  3E1R A;  5B66 H;  3CCE P;  2NUK A;  1WT6 A;  2E5Y A;  2AEJ A;  4WY4 C;  5AW5 B;  3PRJ A;  4QMA A;  2HR3 A;  3L72 J;  4M3L A;  3FOU A;  1BE3 J;  2R3S A;  1AJY A;  1FZG A;  1X0T A;  3CD6 P;  3V2R A;  5EFW B;  4OGQ D;  3HE4 B;  5KLV E;  5KLV J;  1GTW A;  4WY4 D;  1BCC J;  3WU2 E;  4MN4 C;  2GA1 A;  2W6J H;  3VMG D;  2OYI C;  2IBZ E;  1S3J A;  1VQM P;  1T3U A;  1SQB K;  2P1J A;  2W6B A;  3L74 G;  2OYI A;  3EQ2 A;  2KZJ A;  1NTM E;  3SWK A;  2W90 A;  3L72 G;  3GTE A;  2Q7C A;  2GBX A;  1L0L K;  1NGM B;  3VCP A;  4OGQ C;  5APU A;  3D71 A;  2V7Q J;  3IFM A;  1PP9 G;  2YKO A;  1EXJ A;  4HM5 A;  3BVH A;  1NJI Q;  1UUW A;  2ITA A;  5AW2 B;  2WMM A;  2PAJ A;  3OAK A;  1SQB G;  2W8Z A;  3AEC C;  3RK2 C;  1RE4 C;  3KZI H;  3C1L A;  1JOC A;  4WB4 A;  2NVF A;  1OXZ A;  2I1K A;  2GM4 A;  1X22 A;  4H0L D;  2D2C B;  4C46 A;  4IL6 E;  1M7L A;  1N2D C;  2CPB A;  1WRG A;  1QGK B;  4WY4 B;  1CI6 B;  1SQX K;  1N7S C;  4HKV A;  1CI6 A;  4WY4 A;  1GL2 C;  1JY2 N;  1JMM A;  2Z5H A;  4GKG A;  2FYN B;  4BRY A;  1HTL C;  1SQB J;  1YYC A;  2E74 D;  2KOG A;  3CXH E;  2PFX A;  2QM7 A;  2C9L Y;  2A06 D;  2W27 A;  1RF0 C;  1S9K E;  5AVT B;  1KB9 D;  1N73 A;  4HM4 A;  1H0T B;  1L4A A;  3BCC J;  2C0W A;  2P67 A;  1VM9 A;  3AED C;  3H1I G;  1L0N E;  1NTM K;  2YIU B;  3CI9 A;  2M5A A;  1RQV A;  1NU1 K;  1RQU A;  2PGD A;  2H7H A;  1NTZ D;  2KI7 B;  5CCG C;  4PV1 D;  1URQ C;  1LWU A;  2KNC A;  2KK7 A;  2XSH A;  1NTK G;  4QDF A;  3H32 B;  3QH9 A;  2XRX A;  1PP9 D;  2E76 B;  4DJG A;  4H44 D;  4D6T J;  1S5L X;  2QIW A;  3KQG A;  1HGV A;  5AW4 B;  4U7J A;  2KYV A;  2FFD C;  5BVZ A;  4HM0 A;  2WTY A;  2B1X A;  2GUV A;  1YJN P;  2E5T A;  1EXI A;  4R4L A;  3WUT A;  5AVS B;  1RE3 A;  1S5L H;  4EDF A;  2Y0C A;  1LTB C;  4OGQ B;  3LID A;  1QLE D;  1BCC G;  1OFC X;  1OX3 A;  2OTK E;  5B5E E;  4K3A A;  3VMX A;  3O8Z A;  1BSH A;  3H32 A;  3VMI D;  3RK3 D;  5BU8 B;  4NB8 D;  4PJ0 H;  2NZ2 A;  1YTZ I;  2BEQ D;  2JWA A;  3BRT B;  2N9Y B;  1HJ0 A;  1PPJ E;  4Y99 B;  2XNX A;  2M5A B;  4AIV A;  1LTS C;  1K73 Q;  1USD A;  2IYP A;  4HM1 A;  4IL6 H;  4B86 A;  2YKP A;  5APQ A;  1EG9 A;  3AE4 C;  1LTG C;  1N73 B;  3H6P A;  3KXD A;  2BCC J;  4BRY B;  1QVF O;  2OYH C;  3L37 A;  3CX5 H;  1S2E A;  1U57 A;  1YJ9 P;  1SQB D;  2CKF A;  2UWJ E;  1SS1 A;  1SQP D;  1M1J B;  4ASV A;  1Q81 Q;  1PGJ A;  2KB7 P;  4L74 A;  1FOS E;  3AEB C;  1S1C X;  1NU1 D;  4AUW A;  5CBO A;  2ZT9 C;  2FYU E;  4L73 A;  3LW5 J;  3GKE A;  3TK1 A;  3G9R A;  2IBZ G;  2NVE A;  2I7F A;  1JM1 A;  1SLQ A;  1ULI A;  3CWB E;  2B89 A;  1VQ8 P;  1KB9 E;  3S4R A;  2LXB A;  1OIP A;  2WSC H;  2BEZ F;  3H1I D;  1FAV A;  3H1H E;  2QE7 H;  2H89 C;  3L73 G;  2OYI B;  1KIL B;  1JM0 A;  3B5N B;  3D6Z A;  3AE2 C;  4BXL A;  1FZC A;  2MKV A;  1HVV A;  2QJY B;  2Q9I A;  2O01 H;  1NTZ J;  2WPV B;  1LP1 A;  4JQ0 D;  4U3F E;  4HB1 A;  3MUD C;  5CCG D;  4KJM A;  1JB0 J;  1KIL E;  1VDF A;  3CC2 P;  1T3J A;  3IAO A;  2ZYD A;  3S1K A;  2K37 A;  3H1K E;  3P8M C;  1A02 F;  1PZQ A;  2YKQ A;  1JY3 P;  1KYO E;  1GU4 A;  2ZXE B;  2BCC E;  2YFI A;  3VP8 A;  2RN0 A;  1M57 D;  3KZI E;  3NTN A;  3CL3 D;  3ITK A;  4GOE A;  1MFT A;  2SPZ A;  2YNY A;  2QG4 A;  3H1H G;  1G2C B;  1P84 E;  1UII A;  1NHL A;  2JO1 A;  2ZJS E;  1O7P A;  3C9I A;  4DT0 A;  1KQF B;  4GIF A;  1JUN A;  2AEF A;  4WBA A;  1HJB A;  2K1A A;  1KC8 Q;  1EZV I;  3AEG C;  4C7N A;  3EWK A;  4IFD K;  1J1E B;  3V6I A;  1NTK E;  2FXP A;  3A0H H;  2OYH A;  4PD4 E;  2HYN A;  2HPC B;  1WQL A;  1JNM A; 
#chains in the Genus database with same CATH homology
 2A06 E;  2XSO A;  2QPZ A;  4HKV A;  2BMO A;  2NUK A;  1PPJ E;  5AEW A;  3TGU E;  5KLI C;  2NUM A;  1ZRT E;  3CXH E;  3L75 E;  2E74 D;  4AIV A;  4AAY B;  3AZC A;  1Q90 C;  3CX5 E;  1L0L E;  1NDO A;  3FOU A;  4HM1 A;  2BMR A;  1UUV A;  3N0Q A;  4HM4 A;  4NBE D;  1BGY E;  4QDC A;  2E4Q A;  3EN1 A;  4U3F E;  4NBB D;  1SQX E;  3L74 E;  1EG9 A;  1O7N A;  4OGQ D;  5KLV E;  4QCK A;  1VM9 A;  2D2C D;  4QDD A;  4EMJ B;  4QUP A;  1SQB E;  3VMG D;  1NTZ E;  2IBZ E;  2FYN C;  1L0N E;  3GB4 A;  2YVJ B;  4H13 D;  1SQP E;  2HML A;  2HMO A;  3GL0 A;  2B24 A;  4NBH D;  2NWF A;  2HMM A;  2CKF A;  4QUR A;  2XR8 A;  4PV1 D;  1SJG A;  3H1K E;  1NTM E;  2Q3W A;  2HMK A;  3GCE A;  3H1I E;  4P1C H;  3GZY A;  1SQQ E;  2ZT9 D;  5AEU A;  2XSH A;  4HM3 A;  3GTE A;  1NU1 E;  2GBX A;  1KYO E;  2ZYL A;  4QDF A;  2BCC E;  2QJY C;  2YFI A;  3GZX A;  3L72 E;  4D6T E;  2XRX A;  3VCP A;  4H44 D;  2JO6 A;  1NYK A;  2YIU C;  3BCC E;  4NBD D;  2DE5 D;  3D89 A;  3GL2 A;  4NBA D;  2JZA A;  2FYU E;  2QJK C;  4HM5 A;  3DQY A;  4HM6 A;  2BMQ A;  1UUW A;  1PP9 E;  2E76 D;  1P84 E;  2HMJ A;  3GTS A;  1O7M A;  1ULJ A;  3GKE A;  1VCK A;  2DE7 D;  4HM0 A;  5KKZ C;  2B1X A;  4NBC D;  1O7P A;  3H1L E;  5HL4 A;  1G8K B;  3EQQ A;  2NVG A;  1RFS A;  2QJP C;  4HM7 A;  2NVE A;  2E4P A;  1G8J B;  2I7F A;  4NBF D;  1JM1 A;  2YFL A;  3GOB A;  1SQV E;  1BCC E;  1O7G A;  3VMH D;  1BE3 E;  4HM2 A;  1ULI A;  1EZV E;  2NVF A;  3CWB E;  4QUQ A;  5BOK A;  2YFJ A;  3C0D A;  2DE6 D;  1VF5 D;  2HMN A;  3H1J E;  1O7W A;  4H0L D;  1KB9 E;  4NBG D;  4P1B H;  5CXM A;  4QDF B;  1NTK E;  3VMI D;  3VCA A;  2GBW A;  2E75 D;  3H1H E;  4HM8 A;  4PD4 E;  3L73 E;  3L71 E;  4HJL A;  4NB8 D;  1WQL A;  4NB9 D;  1O7H A;  3L70 E;  1FQT A;  1RIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...