3CXHE

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 49
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cxhE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cxhE02
2E75D 1NDOA 2NVGA 3GCEA 2HMMA 1P84E 2XSOA 2BCCE 1UUWA 1RIEA 2HMLA 3CXHE 3TGUE 5AEWA 3L70E 4HM1A 4QDCA 1SQXE 1JM1A 2E74D 4H44D 1SQPE 3GL2A 4NB9D 4NBDD 3H1LE 1NTME 2YFLA 1VF5D 2FYNC 2Q3WA 3GOBA 3CWBE 1NU1E 2JO6A 2ZT9D 3VMGD 1G8JB 1SQQE 2B24A 4QCKA 2D2CD 1L0LE 2IBZE 2DE5D 4NBBD 1ULIA 5AEUA 1SQBE 3L71E 1SJGA 4NBAD 3VMHD 2FYUE 3GZXA 2ZYLA 3H1KE 2NUMA 5CXMA 3L72E 2JZAA 3GZYA 2A06E 2BMOA 1O7NA 4EMJB 2E4PA 4H13D 4U3FE 1BGYE 3CX5E 4NBFD 1KB9E 1NTKE 2XSHA 4HM5A 4NBHD 2QJKC 2BMQA 1BE3E 3EQQA 4NB8D 1SQVE 4PV1D 4HM4A 1EG9A 5BOKA 5KLIC 3L74E 1PPJE 2GBWA 1PP9E 2NVFA 4HM7A 3EN1A 2E76D 2YFJA 1O7WA 2BMRA 1NYKA 4HM8A 1O7GA 3GB4A 5HL4A 1O7HA 2DE7D 2E4QA 2HMKA 1VM9A 4NBED 3L75E 1BCCE 3VMID 3N0QA 4NBCD 3BCCE 1FQTA 2QPZA 2YVJB 2QJYC 3H1IE 1Q90C 2XR8A 4QDFA 1O7MA 4P1BH 2NUKA 5KKZC 1O7PA 1G8KB 2HMJA 4P1CH 4PD4E 2HMOA 1L0NE 4QDFB 1VCKA 4HM6A 3GTSA 2NWFA 3GL0A 3GTEA 2GBXA 5KLVE 4AAYB 4QUQA 4NBGD 2XRXA 3VCPA 4HKVA 3DQYA 3H1JE 1NTZE 1ULJA 3C0DA 3L73E 1UUVA 2HMNA 3D89A 2YFIA 1WQLA 4D6TE 2DE6D 4QURA 4HM2A 1RFSA 4HM0A 4HM3A 2YIUC 3VCAA 1EZVE 2B1XA 4OGQD 1ZRTE 3AZCA 4AIVA 2NVEA 4QDDA 3GKEA 4H0LD 3H1HE 2I7FA 1KYOE 2CKFA 4QUPA 3FOUA 2QJPC 4HJLA
chains in the Genus database with same CATH superfamily
3TK1A 4WB4A 1URQD 1SQXD 4JF7A 2J59M 1UUWA 2KLUA 2KNCA 2B87A 3MIWA 1SQPD 3BCCG 3GLMA 1AVOA 1KQSO 3L4FA 2YFLA 2NPSA 3JSVC 1NWQA 1N7SC 1S5LE 1FOSE 3K5BA 3L75D 2ITAA 5GTIH 2K1AA 5AVYB 3S9OA 3VYIA 3D6YA 1PGPA 3H1KE 3WMM0 3V4WA 2L91A 1AQTA 3MUDC 2YMKA 1BGYE 4KHXA 4HM5A 1GU4A 3A0BH 1M90Q 4PJ0H 2JWDA 3EN1A 1SQXG 2AXTE 3RL0B 1SQPG 1IK7A 4OVNF 3L35A 3H1KJ 2ZYGA 3AE5C 3QWOC 1DEBA 4QDFA 4K35A 1BGYJ 4KT0J 2YO2A 5AW4B 3RGUA 5KLVE 3OAKA 2ZAEB 2I1JA 1N73B 3AEAC 2PGDA 3L75G 3KPEA 2H89C 1NTMD 1YTZT 5AVWB 4D6TE 1KYOD 2N1TD 1N2DC 4OGQD 5CCHA 4PD4H 3H1HE 3CCJP 2Q5UA 1Q7YQ 2QJPC 1KQLA 3G3ZA 1KB9I 1FDOA 4GT1A 1ZXGA 2KS1A 3C8VA 5KLVJ 3KXDA 2OYHB 1AJYA 3VMXA 2HLOA 1IJDB 1JY3P 4D6TJ 1T2KC 3HUSC 1KYOH 4NB9D 5C39A 2KIKA 3LW5H 3AEDC 1QVFO 3H1HJ 2FYUD 3E1IA 3GHGB 3L73G 5AEUA 3VMHD 1MKMA 1SFCB 2FXMA 2JWAA 1URQA 1NTMG 2JZAA 3B5NC 2J58A 1E5WA 5GTHH 1RHZB 1KB9E 4DOJA 3B71A 1PP9D 2QRXA 4Y28J 3TSIA 5B5EH 1IFJA 2YFJA 1M7LA 2KZIA 1YHQP 3I5CA 2WT7A 2ZYAA 1WMKA 2N9BA 1JM0A 1LTJC 1SQXK 3HE4A 1SQPK 2FKWB 2Q7CA 1K04A 3H1JD 4K3AA 2FYUG 3BVHA 2WTYA 1Z56A 2NPSC 1FOSF 1KC8Q 3HD7D 1GTWA 1L0LD 1PP9G 3TGUD 3BATA 1VQ9P 3D70A 3A0HE 3RK3B 1S9KE 5E79E 2K9JA 3BRTB 5AW5B 1QGKB 3LIDA 3CPWO 3P8MC 1W5CE 3G6EP 2M0BA 4PV1C 1FZFA 4ASVA 3PLNA 2O01J 2KSJA 4EI2A 3VMGD 3OW2O 3H1JG 1NTZG 3CXHH 3M06A 3U1CA 1VQMP 2R5DA 2Q3EA 3I56P 2I8DA 3V2PA 3CC4P 3SWKA 1HWTC 5CCGA 1NTMK 4N78E 4XFJA 1FBMA 5APQA 2E74B 3TGUG 4JQ0D 4TT3H 1N7SD 3SWYA 1JY2O 2G3AA 4BWNA 2D2CB 2QJYC 4OWFA 1O7MA 1YJ9P 4P1BH 2PP6A 4RKUJ 1L0NE 1LWUA 1EDKA 3EQ2A 2OYIA 3GL0A 3PJSK 1SQBG 3L71G 1K8AQ 2XZRA 1VDFA 1GDTA 3DQYA 1FDMA 2YFIA 2E42A 2FYUK 4HM2A 5AVRB 1ZRTE 1UIXA 3AEBC 3CCVP 2IBZD 1KILA 2A45H 4W7ZA 1S2EA 1K9MQ 4OGQB 3L70D 1LT9A 1S3JA 3H1LD 2ZVNB 1M1JA 2HODB 4NPEA 2A45G 2C9LY 4ZNCA 2V4HA 4W7YA 4EDFA 3P8CE 4WY4C 4NBBD 1FZCB 2YIUB 4WWIA 2G8YA 1EXJA 5TJHA 2CPSA 2O3JA 4UB6H 3O6QA 3PTZA 1O7NA 4EIJA 1IC2A 2QJKC 3JCUH 1T2KD 4IL6X 1LNQA 1NKZB 2QG4A 3L74E 2M8RA 4RESB 4RO0A 2KYVA 3L70G 1GL2A 1L0LK 1EZVD 5CJ4A 1HTLC 2HMKA 3H1LG 3U1AA 2M5AB 2KZJA 3B5ND 2C0WA 4AUWA 1FZGA 4QUQA 3L74J 3C0DA 1D7MA 3D89A 1WQLA 3D71A 4GKGA 4UB8E 1N7SA 3VOPA 4QDDA 1SQQD 5KLIB 1IFIA 3HD7B 4HJLA 2MJZA 2Z5HA 4C46A 2HMMA 5CCGC 1EZVG 1BE3D 3CD6P 2KI7B 2NPSD 2V7QJ 1OXZA 2E76C 4LC1A 1NU1E 3EWKA 4QCKA 2QM8A 2A06D 2XNXA 2WSEJ 3HE5A 1LTAC 3H1ID 1J1DB 2ZYLA 2YXQB 2OYIC 2YKOA 4R4MA 4EMJB 4ZMDA 3CCRP 2O01N 5KAFE 4PV1D 4HM4A 1NU1J 1AV1A 2MKVA 5AVZB 1RF0A 3OJAB 3S1KA 4H0LC 3V2QA 2GUVA 3N0QA 1BE3G 1YTZI 2NZ2A 2XR8A 2BEZF 3AE4C 1GK6A 5KTBA 1HVVA 1M1JC 1DH3A 1QX8A 1HJBA 1HGVA 1JY2N 3NXSA 1KQFB 4HKZH 5M1BA 3AE2C 1AFOA 2GM4A 3H25A 5BU8B 4GODA 2A06G 1ULJA 5CCHD 2OTLP 1UIIA 4QURA 1G1IA 2W8ZA 2H7HA 1X0TA 2B1XA 1BSHA 3L72J 2QEXP 2I7FA 3WUUA 5KAIH 1P84D 2WZ7A 2WWWA 3H1KD 2E75D 3M9BA 4L74A 1BGYD 1BCCG 4LGDE 2BEQD 5AW0B 1XTGB 1G2CA 1X9VA 1JOCA 1VL2A 1GL2C 4HH2A 2YMYA 5APXA 1P84H 2QE7H 3NTNA 1LTJA 1EXIA 4C7NB 1AVYA 2BMOA 4L73A 1VQ8P 2OTKE 4B86A 1NO4A 3CX5E 5KLVD 5K5GB 3P32A 2OARA 1SQVE 1EG9A 1BSNA 4D6TD 1A02J 2ZYDA 1SQQK 2AXTH 2NVFA 3HUSB 3A5TA 1KFMA 3H1HD 4I2LC 4WY4D 1O7HA 4NBED 3CCSP 2P7JA 3BCCE 1Q82Q 1OVVA 1KFNA 3AE3C 2HMOA 3H32A 3L36A 1S5LX 1SQVJ 1IFMA 4NBGD 5APVA 5EFWB 3B5NB 1WRGA 3KYQA 1YJWP 4EYYQ 2YXRB 2JR8A 3BCCJ 5AW8B 2ZT9C 2QSIA 3RK3E 5AW1B 2HYNA 1LP1B 3BRVB 4MN4C 1GW3A 1KB9D 5GTIE 3SSUA 1VQKP 1SQXE 2KNCB 2B87B 2H8PD 1H0TA 1PIXA 1SQPE 1RH5B 3CWBD 4JPZB 1CI6A 1RF0C 1YYCA 2IZ1A 3A0BE 2Q3WA 1NHLA 1PFIA 2NPSB 4PD4I 1RY3A 1ULIA 2XNDH 4PJ0E 1TU3F 1NTKD 3HRNA 1EDIA 3N4XA 5CCGD 5CXMA 1OWAA 3VMAA 5KKZB 3G71P 1SQXJ 2OTJP 2XSHA 5B66E 1SLQA 1JNMA 3M9HA 2E76D 3KZIH 1O7WA 1CZQA 2RN0A 2E4QA 1FJPA 3CCEP 1JCDA 3CC2P 4DZOA 1T8ZA 3CMEP 3CWBG 4I7ZC 4P1CH 4PD4E 3SFEC 4QDFB 3T97A 2AXCA 1S4XA 1HGZA 2XDJA 3E1RA 3LIEA 1A02F 3L73E 1FU1A 3CCMP 1NTKG 1RFSA 1KILD 1VQOP 2WPRA 4WY4A 4H0LD 3GKEA 1U7JA 1KYOE 2ZFCA 1MFTA 3N7NA 5H2FH 3UIAA 5KLVK 3A2AA 2NVGA 2XSOA 1RIEA 2HPCA 3VMYA 2KS1B 2QJYB 4N78D 4H13C 4HM1A 3L73J 2E75B 3AE8C 4O9BA 3WU2H 3KDPB 5GTHE 2C9NY 3MTUE 3ZDMA 2H88C 2KUBA 3LW5J 2R3SA 1OIPA 4JYCA 5AVQB 2W27A 1FE6A 5B5EE 2FYUE 1MFZA 1T6AA 4DT0A 2OYHC 1MUUA 3C1LA 3P7KA 5CJ0A 1URQB 1GMJA 5APWA 2QIWA 1GL2D 2I1KA 1N86A 2WSFH 1Q86Q 1PP9E 1IK9A 1ZRTD 1NYKA 4C7RA 1DD3A 4L75A 1LTTC 3GHGC 4ZKPA 2R44A 2FFDA 2E5YA 2FYUJ 2WT7B 1SFCC 3TNUA 2YVJB 3MP7B 5AVUB 1GK4A 3HE4B 1L0LG 1Q2NA 4GDOA 2C0XA 1PP9J 5KJ7A 3F5HA 3H1JE 1NTZE 2HMNA 2DE6D 2QJKB 2K9YA 4CPGA 4HM0A 2JKVA 3CI9A 2NVEA 2PAJA 2FYNB 2RKLA 1NTKK 2BCCD 4Y99B 2SPZA 5APSA 1JMMA 3SWFA 1X22A 2J5UA 1H8AA 2VRSA 1K05A 3CXHE 5DJTB 3TGUE 3Q2YA 1FAVA 2YNYA 1OZHA 3H1JJ 3IAOA 1NTZJ 4AYCA 3HTKA 3II6A 3GMAA 1CW5A 5BU5A 3VMZA 3GF7A 3AE6C 4IL6H 5TISH 2N1TB 2ZT9D 3A3YB 1L0NJ 3M0DA 1K73Q 2AEMA 1VQ4P 1GD2E 2AEJA 1SQBE 3L71E 4U3FD 1RF1A 3PH0A 3TGUJ 2LR2A 1U57A 2AEFA 1YBKA 4NBHD 4BRYA 4DJGA 4NB8D 4GOEA 2YKPA 2E5TA 1IFDA 2BCCG 3MD0A 5APUA 2GBWA 1FJKA 1JY3O 2W83C 2O1KA 1M8OB 1SQBJ 3L71J 1ZN5A 2HFED 3TF5A 1VM9A 4NBCD 2E76B 1T3JA 2Q6QA 1ZMEC 3PRJA 3O8ZA 3EFFK 2OQQA 4DCKA 4AQRD 1NAYA 2IBZG 2POHA 1LWUB 1JO5A 2OYIB 1OX3A 2E74C 2O1JA 4H44C 3V6IA 2QM7A 4U3FG 3Q1MA 3H6PA 1JUNA 3VN0A 3V2NA 2HR3A 2D2CC 2M3BA 1NJIQ 1KQGB 1KILB 1Y47A 4H0LB 1Y8AA 1USEA 5AEWA 3L70E 1LT9B 3R4YA 1M1JB 2XU6A 3CMAP 3H1LE 4UB6E 3FXDA 2K88A 4WBAA 2FFDC 1G8JB 2B24A 3L72D 4OGQC 1Y9BA 1JTHA 4HB1A 2KOGA 1M1KQ 3L70J 1J2JB 3RBZA 4H13D 1M56D 2HG5D 1PPJD 2ZVOB 5KJ7C 3O6QB 3H1LJ 5DJUB 2Q9IA 5BOKA 2RH0A 2KLVA 1Q81Q 1L4AA 1KMIZ 1M57D 1GL2B 4YXWH 3CCUP 1DIPA 1ZLLA 1G8KB 1E79H 1SQQG 5AW6B 3GTEA 2GBXA 2WSCH 3ABVC 1MZ9A 3L72G 2WSSH 2UWJE 1VF5C 3M0DC 4HM3A 1H88A 5L8RJ 2WPVB 1QL2A 1SFCD 1N7SB 1RF1C 1PPJG 1LTSC 3GCEA 1YIJP 4LLHA 4RJTA 2Y9YA 3H1IG 1RQVA 1SQVD 1AQ5A 4ZKUA 2Y0EA 1NOHA 4JBZA 3CX5I 1W2BO 3M91A 3BCCD 3VP9A 1EQ7A 1YQ4C 1HF9A 3W67A 1J1EC 4EOTA 1JB0J 2ZT9B 3HE5B 2A06E 4N3YB 2IZ0A 2LKMA 4NBFD 3EQQA 3KQGA 3KHUA 3F89A 3FX0A 1S5LH 1OVUA 1VPCA 2BASA 1O7GA 5CBNA 1BCCE 4TLFA 5AVVB 1ZW0A 2QJPB 1R5SA 1RE3C 2E43A 2NUKA 2HMJA 1JY3N 4GOFA 1SVFA 5KAIE 2KSEA 1N73A 3CLQA 3H1KG 3VCPA 1ZV8A 2W6BA 5AW3B 3VP8A 2IX7C 1BGYG 2JEEA 2P67A 3VCAA 1PGOA 3AZCA 2IPPA 3Q3DA 5AW2B 3Q5PA 1BCCJ 4IFDK 1YQ3C 3V5BA 2KB7P 2P58A 1RQUA 2L5GB 2CPBA 3GF3A 2Y0DA 2OYHA 5AVXB 1P84E 4IFFA 1MV8A 3E7KA 1FZEA 2Y0CA 1JM1A 4I7ZB 2E74D 1X79B 3CCLP 4H44D 3GL2A 4NBDD 1VQ7P 2Q3IA 1G2CB 1L4AC 1JY2P 2WPQA 2LXCB 5KLVG 3AEEC 3RK2C 3GHGA 1VQ5P 1OW8A 1IZNB 1SFCA 2D2CD 1G1JA 1QEXA 1OFCX 4D6TG 3VTPC 1LTJB 3GZXA 4PD4D 2ZJSE 3H1HG 3RBXA 5B66H 3TDKA 2WMMA 1S1CX 4YTPC 3L73D 4H13B 2WPSA 3NMDA 1AA0A 3G9RA 3W68A 1DEEG 3L75E 1KB9H 1FQTA 3GW6A 2JDIH 1SQPJ 4U7JA 3EFGA 1SQVK 2NWFA 5KJ7D 1KYOI 2CK3H 3H32B 3PHLA 1LTIC 4PV1B 3ITKA 1QLED 2Z4EA 4AIVA 3QH9A 3L75J 4I1LA 2JP3A 4IFMA 2CKFA 1IFNA 3Q5SA 3RL0g 1S9KD 2ZXXA 2QA4P 1JEKA 1OW7A 3D6ZA 2JJLA 1NDOA 2FYZA 2Y9ZA 3IFMA 1KD1Q 2W6AA 1OVRA 5CHXA 2RMZA 4QDCA 4BXLA 1X8YA 3A7OA 3RL0C 1HJ0A 2O01H 1NTME 2GA1A 1VF5D 1H0TB 3A0HH 1CI6B 3CWBE 5E79H 2DE5D 2FY8A 1SJGA 3KZIE 2IFMA 3V2RA 1N73C 1EDJA 3M0AA 2W6JH 1FDIA 2E4PA 1NTKE 1LT1A 3IN6A 1ZR4A 1NTMJ 2R5BA 1NTZD 2OYOA 1XTCC 1VQ6P 2FXOA 1FC2C 3CWBJ 1SP4A 2BMRA 3GB4A 2W90A 2P10A 1PGQA 1L0ND 1JMBA 3AEFC 5CMZA 2QVAA 5KKZC 1NTKJ 3CXHD 1USDA 2IYOA 1VQPP 3GTSA 4YPCA 1OW6A 3TYYA 3T97B 2K3RA 5H2FE 1W2EA 2P1JA 3CXHI 2IDBA 2N1TA 4QUPA 1KILE 1SQBD 3L71D 4KJMA 4WY4B 1N7LA 4HYTB 3WU2E 1YJNP 1ZR2A 3MGNA 1R8EA 2HODA 3I55P 4N6JA 2R3CA 1DX7A 1NAFA 1NGMB 3B4SA 1KTMA 2HPCB 4GIFA 1YITP 1EC5A 1JCCA 2PFXA 1L0NG 1GU5A 1GZLA 3P8CD 1S72P 1FZCA 3GOBA 2IYPA 3WUTA 5CCHC 4H44B 5AW9B 1L0LE 2WQYC 2FBWC 3OA7A 1T3UA 2K9JB 1H89A 1QVGO 3L74D 2E75C 2BMQA 3AE7C 1L4AD 4XA4A 4L76A 2B89A 3RK2D 1FZAA 1L2PA 4Z1MH 1L0LJ 4HM8A 4WVZA 2WSFJ 2A45I 2M5AA 3RK3C 2ZXEB 1NKNA 1NYHA 2Z5IA 2FFDB 5CBOA 1Q90C 1VQNP 1NVOA 3TNUB 3L37A 1LJ2A 1URQC 1ZOYC 2KP8A 1VCKA 2N9YB 3S4RA 2R32A 3BASA 1IFPA 1WT6A 3U59A 2IBZI 5AVSB 2B88A 3CC7P 1RE4A 4HJGH 3HD7A 1LTGC 3L74G 3FOUA 4NPDA 4IL6E 4NPFX 5TISE 1ZP0C 2BCCE 2JO1A 2V7QH 1NTZK 3AE1C 3SFDC 4UB8H 1PV3A 3C9IA 2DW3A 1NU1D 5APYA 1GW4A 2YKQA 3HTKB 3GG2A 1KZUB 1L0NK 2P2UA 2FYNC 2WSEH 2JO6A 4Y99C 2M3EA 2IBZE 1VF5B 3AE9C 1VQLP 1RE3A 2BCCJ 1BDCA 3GZYA 3NFQA 1RF1B 2NRGA 4U3FE 1EZVI 3RL0D 1PL5A 3FXEA 3JCUE 4BRYB 4HM7A 2N1TC 2K37A 1LGHB 1SQBK 1NH4A 2DE7D 2XKMA 5APTA 1SS1A 2WVRA 3G4SP 3VMID 2QPZA 1DD4A 3USSA 5KAFH 4U3FJ 2WITA 1NU1G 3AECC 4HM6A 2KXPB 3MUDA 1J1EB 1OMIA 2XRXA 2XV5A 4QMAA 4HKVA 1BDDA 3Q5RA 3CL3D 1N8RQ 3V4QA 1FZCC 5AW7B 2YIUC 1EZVE 2Q1KA 1HBWA 3JC22 4IOIH 4YXDC 4R4LA 3FWLA 1FS0E 2GUSA 2FXPA 1KORA 1PZQA 2HMLA 1QL1A 1LWUC 1EDLA 1KV4A 3FWNA 3WUVA 3PP5A 3CCQP 1YI2P 1HUCA 4C7NA 1SQQE 1BCCD 3AEGC 1KILC 4NBAD 3CX5D 1FZBA 2NUMA 4I6MC 3L72E 4M3LA 1JTHB 4JYBA 2OGUA 1LT9C 3IF4A 4W80A 1BE3E 1HH0A 2H43A 1U7MA 1R5LA 1KN7A 4ASWA 5KLIC 1PPJE 3HUSA 2KK7A 1RE4C 1SQQJ 3HD7C 4A7PA 5HL4A 3IR9A 1L4AB 3MHVA 4XE5B 3CX5H 3RK2B 2LXBA 3H1IE 4OH8B 3R2PA 1O7PA 1CSBA 1LTBC 5AVTB 1BE3J 2YO3A 5BVZA 3B8EB 3B5NA 4AAYB 1NU1K 2B9BA 2PRRA 1IO4A 2WSCJ 1UUVA 3FGAD 1P84I 3MZWB 3RK3D 1J1DC 1SQVG 2IFNA 3H1IJ 3M9QA 1LP1A 1PGJA 1Q90D
chains in the Genus database with same CATH topology
2E75D 1NDOA 2NVGA 3GCEA 2HMMA 1P84E 2XSOA 2BCCE 1UUWA 1RIEA 2HMLA 3CXHE 3TGUE 5AEWA 3L70E 4HM1A 4QDCA 1SQXE 1JM1A 2E74D 4H44D 1SQPE 3GL2A 4NB9D 4NBDD 3H1LE 1NTME 2YFLA 1VF5D 2FYNC 2Q3WA 3GOBA 3CWBE 1NU1E 2JO6A 2ZT9D 3VMGD 1G8JB 1SQQE 2B24A 4QCKA 2D2CD 1L0LE 2IBZE 2DE5D 4NBBD 1ULIA 5AEUA 1SQBE 3L71E 1SJGA 4NBAD 3VMHD 2FYUE 3GZXA 2ZYLA 3H1KE 2NUMA 5CXMA 3L72E 2JZAA 3GZYA 2A06E 2BMOA 1O7NA 4EMJB 2E4PA 4H13D 4U3FE 1BGYE 3CX5E 4NBFD 1KB9E 1NTKE 2XSHA 4HM5A 4NBHD 2QJKC 2BMQA 1BE3E 3EQQA 4NB8D 1SQVE 4PV1D 4HM4A 1EG9A 5BOKA 5KLIC 3L74E 1PPJE 2GBWA 1PP9E 2NVFA 4HM7A 3EN1A 2E76D 2YFJA 1O7WA 2BMRA 1NYKA 4HM8A 1O7GA 3GB4A 5HL4A 1O7HA 2DE7D 2E4QA 2HMKA 1VM9A 4NBED 3L75E 1BCCE 3VMID 3N0QA 4NBCD 3BCCE 1FQTA 2QPZA 2YVJB 2QJYC 3H1IE 1Q90C 2XR8A 4QDFA 1O7MA 4P1BH 2NUKA 5KKZC 1O7PA 1G8KB 2HMJA 4P1CH 4PD4E 2HMOA 1L0NE 4QDFB 1VCKA 4HM6A 3GTSA 2NWFA 3GL0A 3GTEA 2GBXA 5KLVE 4AAYB 4QUQA 4NBGD 2XRXA 3VCPA 4HKVA 3DQYA 3H1JE 1NTZE 1ULJA 3C0DA 3L73E 1UUVA 2HMNA 3D89A 2YFIA 1WQLA 4D6TE 2DE6D 4QURA 4HM2A 1RFSA 4HM0A 4HM3A 2YIUC 3VCAA 1EZVE 2B1XA 4OGQD 1ZRTE 3AZCA 4AIVA 2NVEA 4QDDA 3GKEA 4H0LD 3H1HE 2I7FA 1KYOE 2CKFA 4QUPA 3FOUA 2QJPC 4HJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 D;  1NDO A;  2NVG A;  3GCE A;  2HMM A;  1P84 E;  2XSO A;  2BCC E;  1UUW A;  1RIE A;  2HML A;  3CXH E;  3TGU E;  5AEW A;  3L70 E;  4HM1 A;  4QDC A;  1SQX E;  1JM1 A;  2E74 D;  4H44 D;  1SQP E;  3GL2 A;  4NB9 D;  4NBD D;  3H1L E;  1NTM E;  2YFL A;  1VF5 D;  2FYN C;  2Q3W A;  3GOB A;  3CWB E;  1NU1 E;  2JO6 A;  2ZT9 D;  3VMG D;  1G8J B;  1SQQ E;  2B24 A;  4QCK A;  2D2C D;  1L0L E;  2IBZ E;  2DE5 D;  4NBB D;  1ULI A;  5AEU A;  1SQB E;  3L71 E;  1SJG A;  4NBA D;  3VMH D;  2FYU E;  3GZX A;  2ZYL A;  3H1K E;  2NUM A;  5CXM A;  3L72 E;  2JZA A;  3GZY A;  2A06 E;  2BMO A;  1O7N A;  4EMJ B;  2E4P A;  4H13 D;  4U3F E;  1BGY E;  3CX5 E;  4NBF D;  1KB9 E;  1NTK E;  2XSH A;  4HM5 A;  4NBH D;  2QJK C;  2BMQ A;  1BE3 E;  3EQQ A;  4NB8 D;  1SQV E;  4PV1 D;  4HM4 A;  1EG9 A;  5BOK A;  5KLI C;  3L74 E;  1PPJ E;  2GBW A;  1PP9 E;  2NVF A;  4HM7 A;  3EN1 A;  2E76 D;  2YFJ A;  1O7W A;  2BMR A;  1NYK A;  4HM8 A;  1O7G A;  3GB4 A;  5HL4 A;  1O7H A;  2DE7 D;  2E4Q A;  2HMK A;  1VM9 A;  4NBE D;  3L75 E;  1BCC E;  3VMI D;  3N0Q A;  4NBC D;  3BCC E;  1FQT A;  2QPZ A;  2YVJ B;  2QJY C;  3H1I E;  1Q90 C;  2XR8 A;  4QDF A;  1O7M A;  4P1B H;  2NUK A;  5KKZ C;  1O7P A;  1G8K B;  2HMJ A;  4P1C H;  4PD4 E;  2HMO A;  1L0N E;  4QDF B;  1VCK A;  4HM6 A;  3GTS A;  2NWF A;  3GL0 A;  3GTE A;  2GBX A;  5KLV E;  4AAY B;  4QUQ A;  4NBG D;  2XRX A;  3VCP A;  4HKV A;  3DQY A;  3H1J E;  1NTZ E;  1ULJ A;  3C0D A;  3L73 E;  1UUV A;  2HMN A;  3D89 A;  2YFI A;  1WQL A;  4D6T E;  2DE6 D;  4QUR A;  4HM2 A;  1RFS A;  4HM0 A;  4HM3 A;  2YIU C;  3VCA A;  1EZV E;  2B1X A;  4OGQ D;  1ZRT E;  3AZC A;  4AIV A;  2NVE A;  4QDD A;  3GKE A;  4H0L D;  3H1H E;  2I7F A;  1KYO E;  2CKF A;  4QUP A;  3FOU A;  2QJP C;  4HJL A; 
#chains in the Genus database with same CATH topology
 3TK1 A;  4WB4 A;  1URQ D;  1SQX D;  4JF7 A;  2J59 M;  1UUW A;  2KLU A;  2KNC A;  2B87 A;  3MIW A;  1SQP D;  3BCC G;  3GLM A;  1AVO A;  1KQS O;  3L4F A;  2YFL A;  2NPS A;  3JSV C;  1NWQ A;  1N7S C;  1S5L E;  1FOS E;  3K5B A;  3L75 D;  2ITA A;  5GTI H;  2K1A A;  5AVY B;  3S9O A;  3VYI A;  3D6Y A;  1PGP A;  3H1K E;  3WMM 0;  3V4W A;  2L91 A;  1AQT A;  3MUD C;  2YMK A;  1BGY E;  4KHX A;  4HM5 A;  1GU4 A;  3A0B H;  1M90 Q;  4PJ0 H;  2JWD A;  3EN1 A;  1SQX G;  2AXT E;  3RL0 B;  1SQP G;  1IK7 A;  4OVN F;  3L35 A;  3H1K J;  2ZYG A;  3AE5 C;  3QWO C;  1DEB A;  4QDF A;  4K35 A;  1BGY J;  4KT0 J;  2YO2 A;  5AW4 B;  3RGU A;  5KLV E;  3OAK A;  2ZAE B;  2I1J A;  1N73 B;  3AEA C;  2PGD A;  3L75 G;  3KPE A;  2H89 C;  1NTM D;  1YTZ T;  5AVW B;  4D6T E;  1KYO D;  2N1T D;  1N2D C;  4OGQ D;  5CCH A;  4PD4 H;  3H1H E;  3CCJ P;  2Q5U A;  1Q7Y Q;  2QJP C;  1KQL A;  3G3Z A;  1KB9 I;  1FDO A;  4GT1 A;  1ZXG A;  2KS1 A;  3C8V A;  5KLV J;  3KXD A;  2OYH B;  1AJY A;  3VMX A;  2HLO A;  1IJD B;  1JY3 P;  4D6T J;  1T2K C;  3HUS C;  1KYO H;  4NB9 D;  5C39 A;  2KIK A;  3LW5 H;  3AED C;  1QVF O;  3H1H J;  2FYU D;  3E1I A;  3GHG B;  3L73 G;  5AEU A;  3VMH D;  1MKM A;  1SFC B;  2FXM A;  2JWA A;  1URQ A;  1NTM G;  2JZA A;  3B5N C;  2J58 A;  1E5W A;  5GTH H;  1RHZ B;  1KB9 E;  4DOJ A;  3B71 A;  1PP9 D;  2QRX A;  4Y28 J;  3TSI A;  5B5E H;  1IFJ A;  2YFJ A;  1M7L A;  2KZI A;  1YHQ P;  3I5C A;  2WT7 A;  2ZYA A;  1WMK A;  2N9B A;  1JM0 A;  1LTJ C;  1SQX K;  3HE4 A;  1SQP K;  2FKW B;  2Q7C A;  1K04 A;  3H1J D;  4K3A A;  2FYU G;  3BVH A;  2WTY A;  1Z56 A;  2NPS C;  1FOS F;  1KC8 Q;  3HD7 D;  1GTW A;  1L0L D;  1PP9 G;  3TGU D;  3BAT A;  1VQ9 P;  3D70 A;  3A0H E;  3RK3 B;  1S9K E;  5E79 E;  2K9J A;  3BRT B;  5AW5 B;  1QGK B;  3LID A;  3CPW O;  3P8M C;  1W5C E;  3G6E P;  2M0B A;  4PV1 C;  1FZF A;  4ASV A;  3PLN A;  2O01 J;  2KSJ A;  4EI2 A;  3VMG D;  3OW2 O;  3H1J G;  1NTZ G;  3CXH H;  3M06 A;  3U1C A;  1VQM P;  2R5D A;  2Q3E A;  3I56 P;  2I8D A;  3V2P A;  3CC4 P;  3SWK A;  1HWT C;  5CCG A;  1NTM K;  4N78 E;  4XFJ A;  1FBM A;  5APQ A;  2E74 B;  3TGU G;  4JQ0 D;  4TT3 H;  1N7S D;  3SWY A;  1JY2 O;  2G3A A;  4BWN A;  2D2C B;  2QJY C;  4OWF A;  1O7M A;  1YJ9 P;  4P1B H;  2PP6 A;  4RKU J;  1L0N E;  1LWU A;  1EDK A;  3EQ2 A;  2OYI A;  3GL0 A;  3PJS K;  1SQB G;  3L71 G;  1K8A Q;  2XZR A;  1VDF A;  1GDT A;  3DQY A;  1FDM A;  2YFI A;  2E42 A;  2FYU K;  4HM2 A;  5AVR B;  1ZRT E;  1UIX A;  3AEB C;  3CCV P;  2IBZ D;  1KIL A;  2A45 H;  4W7Z A;  1S2E A;  1K9M Q;  4OGQ B;  3L70 D;  1LT9 A;  1S3J A;  3H1L D;  2ZVN B;  1M1J A;  2HOD B;  4NPE A;  2A45 G;  2C9L Y;  4ZNC A;  2V4H A;  4W7Y A;  4EDF A;  3P8C E;  4WY4 C;  4NBB D;  1FZC B;  2YIU B;  4WWI A;  2G8Y A;  1EXJ A;  5TJH A;  2CPS A;  2O3J A;  4UB6 H;  3O6Q A;  3PTZ A;  1O7N A;  4EIJ A;  1IC2 A;  2QJK C;  3JCU H;  1T2K D;  4IL6 X;  1LNQ A;  1NKZ B;  2QG4 A;  3L74 E;  2M8R A;  4RES B;  4RO0 A;  2KYV A;  3L70 G;  1GL2 A;  1L0L K;  1EZV D;  5CJ4 A;  1HTL C;  2HMK A;  3H1L G;  3U1A A;  2M5A B;  2KZJ A;  3B5N D;  2C0W A;  4AUW A;  1FZG A;  4QUQ A;  3L74 J;  3C0D A;  1D7M A;  3D89 A;  1WQL A;  3D71 A;  4GKG A;  4UB8 E;  1N7S A;  3VOP A;  4QDD A;  1SQQ D;  5KLI B;  1IFI A;  3HD7 B;  4HJL A;  2MJZ A;  2Z5H A;  4C46 A;  2HMM A;  5CCG C;  1EZV G;  1BE3 D;  3CD6 P;  2KI7 B;  2NPS D;  2V7Q J;  1OXZ A;  2E76 C;  4LC1 A;  1NU1 E;  3EWK A;  4QCK A;  2QM8 A;  2A06 D;  2XNX A;  2WSE J;  3HE5 A;  1LTA C;  3H1I D;  1J1D B;  2ZYL A;  2YXQ B;  2OYI C;  2YKO A;  4R4M A;  4EMJ B;  4ZMD A;  3CCR P;  2O01 N;  5KAF E;  4PV1 D;  4HM4 A;  1NU1 J;  1AV1 A;  2MKV A;  5AVZ B;  1RF0 A;  3OJA B;  3S1K A;  4H0L C;  3V2Q A;  2GUV A;  3N0Q A;  1BE3 G;  1YTZ I;  2NZ2 A;  2XR8 A;  2BEZ F;  3AE4 C;  1GK6 A;  5KTB A;  1HVV A;  1M1J C;  1DH3 A;  1QX8 A;  1HJB A;  1HGV A;  1JY2 N;  3NXS A;  1KQF B;  4HKZ H;  5M1B A;  3AE2 C;  1AFO A;  2GM4 A;  3H25 A;  5BU8 B;  4GOD A;  2A06 G;  1ULJ A;  5CCH D;  2OTL P;  1UII A;  4QUR A;  1G1I A;  2W8Z A;  2H7H A;  1X0T A;  2B1X A;  1BSH A;  3L72 J;  2QEX P;  2I7F A;  3WUU A;  5KAI H;  1P84 D;  2WZ7 A;  2WWW A;  3H1K D;  2E75 D;  3M9B A;  4L74 A;  1BGY D;  1BCC G;  4LGD E;  2BEQ D;  5AW0 B;  1XTG B;  1G2C A;  1X9V A;  1JOC A;  1VL2 A;  1GL2 C;  4HH2 A;  2YMY A;  5APX A;  1P84 H;  2QE7 H;  3NTN A;  1LTJ A;  1EXI A;  4C7N B;  1AVY A;  2BMO A;  4L73 A;  1VQ8 P;  2OTK E;  4B86 A;  1NO4 A;  3CX5 E;  5KLV D;  5K5G B;  3P32 A;  2OAR A;  1SQV E;  1EG9 A;  1BSN A;  4D6T D;  1A02 J;  2ZYD A;  1SQQ K;  2AXT H;  2NVF A;  3HUS B;  3A5T A;  1KFM A;  3H1H D;  4I2L C;  4WY4 D;  1O7H A;  4NBE D;  3CCS P;  2P7J A;  3BCC E;  1Q82 Q;  1OVV A;  1KFN A;  3AE3 C;  2HMO A;  3H32 A;  3L36 A;  1S5L X;  1SQV J;  1IFM A;  4NBG D;  5APV A;  5EFW B;  3B5N B;  1WRG A;  3KYQ A;  1YJW P;  4EYY Q;  2YXR B;  2JR8 A;  3BCC J;  5AW8 B;  2ZT9 C;  2QSI A;  3RK3 E;  5AW1 B;  2HYN A;  1LP1 B;  3BRV B;  4MN4 C;  1GW3 A;  1KB9 D;  5GTI E;  3SSU A;  1VQK P;  1SQX E;  2KNC B;  2B87 B;  2H8P D;  1H0T A;  1PIX A;  1SQP E;  1RH5 B;  3CWB D;  4JPZ B;  1CI6 A;  1RF0 C;  1YYC A;  2IZ1 A;  3A0B E;  2Q3W A;  1NHL A;  1PFI A;  2NPS B;  4PD4 I;  1RY3 A;  1ULI A;  2XND H;  4PJ0 E;  1TU3 F;  1NTK D;  3HRN A;  1EDI A;  3N4X A;  5CCG D;  5CXM A;  1OWA A;  3VMA A;  5KKZ B;  3G71 P;  1SQX J;  2OTJ P;  2XSH A;  5B66 E;  1SLQ A;  1JNM A;  3M9H A;  2E76 D;  3KZI H;  1O7W A;  1CZQ A;  2RN0 A;  2E4Q A;  1FJP A;  3CCE P;  1JCD A;  3CC2 P;  4DZO A;  1T8Z A;  3CME P;  3CWB G;  4I7Z C;  4P1C H;  4PD4 E;  3SFE C;  4QDF B;  3T97 A;  2AXC A;  1S4X A;  1HGZ A;  2XDJ A;  3E1R A;  3LIE A;  1A02 F;  3L73 E;  1FU1 A;  3CCM P;  1NTK G;  1RFS A;  1KIL D;  1VQO P;  2WPR A;  4WY4 A;  4H0L D;  3GKE A;  1U7J A;  1KYO E;  2ZFC A;  1MFT A;  3N7N A;  5H2F H;  3UIA A;  5KLV K;  3A2A A;  2NVG A;  2XSO A;  1RIE A;  2HPC A;  3VMY A;  2KS1 B;  2QJY B;  4N78 D;  4H13 C;  4HM1 A;  3L73 J;  2E75 B;  3AE8 C;  4O9B A;  3WU2 H;  3KDP B;  5GTH E;  2C9N Y;  3MTU E;  3ZDM A;  2H88 C;  2KUB A;  3LW5 J;  2R3S A;  1OIP A;  4JYC A;  5AVQ B;  2W27 A;  1FE6 A;  5B5E E;  2FYU E;  1MFZ A;  1T6A A;  4DT0 A;  2OYH C;  1MUU A;  3C1L A;  3P7K A;  5CJ0 A;  1URQ B;  1GMJ A;  5APW A;  2QIW A;  1GL2 D;  2I1K A;  1N86 A;  2WSF H;  1Q86 Q;  1PP9 E;  1IK9 A;  1ZRT D;  1NYK A;  4C7R A;  1DD3 A;  4L75 A;  1LTT C;  3GHG C;  4ZKP A;  2R44 A;  2FFD A;  2E5Y A;  2FYU J;  2WT7 B;  1SFC C;  3TNU A;  2YVJ B;  3MP7 B;  5AVU B;  1GK4 A;  3HE4 B;  1L0L G;  1Q2N A;  4GDO A;  2C0X A;  1PP9 J;  5KJ7 A;  3F5H A;  3H1J E;  1NTZ E;  2HMN A;  2DE6 D;  2QJK B;  2K9Y A;  4CPG A;  4HM0 A;  2JKV A;  3CI9 A;  2NVE A;  2PAJ A;  2FYN B;  2RKL A;  1NTK K;  2BCC D;  4Y99 B;  2SPZ A;  5APS A;  1JMM A;  3SWF A;  1X22 A;  2J5U A;  1H8A A;  2VRS A;  1K05 A;  3CXH E;  5DJT B;  3TGU E;  3Q2Y A;  1FAV A;  2YNY A;  1OZH A;  3H1J J;  3IAO A;  1NTZ J;  4AYC A;  3HTK A;  3II6 A;  3GMA A;  1CW5 A;  5BU5 A;  3VMZ A;  3GF7 A;  3AE6 C;  4IL6 H;  5TIS H;  2N1T B;  2ZT9 D;  3A3Y B;  1L0N J;  3M0D A;  1K73 Q;  2AEM A;  1VQ4 P;  1GD2 E;  2AEJ A;  1SQB E;  3L71 E;  4U3F D;  1RF1 A;  3PH0 A;  3TGU J;  2LR2 A;  1U57 A;  2AEF A;  1YBK A;  4NBH D;  4BRY A;  4DJG A;  4NB8 D;  4GOE A;  2YKP A;  2E5T A;  1IFD A;  2BCC G;  3MD0 A;  5APU A;  2GBW A;  1FJK A;  1JY3 O;  2W83 C;  2O1K A;  1M8O B;  1SQB J;  3L71 J;  1ZN5 A;  2HFE D;  3TF5 A;  1VM9 A;  4NBC D;  2E76 B;  1T3J A;  2Q6Q A;  1ZME C;  3PRJ A;  3O8Z A;  3EFF K;  2OQQ A;  4DCK A;  4AQR D;  1NAY A;  2IBZ G;  2POH A;  1LWU B;  1JO5 A;  2OYI B;  1OX3 A;  2E74 C;  2O1J A;  4H44 C;  3V6I A;  2QM7 A;  4U3F G;  3Q1M A;  3H6P A;  1JUN A;  3VN0 A;  3V2N A;  2HR3 A;  2D2C C;  2M3B A;  1NJI Q;  1KQG B;  1KIL B;  1Y47 A;  4H0L B;  1Y8A A;  1USE A;  5AEW A;  3L70 E;  1LT9 B;  3R4Y A;  1M1J B;  2XU6 A;  3CMA P;  3H1L E;  4UB6 E;  3FXD A;  2K88 A;  4WBA A;  2FFD C;  1G8J B;  2B24 A;  3L72 D;  4OGQ C;  1Y9B A;  1JTH A;  4HB1 A;  2KOG A;  1M1K Q;  3L70 J;  1J2J B;  3RBZ A;  4H13 D;  1M56 D;  2HG5 D;  1PPJ D;  2ZVO B;  5KJ7 C;  3O6Q B;  3H1L J;  5DJU B;  2Q9I A;  5BOK A;  2RH0 A;  2KLV A;  1Q81 Q;  1L4A A;  1KMI Z;  1M57 D;  1GL2 B;  4YXW H;  3CCU P;  1DIP A;  1ZLL A;  1G8K B;  1E79 H;  1SQQ G;  5AW6 B;  3GTE A;  2GBX A;  2WSC H;  3ABV C;  1MZ9 A;  3L72 G;  2WSS H;  2UWJ E;  1VF5 C;  3M0D C;  4HM3 A;  1H88 A;  5L8R J;  2WPV B;  1QL2 A;  1SFC D;  1N7S B;  1RF1 C;  1PPJ G;  1LTS C;  3GCE A;  1YIJ P;  4LLH A;  4RJT A;  2Y9Y A;  3H1I G;  1RQV A;  1SQV D;  1AQ5 A;  4ZKU A;  2Y0E A;  1NOH A;  4JBZ A;  3CX5 I;  1W2B O;  3M91 A;  3BCC D;  3VP9 A;  1EQ7 A;  1YQ4 C;  1HF9 A;  3W67 A;  1J1E C;  4EOT A;  1JB0 J;  2ZT9 B;  3HE5 B;  2A06 E;  4N3Y B;  2IZ0 A;  2LKM A;  4NBF D;  3EQQ A;  3KQG A;  3KHU A;  3F89 A;  3FX0 A;  1S5L H;  1OVU A;  1VPC A;  2BAS A;  1O7G A;  5CBN A;  1BCC E;  4TLF A;  5AVV B;  1ZW0 A;  2QJP B;  1R5S A;  1RE3 C;  2E43 A;  2NUK A;  2HMJ A;  1JY3 N;  4GOF A;  1SVF A;  5KAI E;  2KSE A;  1N73 A;  3CLQ A;  3H1K G;  3VCP A;  1ZV8 A;  2W6B A;  5AW3 B;  3VP8 A;  2IX7 C;  1BGY G;  2JEE A;  2P67 A;  3VCA A;  1PGO A;  3AZC A;  2IPP A;  3Q3D A;  5AW2 B;  3Q5P A;  1BCC J;  4IFD K;  1YQ3 C;  3V5B A;  2KB7 P;  2P58 A;  1RQU A;  2L5G B;  2CPB A;  3GF3 A;  2Y0D A;  2OYH A;  5AVX B;  1P84 E;  4IFF A;  1MV8 A;  3E7K A;  1FZE A;  2Y0C A;  1JM1 A;  4I7Z B;  2E74 D;  1X79 B;  3CCL P;  4H44 D;  3GL2 A;  4NBD D;  1VQ7 P;  2Q3I A;  1G2C B;  1L4A C;  1JY2 P;  2WPQ A;  2LXC B;  5KLV G;  3AEE C;  3RK2 C;  3GHG A;  1VQ5 P;  1OW8 A;  1IZN B;  1SFC A;  2D2C D;  1G1J A;  1QEX A;  1OFC X;  4D6T G;  3VTP C;  1LTJ B;  3GZX A;  4PD4 D;  2ZJS E;  3H1H G;  3RBX A;  5B66 H;  3TDK A;  2WMM A;  1S1C X;  4YTP C;  3L73 D;  4H13 B;  2WPS A;  3NMD A;  1AA0 A;  3G9R A;  3W68 A;  1DEE G;  3L75 E;  1KB9 H;  1FQT A;  3GW6 A;  2JDI H;  1SQP J;  4U7J A;  3EFG A;  1SQV K;  2NWF A;  5KJ7 D;  1KYO I;  2CK3 H;  3H32 B;  3PHL A;  1LTI C;  4PV1 B;  3ITK A;  1QLE D;  2Z4E A;  4AIV A;  3QH9 A;  3L75 J;  4I1L A;  2JP3 A;  4IFM A;  2CKF A;  1IFN A;  3Q5S A;  3RL0 g;  1S9K D;  2ZXX A;  2QA4 P;  1JEK A;  1OW7 A;  3D6Z A;  2JJL A;  1NDO A;  2FYZ A;  2Y9Z A;  3IFM A;  1KD1 Q;  2W6A A;  1OVR A;  5CHX A;  2RMZ A;  4QDC A;  4BXL A;  1X8Y A;  3A7O A;  3RL0 C;  1HJ0 A;  2O01 H;  1NTM E;  2GA1 A;  1VF5 D;  1H0T B;  3A0H H;  1CI6 B;  3CWB E;  5E79 H;  2DE5 D;  2FY8 A;  1SJG A;  3KZI E;  2IFM A;  3V2R A;  1N73 C;  1EDJ A;  3M0A A;  2W6J H;  1FDI A;  2E4P A;  1NTK E;  1LT1 A;  3IN6 A;  1ZR4 A;  1NTM J;  2R5B A;  1NTZ D;  2OYO A;  1XTC C;  1VQ6 P;  2FXO A;  1FC2 C;  3CWB J;  1SP4 A;  2BMR A;  3GB4 A;  2W90 A;  2P10 A;  1PGQ A;  1L0N D;  1JMB A;  3AEF C;  5CMZ A;  2QVA A;  5KKZ C;  1NTK J;  3CXH D;  1USD A;  2IYO A;  1VQP P;  3GTS A;  4YPC A;  1OW6 A;  3TYY A;  3T97 B;  2K3R A;  5H2F E;  1W2E A;  2P1J A;  3CXH I;  2IDB A;  2N1T A;  4QUP A;  1KIL E;  1SQB D;  3L71 D;  4KJM A;  4WY4 B;  1N7L A;  4HYT B;  3WU2 E;  1YJN P;  1ZR2 A;  3MGN A;  1R8E A;  2HOD A;  3I55 P;  4N6J A;  2R3C A;  1DX7 A;  1NAF A;  1NGM B;  3B4S A;  1KTM A;  2HPC B;  4GIF A;  1YIT P;  1EC5 A;  1JCC A;  2PFX A;  1L0N G;  1GU5 A;  1GZL A;  3P8C D;  1S72 P;  1FZC A;  3GOB A;  2IYP A;  3WUT A;  5CCH C;  4H44 B;  5AW9 B;  1L0L E;  2WQY C;  2FBW C;  3OA7 A;  1T3U A;  2K9J B;  1H89 A;  1QVG O;  3L74 D;  2E75 C;  2BMQ A;  3AE7 C;  1L4A D;  4XA4 A;  4L76 A;  2B89 A;  3RK2 D;  1FZA A;  1L2P A;  4Z1M H;  1L0L J;  4HM8 A;  4WVZ A;  2WSF J;  2A45 I;  2M5A A;  3RK3 C;  2ZXE B;  1NKN A;  1NYH A;  2Z5I A;  2FFD B;  5CBO A;  1Q90 C;  1VQN P;  1NVO A;  3TNU B;  3L37 A;  1LJ2 A;  1URQ C;  1ZOY C;  2KP8 A;  1VCK A;  2N9Y B;  3S4R A;  2R32 A;  3BAS A;  1IFP A;  1WT6 A;  3U59 A;  2IBZ I;  5AVS B;  2B88 A;  3CC7 P;  1RE4 A;  4HJG H;  3HD7 A;  1LTG C;  3L74 G;  3FOU A;  4NPD A;  4IL6 E;  4NPF X;  5TIS E;  1ZP0 C;  2BCC E;  2JO1 A;  2V7Q H;  1NTZ K;  3AE1 C;  3SFD C;  4UB8 H;  1PV3 A;  3C9I A;  2DW3 A;  1NU1 D;  5APY A;  1GW4 A;  2YKQ A;  3HTK B;  3GG2 A;  1KZU B;  1L0N K;  2P2U A;  2FYN C;  2WSE H;  2JO6 A;  4Y99 C;  2M3E A;  2IBZ E;  1VF5 B;  3AE9 C;  1VQL P;  1RE3 A;  2BCC J;  1BDC A;  3GZY A;  3NFQ A;  1RF1 B;  2NRG A;  4U3F E;  1EZV I;  3RL0 D;  1PL5 A;  3FXE A;  3JCU E;  4BRY B;  4HM7 A;  2N1T C;  2K37 A;  1LGH B;  1SQB K;  1NH4 A;  2DE7 D;  2XKM A;  5APT A;  1SS1 A;  2WVR A;  3G4S P;  3VMI D;  2QPZ A;  1DD4 A;  3USS A;  5KAF H;  4U3F J;  2WIT A;  1NU1 G;  3AEC C;  4HM6 A;  2KXP B;  3MUD A;  1J1E B;  1OMI A;  2XRX A;  2XV5 A;  4QMA A;  4HKV A;  1BDD A;  3Q5R A;  3CL3 D;  1N8R Q;  3V4Q A;  1FZC C;  5AW7 B;  2YIU C;  1EZV E;  2Q1K A;  1HBW A;  3JC2 2;  4IOI H;  4YXD C;  4R4L A;  3FWL A;  1FS0 E;  2GUS A;  2FXP A;  1KOR A;  1PZQ A;  2HML A;  1QL1 A;  1LWU C;  1EDL A;  1KV4 A;  3FWN A;  3WUV A;  3PP5 A;  3CCQ P;  1YI2 P;  1HUC A;  4C7N A;  1SQQ E;  1BCC D;  3AEG C;  1KIL C;  4NBA D;  3CX5 D;  1FZB A;  2NUM A;  4I6M C;  3L72 E;  4M3L A;  1JTH B;  4JYB A;  2OGU A;  1LT9 C;  3IF4 A;  4W80 A;  1BE3 E;  1HH0 A;  2H43 A;  1U7M A;  1R5L A;  1KN7 A;  4ASW A;  5KLI C;  1PPJ E;  3HUS A;  2KK7 A;  1RE4 C;  1SQQ J;  3HD7 C;  4A7P A;  5HL4 A;  3IR9 A;  1L4A B;  3MHV A;  4XE5 B;  3CX5 H;  3RK2 B;  2LXB A;  3H1I E;  4OH8 B;  3R2P A;  1O7P A;  1CSB A;  1LTB C;  5AVT B;  1BE3 J;  2YO3 A;  5BVZ A;  3B8E B;  3B5N A;  4AAY B;  1NU1 K;  2B9B A;  2PRR A;  1IO4 A;  2WSC J;  1UUV A;  3FGA D;  1P84 I;  3MZW B;  3RK3 D;  1J1D C;  1SQV G;  2IFN A;  3H1I J;  3M9Q A;  1LP1 A;  1PGJ A;  1Q90 D; 
#chains in the Genus database with same CATH homology
 2E75 D;  1NDO A;  2NVG A;  3GCE A;  2HMM A;  1P84 E;  2XSO A;  2BCC E;  1UUW A;  1RIE A;  2HML A;  3CXH E;  3TGU E;  5AEW A;  3L70 E;  4HM1 A;  4QDC A;  1SQX E;  1JM1 A;  2E74 D;  4H44 D;  1SQP E;  3GL2 A;  4NB9 D;  4NBD D;  3H1L E;  1NTM E;  2YFL A;  1VF5 D;  2FYN C;  2Q3W A;  3GOB A;  3CWB E;  1NU1 E;  2JO6 A;  2ZT9 D;  3VMG D;  1G8J B;  1SQQ E;  2B24 A;  4QCK A;  2D2C D;  1L0L E;  2IBZ E;  2DE5 D;  4NBB D;  1ULI A;  5AEU A;  1SQB E;  3L71 E;  1SJG A;  4NBA D;  3VMH D;  2FYU E;  3GZX A;  2ZYL A;  3H1K E;  2NUM A;  5CXM A;  3L72 E;  2JZA A;  3GZY A;  2A06 E;  2BMO A;  1O7N A;  4EMJ B;  2E4P A;  4H13 D;  4U3F E;  1BGY E;  3CX5 E;  4NBF D;  1KB9 E;  1NTK E;  2XSH A;  4HM5 A;  4NBH D;  2QJK C;  2BMQ A;  1BE3 E;  3EQQ A;  4NB8 D;  1SQV E;  4PV1 D;  4HM4 A;  1EG9 A;  5BOK A;  5KLI C;  3L74 E;  1PPJ E;  2GBW A;  1PP9 E;  2NVF A;  4HM7 A;  3EN1 A;  2E76 D;  2YFJ A;  1O7W A;  2BMR A;  1NYK A;  4HM8 A;  1O7G A;  3GB4 A;  5HL4 A;  1O7H A;  2DE7 D;  2E4Q A;  2HMK A;  1VM9 A;  4NBE D;  3L75 E;  1BCC E;  3VMI D;  3N0Q A;  4NBC D;  3BCC E;  1FQT A;  2QPZ A;  2YVJ B;  2QJY C;  3H1I E;  1Q90 C;  2XR8 A;  4QDF A;  1O7M A;  4P1B H;  2NUK A;  5KKZ C;  1O7P A;  1G8K B;  2HMJ A;  4P1C H;  4PD4 E;  2HMO A;  1L0N E;  4QDF B;  1VCK A;  4HM6 A;  3GTS A;  2NWF A;  3GL0 A;  3GTE A;  2GBX A;  5KLV E;  4AAY B;  4QUQ A;  4NBG D;  2XRX A;  3VCP A;  4HKV A;  3DQY A;  3H1J E;  1NTZ E;  1ULJ A;  3C0D A;  3L73 E;  1UUV A;  2HMN A;  3D89 A;  2YFI A;  1WQL A;  4D6T E;  2DE6 D;  4QUR A;  4HM2 A;  1RFS A;  4HM0 A;  4HM3 A;  2YIU C;  3VCA A;  1EZV E;  2B1X A;  4OGQ D;  1ZRT E;  3AZC A;  4AIV A;  2NVE A;  4QDD A;  3GKE A;  4H0L D;  3H1H E;  2I7F A;  1KYO E;  2CKF A;  4QUP A;  3FOU A;  2QJP C;  4HJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...