3CXHE

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
total genus 49
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cxhE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cxhE02
4NBGD 2GBXA 1SQXE 3H1KE 4U3FE 1NDOA 1BGYE 4QDCA 1L0NE 5AEUA 3GZYA 1G8KB 3BCCE 2E4PA 1ULIA 4QDFA 3GOBA 1SQVE 1P84E 1BCCE 3H1LE 2YFIA 2CKFA 1JM1A 2NVEA 3DQYA 2XSOA 2ZT9D 4P1BH 2XSHA 1SJGA 2JO6A 3CX5E 3H1JE 3VMID 5BOKA 4HKVA 4QUPA 2QJYC 5KKZC 2BMRA 2B24A 2GBWA 1NYKA 3EQQA 2HMOA 1EG9A 5HL4A 4QDDA 1WQLA 4HM0A 2YFJA 3FOUA 3VCPA 2NUKA 4PV1D 4QURA 3TGUE 3N0QA 2BMQA 3H1HE 2ZYLA 4NBFD 3C0DA 2FYNC 2HMMA 2Q3WA 4NBHD 4NB9D 2I7FA 1O7WA 3GL0A 4HM6A 3L74E 1ULJA 3H1IE 2YVJB 4H0LD 2E74D 4NBED 3L71E 3GL2A 1EZVE 2HMJA 1RFSA 4HM2A 2HMLA 1O7GA 1FQTA 2NWFA 3CWBE 1UUWA 1G8JB 2NVGA 2QJKC 4HM7A 2DE7D 2XRXA 3VCAA 4EMJB 2HMKA 1SQPE 4AAYB 2NVFA 3VMGD 1O7MA 4NBAD 2D2CD 3GKEA 2YFLA 4QDFB 1SQQE 2B1XA 1VF5D 1BE3E 2IBZE 1KB9E 4NBDD 2A06E 4D6TE 2E75D 4HM1A 1ZRTE 1SQBE 3L70E 1NU1E 1NTZE 3L72E 3GB4A 4HM5A 4HM8A 3GZXA 1RIEA 5CXMA 5KLVE 3CXHE 2JZAA 1NTME 4OGQD 2DE5D 3L73E 5AEWA 4PD4E 2DE6D 1NTKE 1KYOE 4HJLA 2QJPC 1L0LE 1O7PA 3VMHD 1VCKA 2XR8A 2QPZA 4NBCD 4HM4A 5KLIC 1PPJE 1Q90C 3D89A 2FYUE 4H44D 4NBBD 1VM9A 2E76D 4QCKA 4H13D 4QUQA 4AIVA 2HMNA 3GTEA 2YIUC 3GTSA 2BMOA 4HM3A 1UUVA 2BCCE 1O7HA 2NUMA 1PP9E 2E4QA 3EN1A 4NB8D 3GCEA 3AZCA 4P1CH 3L75E 1O7NA
chains in the Genus database with same CATH superfamily
1N7SA 2O1KA 1G2CB 3S9OA 1DIPA 4N6JA 2KSJA 5CHXA 3H1IJ 1ZLLA 4JF7A 1L4AD 4CPGA 3VP9A 3B71A 2ZAEB 5AW2B 3L70G 2YFJA 1KC8Q 1U57A 1UIIA 5E79E 2XU6A 2FYUJ 2WPRA 4WY4B 1RF1C 1ZXGA 1SQVD 4L75A 4HH2A 1ULJA 1T2KD 3PJSK 5APUA 1FC2C 1SQXG 2Y0CA 4PD4I 3CPWO 1YQ4C 2Y0EA 3RK3C 3HE5B 4AUWA 3H1JJ 3FWLA 4IFFA 4KJMA 4U3FG 4RKUJ 2YXQB 3NTNA 3H1LG 1RH5B 4D6TD 4ASVA 4HKZH 3C9IA 4HM1A 2K37A 3JCUE 3RBXA 3L74D 2RMZA 4H44B 3BRTB 1FZAA 1IFPA 2SPZA 2WSSH 2KZJA 1L0LE 3KQGA 2K9JA 2WITA 4JYCA 1M1JB 4QCKA 2HMNA 3B5ND 2J58A 3MTUE 1O7HA 3G9RA 1PGQA 4NB8D 1N86A 2NRGA 1SQVK 1IFNA 2WSEH 1NDOA 3WU2H 3G6EP 3RL0D 2YIUB 3JC22 3Q5PA 5AVTB 2CKFA 3L71J 3WMM0 1NU1G 5BOKA 1DD3A 1BE3G 3KPEA 4RESB 1J1EC 1RE3C 1BGYJ 2ZVNB 1YBKA 1L2PA 2OTLP 1SQBK 2AXTE 1QX8A 4NBHD 2CK3H 5CCGD 1NO4A 3GL2A 3N7NA 4HM2A 4YXDC 1USEA 2QG4A 3GMAA 2P2UA 1VQ5P 2J59M 1H88A 1VQMP 2B87B 2ZFCA 1S9KE 5H2FE 3N4XA 3RL0C 2LR2A 2H43A 1K73Q 1EQ7A 5APYA 3AECC 1CI6B 5AVUB 1N7SD 1Q82Q 1N8RQ 3RBZA 1N2DC 1KQLA 3SWFA 1NTKE 3PTZA 3VMHD 1VCKA 2WSCH 2WPQA 2R3SA 1DH3A 2K88A 1LTSC 3H1HG 3B5NC 4H13D 3GLMA 1T3UA 4HYTB 1YITP 1BGYD 2WZ7A 1FU1A 3FWNA 1O7NA 4NBGD 3IAOA 5KTBA 3CWBG 1VQOP 1A02J 3FX0A 3GW6A 1M8OB 3CX5I 2KNCA 2K1AA 5AW3B 4N78D 3G3ZA 3PP5A 2B89A 1NYKA 4UB8E 3L70J 1IFDA 4PD4H 1X9VA 1VQ7P 1EC5A 3FOUA 5APSA 4DCKA 4IFDK 1JNMA 1PPJG 1XTGB 1K8AQ 1OMIA 1N73A 2ZXXA 3L74E 2YVJB 4H0LD 3CD6P 3L71E 3Q2YA 3U59A 2KOGA 2W6JH 2PGDA 3CCRP 1R5LA 5KLVK 1Q86Q 1HGVA 3HTKA 4K35A 3VCAA 1SQVG 2OYOA 1NU1J 2I1JA 2JO1A 2KUBA 2IDBA 3M0DC 1RF1A 2HPCA 3QH9A 2A06E 2Z4EA 3L36A 4R4LA 1ZRTE 2KP8A 1WRGA 1KILC 3VMXA 1FJKA 2Z5HA 4OGQD 2DE6D 2QJPC 1HVVA 3MD0A 3KDPB 1GL2B 1Q90C 4C7NA 4AIVA 1K9MQ 1QVFO 2OGUA 1VDFA 5KAFH 1JMBA 3IN6A 1QL2A 1NTZD 3L72D 3SWYA 1SQPJ 3L75D 4D6TJ 1IFIA 1SQXE 2WT7A 4LGDE 1NTMD 2HFED 3TDKA 4WY4D 2KI7B 3A0BE 5AEUA 1SQXK 3RK2C 3BCCE 4NPFX 5TJHA 3CCQP 1MFTA 1LTGC 3VYIA 1PZQA 3CX5E 5KJ7D 1VQ8P 5KKZC 2B24A 3EQQA 1JY2N 2HMOA 3O6QA 1KILB 3B5NB 2N1TD 2B9BA 3BCCJ 3AE1C 3A0BH 4NB9D 4K3AA 1HTLC 3H1IE 2K9YA 5KLIB 2ITAA 5KJ7A 3GHGA 1L0LK 3PLNA 2WPVB 1O7MA 3GKEA 3CI9A 4IL6E 1RE3A 3HUSB 4IFMA 5CCHA 2Q3EA 5APWA 1SQBE 3R4YA 5KLVE 1L0NJ 1XTCC 5AEWA 2W6BA 3H1KJ 3RL0B 4C7NB 1BCCJ 1FBMA 2DW3A 2PRRA 3D89A 3W67A 3MP7B 2FBWC 2BCCE 1OW7A 2IFMA 1JO5A 3GCEA 3I56P 1JY3P 3S1KA 1M1KQ 3UIAA 1DD4A 2LKMA 4PJ0H 3Q1MA 3EWKA 1SQBD 2JJLA 4XA4A 3OW2O 1YTZT 1KN7A 1AQTA 3C1LA 1KYOH 1KB9H 2IBZG 2ZYDA 3CWBD 1SQBJ 3A0HE 4JYBA 4JQ0D 3TGUJ 1KMIZ 2WQYC 3U1AA 1GD2E 1L4AB 1ZN5A 2ZYLA 4BWNA 2E74C 4WWIA 3AE2C 1J1DB 3G4SP 1G1IA 3L75G 1RFSA 3CCVP 2Q1KA 3TNUB 5AW9B 1PP9G 2NVGA 4GKGA 3RK2B 1SVFA 3FGAD 2P67A 3MGNA 1ZR4A 1JY2O 1VF5D 1RHZB 4D6TE 2W8ZA 3RGUA 3IF4A 2OYIC 1NHLA 1VQNP 2GA1A 2QJYB 5GTIH 3CXHD 1QL1A 1NAYA 1KB9I 5KLIC 4NBBD 1SQXJ 1OZHA 1HWTC 1BSHA 1LTBC 2M0BA 2JP3A 5AW0B 1GW3A 4L76A 1SQPG 2WTYA 1BSNA 1LWUC 1SFCA 3NFQA 4XFJA 1EXJA 1LNQA 4QDFA 2IFNA 2YFIA 2XSOA 1Y8AA 4EIJA 1X22A 3WUUA 1YI2P 3CCEP 3H1JE 1NTZG 3L72G 2QM7A 4C7RA 2A06G 3PH0A 2FYUK 1BDDA 4GOFA 2IBZI 3B8EB 3A0HH 4PV1B 1R5SA 1X0TA 2NUKA 1AFOA 2O1JA 2FYUG 1J1DC 2KB7P 5GTHH 3ZDMA 5AVZB 2I7FA 3GL0A 1NU1K 1NYHA 3HE4B 3TGUD 2PAJA 4WBAA 1VQKP 2OQQA 3P7KA 2WSEJ 1MV8A 1CW5A 5CCGC 3I55P 2R3CA 1HJBA 2FXPA 2KS1B 2YMYA 5B5EH 4AAYB 2NVFA 1OVRA 1S9KD 1SQQD 4OVNF 3QWOC 1S72P 1VPCA 1JCDA 3AEBC 2C0XA 2E75D 2AXCA 2E75B 1KTMA 1Q81Q 2A45G 1RIEA 1VF5B 5AVQB 2ZVOB 1N7SC 3T97B 1DEBA 1AQ5A 1GL2D 3LIEA 4KHXA 3CCSP 2FY8A 2E4QA 4RO0A 1LTTC 1LTJA 1X79B 3H1KE 4UB6E 3VTPC 3L70D 3SWKA 1VL2A 1X8YA 1NTKJ 5CJ4A 4QUPA 4MN4C 1LT9C 4GOEA 2IYOA 3L35A 5HL4A 1SQBG 3E7KA 3H1JD 4QURA 2OARA 2IZ0A 3CX5H 1M57D 1TU3F 2Q7CA 2IYPA 2FYNC 4WB4A 4TT3H 1LT9B 5APXA 3C8VA 2RKLA 1SS1A 3VMYA 3TK1A 1S5LE 3AE9C 3HD7B 2H7HA 5AVYB 2FXOA 2FFDC 1FE6A 2MKVA 1GK6A 2E75C 1HGZA 1IJDB 1GMJA 3A3YB 1M1JC 2XNDH 3FXDA 4ZKPA 3GB4A 4LLHA 1W5CE 3CCJP 2FYUD 3AE7C 1ZV8A 4QMAA 3V6IA 1JB0J 1PIXA 2R44A 1QEXA 2E76C 3SSUA 3TGUG 1ZMEC 5KKZB 1EDJA 2YIUC 3GTSA 2BASA 2NUMA 1LT1A 3HE5A 1YJNP 3L75E 3AE6C 1S3JA 4H0LB 2HODB 5AW4B 1E79H 2L91A 5AW8B 2B87A 3BRVB 1SJGA 2ZYAA 1JOCA 2JO6A 2W27A 3GHGB 1JUNA 1P84D 3H1LD 4D6TG 2G8YA 3MHVA 4RJTA 2N9YB 5E79H 1FZGA 1CZQA 3N0QA 3CC2P 2CPSA 5DJUB 2MJZA 2M3EA 1KQFB 3E1IA 2GUSA 1RQVA 1FOSE 1N7SB 4H13C 1EZVD 1PGOA 3CLQA 2JR8A 2NWFA 2Y9ZA 3R2PA 1KZUB 2QJKC 3V2NA 3AE3C 2GUVA 3CC7P 1SQPE 2O3JA 4DOJA 2YFLA 1S2EA 2KXPB 2B1XA 2O01N 1JMMA 2HODA 1N7LA 2WT7B 3H1JG 2QVAA 4HM5A 4Y99B 4HM8A 2VRSA 5BVZA 3GHGC 2DE5D 3H6PA 2W83C 1J1EB 1GL2A 2PP6A 1LJ2A 1WMKA 4QUQA 1IFMA 2RN0A 2PFXA 3LIDA 2BMOA 1LTJB 1YIJP 1HF9A 3HUSC 4DJGA 4L74A 3M06A 2GBXA 2V4HA 4BXLA 4U3FE 1YQ3C 4ASWA 1T3JA 1ULIA 2AXTH 3GOBA 3AEEC 3HTKB 1E5WA 3Q5SA 1NTKD 4AQRD 1T6AA 3W68A 2BMRA 1BDCA 1WT6A 2M3BA 4QDDA 3KYQA 2LXCB 4IL6H 4XE5B 1K05A 4GT1A 2QEXP 4GIFA 1S5LX 3BCCD 1EDLA 1SFCD 1NKNA 1SFCB 3G71P 2ZT9B 1LP1A 1Q2NA 2XV5A 3L4FA 1L0LD 2QE7H 3V4QA 1K04A 1OWAA 1URQD 3IR9A 1BGYG 3HE4A 3L73J 3BASA 1MUUA 1GW4A 3H1KG 3KHUA 3V2PA 1OXZA 1BE3E 3MUDC 1QVGO 3RK3B 2UWJE 1HBWA 2ZJSE 3GZXA 3CXHE 1HUCA 1FOSF 2WSFJ 1IC2A 1W2BO 1S4XA 5L8RJ 1IO4A 3HD7D 3MZWB 1EZVG 1PPJD 3F89A 2WVRA 5EFWB 1Q7YQ 5AVXB 3ABVC 3L74J 3KXDA 1FZCA 3Q3DA 1D7MA 2OTKE 1AVOA 1FZCB 5CMZA 1CI6A 1LGHB 2ZXEB 1PGPA 4AYCA 4P1BH 4JBZA 1NOHA 2C9LY 4OWFA 4JPZB 1NTKK 1URQA 1L0LJ 2WSCJ 3VCPA 1Z56A 2QIWA 2HR3A 3H1HE 3KZIE 3II6A 1NTMK 4NBFD 3EFFK 1GU5A 1NVOA 2Q3WA 5AW7B 1O7WA 3HD7C 2HMJA 1FQTA 3AEDC 1RY3A 3RL0g 1RF0A 3TYYA 1A02F 4L73A 3CX5D 5CCGA 1BCCG 1T8ZA 1KD1Q 1SQQE 1LTJC 3KZIH 3L37A 3OJAB 4I2LC 4O9BA 1KILE 3CMAP 4HB1A 1NU1E 1FDIA 3WUVA 1EDIA 2C9NY 3U1CA 2V7QH 1ZR2A 2JZAA 1M1JA 1SQPK 1KFNA 1O7PA 1M7LA 1EZVI 1GU4A 2O01J 3L71G 1VM9A 2A45I 1Q90D 1BE3J 2BCCD 1GL2C 2M5AA 3EN1A 2KYVA 3SFDC 1EDKA 3D6ZA 2FXMA 4OGQB 4Y28J 1JCCA 5KAIE 1DX7A 1YJ9P 1AA0A 2NVEA 1KILA 4C46A 2NPSA 2GBWA 1NTZJ 3L72J 2C0WA 1H0TA 3O6QB 1PP9J 4EYYQ 4HM0A 4R4MA 1LT9A 2OYIA 1LTAC 2YXRB 2JDIH 1NTKG 4PV1C 1CSBA 4A7PA 1FAVA 2AEFA 4NBED 2BEQD 2HG5D 3M91A 3BVHA 1PGJA 1H0TB 1GZLA 2YKOA 1NAFA 3H25A 2NPSB 3BCCG 5APTA 3NXSA 2HMKA 2ZT9C 1VQ4P 1G2CA 2A45H 1NU1D 5KJ7C 3B5NA 3B4SA 3AEAC 1L4AC 3V2QA 4NBDD 2YKQA 2KSEA 3K5BA 3RK3E 1OFCX 5B5EE 3PHLA 1M56D 1ZOYC 1FZFA 2XDJA 2OYHA 2N1TC 3L73E 2IPPA 2XKMA 1KYOE 2IX7C 3VMZA 2XR8A 3JCUH 1Y47A 1GDTA 5KLVD 3T97A 2QA4P 1PPJE 2H88C 5BU5A 1LWUB 2E76D 2QSIA 1FZBA 3FXEA 3L74G 3VN0A 2QJPB 3BATA 1RF0C 2POHA 1S1CX 3GF7A 1YHQP 3AE5C 1BGYE 4QDCA 4ZMDA 3M0AA 3NMDA 5KAIH 1SQVE 2ZT9D 3L73D 3WU2E 2E76B 2Q5UA 4Z1MH 3VMID 2WMMA 1DEEG 1GTWA 1EG9A 2BEZF 4ZNCA 1RF1B 4PV1D 4BRYB 1SQVJ 2KNCB 2V7QJ 4EI2A 2HMMA 2Q6QA 4BRYA 2BCCG 5K5GB 4U7JA 5APQA 1ZP0C 1UIXA 1SQQK 2Q9IA 2E74D 2FYNB 5GTIE 1EZVE 3H32A 3IFMA 3P32A 1VQLP 2D2CB 1LP1B 4EOTA 1LTIC 2R5BA 1AJYA 2XRXA 4WVZA 1KV4A 3GF3A 3I5CA 1SQPD 1OVVA 1IK9A 1MFZA 2R5DA 1RQUA 2IBZE 1KILD 4OGQC 2P7JA 1NWQA 4GODA 4PD4E 1FS0E 3P8MC 4ZKUA 1KQGB 2JEEA 2FFDA 2QPZA 2FYZA 1ZW0A 2YNYA 4KT0J 1OW6A 1UUVA 1M90Q 3OAKA 1PP9E 3H1IG 2KS1A 5CCHC 3P8CE 5CBNA 4WY4C 3H32B 1NJIQ 1H89A 3H1HD 3L71D 1VF5C 3AE4C 2E4PA 2HYNA 1BCCE 3H1HJ 1SQQG 4HKVA 2B88A 5H2FH 2NPSC 1KFMA 1S5LH 1R8EA 2N1TA 2WSFH 1KB9D 5KLVG 5APVA 4DZOA 3O8ZA 1N73B 3AE8C 3M0DA 4HM6A 3D70A 1FDMA 4H44C 3H1LJ 5B66H 2HLOA 5AVVB 1L0NG 4NPDA 4H13B 1URQC 5AW5B 3TSIA 4EMJB 3VMGD 2XNXA 3CC4P 1JTHB 1MKMA 1SQQJ 5DJTB 2O01H 2W6AA 3V2RA 4NPEA 1KB9E 3M9BA 2YMKA 3CXHH 2LXBA 4UB6H 2GM4A 1HH0A 2OYHB 4HJLA 5BU8B 3LW5H 2I8DA 1NGMB 3CCUP 2OTJP 4HM4A 2FFDB 2WWWA 4IL6X 1SLQA 3HD7A 2N9BA 2P1JA 1GK4A 5AVRB 3F5HA 3MIWA 5TISE 3ITKA 3P8CD 2K9JB 1FJPA 3AEFC 2BCCJ 3MUDA 5M1BA 2D2CC 1P84I 3Q5RA 3A2AA 3GG2A 4N3YB 1NTMG 1YTZI 2KIKA 2WPSA 2BMQA 5KLVJ 4LC1A 3L73G 3A7OA 3CXHI 4GDOA 3JSVC 1J2JB 2Z5IA 1QGKB 1MZ9A 1KYOI 1O7GA 3TNUA 1NH4A 2Q3IA 3RK2D 2DE7D 1KYOD 2YKPA 5CJ0A 2IBZD 4M3LA 2OYIB 5AVWB 2CPBA 1JY2P 3A5TA 3L70E 4YPCA 1NTZE 3L72E 1IK7A 2E74B 3HUSA 1U7MA 1Y9BA 1P84H 1VQPP 1H8AA 1NKZB 2R32A 2FYUE 2FKWB 2KZIA 1U7JA 3GTEA 1PP9D 1PL5A 1L0ND 2L5GB 2M5AB 2AEJA 3AZCA 1AVYA 3D6YA 4IOIH 2HPCB 1L0NK 3M9HA 4I6MC 3GZYA 3EFGA 2H89C 3EQ2A 5CBOA 5C39A 3PRJA 1JTHA 1P84E 3H1LE 3DQYA 5AW1B 1JM1A 4W7YA 3H1ID 2KLUA 3SFEC 1EXIA 2W90A 4I1LA 5AW6B 2QJYC 1URQB 1HJ0A 1G1JA 1L0LG 1OW8A 3LW5J 3M9QA 1VQ9P 1SQXD 3TGUE 4Y99C 3C0DA 4WY4A 1NTZK 3H1KD 5CCHD 5AVSB 2N1TB 3CMEP 2HMLA 1UUWA 2H8PD 4HM7A 5TISH 1RE4C 3CCLP 2QJKB 4PJ0E 1OVUA 2A06D 2G3AA 2NPSD 1NTMJ 2AEMA 1ZRTD 3L75J 3V4WA 3D71A 1JM0A 2KLVA 2JWDA 2KK7A 2P10A 4W7ZA 3TF5A 1SP4A 3WUTA 3HRNA 4H44D 4UB8H 1JY3N 4TLFA 2NZ2A 4P1CH 2Y0DA 3E1RA 4EDFA 2JWAA 4PD4D 1L0NE 1YYCA 1PV3A 1G8KB 4I7ZC 1OIPA 2IZ1A 1L4AA 4U3FD 2XSHA 4U3FJ 3CCMP 1IFJA 3VMAA 2XZRA 1W2EA 1YJWP 1PFIA 1WQLA 1JY3O 1QLED 3USSA 3VP8A 4W80A 2JKVA 2YO3A 2ZYGA 1BCCD 2E5YA 4N78E 2YO2A 1VQ6P 3OA7A 5GTHE 3CWBJ 2J5UA 3CWBE 1IZNB 2E5TA 5B66E 4YXWH 1G8JB 3V5BA 1RE4A 2I1KA 3AEGC 1FZCC 2E42A 2QM8A 4B86A 4NBAD 2D2CD 1AV1A 4QDFB 2OYHC 1KQSO 1USDA 4I7ZB 1FDOA 2QRXA 1BE3D 1JEKA 5CXMA 1FZEA 1OX3A 4DT0A 1NTME 5KAFE 2P58A 4HJGH 4YTPC 2Y9YA 1SFCC 1LWUA 1T2KC 2K3RA 3CL3D 4NBCD 4OH8B 4HM3A 1KORA 3RK3D 4H0LC 3VOPA 2E43A 2RH0A 2M8RA 1N73C 3S4RA
chains in the Genus database with same CATH topology
4NBGD 2GBXA 1SQXE 3H1KE 4U3FE 1NDOA 1BGYE 4QDCA 1L0NE 5AEUA 3GZYA 1G8KB 3BCCE 2E4PA 1ULIA 4QDFA 3GOBA 1SQVE 1P84E 1BCCE 3H1LE 2YFIA 2CKFA 1JM1A 2NVEA 3DQYA 2XSOA 2ZT9D 4P1BH 2XSHA 1SJGA 2JO6A 3CX5E 3H1JE 3VMID 5BOKA 4HKVA 4QUPA 2QJYC 5KKZC 2BMRA 2B24A 2GBWA 1NYKA 3EQQA 2HMOA 1EG9A 5HL4A 4QDDA 1WQLA 4HM0A 2YFJA 3FOUA 3VCPA 2NUKA 4PV1D 4QURA 3TGUE 3N0QA 2BMQA 3H1HE 2ZYLA 4NBFD 3C0DA 2FYNC 2HMMA 2Q3WA 4NBHD 4NB9D 2I7FA 1O7WA 3GL0A 4HM6A 3L74E 1ULJA 3H1IE 2YVJB 4H0LD 2E74D 4NBED 3L71E 3GL2A 1EZVE 2HMJA 1RFSA 4HM2A 2HMLA 1O7GA 1FQTA 2NWFA 3CWBE 1UUWA 1G8JB 2NVGA 2QJKC 4HM7A 2DE7D 2XRXA 3VCAA 4EMJB 2HMKA 1SQPE 4AAYB 2NVFA 3VMGD 1O7MA 4NBAD 2D2CD 3GKEA 2YFLA 4QDFB 1SQQE 2B1XA 1VF5D 1BE3E 2IBZE 1KB9E 4NBDD 2A06E 4D6TE 2E75D 4HM1A 1ZRTE 1SQBE 3L70E 1NU1E 1NTZE 3L72E 3GB4A 4HM5A 4HM8A 3GZXA 1RIEA 5CXMA 5KLVE 3CXHE 2JZAA 1NTME 4OGQD 2DE5D 3L73E 5AEWA 4PD4E 2DE6D 1NTKE 1KYOE 4HJLA 2QJPC 1L0LE 1O7PA 3VMHD 1VCKA 2XR8A 2QPZA 4NBCD 4HM4A 5KLIC 1PPJE 1Q90C 3D89A 2FYUE 4H44D 4NBBD 1VM9A 2E76D 4QCKA 4H13D 4QUQA 4AIVA 2HMNA 3GTEA 2YIUC 3GTSA 2BMOA 4HM3A 1UUVA 2BCCE 1O7HA 2NUMA 1PP9E 2E4QA 3EN1A 4NB8D 3GCEA 3AZCA 4P1CH 3L75E 1O7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBG D;  2GBX A;  1SQX E;  3H1K E;  4U3F E;  1NDO A;  1BGY E;  4QDC A;  1L0N E;  5AEU A;  3GZY A;  1G8K B;  3BCC E;  2E4P A;  1ULI A;  4QDF A;  3GOB A;  1SQV E;  1P84 E;  1BCC E;  3H1L E;  2YFI A;  2CKF A;  1JM1 A;  2NVE A;  3DQY A;  2XSO A;  2ZT9 D;  4P1B H;  2XSH A;  1SJG A;  2JO6 A;  3CX5 E;  3H1J E;  3VMI D;  5BOK A;  4HKV A;  4QUP A;  2QJY C;  5KKZ C;  2BMR A;  2B24 A;  2GBW A;  1NYK A;  3EQQ A;  2HMO A;  1EG9 A;  5HL4 A;  4QDD A;  1WQL A;  4HM0 A;  2YFJ A;  3FOU A;  3VCP A;  2NUK A;  4PV1 D;  4QUR A;  3TGU E;  3N0Q A;  2BMQ A;  3H1H E;  2ZYL A;  4NBF D;  3C0D A;  2FYN C;  2HMM A;  2Q3W A;  4NBH D;  4NB9 D;  2I7F A;  1O7W A;  3GL0 A;  4HM6 A;  3L74 E;  1ULJ A;  3H1I E;  2YVJ B;  4H0L D;  2E74 D;  4NBE D;  3L71 E;  3GL2 A;  1EZV E;  2HMJ A;  1RFS A;  4HM2 A;  2HML A;  1O7G A;  1FQT A;  2NWF A;  3CWB E;  1UUW A;  1G8J B;  2NVG A;  2QJK C;  4HM7 A;  2DE7 D;  2XRX A;  3VCA A;  4EMJ B;  2HMK A;  1SQP E;  4AAY B;  2NVF A;  3VMG D;  1O7M A;  4NBA D;  2D2C D;  3GKE A;  2YFL A;  4QDF B;  1SQQ E;  2B1X A;  1VF5 D;  1BE3 E;  2IBZ E;  1KB9 E;  4NBD D;  2A06 E;  4D6T E;  2E75 D;  4HM1 A;  1ZRT E;  1SQB E;  3L70 E;  1NU1 E;  1NTZ E;  3L72 E;  3GB4 A;  4HM5 A;  4HM8 A;  3GZX A;  1RIE A;  5CXM A;  5KLV E;  3CXH E;  2JZA A;  1NTM E;  4OGQ D;  2DE5 D;  3L73 E;  5AEW A;  4PD4 E;  2DE6 D;  1NTK E;  1KYO E;  4HJL A;  2QJP C;  1L0L E;  1O7P A;  3VMH D;  1VCK A;  2XR8 A;  2QPZ A;  4NBC D;  4HM4 A;  5KLI C;  1PPJ E;  1Q90 C;  3D89 A;  2FYU E;  4H44 D;  4NBB D;  1VM9 A;  2E76 D;  4QCK A;  4H13 D;  4QUQ A;  4AIV A;  2HMN A;  3GTE A;  2YIU C;  3GTS A;  2BMO A;  4HM3 A;  1UUV A;  2BCC E;  1O7H A;  2NUM A;  1PP9 E;  2E4Q A;  3EN1 A;  4NB8 D;  3GCE A;  3AZC A;  4P1C H;  3L75 E;  1O7N A; 
#chains in the Genus database with same CATH topology
 1N7S A;  2O1K A;  1G2C B;  3S9O A;  1DIP A;  4N6J A;  2KSJ A;  5CHX A;  3H1I J;  1ZLL A;  4JF7 A;  1L4A D;  4CPG A;  3VP9 A;  3B71 A;  2ZAE B;  5AW2 B;  3L70 G;  2YFJ A;  1KC8 Q;  1U57 A;  1UII A;  5E79 E;  2XU6 A;  2FYU J;  2WPR A;  4WY4 B;  1RF1 C;  1ZXG A;  1SQV D;  4L75 A;  4HH2 A;  1ULJ A;  1T2K D;  3PJS K;  5APU A;  1FC2 C;  1SQX G;  2Y0C A;  4PD4 I;  3CPW O;  1YQ4 C;  2Y0E A;  3RK3 C;  3HE5 B;  4AUW A;  3H1J J;  3FWL A;  4IFF A;  4KJM A;  4U3F G;  4RKU J;  2YXQ B;  3NTN A;  3H1L G;  1RH5 B;  4D6T D;  4ASV A;  4HKZ H;  3C9I A;  4HM1 A;  2K37 A;  3JCU E;  3RBX A;  3L74 D;  2RMZ A;  4H44 B;  3BRT B;  1FZA A;  1IFP A;  2SPZ A;  2WSS H;  2KZJ A;  1L0L E;  3KQG A;  2K9J A;  2WIT A;  4JYC A;  1M1J B;  4QCK A;  2HMN A;  3B5N D;  2J58 A;  3MTU E;  1O7H A;  3G9R A;  1PGQ A;  4NB8 D;  1N86 A;  2NRG A;  1SQV K;  1IFN A;  2WSE H;  1NDO A;  3WU2 H;  3G6E P;  3RL0 D;  2YIU B;  3JC2 2;  3Q5P A;  5AVT B;  2CKF A;  3L71 J;  3WMM 0;  1NU1 G;  5BOK A;  1DD3 A;  1BE3 G;  3KPE A;  4RES B;  1J1E C;  1RE3 C;  1BGY J;  2ZVN B;  1YBK A;  1L2P A;  2OTL P;  1SQB K;  2AXT E;  1QX8 A;  4NBH D;  2CK3 H;  5CCG D;  1NO4 A;  3GL2 A;  3N7N A;  4HM2 A;  4YXD C;  1USE A;  2QG4 A;  3GMA A;  2P2U A;  1VQ5 P;  2J59 M;  1H88 A;  1VQM P;  2B87 B;  2ZFC A;  1S9K E;  5H2F E;  3N4X A;  3RL0 C;  2LR2 A;  2H43 A;  1K73 Q;  1EQ7 A;  5APY A;  3AEC C;  1CI6 B;  5AVU B;  1N7S D;  1Q82 Q;  1N8R Q;  3RBZ A;  1N2D C;  1KQL A;  3SWF A;  1NTK E;  3PTZ A;  3VMH D;  1VCK A;  2WSC H;  2WPQ A;  2R3S A;  1DH3 A;  2K88 A;  1LTS C;  3H1H G;  3B5N C;  4H13 D;  3GLM A;  1T3U A;  4HYT B;  1YIT P;  1BGY D;  2WZ7 A;  1FU1 A;  3FWN A;  1O7N A;  4NBG D;  3IAO A;  5KTB A;  3CWB G;  1VQO P;  1A02 J;  3FX0 A;  3GW6 A;  1M8O B;  3CX5 I;  2KNC A;  2K1A A;  5AW3 B;  4N78 D;  3G3Z A;  3PP5 A;  2B89 A;  1NYK A;  4UB8 E;  3L70 J;  1IFD A;  4PD4 H;  1X9V A;  1VQ7 P;  1EC5 A;  3FOU A;  5APS A;  4DCK A;  4IFD K;  1JNM A;  1PPJ G;  1XTG B;  1K8A Q;  1OMI A;  1N73 A;  2ZXX A;  3L74 E;  2YVJ B;  4H0L D;  3CD6 P;  3L71 E;  3Q2Y A;  3U59 A;  2KOG A;  2W6J H;  2PGD A;  3CCR P;  1R5L A;  5KLV K;  1Q86 Q;  1HGV A;  3HTK A;  4K35 A;  3VCA A;  1SQV G;  2OYO A;  1NU1 J;  2I1J A;  2JO1 A;  2KUB A;  2IDB A;  3M0D C;  1RF1 A;  2HPC A;  3QH9 A;  2A06 E;  2Z4E A;  3L36 A;  4R4L A;  1ZRT E;  2KP8 A;  1WRG A;  1KIL C;  3VMX A;  1FJK A;  2Z5H A;  4OGQ D;  2DE6 D;  2QJP C;  1HVV A;  3MD0 A;  3KDP B;  1GL2 B;  1Q90 C;  4C7N A;  4AIV A;  1K9M Q;  1QVF O;  2OGU A;  1VDF A;  5KAF H;  1JMB A;  3IN6 A;  1QL2 A;  1NTZ D;  3L72 D;  3SWY A;  1SQP J;  3L75 D;  4D6T J;  1IFI A;  1SQX E;  2WT7 A;  4LGD E;  1NTM D;  2HFE D;  3TDK A;  4WY4 D;  2KI7 B;  3A0B E;  5AEU A;  1SQX K;  3RK2 C;  3BCC E;  4NPF X;  5TJH A;  3CCQ P;  1MFT A;  1LTG C;  3VYI A;  1PZQ A;  3CX5 E;  5KJ7 D;  1VQ8 P;  5KKZ C;  2B24 A;  3EQQ A;  1JY2 N;  2HMO A;  3O6Q A;  1KIL B;  3B5N B;  2N1T D;  2B9B A;  3BCC J;  3AE1 C;  3A0B H;  4NB9 D;  4K3A A;  1HTL C;  3H1I E;  2K9Y A;  5KLI B;  2ITA A;  5KJ7 A;  3GHG A;  1L0L K;  3PLN A;  2WPV B;  1O7M A;  3GKE A;  3CI9 A;  4IL6 E;  1RE3 A;  3HUS B;  4IFM A;  5CCH A;  2Q3E A;  5APW A;  1SQB E;  3R4Y A;  5KLV E;  1L0N J;  1XTC C;  5AEW A;  2W6B A;  3H1K J;  3RL0 B;  4C7N B;  1BCC J;  1FBM A;  2DW3 A;  2PRR A;  3D89 A;  3W67 A;  3MP7 B;  2FBW C;  2BCC E;  1OW7 A;  2IFM A;  1JO5 A;  3GCE A;  3I56 P;  1JY3 P;  3S1K A;  1M1K Q;  3UIA A;  1DD4 A;  2LKM A;  4PJ0 H;  3Q1M A;  3EWK A;  1SQB D;  2JJL A;  4XA4 A;  3OW2 O;  1YTZ T;  1KN7 A;  1AQT A;  3C1L A;  1KYO H;  1KB9 H;  2IBZ G;  2ZYD A;  3CWB D;  1SQB J;  3A0H E;  4JYB A;  4JQ0 D;  3TGU J;  1KMI Z;  2WQY C;  3U1A A;  1GD2 E;  1L4A B;  1ZN5 A;  2ZYL A;  4BWN A;  2E74 C;  4WWI A;  3AE2 C;  1J1D B;  3G4S P;  1G1I A;  3L75 G;  1RFS A;  3CCV P;  2Q1K A;  3TNU B;  5AW9 B;  1PP9 G;  2NVG A;  4GKG A;  3RK2 B;  1SVF A;  3FGA D;  2P67 A;  3MGN A;  1ZR4 A;  1JY2 O;  1VF5 D;  1RHZ B;  4D6T E;  2W8Z A;  3RGU A;  3IF4 A;  2OYI C;  1NHL A;  1VQN P;  2GA1 A;  2QJY B;  5GTI H;  3CXH D;  1QL1 A;  1NAY A;  1KB9 I;  5KLI C;  4NBB D;  1SQX J;  1OZH A;  1HWT C;  1BSH A;  1LTB C;  2M0B A;  2JP3 A;  5AW0 B;  1GW3 A;  4L76 A;  1SQP G;  2WTY A;  1BSN A;  1LWU C;  1SFC A;  3NFQ A;  4XFJ A;  1EXJ A;  1LNQ A;  4QDF A;  2IFN A;  2YFI A;  2XSO A;  1Y8A A;  4EIJ A;  1X22 A;  3WUU A;  1YI2 P;  3CCE P;  3H1J E;  1NTZ G;  3L72 G;  2QM7 A;  4C7R A;  2A06 G;  3PH0 A;  2FYU K;  1BDD A;  4GOF A;  2IBZ I;  3B8E B;  3A0H H;  4PV1 B;  1R5S A;  1X0T A;  2NUK A;  1AFO A;  2O1J A;  2FYU G;  1J1D C;  2KB7 P;  5GTH H;  3ZDM A;  5AVZ B;  2I7F A;  3GL0 A;  1NU1 K;  1NYH A;  3HE4 B;  3TGU D;  2PAJ A;  4WBA A;  1VQK P;  2OQQ A;  3P7K A;  2WSE J;  1MV8 A;  1CW5 A;  5CCG C;  3I55 P;  2R3C A;  1HJB A;  2FXP A;  2KS1 B;  2YMY A;  5B5E H;  4AAY B;  2NVF A;  1OVR A;  1S9K D;  1SQQ D;  4OVN F;  3QWO C;  1S72 P;  1VPC A;  1JCD A;  3AEB C;  2C0X A;  2E75 D;  2AXC A;  2E75 B;  1KTM A;  1Q81 Q;  2A45 G;  1RIE A;  1VF5 B;  5AVQ B;  2ZVO B;  1N7S C;  3T97 B;  1DEB A;  1AQ5 A;  1GL2 D;  3LIE A;  4KHX A;  3CCS P;  2FY8 A;  2E4Q A;  4RO0 A;  1LTT C;  1LTJ A;  1X79 B;  3H1K E;  4UB6 E;  3VTP C;  3L70 D;  3SWK A;  1VL2 A;  1X8Y A;  1NTK J;  5CJ4 A;  4QUP A;  4MN4 C;  1LT9 C;  4GOE A;  2IYO A;  3L35 A;  5HL4 A;  1SQB G;  3E7K A;  3H1J D;  4QUR A;  2OAR A;  2IZ0 A;  3CX5 H;  1M57 D;  1TU3 F;  2Q7C A;  2IYP A;  2FYN C;  4WB4 A;  4TT3 H;  1LT9 B;  5APX A;  3C8V A;  2RKL A;  1SS1 A;  3VMY A;  3TK1 A;  1S5L E;  3AE9 C;  3HD7 B;  2H7H A;  5AVY B;  2FXO A;  2FFD C;  1FE6 A;  2MKV A;  1GK6 A;  2E75 C;  1HGZ A;  1IJD B;  1GMJ A;  3A3Y B;  1M1J C;  2XND H;  3FXD A;  4ZKP A;  3GB4 A;  4LLH A;  1W5C E;  3CCJ P;  2FYU D;  3AE7 C;  1ZV8 A;  4QMA A;  3V6I A;  1JB0 J;  1PIX A;  2R44 A;  1QEX A;  2E76 C;  3SSU A;  3TGU G;  1ZME C;  5KKZ B;  1EDJ A;  2YIU C;  3GTS A;  2BAS A;  2NUM A;  1LT1 A;  3HE5 A;  1YJN P;  3L75 E;  3AE6 C;  1S3J A;  4H0L B;  2HOD B;  5AW4 B;  1E79 H;  2L91 A;  5AW8 B;  2B87 A;  3BRV B;  1SJG A;  2ZYA A;  1JOC A;  2JO6 A;  2W27 A;  3GHG B;  1JUN A;  1P84 D;  3H1L D;  4D6T G;  2G8Y A;  3MHV A;  4RJT A;  2N9Y B;  5E79 H;  1FZG A;  1CZQ A;  3N0Q A;  3CC2 P;  2CPS A;  5DJU B;  2MJZ A;  2M3E A;  1KQF B;  3E1I A;  2GUS A;  1RQV A;  1FOS E;  1N7S B;  4H13 C;  1EZV D;  1PGO A;  3CLQ A;  2JR8 A;  2NWF A;  2Y9Z A;  3R2P A;  1KZU B;  2QJK C;  3V2N A;  3AE3 C;  2GUV A;  3CC7 P;  1SQP E;  2O3J A;  4DOJ A;  2YFL A;  1S2E A;  2KXP B;  2B1X A;  2O01 N;  1JMM A;  2HOD A;  1N7L A;  2WT7 B;  3H1J G;  2QVA A;  4HM5 A;  4Y99 B;  4HM8 A;  2VRS A;  5BVZ A;  3GHG C;  2DE5 D;  3H6P A;  2W83 C;  1J1E B;  1GL2 A;  2PP6 A;  1LJ2 A;  1WMK A;  4QUQ A;  1IFM A;  2RN0 A;  2PFX A;  3LID A;  2BMO A;  1LTJ B;  1YIJ P;  1HF9 A;  3HUS C;  4DJG A;  4L74 A;  3M06 A;  2GBX A;  2V4H A;  4BXL A;  4U3F E;  1YQ3 C;  4ASW A;  1T3J A;  1ULI A;  2AXT H;  3GOB A;  3AEE C;  3HTK B;  1E5W A;  3Q5S A;  1NTK D;  4AQR D;  1T6A A;  3W68 A;  2BMR A;  1BDC A;  1WT6 A;  2M3B A;  4QDD A;  3KYQ A;  2LXC B;  4IL6 H;  4XE5 B;  1K05 A;  4GT1 A;  2QEX P;  4GIF A;  1S5L X;  3BCC D;  1EDL A;  1SFC D;  1NKN A;  1SFC B;  3G71 P;  2ZT9 B;  1LP1 A;  1Q2N A;  2XV5 A;  3L4F A;  1L0L D;  2QE7 H;  3V4Q A;  1K04 A;  1OWA A;  1URQ D;  3IR9 A;  1BGY G;  3HE4 A;  3L73 J;  3BAS A;  1MUU A;  1GW4 A;  3H1K G;  3KHU A;  3V2P A;  1OXZ A;  1BE3 E;  3MUD C;  1QVG O;  3RK3 B;  2UWJ E;  1HBW A;  2ZJS E;  3GZX A;  3CXH E;  1HUC A;  1FOS F;  2WSF J;  1IC2 A;  1W2B O;  1S4X A;  5L8R J;  1IO4 A;  3HD7 D;  3MZW B;  1EZV G;  1PPJ D;  3F89 A;  2WVR A;  5EFW B;  1Q7Y Q;  5AVX B;  3ABV C;  3L74 J;  3KXD A;  1FZC A;  3Q3D A;  1D7M A;  2OTK E;  1AVO A;  1FZC B;  5CMZ A;  1CI6 A;  1LGH B;  2ZXE B;  1PGP A;  4AYC A;  4P1B H;  4JBZ A;  1NOH A;  2C9L Y;  4OWF A;  4JPZ B;  1NTK K;  1URQ A;  1L0L J;  2WSC J;  3VCP A;  1Z56 A;  2QIW A;  2HR3 A;  3H1H E;  3KZI E;  3II6 A;  1NTM K;  4NBF D;  3EFF K;  1GU5 A;  1NVO A;  2Q3W A;  5AW7 B;  1O7W A;  3HD7 C;  2HMJ A;  1FQT A;  3AED C;  1RY3 A;  3RL0 g;  1RF0 A;  3TYY A;  1A02 F;  4L73 A;  3CX5 D;  5CCG A;  1BCC G;  1T8Z A;  1KD1 Q;  1SQQ E;  1LTJ C;  3KZI H;  3L37 A;  3OJA B;  4I2L C;  4O9B A;  1KIL E;  3CMA P;  4HB1 A;  1NU1 E;  1FDI A;  3WUV A;  1EDI A;  2C9N Y;  3U1C A;  2V7Q H;  1ZR2 A;  2JZA A;  1M1J A;  1SQP K;  1KFN A;  1O7P A;  1M7L A;  1EZV I;  1GU4 A;  2O01 J;  3L71 G;  1VM9 A;  2A45 I;  1Q90 D;  1BE3 J;  2BCC D;  1GL2 C;  2M5A A;  3EN1 A;  2KYV A;  3SFD C;  1EDK A;  3D6Z A;  2FXM A;  4OGQ B;  4Y28 J;  1JCC A;  5KAI E;  1DX7 A;  1YJ9 P;  1AA0 A;  2NVE A;  1KIL A;  4C46 A;  2NPS A;  2GBW A;  1NTZ J;  3L72 J;  2C0W A;  1H0T A;  3O6Q B;  1PP9 J;  4EYY Q;  4HM0 A;  4R4M A;  1LT9 A;  2OYI A;  1LTA C;  2YXR B;  2JDI H;  1NTK G;  4PV1 C;  1CSB A;  4A7P A;  1FAV A;  2AEF A;  4NBE D;  2BEQ D;  2HG5 D;  3M91 A;  3BVH A;  1PGJ A;  1H0T B;  1GZL A;  2YKO A;  1NAF A;  3H25 A;  2NPS B;  3BCC G;  5APT A;  3NXS A;  2HMK A;  2ZT9 C;  1VQ4 P;  1G2C A;  2A45 H;  1NU1 D;  5KJ7 C;  3B5N A;  3B4S A;  3AEA C;  1L4A C;  3V2Q A;  4NBD D;  2YKQ A;  2KSE A;  3K5B A;  3RK3 E;  1OFC X;  5B5E E;  3PHL A;  1M56 D;  1ZOY C;  1FZF A;  2XDJ A;  2OYH A;  2N1T C;  3L73 E;  2IPP A;  2XKM A;  1KYO E;  2IX7 C;  3VMZ A;  2XR8 A;  3JCU H;  1Y47 A;  1GDT A;  5KLV D;  3T97 A;  2QA4 P;  1PPJ E;  2H88 C;  5BU5 A;  1LWU B;  2E76 D;  2QSI A;  1FZB A;  3FXE A;  3L74 G;  3VN0 A;  2QJP B;  3BAT A;  1RF0 C;  2POH A;  1S1C X;  3GF7 A;  1YHQ P;  3AE5 C;  1BGY E;  4QDC A;  4ZMD A;  3M0A A;  3NMD A;  5KAI H;  1SQV E;  2ZT9 D;  3L73 D;  3WU2 E;  2E76 B;  2Q5U A;  4Z1M H;  3VMI D;  2WMM A;  1DEE G;  1GTW A;  1EG9 A;  2BEZ F;  4ZNC A;  1RF1 B;  4PV1 D;  4BRY B;  1SQV J;  2KNC B;  2V7Q J;  4EI2 A;  2HMM A;  2Q6Q A;  4BRY A;  2BCC G;  5K5G B;  4U7J A;  5APQ A;  1ZP0 C;  1UIX A;  1SQQ K;  2Q9I A;  2E74 D;  2FYN B;  5GTI E;  1EZV E;  3H32 A;  3IFM A;  3P32 A;  1VQL P;  2D2C B;  1LP1 B;  4EOT A;  1LTI C;  2R5B A;  1AJY A;  2XRX A;  4WVZ A;  1KV4 A;  3GF3 A;  3I5C A;  1SQP D;  1OVV A;  1IK9 A;  1MFZ A;  2R5D A;  1RQU A;  2IBZ E;  1KIL D;  4OGQ C;  2P7J A;  1NWQ A;  4GOD A;  4PD4 E;  1FS0 E;  3P8M C;  4ZKU A;  1KQG B;  2JEE A;  2FFD A;  2QPZ A;  2FYZ A;  1ZW0 A;  2YNY A;  4KT0 J;  1OW6 A;  1UUV A;  1M90 Q;  3OAK A;  1PP9 E;  3H1I G;  2KS1 A;  5CCH C;  3P8C E;  5CBN A;  4WY4 C;  3H32 B;  1NJI Q;  1H89 A;  3H1H D;  3L71 D;  1VF5 C;  3AE4 C;  2E4P A;  2HYN A;  1BCC E;  3H1H J;  1SQQ G;  4HKV A;  2B88 A;  5H2F H;  2NPS C;  1KFM A;  1S5L H;  1R8E A;  2N1T A;  2WSF H;  1KB9 D;  5KLV G;  5APV A;  4DZO A;  3O8Z A;  1N73 B;  3AE8 C;  3M0D A;  4HM6 A;  3D70 A;  1FDM A;  4H44 C;  3H1L J;  5B66 H;  2HLO A;  5AVV B;  1L0N G;  4NPD A;  4H13 B;  1URQ C;  5AW5 B;  3TSI A;  4EMJ B;  3VMG D;  2XNX A;  3CC4 P;  1JTH B;  1MKM A;  1SQQ J;  5DJT B;  2O01 H;  2W6A A;  3V2R A;  4NPE A;  1KB9 E;  3M9B A;  2YMK A;  3CXH H;  2LXB A;  4UB6 H;  2GM4 A;  1HH0 A;  2OYH B;  4HJL A;  5BU8 B;  3LW5 H;  2I8D A;  1NGM B;  3CCU P;  2OTJ P;  4HM4 A;  2FFD B;  2WWW A;  4IL6 X;  1SLQ A;  3HD7 A;  2N9B A;  2P1J A;  1GK4 A;  5AVR B;  3F5H A;  3MIW A;  5TIS E;  3ITK A;  3P8C D;  2K9J B;  1FJP A;  3AEF C;  2BCC J;  3MUD A;  5M1B A;  2D2C C;  1P84 I;  3Q5R A;  3A2A A;  3GG2 A;  4N3Y B;  1NTM G;  1YTZ I;  2KIK A;  2WPS A;  2BMQ A;  5KLV J;  4LC1 A;  3L73 G;  3A7O A;  3CXH I;  4GDO A;  3JSV C;  1J2J B;  2Z5I A;  1QGK B;  1MZ9 A;  1KYO I;  1O7G A;  3TNU A;  1NH4 A;  2Q3I A;  3RK2 D;  2DE7 D;  1KYO D;  2YKP A;  5CJ0 A;  2IBZ D;  4M3L A;  2OYI B;  5AVW B;  2CPB A;  1JY2 P;  3A5T A;  3L70 E;  4YPC A;  1NTZ E;  3L72 E;  1IK7 A;  2E74 B;  3HUS A;  1U7M A;  1Y9B A;  1P84 H;  1VQP P;  1H8A A;  1NKZ B;  2R32 A;  2FYU E;  2FKW B;  2KZI A;  1U7J A;  3GTE A;  1PP9 D;  1PL5 A;  1L0N D;  2L5G B;  2M5A B;  2AEJ A;  3AZC A;  1AVY A;  3D6Y A;  4IOI H;  2HPC B;  1L0N K;  3M9H A;  4I6M C;  3GZY A;  3EFG A;  2H89 C;  3EQ2 A;  5CBO A;  5C39 A;  3PRJ A;  1JTH A;  1P84 E;  3H1L E;  3DQY A;  5AW1 B;  1JM1 A;  4W7Y A;  3H1I D;  2KLU A;  3SFE C;  1EXI A;  2W90 A;  4I1L A;  5AW6 B;  2QJY C;  1URQ B;  1HJ0 A;  1G1J A;  1L0L G;  1OW8 A;  3LW5 J;  3M9Q A;  1VQ9 P;  1SQX D;  3TGU E;  4Y99 C;  3C0D A;  4WY4 A;  1NTZ K;  3H1K D;  5CCH D;  5AVS B;  2N1T B;  3CME P;  2HML A;  1UUW A;  2H8P D;  4HM7 A;  5TIS H;  1RE4 C;  3CCL P;  2QJK B;  4PJ0 E;  1OVU A;  2A06 D;  2G3A A;  2NPS D;  1NTM J;  2AEM A;  1ZRT D;  3L75 J;  3V4W A;  3D71 A;  1JM0 A;  2KLV A;  2JWD A;  2KK7 A;  2P10 A;  4W7Z A;  3TF5 A;  1SP4 A;  3WUT A;  3HRN A;  4H44 D;  4UB8 H;  1JY3 N;  4TLF A;  2NZ2 A;  4P1C H;  2Y0D A;  3E1R A;  4EDF A;  2JWA A;  4PD4 D;  1L0N E;  1YYC A;  1PV3 A;  1G8K B;  4I7Z C;  1OIP A;  2IZ1 A;  1L4A A;  4U3F D;  2XSH A;  4U3F J;  3CCM P;  1IFJ A;  3VMA A;  2XZR A;  1W2E A;  1YJW P;  1PFI A;  1WQL A;  1JY3 O;  1QLE D;  3USS A;  3VP8 A;  4W80 A;  2JKV A;  2YO3 A;  2ZYG A;  1BCC D;  2E5Y A;  4N78 E;  2YO2 A;  1VQ6 P;  3OA7 A;  5GTH E;  3CWB J;  2J5U A;  3CWB E;  1IZN B;  2E5T A;  5B66 E;  4YXW H;  1G8J B;  3V5B A;  1RE4 A;  2I1K A;  3AEG C;  1FZC C;  2E42 A;  2QM8 A;  4B86 A;  4NBA D;  2D2C D;  1AV1 A;  4QDF B;  2OYH C;  1KQS O;  1USD A;  4I7Z B;  1FDO A;  2QRX A;  1BE3 D;  1JEK A;  5CXM A;  1FZE A;  1OX3 A;  4DT0 A;  1NTM E;  5KAF E;  2P58 A;  4HJG H;  4YTP C;  2Y9Y A;  1SFC C;  1LWU A;  1T2K C;  2K3R A;  3CL3 D;  4NBC D;  4OH8 B;  4HM3 A;  1KOR A;  3RK3 D;  4H0L C;  3VOP A;  2E43 A;  2RH0 A;  2M8R A;  1N73 C;  3S4R A; 
#chains in the Genus database with same CATH homology
 4NBG D;  2GBX A;  1SQX E;  3H1K E;  4U3F E;  1NDO A;  1BGY E;  4QDC A;  1L0N E;  5AEU A;  3GZY A;  1G8K B;  3BCC E;  2E4P A;  1ULI A;  4QDF A;  3GOB A;  1SQV E;  1P84 E;  1BCC E;  3H1L E;  2YFI A;  2CKF A;  1JM1 A;  2NVE A;  3DQY A;  2XSO A;  2ZT9 D;  4P1B H;  2XSH A;  1SJG A;  2JO6 A;  3CX5 E;  3H1J E;  3VMI D;  5BOK A;  4HKV A;  4QUP A;  2QJY C;  5KKZ C;  2BMR A;  2B24 A;  2GBW A;  1NYK A;  3EQQ A;  2HMO A;  1EG9 A;  5HL4 A;  4QDD A;  1WQL A;  4HM0 A;  2YFJ A;  3FOU A;  3VCP A;  2NUK A;  4PV1 D;  4QUR A;  3TGU E;  3N0Q A;  2BMQ A;  3H1H E;  2ZYL A;  4NBF D;  3C0D A;  2FYN C;  2HMM A;  2Q3W A;  4NBH D;  4NB9 D;  2I7F A;  1O7W A;  3GL0 A;  4HM6 A;  3L74 E;  1ULJ A;  3H1I E;  2YVJ B;  4H0L D;  2E74 D;  4NBE D;  3L71 E;  3GL2 A;  1EZV E;  2HMJ A;  1RFS A;  4HM2 A;  2HML A;  1O7G A;  1FQT A;  2NWF A;  3CWB E;  1UUW A;  1G8J B;  2NVG A;  2QJK C;  4HM7 A;  2DE7 D;  2XRX A;  3VCA A;  4EMJ B;  2HMK A;  1SQP E;  4AAY B;  2NVF A;  3VMG D;  1O7M A;  4NBA D;  2D2C D;  3GKE A;  2YFL A;  4QDF B;  1SQQ E;  2B1X A;  1VF5 D;  1BE3 E;  2IBZ E;  1KB9 E;  4NBD D;  2A06 E;  4D6T E;  2E75 D;  4HM1 A;  1ZRT E;  1SQB E;  3L70 E;  1NU1 E;  1NTZ E;  3L72 E;  3GB4 A;  4HM5 A;  4HM8 A;  3GZX A;  1RIE A;  5CXM A;  5KLV E;  3CXH E;  2JZA A;  1NTM E;  4OGQ D;  2DE5 D;  3L73 E;  5AEW A;  4PD4 E;  2DE6 D;  1NTK E;  1KYO E;  4HJL A;  2QJP C;  1L0L E;  1O7P A;  3VMH D;  1VCK A;  2XR8 A;  2QPZ A;  4NBC D;  4HM4 A;  5KLI C;  1PPJ E;  1Q90 C;  3D89 A;  2FYU E;  4H44 D;  4NBB D;  1VM9 A;  2E76 D;  4QCK A;  4H13 D;  4QUQ A;  4AIV A;  2HMN A;  3GTE A;  2YIU C;  3GTS A;  2BMO A;  4HM3 A;  1UUV A;  2BCC E;  1O7H A;  2NUM A;  1PP9 E;  2E4Q A;  3EN1 A;  4NB8 D;  3GCE A;  3AZC A;  4P1C H;  3L75 E;  1O7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...