3CXHE

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 49
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cxhE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cxhE02
2BCCE 1BCCE 4P1BH 1O7WA 4H44D 3L70E 3GB4A 1KYOE 4QDFA 4NBGD 4QUQA 3D89A 1O7HA 3VMID 3H1JE 3DQYA 1RFSA 1NU1E 4EMJB 4D6TE 2GBWA 2HMJA 3L74E 1BE3E 2FYUE 3EN1A 1L0NE 3N0QA 2BMQA 2NVEA 2E75D 1G8KB 3EQQA 4HM7A 4NBCD 2BMRA 3GTSA 2XRXA 4QDFB 2YFIA 5CXMA 4QCKA 2XR8A 3GKEA 3CWBE 2IBZE 1O7GA 2YIUC 3L71E 2BMOA 4QDCA 3GTEA 1BGYE 4QURA 3GL2A 1SQVE 3CX5E 1G8JB 2XSOA 1EZVE 4NBAD 2XSHA 3GCEA 2NWFA 1PP9E 4NB8D 1VCKA 4HM4A 1NTKE 2ZT9D 4NBHD 2Q3WA 4HM8A 1L0LE 5HL4A 2CKFA 4PD4E 4OGQD 4H0LD 2I7FA 4H13D 1KB9E 3GZYA 1NDOA 4HJLA 3VCPA 1SQBE 3GL0A 2B24A 2QJYC 3GOBA 4QUPA 1O7NA 2B1XA 3H1KE 2QPZA 1SQPE 2NVGA 4HM1A 5AEWA 4HM3A 3AZCA 1ULIA 5AEUA 1SQXE 4AIVA 1RIEA 2JZAA 4NBBD 2FYNC 3L75E 2D2CD 1O7MA 4NB9D 2HMMA 1EG9A 1JM1A 3CXHE 4NBFD 2GBXA 2E74D 3FOUA 1UUVA 2QJKC 4PV1D 3H1IE 5KKZC 2HMNA 4HM2A 4NBED 5BOKA 4HM5A 4P1CH 1SQQE 1Q90C 1WQLA 4QDDA 4HM6A 2NUKA 3L73E 2NUMA 2QJPC 2E76D 4AAYB 5KLIC 2E4PA 1NTME 2DE5D 2YFJA 1ULJA 3VMHD 2HMOA 3L72E 1UUWA 2HMKA 1P84E 3H1LE 4HM0A 3H1HE 4U3FE 4NBDD 3TGUE 2A06E 2JO6A 2YFLA 1VF5D 4HKVA 3C0DA 2E4QA 2ZYLA 2YVJB 3GZXA 1PPJE 2HMLA 1O7PA 1VM9A 3VCAA 1NYKA 1SJGA 2NVFA 1FQTA 1NTZE 2DE7D 2DE6D 3VMGD 5KLVE 1ZRTE 3BCCE
chains in the Genus database with same CATH superfamily
5CCHC 3H25A 2JJLA 1YIJP 1KORA 2KK7A 2NPSD 1NYHA 3N4XA 1URQA 4IFFA 3DQYA 2NPSA 1P84D 3CCQP 1RY3A 1MZ9A 1LT1A 1VQPP 3FX0A 5DJTB 1IFNA 1BGYE 5KLVK 1LT9B 1VCKA 4EI2A 2ZT9D 5HL4A 4HM8A 1JOCA 1KTMA 2I7FA 3CPWO 3L75G 1FOSF 3VCPA 1JY3P 1BE3D 1L0NK 3H1KE 3B4SA 3I55P 5CJ0A 3CWBJ 1AJYA 1KB9I 1NTZK 2A45G 1PP9J 4HB1A 2MJZA 1NTKK 5AVRB 1EXJA 3FXDA 1X79B 2I1JA 5AVTB 3A0BH 1LWUC 1HWTC 4BWNA 3Q2YA 2OTJP 3CXHH 1N2DC 2NUKA 1VQ4P 3PRJA 3V2QA 2BEQD 4AAYB 2OGUA 1VQ7P 1HF9A 1H8AA 1M1JB 1S5LH 3AE5C 2I1KA 5KLIB 5BU5A 3R4YA 3IR9A 3AE2C 1SFCA 5AVSB 3MHVA 1SJGA 1SVFA 1JCCA 1SQQK 3BVHA 1EDIA 3HUSA 2Z5IA 2O1JA 1R5LA 2WSEJ 1Z56A 1RF0A 1NU1E 1BSNA 3SWKA 1FDOA 3EQQA 4GT1A 1KYOI 2YFIA 2R5BA 4QDCA 3BCCJ 3L71E 2JP3A 2I8DA 4U7JA 1W2BO 2R5DA 1DD3A 3PTZA 4I1LA 2CPSA 4HJLA 2FYUD 2QPZA 3VTPC 2H88C 1ZR4A 2E43A 3L36A 4HM3A 1ULIA 1M8OB 3MUDC 3LW5J 1PL5A 2FBWC 2WSCH 5AW0B 3RK2C 5TISH 1HUCA 2MKVA 1N7SB 4R4MA 2RH0A 4P1CH 5EFWB 1U7MA 1SQPJ 1VQNP 2YKPA 1BSHA 1PPJG 4C7NA 3W67A 2HMKA 1FDIA 3S9OA 3CC2P 3AECC 2IYOA 2XKMA 3MD0A 3H1IJ 1N7LA 3GW6A 1GL2B 1GDTA 1YBKA 2DE7D 1NHLA 4MN4C 3B5NB 1JTHB 4DCKA 1O7HA 1JO5A 1LT9A 1IC2A 5CBOA 1N73C 3G9RA 1FZBA 1JY3O 2YXQB 1LTSC 2XNXA 2FFDB 3IN6A 1SQVE 4NB8D 2POHA 2ZYGA 1SQXG 2WWWA 1NU1K 3P8CD 1VQOP 1BE3J 2QE7H 4R4LA 1AVYA 1Y9BA 1KZUB 3O6QB 1FBMA 2NVGA 4EOTA 3E1RA 4IOIH 2IBZD 5APSA 1KILE 2E74B 3A0BE 3RL0D 1FAVA 1S1CX 3L73G 1PFIA 3CXHE 4YTPC 1J1DB 2AEJA 1LNQA 1YTZI 3Q3DA 3S1KA 5CHXA 4HM2A 3H1HG 1M1JA 1FC2C 2KNCB 2K9JB 1Q90C 3P8MC 2P10A 4HM6A 1RQUA 2E4PA 2Y0DA 3CCJP 4U3FG 2HR3A 2M5AB 1KFNA 2FYZA 2KSJA 2M3EA 1FZCB 4HKVA 3FXEA 1WRGA 1GU5A 5KAIE 1DEEG 3E1IA 5APTA 2E76B 1KQFB 5KLVD 3M0DC 3GB4A 1KFMA 3CMEP 1EDKA 5AVQB 2IZ0A 3D89A 3VMID 1OXZA 1K04A 1Q81Q 4D6TE 1AA0A 1J1EC 2AEFA 3CX5I 2KLUA 3EQ2A 1KQLA 1L0ND 3L37A 3OA7A 1MFZA 2QM8A 2VRSA 4DT0A 1L4AB 1SQBG 1NTZD 3JC22 3CCEP 5APXA 2E75C 4QURA 5KAFE 5CCGD 2BCCD 1EZVE 1BCCD 2ZYAA 3OAKA 1JY2N 4K35A 1W5CE 2Q9IA 2YIUB 4W7YA 4H13D 2H89C 1OW6A 2FYUJ 3L74D 1WMKA 3KPEA 1NKZB 1GTWA 3VMYA 1N7SA 1RIEA 1SQVK 3T97B 1L0LJ 2P67A 1Q86Q 2W83C 2FYNB 1NTMG 1RE3A 3H1LG 3TGUG 3I5CA 1GL2D 2ZXEB 1OW8A 1GL2A 1M7LA 1IK9A 4TLFA 2PGDA 3B5ND 3L72E 3L75D 3HTKB 1DIPA 2JO6A 3B5NA 1JTHA 3PHLA 4A7PA 1KILC 3GZXA 2HMLA 1N86A 2NVFA 1T3JA 1J2JB 4C7RA 1O7WA 5AW9B 5B66E 4ZKUA 1ZLLA 4NBGD 2W6AA 3FGAD 2FFDA 2O01H 1KN7A 2IPPA 2Y0CA 1OX3A 3CMAP 2BMQA 1SLQA 1G8KB 1YITP 4NBCD 2ZVOB 1ZW0A 5GTHE 3M0AA 2PAJA 3GCEA 1FZFA 3O6QA 3MTUE 2XV5A 4N3YB 4JYCA 2OARA 2QJYC 1KV4A 1OVRA 4OGQC 4HH2A 2OYIB 5AEUA 2UWJE 3VOPA 1YJ9P 2KNCA 2K9JA 1GMJA 4GKGA 4NBFD 5CMZA 2C0WA 3UIAA 1OFCX 2M5AA 2KZIA 2QEXP 1FZCA 4LC1A 5AW2B 1T2KD 2E76D 2O01N 4NPEA 5KLVG 5M1BA 1VQ9P 5APYA 3L70G 1VF5D 1LT9C 1U57A 2OYOA 3KDPB 1FQTA 1YJNP 2B88A 1L0NG 2YMKA 2RKLA 3NTNA 2YO3A 1NO4A 1L4AD 1QVGO 1L4AA 3CC7P 3IFMA 3WUTA 1L0NJ 1NTKG 3AEGC 1AQTA 2NVEA 3GMAA 4K3AA 2XRXA 1NTZJ 1PPJD 2WVRA 1S2EA 1JB0J 3CWBE 3L74G 1O7GA 2BCCJ 1BCCJ 1PP9E 1YQ4C 4N78E 4HM4A 1URQD 1ZR2A 1KB9E 1FJKA 3AE6C 3L74J 3RL0C 3T97A 1S9KD 2KZJA 2XU6A 2QRXA 1EQ7A 2E5YA 2KB7P 1IO4A 2LXCB 2L5GB 1USDA 4HJGH 1SQQG 4I6MC 3WMM0 1LTJB 3MGNA 1DH3A 4PD4D 1OW7A 2AXTE 5DJUB 2K37A 5AW6B 1X8YA 2A06G 2WSSH 4NBED 3HTKA 2R44A 1R5SA 3GHGB 3SSUA 1YI2P 3L75J 1SQXD 2A45I 2JWAA 1RHZB 2YFLA 2FY8A 4HKZH 4LLHA 3EFGA 2ZYLA 3IAOA 1VM9A 2WSFH 1JUNA 4ASWA 3BCCE 1NVOA 3L73D 4GDOA 1KYOE 3A3YB 1RE4A 4BRYB 3TF5A 1BGYG 1TU3F 2V7QJ 5AVXB 4RJTA 5CCGC 3H1HD 4H44C 1SFCD 4H13C 4QCKA 2KI7B 2J5UA 3L35A 4RKUJ 2KLVA 3SFEC 3CCRP 4U3FD 4I2LC 3TDKA 2LR2A 2OYIA 2ZJSE 2B87B 1HGZA 5KAIH 2FXOA 3FWLA 2IZ1A 1KMIZ 2B24A 1MKMA 4L73A 2QSIA 4RESB 1SQPE 1USEA 1LP1B 1LTTC 4W7ZA 3AZCA 2JZAA 3CX5D 1FZAA 2WPSA 2QJKC 3ITKA 3H1IE 1SQBD 5KAFH 2ZVNB 3QH9A 3Q5RA 2V4HA 1LWUB 2QVAA 2FXMA 1UUWA 4OH8B 1P84E 1NH4A 2HLOA 1DX7A 1RF1C 1NAFA 1NU1G 2NZ2A 2J59M 2K9YA 1IFDA 1LJ2A 1H88A 3V6IA 4P1BH 4KT0J 3C8VA 1K9MQ 3OJAB 4IFMA 3L71G 1NTMD 4Y99C 3CC4P 3H1LD 2M8RA 3TGUD 4D6TD 1KC8Q 1BE3E 2WMMA 2FKWB 4HM7A 3WUVA 4QDFB 5CXMA 2XNDH 1UIIA 1LTIC 3GF7A 3AEAC 4HYTB 3OW2O 3D70A 4WVZA 2NRGA 1LTAC 5BVZA 3GZYA 3RK3B 1LTJA 4GOEA 3S4RA 1EDJA 5APQA 1QX8A 3U1AA 2N1TC 3VP9A 1AFOA 5B66H 4PD4I 1VQ5P 2W90A 1OVVA 1BDCA 1YJWP 2N9YB 1M57D 4AIVA 3D6YA 4NB9D 3JCUE 1FE6A 3AE1C 1T2KC 2OYHB 2OTLP 3GHGA 1UUVA 3GF3A 3KQGA 2PRRA 4C46A 5GTHH 1N8RQ 2D2CC 1G1IA 1YTZT 4HM5A 3RK2B 1VF5C 4PV1C 2Z5HA 1SQPK 4GIFA 1SQXJ 3HE5B 2C9LY 3K5BA 3KZIE 2PFXA 4HM0A 4M3LA 5AW1B 3C1LA 2Q1KA 1OVUA 5CCHD 2YVJB 4BRYA 3NXSA 2KYVA 2QG4A 3BATA 2GM4A 5CCHA 3SWYA 3L73J 4I7ZC 5KKZB 2JEEA 5APVA 3NMDA 3H1HJ 1RFSA 1SQVG 1RH5B 2GBWA 3RL0g 1HGVA 2FYUE 3N0QA 1URQC 2KP8A 4ZNCA 2NPSC 1SP4A 2B87A 2Y0EA 3AEDC 1JNMA 1G2CB 1GD2E 3RBZA 4U3FJ 3GL2A 1G8JB 2JWDA 3AEBC 3D71A 3L70D 1L0LE 1JY2P 1LP1A 4L75A 3H1JD 1EDLA 2KUBA 1NDOA 1LTBC 2HODB 2YNYA 2ZT9C 1T3UA 1O7NA 4IL6E 3VMZA 3VN0A 2G3AA 1IZNB 3CXHI 3WUUA 5AEWA 3Q5SA 3NFQA 4WY4B 4AUWA 4H0LB 1JMMA 1NWQA 4WB4A 1NTKD 3FOUA 1LWUA 2W8ZA 1SQBJ 3TSIA 1A02J 2OTKE 1RQVA 4L74A 1YYCA 1N7SD 4DJGA 1VQMP 1KB9H 2E42A 1PGJA 2RMZA 4GOFA 2C0XA 1ZP0C 1O7PA 4D6TG 1AVOA 1NYKA 1JM0A 1SQQD 3M91A 1SFCC 1CW5A 2Q3EA 1NTMJ 2AXTH 4QDFA 3HUSC 3H1LJ 2QJPB 3TGUJ 3P8CE 1MFTA 3CL3D 1EZVG 2HMJA 2A06D 3C9IA 3CCUP 3AE7C 2P2UA 2KIKA 1RF0C 2PP6A 5KTBA 3A0HE 3PLNA 3RK3D 1J1EB 2WSEH 1CI6B 2IBZE 1ZRTD 3Q5PA 5CBNA 1X22A 3M06A 1FOSE 1ZN5A 5AVZB 1GU4A 3QWOC 2XZRA 2E75B 4DZOA 2ITAA 2FYUK 4W80A 3MP7B 2WSCJ 1WT6A 2OYHA 1IFIA 1KYOH 3G71P 2ZFCA 1S4XA 3RK2D 3HD7B 1BGYD 2HYNA 1JM1A 1L0LK 2E74D 2GBXA 4NPDA 3HE5A 3L72G 1NAYA 1ZV8A 5AVVB 1M1KQ 5BOKA 3V4QA 4TT3H 3H1KD 2DW3A 3LW5H 2JDIH 3V2RA 5H2FE 1DEBA 3W68A 4RO0A 3SFDC 5GTIE 3U1CA 1LGHB 4NBDD 2QIWA 2CPBA 1PGPA 4EIJA 2Q6QA 1OWAA 3KHUA 5AW7B 2N9BA 1NTZE 2KS1B 2K1AA 1KILB 2BCCE 1BCCE 1XTGB 1G2CA 1HH0A 4YXDC 3L74E 4EDFA 2KOGA 1JY2O 2K88A 5KJ7D 3O8ZA 2KXPB 2W6JH 3PJSK 3H1JG 5KJ7A 1LTJC 1CZQA 5KLVJ 4O9BA 1K8AQ 1P84H 2BMOA 2HODA 4WBAA 2B9BA 3L70J 1IFMA 3LIEA 1CSBA 3H1JJ 4WY4D 1QEXA 3TNUB 4H0LD 4UB8H 4WY4A 1NU1D 4QUPA 2W27A 1GK4A 3A2AA 3EWKA 2QJYB 4XA4A 3L71D 4OGQB 3FWNA 3L75E 1T6AA 1NTKJ 1FZEA 5B5EE 1Q90D 4IL6X 3E7KA 3P7KA 1H0TB 1WQLA 2YMYA 2BEZF 4PJ0E 1M1JC 5AVYB 5KLIC 2YFJA 2AEMA 2FXPA 3GLMA 1OZHA 2E4QA 1NOHA 3V4WA 1ZXGA 1SQQJ 3M0DA 1JEKA 5AVUB 1ZMEC 3JCUH 3KXDA 2M3BA 1PGOA 3CWBG 1CI6A 1PP9G 2E75D 3HRNA 3KZIH 4N6JA 2P1JA 2YXRB 3GTEA 2Q7CA 3BRVB 1L2PA 2LXBA 2IX7C 4JBZA 3IF4A 3HD7D 4ZKPA 2K3RA 1JY3N 3HD7A 4OVNF 3GL0A 4EYYQ 3CX5H 2B1XA 2IDBA 5APUA 3RL0B 2BASA 1BGYJ 4UB6E 5TJHA 3H1KG 4NBBD 1SQVD 1O7MA 1FZGA 1N7SC 3I56P 4AYCA 2Q3IA 5E79H 3VYIA 3H1KJ 5AW4B 3A5TA 1IK7A 5AW5B 1RE3C 3MZWB 2NUMA 1Y8AA 3L4FA 1KILD 1ULJA 3BCCG 2KS1A 1GL2C 2WT7B 4IL6H 1KILA 1VQKP 2YKQA 3CXHD 1VQLP 3CCLP 1PPJE 3B5NC 2O01J 2QA4P 1UIXA 2RN0A 3VMGD 4NBAD 2JO1A 3VMXA 3ZDMA 3M9HA 3B71A 1HTLC 3AEFC 3RK3C 1VL2A 2J58A 1S9KE 1VPCA 2FFDC 2GUSA 3TNUA 4H44B 4UB8E 4KJMA 1D7MA 2OYHC 3HE4B 3CI9A 4Y28J 4JPZB 2H43A 4H13B 1GW3A 1SQPG 1NJIQ 2Q3WA 1E79H 1L0LD 4PD4E 1NU1J 4OGQD 1G1JA 1X9VA 1VDFA 4JF7A 3AE9C 1KQSO 1IFJA 3KYQA 2QM7A 2E74C 3CCSP 1R8EA 3H1IG 1AQ5A 2O3JA 2Q5UA 3L71J 3VMAA 1H0TA 2C9NY 1J1DC 1SQXE 2XDJA 1EZVD 3CCMP 2WPVB 3A0HH 1FDMA 1GZLA 2GA1A 1IFPA 1QGKB 5KKZC 4ZMDA 4B86A 1P84I 2QJKB 2SPZA 3WU2H 1BDDA 3L73E 1HBWA 3AE8C 1QVFO 1DD4A 5AW8B 1FZCC 4ASVA 2DE5D 3H1HE 3R2PA 2E76C 1FU1A 3C0DA 1U7JA 3F89A 2LKMA 2DE6D 1BE3G 3EFFK 1KD1Q 4U3FE 1PIXA 5KJ7C 1OMIA 1RF1B 2M0BA 4IFDK 4OWFA 3H32B 3AE4C 3M9BA 2WZ7A 2JR8A 3L72D 1KQGB 1L4AC 3USSA 4WY4C 5AVWB 4Y99B 3N7NA 4H0LC 5H2FH 2ZXXA 5GTIH 1K05A 1LTGC 2YIUC 1AV1A 3G3ZA 3CX5E 1JMBA 2NWFA 3PH0A 1QLED 4NBHD 3F5HA 2IFMA 2L91A 1MV8A 4YPCA 1HVVA 1SQBE 3GOBA 1S5LE 1Q82Q 2WTYA 2P58A 5E79E 1GK6A 3M9QA 4Z1MH 1SQVJ 1N73B 2N1TB 1Q7YQ 2FYNC 3RGUA 2HPCB 2P7JA 1YHQP 2WPQA 3B8EB 2Z4EA 2W6BA 2YKOA 1PV3A 2WT7A 1IJDB 2R3SA 2D2CB 2QJPC 1NTME 2WPRA 1VF5B 1YQ3C 1SQXK 2WSFJ 3BASA 4PV1B 2HMOA 3H1LE 3TGUE 3AEEC 3MIWA 1VQ8P 2Y9YA 4XE5B 3VP8A 1GW4A 3VCAA 2FYUG 5B5EH 3A7OA 1ZOYC 4H44D 2R3CA 5CCGA 4QUQA 4WWIA 5K5GB 4I7ZB 3U59A 2A45H 3GG2A 3HE4A 1RE4C 3EN1A 4PJ0H 1L0LG 3HD7C 5TISE 1K73Q 2XR8A 3GKEA 1URQB 2NPSB 1FJPA 2V7QH 2XSOA 1SS1A 3TK1A 5APWA 1NKNA 1JCDA 4BXLA 2CKFA 4L76A 4D6TJ 1XTCC 5C39A 2OYIC 1E5WA 3G4SP 2HFED 1EZVI 4LGDE 2ZT9B 2Y9ZA 1T8ZA 3LIDA 3RBXA 2G8YA 3CWBD 1M90Q 2GUVA 2H8PD 1NGMB 1PP9D 1EG9A 3WU2E 4N78D 2KSEA 1EC5A 1FS0E 4YXWH 5CJ4A 1KB9D 2HMNA 1SQBK 2WITA 2OQQA 3MUDA 1EXIA 5BU8B 3V2NA 4AQRD 4JQ0D 1RF1A 1H89A 1S3JA 3H32A 1QL2A 5AW3B 4UB6H 3G6EP 3AE3C 5KLVE 3H6PA 2O1KA 4CPGA 3V5BA 1Y47A 2ZYDA 3L70E 3CD6P 2JKVA 1PZQA 2CK3H 2IBZG 3L72J 1NTMK 1SFCB 3H1JE 4EMJB 2IBZI 2IFNA 3HUSB 4GODA 1L0NE 4QMAA 3CLQA 3JSVC 1W2EA 2BMRA 3GTSA 3TYYA 1M56D 1A02F 3P32A 1MUUA 2YO2A 3BCCD 2XSHA 3V2PA 1NTKE 1KYOD 1VQ6P 2N1TD 1N73A 2N1TA 2WQYC 2IYPA 4JYBA 2HPCA 2R32A 1HJ0A 1X0TA 4DOJA 2HG5D 3CCVP 3II6A 1HJBA 4HM1A 1OIPA 2E5TA 2B89A 2D2CD 3SWFA 1Q2NA 2H7HA 1S72P 2HMMA 1S5LX 3BRTB 4PV1D 1PGQA 5L8RJ 2ZAEB 3GHGC 3D6ZA 1QL1A 1SQQE 4QDDA 1SQPD 4PD4H 1NTZG 4NPFX 3VMHD 2BCCG 1BCCG 2A06E 3ABVC 2AXCA 4KHXA 3RK3E 3H1ID 3Q1MA 3PP5A 4XFJA 4C7NB 1ZRTE
chains in the Genus database with same CATH topology
2BCCE 1BCCE 4P1BH 1O7WA 4H44D 3L70E 3GB4A 1KYOE 4QDFA 4NBGD 4QUQA 3D89A 1O7HA 3VMID 3H1JE 3DQYA 1RFSA 1NU1E 4EMJB 4D6TE 2GBWA 2HMJA 3L74E 1BE3E 2FYUE 3EN1A 1L0NE 3N0QA 2BMQA 2NVEA 2E75D 1G8KB 3EQQA 4HM7A 4NBCD 2BMRA 3GTSA 2XRXA 4QDFB 2YFIA 5CXMA 4QCKA 2XR8A 3GKEA 3CWBE 2IBZE 1O7GA 2YIUC 3L71E 2BMOA 4QDCA 3GTEA 1BGYE 4QURA 3GL2A 1SQVE 3CX5E 1G8JB 2XSOA 1EZVE 4NBAD 2XSHA 3GCEA 2NWFA 1PP9E 4NB8D 1VCKA 4HM4A 1NTKE 2ZT9D 4NBHD 2Q3WA 4HM8A 1L0LE 5HL4A 2CKFA 4PD4E 4OGQD 4H0LD 2I7FA 4H13D 1KB9E 3GZYA 1NDOA 4HJLA 3VCPA 1SQBE 3GL0A 2B24A 2QJYC 3GOBA 4QUPA 1O7NA 2B1XA 3H1KE 2QPZA 1SQPE 2NVGA 4HM1A 5AEWA 4HM3A 3AZCA 1ULIA 5AEUA 1SQXE 4AIVA 1RIEA 2JZAA 4NBBD 2FYNC 3L75E 2D2CD 1O7MA 4NB9D 2HMMA 1EG9A 1JM1A 3CXHE 4NBFD 2GBXA 2E74D 3FOUA 1UUVA 2QJKC 4PV1D 3H1IE 5KKZC 2HMNA 4HM2A 4NBED 5BOKA 4HM5A 4P1CH 1SQQE 1Q90C 1WQLA 4QDDA 4HM6A 2NUKA 3L73E 2NUMA 2QJPC 2E76D 4AAYB 5KLIC 2E4PA 1NTME 2DE5D 2YFJA 1ULJA 3VMHD 2HMOA 3L72E 1UUWA 2HMKA 1P84E 3H1LE 4HM0A 3H1HE 4U3FE 4NBDD 3TGUE 2A06E 2JO6A 2YFLA 1VF5D 4HKVA 3C0DA 2E4QA 2ZYLA 2YVJB 3GZXA 1PPJE 2HMLA 1O7PA 1VM9A 3VCAA 1NYKA 1SJGA 2NVFA 1FQTA 1NTZE 2DE7D 2DE6D 3VMGD 5KLVE 1ZRTE 3BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC E;  1BCC E;  4P1B H;  1O7W A;  4H44 D;  3L70 E;  3GB4 A;  1KYO E;  4QDF A;  4NBG D;  4QUQ A;  3D89 A;  1O7H A;  3VMI D;  3H1J E;  3DQY A;  1RFS A;  1NU1 E;  4EMJ B;  4D6T E;  2GBW A;  2HMJ A;  3L74 E;  1BE3 E;  2FYU E;  3EN1 A;  1L0N E;  3N0Q A;  2BMQ A;  2NVE A;  2E75 D;  1G8K B;  3EQQ A;  4HM7 A;  4NBC D;  2BMR A;  3GTS A;  2XRX A;  4QDF B;  2YFI A;  5CXM A;  4QCK A;  2XR8 A;  3GKE A;  3CWB E;  2IBZ E;  1O7G A;  2YIU C;  3L71 E;  2BMO A;  4QDC A;  3GTE A;  1BGY E;  4QUR A;  3GL2 A;  1SQV E;  3CX5 E;  1G8J B;  2XSO A;  1EZV E;  4NBA D;  2XSH A;  3GCE A;  2NWF A;  1PP9 E;  4NB8 D;  1VCK A;  4HM4 A;  1NTK E;  2ZT9 D;  4NBH D;  2Q3W A;  4HM8 A;  1L0L E;  5HL4 A;  2CKF A;  4PD4 E;  4OGQ D;  4H0L D;  2I7F A;  4H13 D;  1KB9 E;  3GZY A;  1NDO A;  4HJL A;  3VCP A;  1SQB E;  3GL0 A;  2B24 A;  2QJY C;  3GOB A;  4QUP A;  1O7N A;  2B1X A;  3H1K E;  2QPZ A;  1SQP E;  2NVG A;  4HM1 A;  5AEW A;  4HM3 A;  3AZC A;  1ULI A;  5AEU A;  1SQX E;  4AIV A;  1RIE A;  2JZA A;  4NBB D;  2FYN C;  3L75 E;  2D2C D;  1O7M A;  4NB9 D;  2HMM A;  1EG9 A;  1JM1 A;  3CXH E;  4NBF D;  2GBX A;  2E74 D;  3FOU A;  1UUV A;  2QJK C;  4PV1 D;  3H1I E;  5KKZ C;  2HMN A;  4HM2 A;  4NBE D;  5BOK A;  4HM5 A;  4P1C H;  1SQQ E;  1Q90 C;  1WQL A;  4QDD A;  4HM6 A;  2NUK A;  3L73 E;  2NUM A;  2QJP C;  2E76 D;  4AAY B;  5KLI C;  2E4P A;  1NTM E;  2DE5 D;  2YFJ A;  1ULJ A;  3VMH D;  2HMO A;  3L72 E;  1UUW A;  2HMK A;  1P84 E;  3H1L E;  4HM0 A;  3H1H E;  4U3F E;  4NBD D;  3TGU E;  2A06 E;  2JO6 A;  2YFL A;  1VF5 D;  4HKV A;  3C0D A;  2E4Q A;  2ZYL A;  2YVJ B;  3GZX A;  1PPJ E;  2HML A;  1O7P A;  1VM9 A;  3VCA A;  1NYK A;  1SJG A;  2NVF A;  1FQT A;  1NTZ E;  2DE7 D;  2DE6 D;  3VMG D;  5KLV E;  1ZRT E;  3BCC E; 
#chains in the Genus database with same CATH topology
 5CCH C;  3H25 A;  2JJL A;  1YIJ P;  1KOR A;  2KK7 A;  2NPS D;  1NYH A;  3N4X A;  1URQ A;  4IFF A;  3DQY A;  2NPS A;  1P84 D;  3CCQ P;  1RY3 A;  1MZ9 A;  1LT1 A;  1VQP P;  3FX0 A;  5DJT B;  1IFN A;  1BGY E;  5KLV K;  1LT9 B;  1VCK A;  4EI2 A;  2ZT9 D;  5HL4 A;  4HM8 A;  1JOC A;  1KTM A;  2I7F A;  3CPW O;  3L75 G;  1FOS F;  3VCP A;  1JY3 P;  1BE3 D;  1L0N K;  3H1K E;  3B4S A;  3I55 P;  5CJ0 A;  3CWB J;  1AJY A;  1KB9 I;  1NTZ K;  2A45 G;  1PP9 J;  4HB1 A;  2MJZ A;  1NTK K;  5AVR B;  1EXJ A;  3FXD A;  1X79 B;  2I1J A;  5AVT B;  3A0B H;  1LWU C;  1HWT C;  4BWN A;  3Q2Y A;  2OTJ P;  3CXH H;  1N2D C;  2NUK A;  1VQ4 P;  3PRJ A;  3V2Q A;  2BEQ D;  4AAY B;  2OGU A;  1VQ7 P;  1HF9 A;  1H8A A;  1M1J B;  1S5L H;  3AE5 C;  2I1K A;  5KLI B;  5BU5 A;  3R4Y A;  3IR9 A;  3AE2 C;  1SFC A;  5AVS B;  3MHV A;  1SJG A;  1SVF A;  1JCC A;  1SQQ K;  3BVH A;  1EDI A;  3HUS A;  2Z5I A;  2O1J A;  1R5L A;  2WSE J;  1Z56 A;  1RF0 A;  1NU1 E;  1BSN A;  3SWK A;  1FDO A;  3EQQ A;  4GT1 A;  1KYO I;  2YFI A;  2R5B A;  4QDC A;  3BCC J;  3L71 E;  2JP3 A;  2I8D A;  4U7J A;  1W2B O;  2R5D A;  1DD3 A;  3PTZ A;  4I1L A;  2CPS A;  4HJL A;  2FYU D;  2QPZ A;  3VTP C;  2H88 C;  1ZR4 A;  2E43 A;  3L36 A;  4HM3 A;  1ULI A;  1M8O B;  3MUD C;  3LW5 J;  1PL5 A;  2FBW C;  2WSC H;  5AW0 B;  3RK2 C;  5TIS H;  1HUC A;  2MKV A;  1N7S B;  4R4M A;  2RH0 A;  4P1C H;  5EFW B;  1U7M A;  1SQP J;  1VQN P;  2YKP A;  1BSH A;  1PPJ G;  4C7N A;  3W67 A;  2HMK A;  1FDI A;  3S9O A;  3CC2 P;  3AEC C;  2IYO A;  2XKM A;  3MD0 A;  3H1I J;  1N7L A;  3GW6 A;  1GL2 B;  1GDT A;  1YBK A;  2DE7 D;  1NHL A;  4MN4 C;  3B5N B;  1JTH B;  4DCK A;  1O7H A;  1JO5 A;  1LT9 A;  1IC2 A;  5CBO A;  1N73 C;  3G9R A;  1FZB A;  1JY3 O;  2YXQ B;  1LTS C;  2XNX A;  2FFD B;  3IN6 A;  1SQV E;  4NB8 D;  2POH A;  2ZYG A;  1SQX G;  2WWW A;  1NU1 K;  3P8C D;  1VQO P;  1BE3 J;  2QE7 H;  4R4L A;  1AVY A;  1Y9B A;  1KZU B;  3O6Q B;  1FBM A;  2NVG A;  4EOT A;  3E1R A;  4IOI H;  2IBZ D;  5APS A;  1KIL E;  2E74 B;  3A0B E;  3RL0 D;  1FAV A;  1S1C X;  3L73 G;  1PFI A;  3CXH E;  4YTP C;  1J1D B;  2AEJ A;  1LNQ A;  1YTZ I;  3Q3D A;  3S1K A;  5CHX A;  4HM2 A;  3H1H G;  1M1J A;  1FC2 C;  2KNC B;  2K9J B;  1Q90 C;  3P8M C;  2P10 A;  4HM6 A;  1RQU A;  2E4P A;  2Y0D A;  3CCJ P;  4U3F G;  2HR3 A;  2M5A B;  1KFN A;  2FYZ A;  2KSJ A;  2M3E A;  1FZC B;  4HKV A;  3FXE A;  1WRG A;  1GU5 A;  5KAI E;  1DEE G;  3E1I A;  5APT A;  2E76 B;  1KQF B;  5KLV D;  3M0D C;  3GB4 A;  1KFM A;  3CME P;  1EDK A;  5AVQ B;  2IZ0 A;  3D89 A;  3VMI D;  1OXZ A;  1K04 A;  1Q81 Q;  4D6T E;  1AA0 A;  1J1E C;  2AEF A;  3CX5 I;  2KLU A;  3EQ2 A;  1KQL A;  1L0N D;  3L37 A;  3OA7 A;  1MFZ A;  2QM8 A;  2VRS A;  4DT0 A;  1L4A B;  1SQB G;  1NTZ D;  3JC2 2;  3CCE P;  5APX A;  2E75 C;  4QUR A;  5KAF E;  5CCG D;  2BCC D;  1EZV E;  1BCC D;  2ZYA A;  3OAK A;  1JY2 N;  4K35 A;  1W5C E;  2Q9I A;  2YIU B;  4W7Y A;  4H13 D;  2H89 C;  1OW6 A;  2FYU J;  3L74 D;  1WMK A;  3KPE A;  1NKZ B;  1GTW A;  3VMY A;  1N7S A;  1RIE A;  1SQV K;  3T97 B;  1L0L J;  2P67 A;  1Q86 Q;  2W83 C;  2FYN B;  1NTM G;  1RE3 A;  3H1L G;  3TGU G;  3I5C A;  1GL2 D;  2ZXE B;  1OW8 A;  1GL2 A;  1M7L A;  1IK9 A;  4TLF A;  2PGD A;  3B5N D;  3L72 E;  3L75 D;  3HTK B;  1DIP A;  2JO6 A;  3B5N A;  1JTH A;  3PHL A;  4A7P A;  1KIL C;  3GZX A;  2HML A;  1N86 A;  2NVF A;  1T3J A;  1J2J B;  4C7R A;  1O7W A;  5AW9 B;  5B66 E;  4ZKU A;  1ZLL A;  4NBG D;  2W6A A;  3FGA D;  2FFD A;  2O01 H;  1KN7 A;  2IPP A;  2Y0C A;  1OX3 A;  3CMA P;  2BMQ A;  1SLQ A;  1G8K B;  1YIT P;  4NBC D;  2ZVO B;  1ZW0 A;  5GTH E;  3M0A A;  2PAJ A;  3GCE A;  1FZF A;  3O6Q A;  3MTU E;  2XV5 A;  4N3Y B;  4JYC A;  2OAR A;  2QJY C;  1KV4 A;  1OVR A;  4OGQ C;  4HH2 A;  2OYI B;  5AEU A;  2UWJ E;  3VOP A;  1YJ9 P;  2KNC A;  2K9J A;  1GMJ A;  4GKG A;  4NBF D;  5CMZ A;  2C0W A;  3UIA A;  1OFC X;  2M5A A;  2KZI A;  2QEX P;  1FZC A;  4LC1 A;  5AW2 B;  1T2K D;  2E76 D;  2O01 N;  4NPE A;  5KLV G;  5M1B A;  1VQ9 P;  5APY A;  3L70 G;  1VF5 D;  1LT9 C;  1U57 A;  2OYO A;  3KDP B;  1FQT A;  1YJN P;  2B88 A;  1L0N G;  2YMK A;  2RKL A;  3NTN A;  2YO3 A;  1NO4 A;  1L4A D;  1QVG O;  1L4A A;  3CC7 P;  3IFM A;  3WUT A;  1L0N J;  1NTK G;  3AEG C;  1AQT A;  2NVE A;  3GMA A;  4K3A A;  2XRX A;  1NTZ J;  1PPJ D;  2WVR A;  1S2E A;  1JB0 J;  3CWB E;  3L74 G;  1O7G A;  2BCC J;  1BCC J;  1PP9 E;  1YQ4 C;  4N78 E;  4HM4 A;  1URQ D;  1ZR2 A;  1KB9 E;  1FJK A;  3AE6 C;  3L74 J;  3RL0 C;  3T97 A;  1S9K D;  2KZJ A;  2XU6 A;  2QRX A;  1EQ7 A;  2E5Y A;  2KB7 P;  1IO4 A;  2LXC B;  2L5G B;  1USD A;  4HJG H;  1SQQ G;  4I6M C;  3WMM 0;  1LTJ B;  3MGN A;  1DH3 A;  4PD4 D;  1OW7 A;  2AXT E;  5DJU B;  2K37 A;  5AW6 B;  1X8Y A;  2A06 G;  2WSS H;  4NBE D;  3HTK A;  2R44 A;  1R5S A;  3GHG B;  3SSU A;  1YI2 P;  3L75 J;  1SQX D;  2A45 I;  2JWA A;  1RHZ B;  2YFL A;  2FY8 A;  4HKZ H;  4LLH A;  3EFG A;  2ZYL A;  3IAO A;  1VM9 A;  2WSF H;  1JUN A;  4ASW A;  3BCC E;  1NVO A;  3L73 D;  4GDO A;  1KYO E;  3A3Y B;  1RE4 A;  4BRY B;  3TF5 A;  1BGY G;  1TU3 F;  2V7Q J;  5AVX B;  4RJT A;  5CCG C;  3H1H D;  4H44 C;  1SFC D;  4H13 C;  4QCK A;  2KI7 B;  2J5U A;  3L35 A;  4RKU J;  2KLV A;  3SFE C;  3CCR P;  4U3F D;  4I2L C;  3TDK A;  2LR2 A;  2OYI A;  2ZJS E;  2B87 B;  1HGZ A;  5KAI H;  2FXO A;  3FWL A;  2IZ1 A;  1KMI Z;  2B24 A;  1MKM A;  4L73 A;  2QSI A;  4RES B;  1SQP E;  1USE A;  1LP1 B;  1LTT C;  4W7Z A;  3AZC A;  2JZA A;  3CX5 D;  1FZA A;  2WPS A;  2QJK C;  3ITK A;  3H1I E;  1SQB D;  5KAF H;  2ZVN B;  3QH9 A;  3Q5R A;  2V4H A;  1LWU B;  2QVA A;  2FXM A;  1UUW A;  4OH8 B;  1P84 E;  1NH4 A;  2HLO A;  1DX7 A;  1RF1 C;  1NAF A;  1NU1 G;  2NZ2 A;  2J59 M;  2K9Y A;  1IFD A;  1LJ2 A;  1H88 A;  3V6I A;  4P1B H;  4KT0 J;  3C8V A;  1K9M Q;  3OJA B;  4IFM A;  3L71 G;  1NTM D;  4Y99 C;  3CC4 P;  3H1L D;  2M8R A;  3TGU D;  4D6T D;  1KC8 Q;  1BE3 E;  2WMM A;  2FKW B;  4HM7 A;  3WUV A;  4QDF B;  5CXM A;  2XND H;  1UII A;  1LTI C;  3GF7 A;  3AEA C;  4HYT B;  3OW2 O;  3D70 A;  4WVZ A;  2NRG A;  1LTA C;  5BVZ A;  3GZY A;  3RK3 B;  1LTJ A;  4GOE A;  3S4R A;  1EDJ A;  5APQ A;  1QX8 A;  3U1A A;  2N1T C;  3VP9 A;  1AFO A;  5B66 H;  4PD4 I;  1VQ5 P;  2W90 A;  1OVV A;  1BDC A;  1YJW P;  2N9Y B;  1M57 D;  4AIV A;  3D6Y A;  4NB9 D;  3JCU E;  1FE6 A;  3AE1 C;  1T2K C;  2OYH B;  2OTL P;  3GHG A;  1UUV A;  3GF3 A;  3KQG A;  2PRR A;  4C46 A;  5GTH H;  1N8R Q;  2D2C C;  1G1I A;  1YTZ T;  4HM5 A;  3RK2 B;  1VF5 C;  4PV1 C;  2Z5H A;  1SQP K;  4GIF A;  1SQX J;  3HE5 B;  2C9L Y;  3K5B A;  3KZI E;  2PFX A;  4HM0 A;  4M3L A;  5AW1 B;  3C1L A;  2Q1K A;  1OVU A;  5CCH D;  2YVJ B;  4BRY A;  3NXS A;  2KYV A;  2QG4 A;  3BAT A;  2GM4 A;  5CCH A;  3SWY A;  3L73 J;  4I7Z C;  5KKZ B;  2JEE A;  5APV A;  3NMD A;  3H1H J;  1RFS A;  1SQV G;  1RH5 B;  2GBW A;  3RL0 g;  1HGV A;  2FYU E;  3N0Q A;  1URQ C;  2KP8 A;  4ZNC A;  2NPS C;  1SP4 A;  2B87 A;  2Y0E A;  3AED C;  1JNM A;  1G2C B;  1GD2 E;  3RBZ A;  4U3F J;  3GL2 A;  1G8J B;  2JWD A;  3AEB C;  3D71 A;  3L70 D;  1L0L E;  1JY2 P;  1LP1 A;  4L75 A;  3H1J D;  1EDL A;  2KUB A;  1NDO A;  1LTB C;  2HOD B;  2YNY A;  2ZT9 C;  1T3U A;  1O7N A;  4IL6 E;  3VMZ A;  3VN0 A;  2G3A A;  1IZN B;  3CXH I;  3WUU A;  5AEW A;  3Q5S A;  3NFQ A;  4WY4 B;  4AUW A;  4H0L B;  1JMM A;  1NWQ A;  4WB4 A;  1NTK D;  3FOU A;  1LWU A;  2W8Z A;  1SQB J;  3TSI A;  1A02 J;  2OTK E;  1RQV A;  4L74 A;  1YYC A;  1N7S D;  4DJG A;  1VQM P;  1KB9 H;  2E42 A;  1PGJ A;  2RMZ A;  4GOF A;  2C0X A;  1ZP0 C;  1O7P A;  4D6T G;  1AVO A;  1NYK A;  1JM0 A;  1SQQ D;  3M91 A;  1SFC C;  1CW5 A;  2Q3E A;  1NTM J;  2AXT H;  4QDF A;  3HUS C;  3H1L J;  2QJP B;  3TGU J;  3P8C E;  1MFT A;  3CL3 D;  1EZV G;  2HMJ A;  2A06 D;  3C9I A;  3CCU P;  3AE7 C;  2P2U A;  2KIK A;  1RF0 C;  2PP6 A;  5KTB A;  3A0H E;  3PLN A;  3RK3 D;  1J1E B;  2WSE H;  1CI6 B;  2IBZ E;  1ZRT D;  3Q5P A;  5CBN A;  1X22 A;  3M06 A;  1FOS E;  1ZN5 A;  5AVZ B;  1GU4 A;  3QWO C;  2XZR A;  2E75 B;  4DZO A;  2ITA A;  2FYU K;  4W80 A;  3MP7 B;  2WSC J;  1WT6 A;  2OYH A;  1IFI A;  1KYO H;  3G71 P;  2ZFC A;  1S4X A;  3RK2 D;  3HD7 B;  1BGY D;  2HYN A;  1JM1 A;  1L0L K;  2E74 D;  2GBX A;  4NPD A;  3HE5 A;  3L72 G;  1NAY A;  1ZV8 A;  5AVV B;  1M1K Q;  5BOK A;  3V4Q A;  4TT3 H;  3H1K D;  2DW3 A;  3LW5 H;  2JDI H;  3V2R A;  5H2F E;  1DEB A;  3W68 A;  4RO0 A;  3SFD C;  5GTI E;  3U1C A;  1LGH B;  4NBD D;  2QIW A;  2CPB A;  1PGP A;  4EIJ A;  2Q6Q A;  1OWA A;  3KHU A;  5AW7 B;  2N9B A;  1NTZ E;  2KS1 B;  2K1A A;  1KIL B;  2BCC E;  1BCC E;  1XTG B;  1G2C A;  1HH0 A;  4YXD C;  3L74 E;  4EDF A;  2KOG A;  1JY2 O;  2K88 A;  5KJ7 D;  3O8Z A;  2KXP B;  2W6J H;  3PJS K;  3H1J G;  5KJ7 A;  1LTJ C;  1CZQ A;  5KLV J;  4O9B A;  1K8A Q;  1P84 H;  2BMO A;  2HOD A;  4WBA A;  2B9B A;  3L70 J;  1IFM A;  3LIE A;  1CSB A;  3H1J J;  4WY4 D;  1QEX A;  3TNU B;  4H0L D;  4UB8 H;  4WY4 A;  1NU1 D;  4QUP A;  2W27 A;  1GK4 A;  3A2A A;  3EWK A;  2QJY B;  4XA4 A;  3L71 D;  4OGQ B;  3FWN A;  3L75 E;  1T6A A;  1NTK J;  1FZE A;  5B5E E;  1Q90 D;  4IL6 X;  3E7K A;  3P7K A;  1H0T B;  1WQL A;  2YMY A;  2BEZ F;  4PJ0 E;  1M1J C;  5AVY B;  5KLI C;  2YFJ A;  2AEM A;  2FXP A;  3GLM A;  1OZH A;  2E4Q A;  1NOH A;  3V4W A;  1ZXG A;  1SQQ J;  3M0D A;  1JEK A;  5AVU B;  1ZME C;  3JCU H;  3KXD A;  2M3B A;  1PGO A;  3CWB G;  1CI6 A;  1PP9 G;  2E75 D;  3HRN A;  3KZI H;  4N6J A;  2P1J A;  2YXR B;  3GTE A;  2Q7C A;  3BRV B;  1L2P A;  2LXB A;  2IX7 C;  4JBZ A;  3IF4 A;  3HD7 D;  4ZKP A;  2K3R A;  1JY3 N;  3HD7 A;  4OVN F;  3GL0 A;  4EYY Q;  3CX5 H;  2B1X A;  2IDB A;  5APU A;  3RL0 B;  2BAS A;  1BGY J;  4UB6 E;  5TJH A;  3H1K G;  4NBB D;  1SQV D;  1O7M A;  1FZG A;  1N7S C;  3I56 P;  4AYC A;  2Q3I A;  5E79 H;  3VYI A;  3H1K J;  5AW4 B;  3A5T A;  1IK7 A;  5AW5 B;  1RE3 C;  3MZW B;  2NUM A;  1Y8A A;  3L4F A;  1KIL D;  1ULJ A;  3BCC G;  2KS1 A;  1GL2 C;  2WT7 B;  4IL6 H;  1KIL A;  1VQK P;  2YKQ A;  3CXH D;  1VQL P;  3CCL P;  1PPJ E;  3B5N C;  2O01 J;  2QA4 P;  1UIX A;  2RN0 A;  3VMG D;  4NBA D;  2JO1 A;  3VMX A;  3ZDM A;  3M9H A;  3B71 A;  1HTL C;  3AEF C;  3RK3 C;  1VL2 A;  2J58 A;  1S9K E;  1VPC A;  2FFD C;  2GUS A;  3TNU A;  4H44 B;  4UB8 E;  4KJM A;  1D7M A;  2OYH C;  3HE4 B;  3CI9 A;  4Y28 J;  4JPZ B;  2H43 A;  4H13 B;  1GW3 A;  1SQP G;  1NJI Q;  2Q3W A;  1E79 H;  1L0L D;  4PD4 E;  1NU1 J;  4OGQ D;  1G1J A;  1X9V A;  1VDF A;  4JF7 A;  3AE9 C;  1KQS O;  1IFJ A;  3KYQ A;  2QM7 A;  2E74 C;  3CCS P;  1R8E A;  3H1I G;  1AQ5 A;  2O3J A;  2Q5U A;  3L71 J;  3VMA A;  1H0T A;  2C9N Y;  1J1D C;  1SQX E;  2XDJ A;  1EZV D;  3CCM P;  2WPV B;  3A0H H;  1FDM A;  1GZL A;  2GA1 A;  1IFP A;  1QGK B;  5KKZ C;  4ZMD A;  4B86 A;  1P84 I;  2QJK B;  2SPZ A;  3WU2 H;  1BDD A;  3L73 E;  1HBW A;  3AE8 C;  1QVF O;  1DD4 A;  5AW8 B;  1FZC C;  4ASV A;  2DE5 D;  3H1H E;  3R2P A;  2E76 C;  1FU1 A;  3C0D A;  1U7J A;  3F89 A;  2LKM A;  2DE6 D;  1BE3 G;  3EFF K;  1KD1 Q;  4U3F E;  1PIX A;  5KJ7 C;  1OMI A;  1RF1 B;  2M0B A;  4IFD K;  4OWF A;  3H32 B;  3AE4 C;  3M9B A;  2WZ7 A;  2JR8 A;  3L72 D;  1KQG B;  1L4A C;  3USS A;  4WY4 C;  5AVW B;  4Y99 B;  3N7N A;  4H0L C;  5H2F H;  2ZXX A;  5GTI H;  1K05 A;  1LTG C;  2YIU C;  1AV1 A;  3G3Z A;  3CX5 E;  1JMB A;  2NWF A;  3PH0 A;  1QLE D;  4NBH D;  3F5H A;  2IFM A;  2L91 A;  1MV8 A;  4YPC A;  1HVV A;  1SQB E;  3GOB A;  1S5L E;  1Q82 Q;  2WTY A;  2P58 A;  5E79 E;  1GK6 A;  3M9Q A;  4Z1M H;  1SQV J;  1N73 B;  2N1T B;  1Q7Y Q;  2FYN C;  3RGU A;  2HPC B;  2P7J A;  1YHQ P;  2WPQ A;  3B8E B;  2Z4E A;  2W6B A;  2YKO A;  1PV3 A;  2WT7 A;  1IJD B;  2R3S A;  2D2C B;  2QJP C;  1NTM E;  2WPR A;  1VF5 B;  1YQ3 C;  1SQX K;  2WSF J;  3BAS A;  4PV1 B;  2HMO A;  3H1L E;  3TGU E;  3AEE C;  3MIW A;  1VQ8 P;  2Y9Y A;  4XE5 B;  3VP8 A;  1GW4 A;  3VCA A;  2FYU G;  5B5E H;  3A7O A;  1ZOY C;  4H44 D;  2R3C A;  5CCG A;  4QUQ A;  4WWI A;  5K5G B;  4I7Z B;  3U59 A;  2A45 H;  3GG2 A;  3HE4 A;  1RE4 C;  3EN1 A;  4PJ0 H;  1L0L G;  3HD7 C;  5TIS E;  1K73 Q;  2XR8 A;  3GKE A;  1URQ B;  2NPS B;  1FJP A;  2V7Q H;  2XSO A;  1SS1 A;  3TK1 A;  5APW A;  1NKN A;  1JCD A;  4BXL A;  2CKF A;  4L76 A;  4D6T J;  1XTC C;  5C39 A;  2OYI C;  1E5W A;  3G4S P;  2HFE D;  1EZV I;  4LGD E;  2ZT9 B;  2Y9Z A;  1T8Z A;  3LID A;  3RBX A;  2G8Y A;  3CWB D;  1M90 Q;  2GUV A;  2H8P D;  1NGM B;  1PP9 D;  1EG9 A;  3WU2 E;  4N78 D;  2KSE A;  1EC5 A;  1FS0 E;  4YXW H;  5CJ4 A;  1KB9 D;  2HMN A;  1SQB K;  2WIT A;  2OQQ A;  3MUD A;  1EXI A;  5BU8 B;  3V2N A;  4AQR D;  4JQ0 D;  1RF1 A;  1H89 A;  1S3J A;  3H32 A;  1QL2 A;  5AW3 B;  4UB6 H;  3G6E P;  3AE3 C;  5KLV E;  3H6P A;  2O1K A;  4CPG A;  3V5B A;  1Y47 A;  2ZYD A;  3L70 E;  3CD6 P;  2JKV A;  1PZQ A;  2CK3 H;  2IBZ G;  3L72 J;  1NTM K;  1SFC B;  3H1J E;  4EMJ B;  2IBZ I;  2IFN A;  3HUS B;  4GOD A;  1L0N E;  4QMA A;  3CLQ A;  3JSV C;  1W2E A;  2BMR A;  3GTS A;  3TYY A;  1M56 D;  1A02 F;  3P32 A;  1MUU A;  2YO2 A;  3BCC D;  2XSH A;  3V2P A;  1NTK E;  1KYO D;  1VQ6 P;  2N1T D;  1N73 A;  2N1T A;  2WQY C;  2IYP A;  4JYB A;  2HPC A;  2R32 A;  1HJ0 A;  1X0T A;  4DOJ A;  2HG5 D;  3CCV P;  3II6 A;  1HJB A;  4HM1 A;  1OIP A;  2E5T A;  2B89 A;  2D2C D;  3SWF A;  1Q2N A;  2H7H A;  1S72 P;  2HMM A;  1S5L X;  3BRT B;  4PV1 D;  1PGQ A;  5L8R J;  2ZAE B;  3GHG C;  3D6Z A;  1QL1 A;  1SQQ E;  4QDD A;  1SQP D;  4PD4 H;  1NTZ G;  4NPF X;  3VMH D;  2BCC G;  1BCC G;  2A06 E;  3ABV C;  2AXC A;  4KHX A;  3RK3 E;  3H1I D;  3Q1M A;  3PP5 A;  4XFJ A;  4C7N B;  1ZRT E; 
#chains in the Genus database with same CATH homology
 2BCC E;  1BCC E;  4P1B H;  1O7W A;  4H44 D;  3L70 E;  3GB4 A;  1KYO E;  4QDF A;  4NBG D;  4QUQ A;  3D89 A;  1O7H A;  3VMI D;  3H1J E;  3DQY A;  1RFS A;  1NU1 E;  4EMJ B;  4D6T E;  2GBW A;  2HMJ A;  3L74 E;  1BE3 E;  2FYU E;  3EN1 A;  1L0N E;  3N0Q A;  2BMQ A;  2NVE A;  2E75 D;  1G8K B;  3EQQ A;  4HM7 A;  4NBC D;  2BMR A;  3GTS A;  2XRX A;  4QDF B;  2YFI A;  5CXM A;  4QCK A;  2XR8 A;  3GKE A;  3CWB E;  2IBZ E;  1O7G A;  2YIU C;  3L71 E;  2BMO A;  4QDC A;  3GTE A;  1BGY E;  4QUR A;  3GL2 A;  1SQV E;  3CX5 E;  1G8J B;  2XSO A;  1EZV E;  4NBA D;  2XSH A;  3GCE A;  2NWF A;  1PP9 E;  4NB8 D;  1VCK A;  4HM4 A;  1NTK E;  2ZT9 D;  4NBH D;  2Q3W A;  4HM8 A;  1L0L E;  5HL4 A;  2CKF A;  4PD4 E;  4OGQ D;  4H0L D;  2I7F A;  4H13 D;  1KB9 E;  3GZY A;  1NDO A;  4HJL A;  3VCP A;  1SQB E;  3GL0 A;  2B24 A;  2QJY C;  3GOB A;  4QUP A;  1O7N A;  2B1X A;  3H1K E;  2QPZ A;  1SQP E;  2NVG A;  4HM1 A;  5AEW A;  4HM3 A;  3AZC A;  1ULI A;  5AEU A;  1SQX E;  4AIV A;  1RIE A;  2JZA A;  4NBB D;  2FYN C;  3L75 E;  2D2C D;  1O7M A;  4NB9 D;  2HMM A;  1EG9 A;  1JM1 A;  3CXH E;  4NBF D;  2GBX A;  2E74 D;  3FOU A;  1UUV A;  2QJK C;  4PV1 D;  3H1I E;  5KKZ C;  2HMN A;  4HM2 A;  4NBE D;  5BOK A;  4HM5 A;  4P1C H;  1SQQ E;  1Q90 C;  1WQL A;  4QDD A;  4HM6 A;  2NUK A;  3L73 E;  2NUM A;  2QJP C;  2E76 D;  4AAY B;  5KLI C;  2E4P A;  1NTM E;  2DE5 D;  2YFJ A;  1ULJ A;  3VMH D;  2HMO A;  3L72 E;  1UUW A;  2HMK A;  1P84 E;  3H1L E;  4HM0 A;  3H1H E;  4U3F E;  4NBD D;  3TGU E;  2A06 E;  2JO6 A;  2YFL A;  1VF5 D;  4HKV A;  3C0D A;  2E4Q A;  2ZYL A;  2YVJ B;  3GZX A;  1PPJ E;  2HML A;  1O7P A;  1VM9 A;  3VCA A;  1NYK A;  1SJG A;  2NVF A;  1FQT A;  1NTZ E;  2DE7 D;  2DE6 D;  3VMG D;  5KLV E;  1ZRT E;  3BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...