3CXHE

Structure of yeast complex iii with isoform-2 cytochrome c bound and definition of a minimal core interface for electron transfer.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cxhE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cxhE02
4NBFD 1SQPE 3H1IE 3H1KE 1O7NA 4H0LD 1Q90C 4HM5A 2XSOA 3AZCA 3L73E 1FQTA 3D89A 1BGYE 1NU1E 2NUKA 1PPJE 4H13D 4AIVA 2JZAA 2QPZA 2GBXA 2XRXA 3GCEA 3H1HE 3FOUA 4NBCD 1WQLA 4P1BH 4QDFA 4HM1A 5KLVE 2YIUC 1EG9A 1SQVE 1O7MA 2DE6D 3N0QA 3GOBA 4HM7A 3VMHD 4NBHD 5CXMA 2D2CD 2E76D 4NBGD 3TGUE 2NVGA 1NYKA 3L72E 4P1CH 2CKFA 1UUWA 4NBAD 5HL4A 2QJPC 2DE5D 2QJKC 1ULIA 2XSHA 4H44D 1VF5D 1RIEA 1BCCE 4HM6A 4PV1D 4NB8D 1SQQE 2HMMA 1PP9E 3H1JE 1UUVA 2BMQA 2E4QA 2HMNA 2B24A 3GTEA 4QDDA 4QURA 1L0LE 3VMID 4EMJB 1O7GA 2NUMA 2BMOA 5KLIC 2JO6A 2ZYLA 3VCAA 2E4PA 2BMRA 2E75D 4HJLA 1KB9E 4NBBD 4QDFB 3GZXA 1VCKA 2HMOA 2IBZE 1VM9A 2FYNC 4HM3A 1BE3E 4QUPA 1O7HA 2NVFA 3EN1A 4QDCA 3GKEA 1NTME 4OGQD 1O7WA 1SJGA 1NTKE 1KYOE 4NB9D 3DQYA 4HM8A 1O7PA 3L75E 1L0NE 2HMKA 1SQXE 4PD4E 3GL2A 1ZRTE 1NTZE 2B1XA 4NBED 4U3FE 1P84E 2Q3WA 3VMGD 1G8JB 2GBWA 2A06E 1EZVE 3EQQA 3GB4A 5KKZC 4HM2A 2YVJB 2HMLA 3GL0A 3GTSA 4AAYB 3L70E 2E74D 2YFJA 5AEUA 2BCCE 5BOKA 3VCPA 4HM0A 2FYUE 3CWBE 4QUQA 3BCCE 1SQBE 1G8KB 1ULJA 2ZT9D 2YFIA 3C0DA 2I7FA 4QCKA 3GZYA 3CX5E 1RFSA 1NDOA 2HMJA 3L74E 4HM4A 3CXHE 4NBDD 2NWFA 2YFLA 4HKVA 3H1LE 2DE7D 3L71E 2NVEA 2QJYC 5AEWA 2XR8A 1JM1A 4D6TE
chains in the Genus database with same CATH superfamily
1KQLA 5APSA 1M56D 1MUUA 5E79E 2W6BA 1KN7A 3A5TA 2GBXA 1EDIA 4UB6E 2A45H 5BU8B 1YQ4C 1BE3D 3KPEA 2WPSA 3G6EP 2P58A 4ZNCA 4R4LA 1KYOD 1JB0J 3SFEC 4I7ZC 1L0ND 2QJKC 4PD4D 1JCDA 2WSFJ 3G9RA 4I6MC 2A45G 4C7NB 2W27A 3H1JG 3P8CE 3L70D 2BEQD 2BMOA 5H2FE 4I1LA 2P67A 2PGDA 1K8AQ 2IZ1A 3H1LD 4L74A 3MD0A 1S9KE 3ITKA 3DQYA 5AW2B 1PPJD 1SQXG 4WY4A 2W6JH 2Z5IA 3R2PA 5AW6B 2XZRA 4DJGA 1IFDA 2JWAA 3L74J 4U3FE 2KXPB 5AW9B 1VQ4P 2OYIC 4AAYB 2BCCE 5BOKA 1AVOA 1SQPK 2FY8A 5AW7B 4NBDD 1AFOA 2HYNA 4D6TG 3M91A 2DE7D 2NVEA 4H0LD 2KB7P 1PZQA 1Q90C 4N78E 3LIEA 2JZAA 1YJNP 1IFJA 4HM7A 3RL0D 2E5TA 2D2CD 3E7KA 2NVGA 3O8ZA 4P1CH 1P84I 2WQYC 1ZLLA 2YNYA 1FZBA 3L35A 3VMYA 1SQQE 2HMMA 5DJUB 2B24A 2M3EA 2A06G 3BATA 1N73A 3S1KA 1JMMA 3AEDC 1DX7A 3H6PA 1VM9A 1JY2O 3G3ZA 1FC2C 1AA0A 1JTHB 1CZQA 1JMBA 1LTJB 4IL6H 1XTGB 3M06A 1T2KC 2FYUJ 5KAFH 1YQ3C 3N4XA 3A0BH 1S5LE 4JYCA 1GU5A 2QIWA 3G71P 2FFDA 1SQPJ 1LT1A 5AW8B 1OVVA 1N7SD 1NTZK 2ZJSE 1JM0A 2KSJA 3V2NA 3CCUP 1EC5A 2QE7H 3HTKA 2NWFA 1RF1A 2N1TA 1LTJC 4NPDA 3E1RA 1PP9D 3P32A 1SFCB 2XSOA 2GM4A 3O6QA 4C46A 1EZVI 1YBKA 2B9BA 1KILE 3H1HE 3S4RA 1PL5A 2FYNB 1MZ9A 4GDOA 3SWFA 1IJDB 1NU1K 1GL2B 4NBGD 3V2RA 3EWKA 4PV1C 1KFNA 2KS1B 2ZYDA 1BCCE 1SFCC 2KUBA 1HGZA 5B66H 3W67A 3K5BA 1URQD 3L75J 2ITAA 4NBBD 2FYNC 2KSEA 2E76B 1GL2C 5KTBA 2KZIA 3CL3D 2WSSH 2Y0EA 1NTKE 1VF5B 3LIDA 1G1JA 1D7MA 1NTMK 3H1IJ 2E42A 4I2LC 1RE4A 4ZKUA 2FYUG 4KJMA 2POHA 3BCCE 1SQBE 1QEXA 2E76C 5APWA 5KLVJ 2YFLA 4EYYQ 2XR8A 5AVXB 1IFMA 1O7NA 1LTSC 1GW4A 1GZLA 1VF5C 1LTIC 1M90Q 1ZN5A 4IL6X 3M0DC 2WSEJ 2XRXA 3FWNA 1LWUB 1NU1J 4ZKPA 1FBMA 1JOCA 2DE6D 1RQVA 2R32A 2M0BA 1GTWA 1G2CB 3HD7A 3U59A 2YMKA 2I1JA 2YKQA 4BXLA 3L72E 1ZXGA 4EDFA 1AJYA 1NOHA 1P84D 1RY3A 1EDKA 4ZMDA 4JYBA 2MJZA 1LWUC 2IZ0A 4HJLA 1DEEG 1LTTC 2OQQA 4Y99B 1FOSE 4HM3A 1BE3E 3Q5RA 3U1CA 1QX8A 3HUSB 3H1KD 4XFJA 2WVRA 5CCHA 1KYOE 3L73D 1FDOA 1KILA 3M0AA 3M9HA 1L0NE 1T2KD 4PD4E 3CPWO 3C8VA 1EZVG 2JKVA 2FBWC 3IN6A 1SQVD 1KZUB 2YIUB 1HH0A 1VQNP 3E1IA 3L70E 1BGYJ 1SQXK 2XNXA 4Y99C 1NJIQ 2K3RA 3IF4A 2R5BA 3OJAB 1FDMA 2JEEA 1Y8AA 5AW1B 3L71G 3VTPC 1T3JA 4HKVA 3H1LE 3H1IG 2JDIH 4QUPA 1YTZT 4GKGA 2QA4P 3TGUJ 1SP4A 4WY4B 3SWKA 1FQTA 3RK3D 4N6JA 1PPJE 2WSEH 5AW3B 5DJTB 3KZIH 3IFMA 5KLVG 3PJSK 1K04A 2O1KA 4ASWA 2YIUC 1YIJP 3N0QA 1UIIA 3PHLA 1FZAA 1LGHB 1S2EA 2KS1A 5CBOA 1NYKA 1OIPA 2L91A 2W83C 3JCUH 5AW5B 1NTZD 4KT0J 2P7JA 4PV1D 3W68A 4WY4C 1UUVA 5B5EH 1NAYA 2Z4EA 1O7GA 4K3AA 2E75D 3CX5I 2IBZG 4M3LA 3NTNA 1Q7YQ 3CCLP 3CCEP 1CI6A 1O7HA 1SQBG 2JJLA 1QGKB 4HYTB 3WU2H 1MV8A 1DEBA 1NU1D 2HG5D 4W7YA 5AVUB 1SQXJ 1LNQA 3Q5SA 2IFNA 4HM2A 2XU6A 2E74D 1N73B 4HM0A 2ZT9D 1FU1A 2WPQA 3M9QA 3ZDMA 3QH9A 1QVFO 1RF0A 2QJYC 4OGQB 3D71A 1RH5B 3TSIA 1BGYG 2SPZA 4LLHA 4D6TJ 4GODA 1JO5A 3TYYA 1KB9D 2Q3EA 2KP8A 4U7JA 1LT9B 2FFDB 1W5CE 2OYHA 1N73C 1OMIA 2H88C 3TGUG 1NTMD 1IFPA 2C9NY 3PH0A 4PJ0E 4L73A 3CXHI 3F5HA 2KOGA 1KV4A 3R4YA 2YO2A 4OGQC 3HTKB 4DT0A 1RF1B 2PP6A 2N1TB 2LXCB 3FX0A 5KJ7D 1L0NG 1PP9E 3O6QB 1L0LG 1EDLA 4IFDK 4H13B 2B88A 2QVAA 3A0HE 1AQ5A 1LT9C 3HUSA 1HVVA 2FFDC 1VQ6P 3V6IA 4QDCA 1UIXA 2WSCJ 1H0TA 1SJGA 1X22A 1RF1C 1O7PA 2N1TC 1BDCA 3CCMP 3GL2A 1GK6A 3C9IA 1YJWP 1VQKP 1G8JB 4H13C 1OZHA 2O01N 3M9BA 3CWBG 2WWWA 3C0DA 2I7FA 4QCKA 5APTA 2KZJA 1VQ9P 5APXA 1R5LA 3CX5H 1JM1A 3H1JD 3AEGC 3P8MC 2FYUK 4HKZH 2AXCA 1YHQP 4QDFA 2NZ2A 1FZCB 2E5YA 4TT3H 2JR8A 1FE6A 4WWIA 4H44D 1SQXD 3B5NB 1S1CX 5GTIE 3WUTA 4C7RA 3II6A 3GTEA 4WY4D 2NPSB 1JUNA 2Q9IA 3JC22 3CX5D 1FZCC 3BVHA 1RE4C 3GW6A 3Q2YA 2OYOA 1ZV8A 2WSCH 3D6YA 4D6TD 3HD7B 2AXTE 2IFMA 1HGVA 3HE4A 2Y0CA 3B5NC 2P10A 1SVFA 3AE4C 3V4WA 3I56P 3CXHH 2QM8A 3G4SP 3CCJP 4NBED 1P84E 5KAIE 2XDJA 1SLQA 1T8ZA 2HMLA 2NPSC 4DOJA 5E79H 2UWJE 1N7SA 2Q1KA 4UB6H 5L8RJ 5APQA 1N8RQ 3CC4P 3HD7C 5CCGA 2XV5A 1Y9BA 2H7HA 3H1KE 2Y9ZA 1WMKA 4HM5A 3KQGA 2WT7B 1LT9A 3Q5PA 1KILB 3L73E 1WT6A 1OFCX 2LR2A 2Y0DA 1PP9G 4NBCD 4P1BH 1NGMB 1H8AA 1SQVE 1O7MA 1XTCC 1SQQJ 5H2FH 1R8EA 1L4AD 2B87A 2L5GB 5KLVK 2CKFA 1LTGC 3PP5A 1UUWA 2RN0A 5CCHC 1Q2NA 1PFIA 1K9MQ 1KILC 2PAJA 1QLED 1URQA 4QURA 1RE3A 3RK3E 5AVYB 5TISE 1PGQA 3KDPB 1AQTA 4O9BA 2C0WA 1CSBA 3L74D 4WBAA 1KC8Q 5AVSB 1OX3A 1FJKA 3VOPA 4DZOA 1EQ7A 4BRYA 2W6AA 1LJ2A 2NRGA 2V7QJ 4U3FG 3T97A 1NTZE 3GHGA 4JPZB 5C39A 3VMGD 1Q86Q 3V2PA 4YPCA 3GB4A 4OWFA 2WPRA 3GL0A 3N7NA 2BCCG 4B86A 2YFJA 1RHZB 1VQLP 3B8EB 3VCPA 3H1HJ 3BRVB 3H32A 1RFSA 1CI6B 1ZP0C 3AEBC 3AE5C 1YTZI 2KIKA 1NVOA 1M57D 3L71J 2AEMA 4Y28J 4L76A 1CW5A 3SFDC 5AVVB 1NO4A 2DW3A 1NU1E 1FZCA 2IBZI 4YTPC 4AIVA 3FOUA 1YJ9P 4K35A 1S72P 4IFMA 3VMHD 5AVTB 2O01J 5GTHE 3B5NA 1HUCA 2YKPA 3CMEP 3Q1MA 1W2EA 1NWQA 1Q81Q 1IZNB 2B89A 1Q90D 1ZRTD 1FZGA 1GDTA 2NPSA 1H89A 1SQQG 4NPFX 1NKNA 4NB8D 2HODA 5CHXA 5KKZB 3CCSP 1LTAC 1VQ7P 1QL1A 1NAFA 2FYUD 1S5LH 1KB9E 1ZMEC 3GZXA 4XA4A 2OYHB 3NXSA 1L0LK 1SQPD 3IR9A 1NTME 2YXQB 2BEZF 4NB9D 2V7QH 1VPCA 1SQBJ 1RF0C 2WITA 3MUDA 2N9BA 3H1KG 1OVUA 2Z5HA 5KKZC 3JSVC 2AEJA 5AEUA 1SQVG 2RKLA 2OYHC 3PTZA 2WT7A 3AE9C 3H25A 3PRJA 1KQFB 1M1KQ 3WUVA 4NBFD 1H0TB 4PD4I 2YMYA 2YXRB 4MN4C 3H1HG 1OW7A 2OGUA 1JCCA 1OW8A 3GCEA 3CI9A 2KK7A 2O01H 3GOBA 3HRNA 4AQRD 3HUSC 1JEKA 1MFZA 3L75D 3TK1A 5HL4A 2DE5D 3VP8A 1T3UA 1BCCG 1EXJA 1OXZA 1EZVD 4HM6A 3H1JE 2BMQA 1HBWA 4LC1A 2G8YA 1L0NJ 1L0LJ 4QDFB 1U7MA 4UB8H 4JF7A 1HWTC 2HMOA 1GU4A 3RL0B 3F89A 1L2PA 1DH3A 3L71D 2MKVA 1G1IA 3H1ID 1NTKG 3GKEA 3L37A 2ZYAA 4GT1A 1ZR2A 3AE6C 1SFCD 4JBZA 3LW5J 2KLVA 1SQXE 1JY3P 3KYQA 5KLVD 3H1LJ 2HPCB 1NHLA 2Q6QA 3BCCG 3U1AA 4QMAA 3TNUA 1YYCA 2ZYGA 3BRTB 1GL2D 1GD2E 3CX5E 4RESB 3CWBJ 1S5LX 2QM7A 4D6TE 3Q3DA 3HE4B 1LTBC 1VDFA 3GF7A 1QVGO 3NMDA 4CPGA 4WB4A 4XE5B 1KQSO 1WQLA 2IBZD 1ZW0A 1EG9A 3L36A 1VQ5P 4NBHD 1FDIA 2QEXP 5CXMA 3B71A 1N7SB 2E76D 3KHUA 3L72G 4RKUJ 3CD6P 3V5BA 1H88A 5KJ7A 1VF5D 3EFGA 4EOTA 3MIWA 3CC7P 3AEFC 1KYOH 5APYA 4QDDA 1Y47A 3A2AA 2KLUA 3VCAA 2HLOA 4PD4H 2E4PA 2BMRA 3GMAA 1USDA 2Y9YA 1BE3G 2AEFA 4Z1MH 1N7SC 1JY3O 3EN1A 3AE2C 5BU5A 2B87B 2OTLP 2XNDH 3LW5H 4HM8A 1BGYD 3MHVA 5CCGC 2FYZA 2QG4A 4NPEA 2IYOA 2R5DA 3RL0g 3L70G 1URQB 3TGUD 1M7LA 3VMXA 4IL6E 1ULJA 2YO3A 5KAFE 3C1LA 2R3SA 3GZYA 3H1LG 1NDOA 3A0BE 3L74E 3PLNA 1MKMA 4EIJA 1RQUA 1J1DB 1KQGB 4BRYB 1PPJG 5CJ4A 1L0LD 3UIAA 3WMM0 3T97B 3GHGB 1U57A 1URQC 1RE3C 4OH8B 1KMIZ 1AVYA 2OYIB 1PP9J 5TJHA 1X79B 1J2JB 2WZ7A 1T6AA 3H32B 2K9JB 2IPPA 1J1DC 1FZFA 1X0TA 5AVQB 5AVZB 4TLFA 1RIEA 1N7LA 5CMZA 1JY2P 3GHGC 3VN0A 2JO6A 3CWBD 3VMZA 2M3BA 1HF9A 2M5AA 1SQQK 1VQPP 2QSIA 1S4XA 3KXDA 2HPCA 3MGNA 1KFMA 2K1AA 1BDDA 5B66E 2RMZA 3GF3A 2HMKA 3MTUE 5CJ0A 1IO4A 1ZRTE 2OTJP 1YITP 1IK9A 2HODB 2GBWA 2LKMA 1PIXA 3FGAD 5BVZA 4U3FJ 5AW4B 1JY3N 2K37A 1NYHA 1GMJA 1NKZB 2FYUE 4BWNA 2YFIA 2BCCJ 4R4MA 2HMJA 2QJPB 5AEWA 4PJ0H 1SQPE 3EFFK 1SQVK 2WSFH 2HR3A 3OA7A 1BSNA 1PGJA 2V4HA 2VRSA 3A3YB 2HFED 1M1JA 3FWLA 4L75A 1S3JA 1L4AA 3A0HH 1YI2P 3ABVC 3USSA 4W7ZA 1HTLC 2FXPA 2IX7C 2QJPC 2XSHA 4WVZA 2N9YB 2PRRA 1DD3A 2A06D 3VYIA 1PGOA 3RK3B 3MUDC 3VMAA 1Q82Q 4IOIH 1EDJA 3S9OA 3SSUA 3CXHD 3WUUA 3I55P 2O3JA 3GG2A 3FXEA 4OGQD 3L74G 3QWOC 2CPBA 3L75E 4YXDC 4AYCA 4PV1B 5CCGD 1K73Q 2P1JA 3RK3C 1EZVE 1NTKK 3H1KJ 4AUWA 3GTSA 1JNMA 2E75B 3L73J 1FJPA 5K5GB 3AECC 4HM4A 1VQ8P 1SQVJ 2R3CA 3L71E 1BSHA 4C7NA 3P8CD 2FXMA 2N1TD 3TDKA 3H1IE 1OVRA 1SQBK 3V4QA 1OWAA 3AE1C 2NUKA 2OYIA 2ZXEB 4H13D 1WRGA 2KNCB 2QPZA 1X9VA 5GTIH 1DIPA 2JO1A 5KLVE 4HB1A 2E74B 2ZVOB 2E75C 2CK3H 2K9JA 3TNUB 2ZT9B 1VL2A 3HE5B 1S9KD 2LXBA 1E79H 4GOFA 4N3YB 2CPSA 1ULIA 1N86A 1HJBA 3KZIE 3RK2B 1J1EB 4U3FD 2AXTH 5EFWB 3RGUA 2W8ZA 2R44A 1BCCJ 4LGDE 3RBZA 3EQ2A 5APVA 3VMID 2BCCD 4EMJB 2OARA 2NUMA 4UB8E 4OVNF 1P84H 1JY2N 5KAIH 2E74C 1NTZJ 2IBZE 1FS0E 3A7OA 3JCUE 2ZT9C 3AE8C 2M8RA 2J5UA 1HJ0A 2GA1A 3FXDA 1ZOYC 4N78D 1OW6A 2O1JA 4HJGH 5B5EE 3RK2C 2Q3IA 1J1EC 1NTKJ 1SQPG 2YKOA 4A7PA 4ASVA 2Q3WA 2WTYA 4KHXA 1KB9I 2ZXXA 1KTMA 2J58A 1L0NK 3CCVP 3WU2E 3AEAC 1KD1Q 2IDBA 2WMMA 3BCCJ 1W2BO 3B5ND 1SQQD 2I1KA 2FKWB 1SS1A 4RJTA 2FXOA 3L73G 3TF5A 1FAVA 1LP1B 3D89A 5KJ7C 1BGYE 3CLQA 1MFTA 2ZVNB 2NPSD 4HH2A 4YXWH 4HM1A 1GK4A 5M1BA 4EI2A 2GUVA 1IK7A 2WPVB 1KYOI 2C0XA 2QRXA 1U7JA 5TISH 1PV3A 3TGUE 2IYPA 3HD7D 1JTHA 1LTJA 3CC2P 2K88A 3L72J 3CMAP 1FOSF 2KYVA 2RH0A 4IFFA 3L75G 1NTMJ 2E4QA 2HMNA 1L0LE 3GLMA 2G3AA 2ZAEB 1Z56A 2NVFA 2H43A 2OTKE 3L4FA 1R5SA 3CCRP 4H0LB 1BE3J 2I8DA 2Q5UA 4H44B 5CCHD 1SFCA 2A45I 1KILD 1NTZG 1KORA 3H1HD 4GIFA 4DCKA 2JWDA 1EXIA 3IAOA 5CBNA 2YVJB 2D2CB 3SWYA 3D70A 4RO0A 1GL2A 2PFXA 2H89C 3CWBE 3L70J 4QUQA 1G8KB 2M5AB 5AVRB 2E43A 1AV1A 4H0LC 1BCCD 5GTHH 3RBXA 2KNCA 4H44C 3V2QA 3AZCA 2XKMA 1NU1G 3AE3C 3I5CA 2GUSA 3AE7C 5KLIB 3HE5A 1PGPA 1DD4A 3RL0C 2D2CC 2BASA 3H1JJ 1M8OB 2KI7B 1NTKD 1QL2A 1KB9H 4GOEA 4W80A 4JQ0D 3AEEC 4NBAD 3MP7B 1VQMP 3CCQP 2QJYB 1X8YA 3M0DA 5KLIC 1N2DC 2ZYLA 3NFQA 3BCCD 1SQBD 5AVWB 1VCKA 1A02F 3OAKA 2Q7CA 1M1JB 3D6ZA 1E5WA 1GW3A 1IFNA 2JP3A 3VP9A 1NTMG 1L4AB 2J59M 3BASA 1O7WA 1IFIA 1ZR4A 1VQOP 2K9YA 3MZWB 2P2UA 2C9LY 2ZFCA 3RK2D 2B1XA 1LWUA 2A06E 1USEA 1A02J 5AW0B 1K05A 3EQQA 5APUA 2W90A 2H8PD 1IC2A 1G2CA 1FZEA 1M1JC 3L72D 3OW2O 1NH4A 3B4SA 1L4AC 3P7KA 4I7ZB 3CXHE 1LP1A 2QJKB 1TU3F
chains in the Genus database with same CATH topology
4NBFD 1SQPE 3H1IE 3H1KE 1O7NA 4H0LD 1Q90C 4HM5A 2XSOA 3AZCA 3L73E 1FQTA 3D89A 1BGYE 1NU1E 2NUKA 1PPJE 4H13D 4AIVA 2JZAA 2QPZA 2GBXA 2XRXA 3GCEA 3H1HE 3FOUA 4NBCD 1WQLA 4P1BH 4QDFA 4HM1A 5KLVE 2YIUC 1EG9A 1SQVE 1O7MA 2DE6D 3N0QA 3GOBA 4HM7A 3VMHD 4NBHD 5CXMA 2D2CD 2E76D 4NBGD 3TGUE 2NVGA 1NYKA 3L72E 4P1CH 2CKFA 1UUWA 4NBAD 5HL4A 2QJPC 2DE5D 2QJKC 1ULIA 2XSHA 4H44D 1VF5D 1RIEA 1BCCE 4HM6A 4PV1D 4NB8D 1SQQE 2HMMA 1PP9E 3H1JE 1UUVA 2BMQA 2E4QA 2HMNA 2B24A 3GTEA 4QDDA 4QURA 1L0LE 3VMID 4EMJB 1O7GA 2NUMA 2BMOA 5KLIC 2JO6A 2ZYLA 3VCAA 2E4PA 2BMRA 2E75D 4HJLA 1KB9E 4NBBD 4QDFB 3GZXA 1VCKA 2HMOA 2IBZE 1VM9A 2FYNC 4HM3A 1BE3E 4QUPA 1O7HA 2NVFA 3EN1A 4QDCA 3GKEA 1NTME 4OGQD 1O7WA 1SJGA 1NTKE 1KYOE 4NB9D 3DQYA 4HM8A 1O7PA 3L75E 1L0NE 2HMKA 1SQXE 4PD4E 3GL2A 1ZRTE 1NTZE 2B1XA 4NBED 4U3FE 1P84E 2Q3WA 3VMGD 1G8JB 2GBWA 2A06E 1EZVE 3EQQA 3GB4A 5KKZC 4HM2A 2YVJB 2HMLA 3GL0A 3GTSA 4AAYB 3L70E 2E74D 2YFJA 5AEUA 2BCCE 5BOKA 3VCPA 4HM0A 2FYUE 3CWBE 4QUQA 3BCCE 1SQBE 1G8KB 1ULJA 2ZT9D 2YFIA 3C0DA 2I7FA 4QCKA 3GZYA 3CX5E 1RFSA 1NDOA 2HMJA 3L74E 4HM4A 3CXHE 4NBDD 2NWFA 2YFLA 4HKVA 3H1LE 2DE7D 3L71E 2NVEA 2QJYC 5AEWA 2XR8A 1JM1A 4D6TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBF D;  1SQP E;  3H1I E;  3H1K E;  1O7N A;  4H0L D;  1Q90 C;  4HM5 A;  2XSO A;  3AZC A;  3L73 E;  1FQT A;  3D89 A;  1BGY E;  1NU1 E;  2NUK A;  1PPJ E;  4H13 D;  4AIV A;  2JZA A;  2QPZ A;  2GBX A;  2XRX A;  3GCE A;  3H1H E;  3FOU A;  4NBC D;  1WQL A;  4P1B H;  4QDF A;  4HM1 A;  5KLV E;  2YIU C;  1EG9 A;  1SQV E;  1O7M A;  2DE6 D;  3N0Q A;  3GOB A;  4HM7 A;  3VMH D;  4NBH D;  5CXM A;  2D2C D;  2E76 D;  4NBG D;  3TGU E;  2NVG A;  1NYK A;  3L72 E;  4P1C H;  2CKF A;  1UUW A;  4NBA D;  5HL4 A;  2QJP C;  2DE5 D;  2QJK C;  1ULI A;  2XSH A;  4H44 D;  1VF5 D;  1RIE A;  1BCC E;  4HM6 A;  4PV1 D;  4NB8 D;  1SQQ E;  2HMM A;  1PP9 E;  3H1J E;  1UUV A;  2BMQ A;  2E4Q A;  2HMN A;  2B24 A;  3GTE A;  4QDD A;  4QUR A;  1L0L E;  3VMI D;  4EMJ B;  1O7G A;  2NUM A;  2BMO A;  5KLI C;  2JO6 A;  2ZYL A;  3VCA A;  2E4P A;  2BMR A;  2E75 D;  4HJL A;  1KB9 E;  4NBB D;  4QDF B;  3GZX A;  1VCK A;  2HMO A;  2IBZ E;  1VM9 A;  2FYN C;  4HM3 A;  1BE3 E;  4QUP A;  1O7H A;  2NVF A;  3EN1 A;  4QDC A;  3GKE A;  1NTM E;  4OGQ D;  1O7W A;  1SJG A;  1NTK E;  1KYO E;  4NB9 D;  3DQY A;  4HM8 A;  1O7P A;  3L75 E;  1L0N E;  2HMK A;  1SQX E;  4PD4 E;  3GL2 A;  1ZRT E;  1NTZ E;  2B1X A;  4NBE D;  4U3F E;  1P84 E;  2Q3W A;  3VMG D;  1G8J B;  2GBW A;  2A06 E;  1EZV E;  3EQQ A;  3GB4 A;  5KKZ C;  4HM2 A;  2YVJ B;  2HML A;  3GL0 A;  3GTS A;  4AAY B;  3L70 E;  2E74 D;  2YFJ A;  5AEU A;  2BCC E;  5BOK A;  3VCP A;  4HM0 A;  2FYU E;  3CWB E;  4QUQ A;  3BCC E;  1SQB E;  1G8K B;  1ULJ A;  2ZT9 D;  2YFI A;  3C0D A;  2I7F A;  4QCK A;  3GZY A;  3CX5 E;  1RFS A;  1NDO A;  2HMJ A;  3L74 E;  4HM4 A;  3CXH E;  4NBD D;  2NWF A;  2YFL A;  4HKV A;  3H1L E;  2DE7 D;  3L71 E;  2NVE A;  2QJY C;  5AEW A;  2XR8 A;  1JM1 A;  4D6T E; 
#chains in the Genus database with same CATH topology
 1KQL A;  5APS A;  1M56 D;  1MUU A;  5E79 E;  2W6B A;  1KN7 A;  3A5T A;  2GBX A;  1EDI A;  4UB6 E;  2A45 H;  5BU8 B;  1YQ4 C;  1BE3 D;  3KPE A;  2WPS A;  3G6E P;  2P58 A;  4ZNC A;  4R4L A;  1KYO D;  1JB0 J;  3SFE C;  4I7Z C;  1L0N D;  2QJK C;  4PD4 D;  1JCD A;  2WSF J;  3G9R A;  4I6M C;  2A45 G;  4C7N B;  2W27 A;  3H1J G;  3P8C E;  3L70 D;  2BEQ D;  2BMO A;  5H2F E;  4I1L A;  2P67 A;  2PGD A;  1K8A Q;  2IZ1 A;  3H1L D;  4L74 A;  3MD0 A;  1S9K E;  3ITK A;  3DQY A;  5AW2 B;  1PPJ D;  1SQX G;  4WY4 A;  2W6J H;  2Z5I A;  3R2P A;  5AW6 B;  2XZR A;  4DJG A;  1IFD A;  2JWA A;  3L74 J;  4U3F E;  2KXP B;  5AW9 B;  1VQ4 P;  2OYI C;  4AAY B;  2BCC E;  5BOK A;  1AVO A;  1SQP K;  2FY8 A;  5AW7 B;  4NBD D;  1AFO A;  2HYN A;  4D6T G;  3M91 A;  2DE7 D;  2NVE A;  4H0L D;  2KB7 P;  1PZQ A;  1Q90 C;  4N78 E;  3LIE A;  2JZA A;  1YJN P;  1IFJ A;  4HM7 A;  3RL0 D;  2E5T A;  2D2C D;  3E7K A;  2NVG A;  3O8Z A;  4P1C H;  1P84 I;  2WQY C;  1ZLL A;  2YNY A;  1FZB A;  3L35 A;  3VMY A;  1SQQ E;  2HMM A;  5DJU B;  2B24 A;  2M3E A;  2A06 G;  3BAT A;  1N73 A;  3S1K A;  1JMM A;  3AED C;  1DX7 A;  3H6P A;  1VM9 A;  1JY2 O;  3G3Z A;  1FC2 C;  1AA0 A;  1JTH B;  1CZQ A;  1JMB A;  1LTJ B;  4IL6 H;  1XTG B;  3M06 A;  1T2K C;  2FYU J;  5KAF H;  1YQ3 C;  3N4X A;  3A0B H;  1S5L E;  4JYC A;  1GU5 A;  2QIW A;  3G71 P;  2FFD A;  1SQP J;  1LT1 A;  5AW8 B;  1OVV A;  1N7S D;  1NTZ K;  2ZJS E;  1JM0 A;  2KSJ A;  3V2N A;  3CCU P;  1EC5 A;  2QE7 H;  3HTK A;  2NWF A;  1RF1 A;  2N1T A;  1LTJ C;  4NPD A;  3E1R A;  1PP9 D;  3P32 A;  1SFC B;  2XSO A;  2GM4 A;  3O6Q A;  4C46 A;  1EZV I;  1YBK A;  2B9B A;  1KIL E;  3H1H E;  3S4R A;  1PL5 A;  2FYN B;  1MZ9 A;  4GDO A;  3SWF A;  1IJD B;  1NU1 K;  1GL2 B;  4NBG D;  3V2R A;  3EWK A;  4PV1 C;  1KFN A;  2KS1 B;  2ZYD A;  1BCC E;  1SFC C;  2KUB A;  1HGZ A;  5B66 H;  3W67 A;  3K5B A;  1URQ D;  3L75 J;  2ITA A;  4NBB D;  2FYN C;  2KSE A;  2E76 B;  1GL2 C;  5KTB A;  2KZI A;  3CL3 D;  2WSS H;  2Y0E A;  1NTK E;  1VF5 B;  3LID A;  1G1J A;  1D7M A;  1NTM K;  3H1I J;  2E42 A;  4I2L C;  1RE4 A;  4ZKU A;  2FYU G;  4KJM A;  2POH A;  3BCC E;  1SQB E;  1QEX A;  2E76 C;  5APW A;  5KLV J;  2YFL A;  4EYY Q;  2XR8 A;  5AVX B;  1IFM A;  1O7N A;  1LTS C;  1GW4 A;  1GZL A;  1VF5 C;  1LTI C;  1M90 Q;  1ZN5 A;  4IL6 X;  3M0D C;  2WSE J;  2XRX A;  3FWN A;  1LWU B;  1NU1 J;  4ZKP A;  1FBM A;  1JOC A;  2DE6 D;  1RQV A;  2R32 A;  2M0B A;  1GTW A;  1G2C B;  3HD7 A;  3U59 A;  2YMK A;  2I1J A;  2YKQ A;  4BXL A;  3L72 E;  1ZXG A;  4EDF A;  1AJY A;  1NOH A;  1P84 D;  1RY3 A;  1EDK A;  4ZMD A;  4JYB A;  2MJZ A;  1LWU C;  2IZ0 A;  4HJL A;  1DEE G;  1LTT C;  2OQQ A;  4Y99 B;  1FOS E;  4HM3 A;  1BE3 E;  3Q5R A;  3U1C A;  1QX8 A;  3HUS B;  3H1K D;  4XFJ A;  2WVR A;  5CCH A;  1KYO E;  3L73 D;  1FDO A;  1KIL A;  3M0A A;  3M9H A;  1L0N E;  1T2K D;  4PD4 E;  3CPW O;  3C8V A;  1EZV G;  2JKV A;  2FBW C;  3IN6 A;  1SQV D;  1KZU B;  2YIU B;  1HH0 A;  1VQN P;  3E1I A;  3L70 E;  1BGY J;  1SQX K;  2XNX A;  4Y99 C;  1NJI Q;  2K3R A;  3IF4 A;  2R5B A;  3OJA B;  1FDM A;  2JEE A;  1Y8A A;  5AW1 B;  3L71 G;  3VTP C;  1T3J A;  4HKV A;  3H1L E;  3H1I G;  2JDI H;  4QUP A;  1YTZ T;  4GKG A;  2QA4 P;  3TGU J;  1SP4 A;  4WY4 B;  3SWK A;  1FQT A;  3RK3 D;  4N6J A;  1PPJ E;  2WSE H;  5AW3 B;  5DJT B;  3KZI H;  3IFM A;  5KLV G;  3PJS K;  1K04 A;  2O1K A;  4ASW A;  2YIU C;  1YIJ P;  3N0Q A;  1UII A;  3PHL A;  1FZA A;  1LGH B;  1S2E A;  2KS1 A;  5CBO A;  1NYK A;  1OIP A;  2L91 A;  2W83 C;  3JCU H;  5AW5 B;  1NTZ D;  4KT0 J;  2P7J A;  4PV1 D;  3W68 A;  4WY4 C;  1UUV A;  5B5E H;  1NAY A;  2Z4E A;  1O7G A;  4K3A A;  2E75 D;  3CX5 I;  2IBZ G;  4M3L A;  3NTN A;  1Q7Y Q;  3CCL P;  3CCE P;  1CI6 A;  1O7H A;  1SQB G;  2JJL A;  1QGK B;  4HYT B;  3WU2 H;  1MV8 A;  1DEB A;  1NU1 D;  2HG5 D;  4W7Y A;  5AVU B;  1SQX J;  1LNQ A;  3Q5S A;  2IFN A;  4HM2 A;  2XU6 A;  2E74 D;  1N73 B;  4HM0 A;  2ZT9 D;  1FU1 A;  2WPQ A;  3M9Q A;  3ZDM A;  3QH9 A;  1QVF O;  1RF0 A;  2QJY C;  4OGQ B;  3D71 A;  1RH5 B;  3TSI A;  1BGY G;  2SPZ A;  4LLH A;  4D6T J;  4GOD A;  1JO5 A;  3TYY A;  1KB9 D;  2Q3E A;  2KP8 A;  4U7J A;  1LT9 B;  2FFD B;  1W5C E;  2OYH A;  1N73 C;  1OMI A;  2H88 C;  3TGU G;  1NTM D;  1IFP A;  2C9N Y;  3PH0 A;  4PJ0 E;  4L73 A;  3CXH I;  3F5H A;  2KOG A;  1KV4 A;  3R4Y A;  2YO2 A;  4OGQ C;  3HTK B;  4DT0 A;  1RF1 B;  2PP6 A;  2N1T B;  2LXC B;  3FX0 A;  5KJ7 D;  1L0N G;  1PP9 E;  3O6Q B;  1L0L G;  1EDL A;  4IFD K;  4H13 B;  2B88 A;  2QVA A;  3A0H E;  1AQ5 A;  1LT9 C;  3HUS A;  1HVV A;  2FFD C;  1VQ6 P;  3V6I A;  4QDC A;  1UIX A;  2WSC J;  1H0T A;  1SJG A;  1X22 A;  1RF1 C;  1O7P A;  2N1T C;  1BDC A;  3CCM P;  3GL2 A;  1GK6 A;  3C9I A;  1YJW P;  1VQK P;  1G8J B;  4H13 C;  1OZH A;  2O01 N;  3M9B A;  3CWB G;  2WWW A;  3C0D A;  2I7F A;  4QCK A;  5APT A;  2KZJ A;  1VQ9 P;  5APX A;  1R5L A;  3CX5 H;  1JM1 A;  3H1J D;  3AEG C;  3P8M C;  2FYU K;  4HKZ H;  2AXC A;  1YHQ P;  4QDF A;  2NZ2 A;  1FZC B;  2E5Y A;  4TT3 H;  2JR8 A;  1FE6 A;  4WWI A;  4H44 D;  1SQX D;  3B5N B;  1S1C X;  5GTI E;  3WUT A;  4C7R A;  3II6 A;  3GTE A;  4WY4 D;  2NPS B;  1JUN A;  2Q9I A;  3JC2 2;  3CX5 D;  1FZC C;  3BVH A;  1RE4 C;  3GW6 A;  3Q2Y A;  2OYO A;  1ZV8 A;  2WSC H;  3D6Y A;  4D6T D;  3HD7 B;  2AXT E;  2IFM A;  1HGV A;  3HE4 A;  2Y0C A;  3B5N C;  2P10 A;  1SVF A;  3AE4 C;  3V4W A;  3I56 P;  3CXH H;  2QM8 A;  3G4S P;  3CCJ P;  4NBE D;  1P84 E;  5KAI E;  2XDJ A;  1SLQ A;  1T8Z A;  2HML A;  2NPS C;  4DOJ A;  5E79 H;  2UWJ E;  1N7S A;  2Q1K A;  4UB6 H;  5L8R J;  5APQ A;  1N8R Q;  3CC4 P;  3HD7 C;  5CCG A;  2XV5 A;  1Y9B A;  2H7H A;  3H1K E;  2Y9Z A;  1WMK A;  4HM5 A;  3KQG A;  2WT7 B;  1LT9 A;  3Q5P A;  1KIL B;  3L73 E;  1WT6 A;  1OFC X;  2LR2 A;  2Y0D A;  1PP9 G;  4NBC D;  4P1B H;  1NGM B;  1H8A A;  1SQV E;  1O7M A;  1XTC C;  1SQQ J;  5H2F H;  1R8E A;  1L4A D;  2B87 A;  2L5G B;  5KLV K;  2CKF A;  1LTG C;  3PP5 A;  1UUW A;  2RN0 A;  5CCH C;  1Q2N A;  1PFI A;  1K9M Q;  1KIL C;  2PAJ A;  1QLE D;  1URQ A;  4QUR A;  1RE3 A;  3RK3 E;  5AVY B;  5TIS E;  1PGQ A;  3KDP B;  1AQT A;  4O9B A;  2C0W A;  1CSB A;  3L74 D;  4WBA A;  1KC8 Q;  5AVS B;  1OX3 A;  1FJK A;  3VOP A;  4DZO A;  1EQ7 A;  4BRY A;  2W6A A;  1LJ2 A;  2NRG A;  2V7Q J;  4U3F G;  3T97 A;  1NTZ E;  3GHG A;  4JPZ B;  5C39 A;  3VMG D;  1Q86 Q;  3V2P A;  4YPC A;  3GB4 A;  4OWF A;  2WPR A;  3GL0 A;  3N7N A;  2BCC G;  4B86 A;  2YFJ A;  1RHZ B;  1VQL P;  3B8E B;  3VCP A;  3H1H J;  3BRV B;  3H32 A;  1RFS A;  1CI6 B;  1ZP0 C;  3AEB C;  3AE5 C;  1YTZ I;  2KIK A;  1NVO A;  1M57 D;  3L71 J;  2AEM A;  4Y28 J;  4L76 A;  1CW5 A;  3SFD C;  5AVV B;  1NO4 A;  2DW3 A;  1NU1 E;  1FZC A;  2IBZ I;  4YTP C;  4AIV A;  3FOU A;  1YJ9 P;  4K35 A;  1S72 P;  4IFM A;  3VMH D;  5AVT B;  2O01 J;  5GTH E;  3B5N A;  1HUC A;  2YKP A;  3CME P;  3Q1M A;  1W2E A;  1NWQ A;  1Q81 Q;  1IZN B;  2B89 A;  1Q90 D;  1ZRT D;  1FZG A;  1GDT A;  2NPS A;  1H89 A;  1SQQ G;  4NPF X;  1NKN A;  4NB8 D;  2HOD A;  5CHX A;  5KKZ B;  3CCS P;  1LTA C;  1VQ7 P;  1QL1 A;  1NAF A;  2FYU D;  1S5L H;  1KB9 E;  1ZME C;  3GZX A;  4XA4 A;  2OYH B;  3NXS A;  1L0L K;  1SQP D;  3IR9 A;  1NTM E;  2YXQ B;  2BEZ F;  4NB9 D;  2V7Q H;  1VPC A;  1SQB J;  1RF0 C;  2WIT A;  3MUD A;  2N9B A;  3H1K G;  1OVU A;  2Z5H A;  5KKZ C;  3JSV C;  2AEJ A;  5AEU A;  1SQV G;  2RKL A;  2OYH C;  3PTZ A;  2WT7 A;  3AE9 C;  3H25 A;  3PRJ A;  1KQF B;  1M1K Q;  3WUV A;  4NBF D;  1H0T B;  4PD4 I;  2YMY A;  2YXR B;  4MN4 C;  3H1H G;  1OW7 A;  2OGU A;  1JCC A;  1OW8 A;  3GCE A;  3CI9 A;  2KK7 A;  2O01 H;  3GOB A;  3HRN A;  4AQR D;  3HUS C;  1JEK A;  1MFZ A;  3L75 D;  3TK1 A;  5HL4 A;  2DE5 D;  3VP8 A;  1T3U A;  1BCC G;  1EXJ A;  1OXZ A;  1EZV D;  4HM6 A;  3H1J E;  2BMQ A;  1HBW A;  4LC1 A;  2G8Y A;  1L0N J;  1L0L J;  4QDF B;  1U7M A;  4UB8 H;  4JF7 A;  1HWT C;  2HMO A;  1GU4 A;  3RL0 B;  3F89 A;  1L2P A;  1DH3 A;  3L71 D;  2MKV A;  1G1I A;  3H1I D;  1NTK G;  3GKE A;  3L37 A;  2ZYA A;  4GT1 A;  1ZR2 A;  3AE6 C;  1SFC D;  4JBZ A;  3LW5 J;  2KLV A;  1SQX E;  1JY3 P;  3KYQ A;  5KLV D;  3H1L J;  2HPC B;  1NHL A;  2Q6Q A;  3BCC G;  3U1A A;  4QMA A;  3TNU A;  1YYC A;  2ZYG A;  3BRT B;  1GL2 D;  1GD2 E;  3CX5 E;  4RES B;  3CWB J;  1S5L X;  2QM7 A;  4D6T E;  3Q3D A;  3HE4 B;  1LTB C;  1VDF A;  3GF7 A;  1QVG O;  3NMD A;  4CPG A;  4WB4 A;  4XE5 B;  1KQS O;  1WQL A;  2IBZ D;  1ZW0 A;  1EG9 A;  3L36 A;  1VQ5 P;  4NBH D;  1FDI A;  2QEX P;  5CXM A;  3B71 A;  1N7S B;  2E76 D;  3KHU A;  3L72 G;  4RKU J;  3CD6 P;  3V5B A;  1H88 A;  5KJ7 A;  1VF5 D;  3EFG A;  4EOT A;  3MIW A;  3CC7 P;  3AEF C;  1KYO H;  5APY A;  4QDD A;  1Y47 A;  3A2A A;  2KLU A;  3VCA A;  2HLO A;  4PD4 H;  2E4P A;  2BMR A;  3GMA A;  1USD A;  2Y9Y A;  1BE3 G;  2AEF A;  4Z1M H;  1N7S C;  1JY3 O;  3EN1 A;  3AE2 C;  5BU5 A;  2B87 B;  2OTL P;  2XND H;  3LW5 H;  4HM8 A;  1BGY D;  3MHV A;  5CCG C;  2FYZ A;  2QG4 A;  4NPE A;  2IYO A;  2R5D A;  3RL0 g;  3L70 G;  1URQ B;  3TGU D;  1M7L A;  3VMX A;  4IL6 E;  1ULJ A;  2YO3 A;  5KAF E;  3C1L A;  2R3S A;  3GZY A;  3H1L G;  1NDO A;  3A0B E;  3L74 E;  3PLN A;  1MKM A;  4EIJ A;  1RQU A;  1J1D B;  1KQG B;  4BRY B;  1PPJ G;  5CJ4 A;  1L0L D;  3UIA A;  3WMM 0;  3T97 B;  3GHG B;  1U57 A;  1URQ C;  1RE3 C;  4OH8 B;  1KMI Z;  1AVY A;  2OYI B;  1PP9 J;  5TJH A;  1X79 B;  1J2J B;  2WZ7 A;  1T6A A;  3H32 B;  2K9J B;  2IPP A;  1J1D C;  1FZF A;  1X0T A;  5AVQ B;  5AVZ B;  4TLF A;  1RIE A;  1N7L A;  5CMZ A;  1JY2 P;  3GHG C;  3VN0 A;  2JO6 A;  3CWB D;  3VMZ A;  2M3B A;  1HF9 A;  2M5A A;  1SQQ K;  1VQP P;  2QSI A;  1S4X A;  3KXD A;  2HPC A;  3MGN A;  1KFM A;  2K1A A;  1BDD A;  5B66 E;  2RMZ A;  3GF3 A;  2HMK A;  3MTU E;  5CJ0 A;  1IO4 A;  1ZRT E;  2OTJ P;  1YIT P;  1IK9 A;  2HOD B;  2GBW A;  2LKM A;  1PIX A;  3FGA D;  5BVZ A;  4U3F J;  5AW4 B;  1JY3 N;  2K37 A;  1NYH A;  1GMJ A;  1NKZ B;  2FYU E;  4BWN A;  2YFI A;  2BCC J;  4R4M A;  2HMJ A;  2QJP B;  5AEW A;  4PJ0 H;  1SQP E;  3EFF K;  1SQV K;  2WSF H;  2HR3 A;  3OA7 A;  1BSN A;  1PGJ A;  2V4H A;  2VRS A;  3A3Y B;  2HFE D;  1M1J A;  3FWL A;  4L75 A;  1S3J A;  1L4A A;  3A0H H;  1YI2 P;  3ABV C;  3USS A;  4W7Z A;  1HTL C;  2FXP A;  2IX7 C;  2QJP C;  2XSH A;  4WVZ A;  2N9Y B;  2PRR A;  1DD3 A;  2A06 D;  3VYI A;  1PGO A;  3RK3 B;  3MUD C;  3VMA A;  1Q82 Q;  4IOI H;  1EDJ A;  3S9O A;  3SSU A;  3CXH D;  3WUU A;  3I55 P;  2O3J A;  3GG2 A;  3FXE A;  4OGQ D;  3L74 G;  3QWO C;  2CPB A;  3L75 E;  4YXD C;  4AYC A;  4PV1 B;  5CCG D;  1K73 Q;  2P1J A;  3RK3 C;  1EZV E;  1NTK K;  3H1K J;  4AUW A;  3GTS A;  1JNM A;  2E75 B;  3L73 J;  1FJP A;  5K5G B;  3AEC C;  4HM4 A;  1VQ8 P;  1SQV J;  2R3C A;  3L71 E;  1BSH A;  4C7N A;  3P8C D;  2FXM A;  2N1T D;  3TDK A;  3H1I E;  1OVR A;  1SQB K;  3V4Q A;  1OWA A;  3AE1 C;  2NUK A;  2OYI A;  2ZXE B;  4H13 D;  1WRG A;  2KNC B;  2QPZ A;  1X9V A;  5GTI H;  1DIP A;  2JO1 A;  5KLV E;  4HB1 A;  2E74 B;  2ZVO B;  2E75 C;  2CK3 H;  2K9J A;  3TNU B;  2ZT9 B;  1VL2 A;  3HE5 B;  1S9K D;  2LXB A;  1E79 H;  4GOF A;  4N3Y B;  2CPS A;  1ULI A;  1N86 A;  1HJB A;  3KZI E;  3RK2 B;  1J1E B;  4U3F D;  2AXT H;  5EFW B;  3RGU A;  2W8Z A;  2R44 A;  1BCC J;  4LGD E;  3RBZ A;  3EQ2 A;  5APV A;  3VMI D;  2BCC D;  4EMJ B;  2OAR A;  2NUM A;  4UB8 E;  4OVN F;  1P84 H;  1JY2 N;  5KAI H;  2E74 C;  1NTZ J;  2IBZ E;  1FS0 E;  3A7O A;  3JCU E;  2ZT9 C;  3AE8 C;  2M8R A;  2J5U A;  1HJ0 A;  2GA1 A;  3FXD A;  1ZOY C;  4N78 D;  1OW6 A;  2O1J A;  4HJG H;  5B5E E;  3RK2 C;  2Q3I A;  1J1E C;  1NTK J;  1SQP G;  2YKO A;  4A7P A;  4ASV A;  2Q3W A;  2WTY A;  4KHX A;  1KB9 I;  2ZXX A;  1KTM A;  2J58 A;  1L0N K;  3CCV P;  3WU2 E;  3AEA C;  1KD1 Q;  2IDB A;  2WMM A;  3BCC J;  1W2B O;  3B5N D;  1SQQ D;  2I1K A;  2FKW B;  1SS1 A;  4RJT A;  2FXO A;  3L73 G;  3TF5 A;  1FAV A;  1LP1 B;  3D89 A;  5KJ7 C;  1BGY E;  3CLQ A;  1MFT A;  2ZVN B;  2NPS D;  4HH2 A;  4YXW H;  4HM1 A;  1GK4 A;  5M1B A;  4EI2 A;  2GUV A;  1IK7 A;  2WPV B;  1KYO I;  2C0X A;  2QRX A;  1U7J A;  5TIS H;  1PV3 A;  3TGU E;  2IYP A;  3HD7 D;  1JTH A;  1LTJ A;  3CC2 P;  2K88 A;  3L72 J;  3CMA P;  1FOS F;  2KYV A;  2RH0 A;  4IFF A;  3L75 G;  1NTM J;  2E4Q A;  2HMN A;  1L0L E;  3GLM A;  2G3A A;  2ZAE B;  1Z56 A;  2NVF A;  2H43 A;  2OTK E;  3L4F A;  1R5S A;  3CCR P;  4H0L B;  1BE3 J;  2I8D A;  2Q5U A;  4H44 B;  5CCH D;  1SFC A;  2A45 I;  1KIL D;  1NTZ G;  1KOR A;  3H1H D;  4GIF A;  4DCK A;  2JWD A;  1EXI A;  3IAO A;  5CBN A;  2YVJ B;  2D2C B;  3SWY A;  3D70 A;  4RO0 A;  1GL2 A;  2PFX A;  2H89 C;  3CWB E;  3L70 J;  4QUQ A;  1G8K B;  2M5A B;  5AVR B;  2E43 A;  1AV1 A;  4H0L C;  1BCC D;  5GTH H;  3RBX A;  2KNC A;  4H44 C;  3V2Q A;  3AZC A;  2XKM A;  1NU1 G;  3AE3 C;  3I5C A;  2GUS A;  3AE7 C;  5KLI B;  3HE5 A;  1PGP A;  1DD4 A;  3RL0 C;  2D2C C;  2BAS A;  3H1J J;  1M8O B;  2KI7 B;  1NTK D;  1QL2 A;  1KB9 H;  4GOE A;  4W80 A;  4JQ0 D;  3AEE C;  4NBA D;  3MP7 B;  1VQM P;  3CCQ P;  2QJY B;  1X8Y A;  3M0D A;  5KLI C;  1N2D C;  2ZYL A;  3NFQ A;  3BCC D;  1SQB D;  5AVW B;  1VCK A;  1A02 F;  3OAK A;  2Q7C A;  1M1J B;  3D6Z A;  1E5W A;  1GW3 A;  1IFN A;  2JP3 A;  3VP9 A;  1NTM G;  1L4A B;  2J59 M;  3BAS A;  1O7W A;  1IFI A;  1ZR4 A;  1VQO P;  2K9Y A;  3MZW B;  2P2U A;  2C9L Y;  2ZFC A;  3RK2 D;  2B1X A;  1LWU A;  2A06 E;  1USE A;  1A02 J;  5AW0 B;  1K05 A;  3EQQ A;  5APU A;  2W90 A;  2H8P D;  1IC2 A;  1G2C A;  1FZE A;  1M1J C;  3L72 D;  3OW2 O;  1NH4 A;  3B4S A;  1L4A C;  3P7K A;  4I7Z B;  3CXH E;  1LP1 A;  2QJK B;  1TU3 F; 
#chains in the Genus database with same CATH homology
 4NBF D;  1SQP E;  3H1I E;  3H1K E;  1O7N A;  4H0L D;  1Q90 C;  4HM5 A;  2XSO A;  3AZC A;  3L73 E;  1FQT A;  3D89 A;  1BGY E;  1NU1 E;  2NUK A;  1PPJ E;  4H13 D;  4AIV A;  2JZA A;  2QPZ A;  2GBX A;  2XRX A;  3GCE A;  3H1H E;  3FOU A;  4NBC D;  1WQL A;  4P1B H;  4QDF A;  4HM1 A;  5KLV E;  2YIU C;  1EG9 A;  1SQV E;  1O7M A;  2DE6 D;  3N0Q A;  3GOB A;  4HM7 A;  3VMH D;  4NBH D;  5CXM A;  2D2C D;  2E76 D;  4NBG D;  3TGU E;  2NVG A;  1NYK A;  3L72 E;  4P1C H;  2CKF A;  1UUW A;  4NBA D;  5HL4 A;  2QJP C;  2DE5 D;  2QJK C;  1ULI A;  2XSH A;  4H44 D;  1VF5 D;  1RIE A;  1BCC E;  4HM6 A;  4PV1 D;  4NB8 D;  1SQQ E;  2HMM A;  1PP9 E;  3H1J E;  1UUV A;  2BMQ A;  2E4Q A;  2HMN A;  2B24 A;  3GTE A;  4QDD A;  4QUR A;  1L0L E;  3VMI D;  4EMJ B;  1O7G A;  2NUM A;  2BMO A;  5KLI C;  2JO6 A;  2ZYL A;  3VCA A;  2E4P A;  2BMR A;  2E75 D;  4HJL A;  1KB9 E;  4NBB D;  4QDF B;  3GZX A;  1VCK A;  2HMO A;  2IBZ E;  1VM9 A;  2FYN C;  4HM3 A;  1BE3 E;  4QUP A;  1O7H A;  2NVF A;  3EN1 A;  4QDC A;  3GKE A;  1NTM E;  4OGQ D;  1O7W A;  1SJG A;  1NTK E;  1KYO E;  4NB9 D;  3DQY A;  4HM8 A;  1O7P A;  3L75 E;  1L0N E;  2HMK A;  1SQX E;  4PD4 E;  3GL2 A;  1ZRT E;  1NTZ E;  2B1X A;  4NBE D;  4U3F E;  1P84 E;  2Q3W A;  3VMG D;  1G8J B;  2GBW A;  2A06 E;  1EZV E;  3EQQ A;  3GB4 A;  5KKZ C;  4HM2 A;  2YVJ B;  2HML A;  3GL0 A;  3GTS A;  4AAY B;  3L70 E;  2E74 D;  2YFJ A;  5AEU A;  2BCC E;  5BOK A;  3VCP A;  4HM0 A;  2FYU E;  3CWB E;  4QUQ A;  3BCC E;  1SQB E;  1G8K B;  1ULJ A;  2ZT9 D;  2YFI A;  3C0D A;  2I7F A;  4QCK A;  3GZY A;  3CX5 E;  1RFS A;  1NDO A;  2HMJ A;  3L74 E;  4HM4 A;  3CXH E;  4NBD D;  2NWF A;  2YFL A;  4HKV A;  3H1L E;  2DE7 D;  3L71 E;  2NVE A;  2QJY C;  5AEW A;  2XR8 A;  1JM1 A;  4D6T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...