3H1LE

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
total genus 43
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1lE02
2YFJA 4HM6A 4NBGD 4PV1D 4NBFD 2B1XA 3GZYA 4HM7A 1NYKA 1PPJE 3H1LE 4H44D 4NBED 2BMOA 2E4QA 5BOKA 1KYOE 2NVEA 1EZVE 1SQQE 2XR8A 3GTEA 4QURA 1FQTA 2GBWA 1O7PA 3EN1A 2HMJA 3L73E 1UUWA 5HL4A 1WQLA 2BCCE 3VCPA 1SJGA 3VMHD 2NUKA 2XSHA 2HMKA 3BCCE 1RFSA 1L0LE 1VM9A 1ULIA 2HMNA 3H1JE 1VF5D 2HMOA 2HMMA 3EQQA 1BE3E 3DQYA 3GOBA 3L71E 3L70E 2QJKC 4HM3A 5KLIC 1KB9E 4NBBD 2NUMA 2I7FA 2E74D 4NBDD 2DE5D 2BMRA 2ZT9D 3GTSA 2YFIA 4QUPA 3VCAA 3C0DA 2BMQA 1NDOA 5CXMA 4HM1A 2JZAA 4HM5A 3FOUA 1NTKE 2JO6A 4HM0A 2E4PA 4HM4A 4H0LD 4QDDA 4HM8A 4AAYB 1UUVA 1P84E 2B24A 3H1KE 2YVJB 2E76D 4QDFB 2FYUE 3L72E 5AEUA 1NTME 2DE6D 4HJLA 3L75E 3H1IE 2NWFA 4HM2A 2CKFA 4PD4E 2D2CD 2QPZA 2YIUC 4QCKA 2IBZE 3L74E 1EG9A 3GL2A 3VMGD 2XSOA 2FYNC 3GKEA 1G8KB 4U3FE 2XRXA 1NU1E 3GZXA 3CWBE 4HKVA 1SQPE 1VCKA 1Q90C 1BCCE 2NVGA 1SQVE 2QJYC 4NB8D 2DE7D 1O7MA 1BGYE 4NBHD 4NBAD 5KKZC 4QUQA 1O7WA 3H1HE 4P1BH 4QDCA 4QDFA 1PP9E 1L0NE 1JM1A 2Q3WA 3CX5E 3CXHE 5AEWA 1SQXE 1O7GA 2HMLA 2NVFA 4EMJB 1G8JB 3GL0A 2ZYLA 5KLVE 4AIVA 4P1CH 3N0QA 3GCEA 3VMID 1ULJA 1O7HA 4H13D 2GBXA 2A06E 3GB4A 1NTZE 1ZRTE 4NB9D 4OGQD 1SQBE 2E75D 3TGUE 1O7NA 3D89A 1RIEA 4D6TE 2QJPC 4NBCD 3AZCA 2YFLA
chains in the Genus database with same CATH superfamily
4NPEA 1T8ZA 1NYKA 4L74A 1SFCC 5TJHA 1KZUB 1FZBA 2SPZA 3IN6A 2FYNB 3RK2B 3PH0A 4K3AA 4GT1A 3MGNA 2O3JA 4Y99C 4PV1C 2E76B 1VM9A 1M1JA 1FZEA 2YKQA 1NU1J 1BCCG 4ZNCA 3CC2P 4LC1A 4NBBD 1ZR4A 1OMIA 1PP9G 2YKOA 2FFDC 2POHA 1YJ9P 2CK3H 1QEXA 3AECC 3CXHD 5KJ7D 2IFMA 1QVGO 1HJBA 2DE6D 1GU4A 1PZQA 1OX3A 1NWQA 1FBMA 1SQQK 1EG9A 3RBZA 3WMM0 4I7ZC 1AQTA 3KZIE 5B66E 2JP3A 1N2DC 4ASVA 2NPSA 5B5EH 3P8CE 1VPCA 2N1TD 3Q1MA 2WT7B 3HTKA 1S3JA 1CI6A 3AEGC 3M91A 2Q3WA 1H0TA 1LTJA 4GIFA 1SFCD 3LW5H 1J1DB 2KS1A 1O7HA 3EFGA 1N73C 2KZIA 4JYCA 1OVUA 1J1EB 1QGKB 1YBKA 2FYUK 1EC5A 4PV1D 1LTSC 1UIIA 2M5AB 3KXDA 2NVEA 1KILB 1QLED 3HD7C 1JMMA 3H32A 1EDKA 2YXRB 2R5DA 2HMKA 5CJ0A 1RQUA 3BCCE 3IR9A 4UB6H 3GG2A 1G2CA 1URQC 3P32A 1SQXK 2I7FA 5CJ4A 3GHGB 5KLVK 1DH3A 2WPVB 4HM5A 1OZHA 1RHZB 4PD4H 1BSHA 2JDIH 2AEMA 3L75D 2YKPA 2WPSA 1NVOA 4BWNA 5AEUA 3L72E 3LIDA 2W83C 4HM2A 2R3SA 2YNYA 1QX8A 5CCHA 1DEEG 4N3YB 1NU1E 3H1HJ 4K35A 3M0AA 1SQVE 1YYCA 3MP7B 1FE6A 4C7NB 5APWA 1HUCA 3W67A 2N9BA 1OVRA 2C0WA 4QDCA 2PGDA 3CX5D 3Q5RA 2D2CC 3L73J 1R5SA 2WWWA 1VQKP 4IFFA 1W5CE 3U1CA 3OJAB 3TF5A 3HD7D 5DJUB 1RF0C 2QRXA 1YTZI 4NPDA 3II6A 1LGHB 1K73Q 3ABVC 1M1JB 4H44D 3CCVP 5BOKA 3AE9C 2QJKB 1N7SD 1URQD 3VMZA 4OVNF 1RE3C 1L4AD 1Q82Q 4OH8B 1YITP 1IJDB 4I1LA 2BCCE 4ZMDA 3L75G 2FFDA 1M8OB 4MN4C 3Q5SA 4L75A 1KTMA 3JC22 1FZCA 5AVTB 3IF4A 3E1RA 1T3JA 2AXCA 1HJ0A 3KQGA 3GTSA 2YFIA 5BVZA 4WBAA 1KYOI 3A0BE 3H1KJ 2Q9IA 2E75C 3M9QA 5KAIH 3M06A 2NPSB 1IZNB 4GKGA 3BVHA 1NTME 5APYA 3H1IE 1CI6B 4DZOA 1H0TB 5APUA 4HB1A 2D2CD 2KS1B 5AW8B 3S4RA 4WY4D 1G8KB 1ZXGA 2WPQA 3AE3C 1KYOH 2Q1KA 1PGJA 2C0XA 1Z56A 3I5CA 4QUQA 3EFFK 4JPZB 1Q2NA 5TISE 5BU5A 4EMJB 5AVQB 5GTHE 1ZRTD 3H32B 1Q7YQ 2B89A 2QVAA 1FZAA 1KB9D 1HF9A 2W6BA 1G2CB 1PPJE 1PGQA 1URQA 3QWOC 5AW3B 3TYYA 4PJ0E 1DD4A 3L73E 1SQPK 1IFDA 4C46A 4XE5B 1IFPA 1WQLA 1G1IA 2QJYB 2HG5D 1RY3A 5AVUB 1BE3D 3L71D 2HMOA 3B4SA 3FXEA 2H7HA 1JEKA 1NTKJ 2NUMA 2P7JA 3AE1C 2M3BA 2I1JA 4I6MC 2AXTH 3FOUA 3G6EP 2E43A 4YPCA 4ZKUA 1GZLA 5APXA 3AEEC 2I8DA 2H43A 4ZKPA 1SFCB 2HODA 2KNCA 3AE6C 1SQBD 3CWBE 2IYOA 3NMDA 1BCCE 1JTHB 1RF0A 1FZFA 1L0ND 5AW0B 2LXCB 1VF5C 4Y99B 4QDFA 1PP9E 1PGOA 3IAOA 3O6QA 1NGMB 3P7KA 4JQ0D 1RE3A 1ULJA 2FKWB 3GB4A 3L71G 2FFDB 3P8MC 2QJPC 1FZCB 2B1XA 2R44A 2P1JA 5AW7B 3CCEP 3MD0A 2E4QA 1KQFB 3UIAA 1FDIA 2BCCG 4IOIH 3S1KA 4I7ZB 2JJLA 2ZVNB 3VMHD 2JEEA 3H1JD 2OYOA 5APSA 5B66H 1JY2O 1S5LE 4UB8E 3RGUA 3CMEP 3TNUA 1KC8Q 1P84H 2A45H 1L0NG 1SQBK 4L76A 2JWDA 1LWUC 1N73B 5E79H 1OW7A 2P10A 3SFEC 4PD4D 2KZJA 3TDKA 1D7MA 2YMKA 2E74C 1AVOA 4U3FD 3CCSP 2E5TA 1BGYD 1JY3P 3D71A 2P58A 2HFED 3Q3DA 1FOSF 3AE2C 2O01J 1EXIA 1O7GA 2FXMA 1URQB 1MV8A 3AE4C 3GHGA 3TGUD 1KV4A 2GBXA 5AVXB 3H1JG 2KLUA 3L70G 4LLHA 5APTA 5KJ7C 4RO0A 2LXBA 3KHUA 1N8RQ 1FAVA 3GTEA 3VOPA 4QURA 2IDBA 3H6PA 2IZ1A 2K3RA 1YIJP 3I56P 3RBXA 1OW8A 1EDJA 1FDOA 2N1TC 2IZ0A 2D2CB 2HODB 2KNCB 2E74D 1KQSO 2KK7A 4YXDC 3T97A 1BGYG 1UIXA 1OXZA 3G3ZA 3L72J 3VN0A 2RMZA 2FYUD 3SWFA 2FY8A 1UUVA 1AFOA 4QDFB 1FJPA 1NHLA 3L75E 3HE4A 3W68A 3CWBG 1HWTC 1Q86Q 3O6QB 3CI9A 1SQVJ 3PLNA 3L4FA 3TGUG 3KDPB 1GL2C 2H89C 3RL0B 1OIPA 1JB0J 2KI7B 2IPPA 1RF1C 1PIXA 1RQVA 2DE7D 1SQQG 4QMAA 1L0LK 1O7WA 3RK3D 1VL2A 1SQXD 3CCUP 2M0BA 4IFMA 3CX5E 3WUUA 5KLVD 2HMLA 3HUSC 1GMJA 2B9BA 1VQPP 2FBWC 1H89A 1KN7A 4NB9D 2KLVA 4OGQD 2OYHC 2E75B 5KTBA 3CCQP 1EXJA 1WRGA 5H2FE 4NBCD 4TT3H 3A0BH 3A0HH 1OW6A 1H88A 4HM7A 2BCCJ 5AW1B 3TNUB 1U7MA 1FQTA 3FWNA 1NAFA 4H13C 2P2UA 2FYUG 4N6JA 5AW4B 3K5BA 1R8EA 3WU2H 2KUBA 5KLIC 3GF3A 1CZQA 2HPCA 4JF7A 2BMRA 3C0DA 2MKVA 1GL2D 5CXMA 1NTZK 1NTMJ 3MIWA 1HGVA 1BSNA 1NO4A 3H1IJ 5APVA 1L2PA 1SQXG 2Q7CA 2Z5HA 5KLVG 4HJLA 2QE7H 3L74D 4H44C 3M9HA 3D6YA 3MHVA 1N7SC 2QPZA 2OTLP 1G1JA 1L4AC 3V5BA 2YXQB 1BDDA 3NTNA 2ZVOB 2ITAA 1PFIA 2WMMA 3N7NA 5KJ7A 2JWAA 2Y9ZA 2CPSA 3KPEA 4AQRD 5KAFE 4H13D 4D6TD 1NTKK 3H1JJ 1ZRTE 2K9JA 3L70J 3VMAA 1M7LA 1LT1A 3L36A 4KT0J 2N1TA 1M56D 1EZVD 1E5WA 1JY3O 2CPBA 4IL6X 1SFCA 4WY4C 1IK7A 2FXPA 3T97B 4KJMA 3VP8A 1JTHA 1S5LX 1QL1A 1JUNA 1RFSA 2K1AA 3L74G 1X9VA 1VF5B 1BE3E 1GW3A 3HE4B 3L71E 2KXPB 2G8YA 1KORA 4QUPA 1LNQA 3P8CD 3B5ND 2XDJA 1P84D 1RF1A 2B87A 1AVYA 2PP6A 3AE8C 2WSSH 2QJPB 2YVJB 1IFJA 2K88A 3CWBJ 1BCCJ 2MJZA 1XTGB 2KB7P 1OFCX 3AE5C 1SQPD 3CLQA 2XSOA 4D6TG 2L5GB 1Y47A 1PP9J 1ZN5A 4H0LC 3GF7A 1NYHA 1FC2C 1SQQJ 2ZAEB 4NBAD 1EZVG 1T6AA 1L0NE 1JY2N 3VMYA 3CXHI 5L8RJ 3B71A 5B5EE 2A06D 2Y9YA 3EQ2A 1O7NA 1LTTC 2YMYA 1LWUB 1N73A 1Y8AA 3R2PA 5GTIH 2FYZA 1AV1A 1HGZA 1IK9A 2WTYA 2XR8A 2C9LY 2HPCB 4N78D 2GUSA 2O1JA 3N4XA 3HD7A 3RK2D 1IFMA 1Q90D 3VCPA 3GMAA 3S9OA 2R32A 4WVZA 1TU3F 3M0DC 1S4XA 4HJGH 3H1JE 3EQQA 2PFXA 3L70E 4CPGA 4JBZA 2KIKA 1N7SA 3ITKA 2R5BA 1L4AA 2BMQA 1NDOA 5AW2B 1GW4A 3M9BA 3JCUE 1YQ3C 3LIEA 2V7QJ 4H0LD 1JOCA 2P67A 2B24A 5DJTB 1FZGA 2HR3A 1DIPA 4PD4E 3CCLP 4QCKA 3CC4P 2A06G 1J2JB 3C9IA 4W7YA 1S9KD 4U3FE 3GZXA 3NFQA 2G3AA 5AW9B 3D6ZA 2K9JB 4A7PA 1YTZT 1BGYE 5KKZC 5CCGD 3GLMA 2N1TB 1GD2E 3FGAD 1LTGC 1GTWA 1KQGB 4WY4A 1XTCC 2W8ZA 3VMID 2Q6QA 2WSCH 3TGUE 3OA7A 1K05A 3H1LD 4PV1B 4W7ZA 2VRSA 4Y28J 4NBED 3FX0A 1SQQE 2OARA 1S72P 1CW5A 1KILD 2V4HA 3CX5I 1O7PA 2HMJA 5AVVB 1NU1K 1RE4C 1X22A 1SQVK 2NUKA 1BE3G 3V4QA 2XSHA 1RF1B 2B87B 1ZV8A 2WSCJ 2OYIC 2Y0CA 3DQYA 5CBNA 3AEBC 2QJKC 2XNDH 1GU5A 1PL5A 3IFMA 3HUSB 4IL6E 1MZ9A 3L75J 3GW6A 2OYHB 2WSFJ 4HM4A 1GK6A 1VQ6P 3OW2O 2FYUE 3KZIH 2IBZD 3F5HA 1HTLC 4XFJA 1SQBG 4U7JA 1SS1A 1QVFO 2C9NY 4H13B 3V6IA 3BRTB 3QH9A 3KYQA 3H1HD 2E5YA 3H1LG 2K37A 4C7RA 3VTPC 3A5TA 2O01H 3MZWB 1LTJC 5AVSB 3RK3E 3CXHE 1SQXE 1YJNP 5KLIB 1FJKA 1M57D 5KLVE 4AIVA 4P1CH 3HD7B 1X8YA 2Q3EA 1K04A 3M0DA 2W27A 3CCRP 2HYNA 4HM6A 2IYPA 1NTMK 2WZ7A 4H44B 1N7SB 4DT0A 2GBWA 1IFIA 1L4AB 2YO3A 2XNXA 3C8VA 2WSEJ 1L0LD 3L35A 5BU8B 2Q3IA 2IBZG 3RK3C 2K9YA 3AEAC 3ZDMA 2ZJSE 3GOBA 4BXLA 2KOGA 3C1LA 5AVZB 4RESB 1KB9I 2KSJA 1ZR2A 1T3UA 3H1HG 2BEQD 3PHLA 4OGQC 2PRRA 1LTIC 1IC2A 3H1KD 1VDFA 2NPSD 2ZYDA 1HVVA 1Q81Q 2AXTE 1T2KD 4U3FG 2YIUC 1GK4A 3MUDC 3L74E 1LJ2A 4WY4B 3GKEA 2OQQA 5AVYB 4OWFA 1AJYA 4TLFA 1PGPA 1VQ5P 1W2EA 4LGDE 1ZLLA 1MKMA 5AEWA 3F89A 1VQOP 2IFNA 1NTZD 1ZW0A 1L0LG 2Z4EA 1RE4A 2GUVA 1WMKA 3SWKA 1RIEA 4D6TE 2YFJA 2OYIA 1KYOD 2NZ2A 2RN0A 3VP9A 1E79H 3EWKA 1VQLP 1EZVE 1YJWP 4ASWA 3H1KG 1MFZA 1BE3J 2R3CA 3L71J 4H0LB 1FZCC 2KSEA 4I2LC 4IFDK 5K5GB 1ZP0C 1KD1Q 2XU6A 1M1KQ 2M8RA 5CCHD 1NTKD 4XA4A 1DX7A 2JZAA 1AQ5A 3V2QA 3JSVC 4QDDA 4AAYB 1P84E 1LWUA 1MUUA 2B88A 3V2RA 3B8EB 1BDCA 1JMBA 2ZT9C 1NTZG 1SQBJ 3GL2A 3VMGD 5E79E 4HKZH 2IBZI 1SQPE 1VCKA 3BATA 1YQ4C 2Y0DA 1L0NJ 1R5LA 5TISH 1LT9C 3H1LJ 2ZFCA 5GTHH 1USEA 2ZXXA 4P1BH 2L91A 4O9BA 2NVFA 2W6JH 1G8JB 4PD4I 2QM7A 1HBWA 3LW5J 2QM8A 3WUVA 3B5NC 2A06E 1PV3A 3BASA 1FOSE 4PJ0H 2YFLA 3JCUH 2BMOA 1NTKG 3G9RA 1SLQA 1NH4A 4N78E 1UUWA 1MFTA 1VQ4P 1JNMA 4Z1MH 1LTAC 3TSIA 1WT6A 5KKZB 3Q2YA 3CL3D 1ZOYC 3CD6P 2HMMA 2ZYGA 1N7LA 2O01N 1OWAA 4B86A 1KB9E 3MUDA 2DE5D 2J59M 2J58A 2ZT9D 2OGUA 1LTBC 3PTZA 4GOFA 1U57A 2JO1A 2E4PA 1FDMA 2QG4A 2DW3A 3USSA 4BRYA 1IFNA 2NWFA 4U3FJ 2CKFA 4DJGA 1QL2A 1YI2P 2RH0A 2FYNC 3RK2C 3PRJA 1KFMA 1BGYJ 4WWIA 2XRXA 2ZXEB 1GL2A 1Q90C 4AUWA 1S9KE 1JY2P 1NJIQ 2E76C 4NBHD 2OYIB 4EYYQ 4JYBA 3GL0A 3FXDA 3RL0C 3TGUJ 4DOJA 4M3LA 1L0LJ 3HUSA 5M1BA 3PJSK 1SQBE 2BASA 5AVRB 2OYHA 3SSUA 1DEBA 2YO2A 4NBGD 4IL6H 3GZYA 1X79B 3H1LE 3A3YB 1KILE 1S5LH 3A0HE 4R4LA 3E1IA 3BCCD 2JR8A 5EFWB 2M3EA 4UB8H 2W90A 1EDIA 5CCGC 1FU1A 1HH0A 4EI2A 2Z5IA 3HTKB 2KYVA 3RL0g 1LTJB 2FXOA 1NKNA 1J1DC 2LR2A 2E74B 2XV5A 3G4SP 1RH5B 4HYTB 3WU2E 3CXHH 2FYUJ 2V7QH 4HM0A 3MTUE 1K8AQ 1LT9A 3L72D 1H8AA 1J1EC 2A45G 3Q5PA 4HM8A 1VQ8P 5APQA 2E76D 2WVRA 1Y9BA 1KFNA 2N9YB 4GOEA 3D70A 1SQPG 1KILC 1NTZJ 2IBZE 4NPFX 1NU1D 4HH2A 4EOTA 3CPWO 1SQVD 2AEFA 3RL0D 1VQ9P 4HKVA 4UB6E 2J5UA 1K9MQ 1NOHA 3B5NA 2Q5UA 1JO5A 1LP1A 1O7MA 1SQXJ 3H1HE 2OTJP 3RK3B 5KLVJ 1CSBA 3GHGC 2ZYLA 3VYIA 3BCCG 3N0QA 4OGQB 5AW6B 2E75D 3D89A 2Y0EA 4NBFD 5CMZA 1VQMP 1FS0E 2YIUB 1AA0A 3HE5A 2BCCD 3WUTA 3SWYA 2LKMA 3L72G 3L37A 4DCKA 1L0LE 2HMNA 3O8ZA 4BRYB 1NKZB 2WITA 1EQ7A 3HRNA 1NU1G 4RJTA 3A7OA 2IX7C 2AEJA 1ZMEC 1SQVG 3TK1A 3SFDC 1EZVI 1GL2B 4HM1A 2WSFH 4YXWH 1VQNP 2UWJE 1NTMD 2H88C 2I1KA 3H1ID 3L74J 3H1KE 1M1JC 2H8PD 3E7KA 2GM4A 2WQYC 3U1AA 3R4YA 3CMAP 2QSIA 1A02F 5C39A 3V2PA 4NB8D 3CX5H 1SVFA 2XZRA 1EDLA 3AEFC 1JM0A 3CCJP 1KQLA 2OTKE 3PP5A 1JM1A 1P84I 2JKVA 5KAIE 4WB4A 5H2FH 4EDFA 4EIJA 2A45I 4D6TJ 2RKLA 1X0TA 3V4WA 1YHQP 1NTZE 4AYCA 2NPSC 3I55P 1DD3A 3L70D 5CCGA 1M90Q 3AZCA 1A02J 1PPJD 1USDA 2WT7A 3FWLA 2NRGA 1T2KC 3OAKA 1U7JA 1NAYA 1KYOE 2ZT9B 3L73D 3EN1A 2WSEH 1JCDA 5GTIE 5HL4A 1NTMG 1SJGA 3H1IG 1LT9B 1OVVA 5AW5B 3H25A 3BRVB 1W2BO 4RKUJ 1ULIA 1SP4A 4R4MA 1VF5D 1L0NK 1S1CX 2M5AA 4HM3A 2ZYAA 5AVWB 4NBDD 1KILA 2QEXP 3CCMP 2E42A 3VCAA 3A2AA 3CC7P 1NTKE 2JO6A 3B5NB 4KHXA 2O1KA 1LP1B 1VQ7P 3NXSA 1SQPJ 1S2EA 3CWBD 1BCCD 2HLOA 2XKMA 3VMXA 2NVGA 2W6AA 1IO4A 2QJYC 4YTPC 1PPJG 1PP9D 3U59A 1SQQD 5KAFH 2QA4P 5CBOA 2GA1A 3L73G 1JCCA 4GODA 5CCHC 2BEZF 3V2NA 2QIWA 3G71P 3HE5B 2WPRA 1JY3N 3BCCJ 2PAJA 4W80A 3AE7C 4L73A 4GDOA 3GCEA 1KB9H 3AEDC 1KMIZ 4C7NA 1GDTA 5CHXA 1N86A 2KP8A
chains in the Genus database with same CATH topology
2YFJA 4HM6A 4NBGD 4PV1D 4NBFD 2B1XA 3GZYA 4HM7A 1NYKA 1PPJE 3H1LE 4H44D 4NBED 2BMOA 2E4QA 5BOKA 1KYOE 2NVEA 1EZVE 1SQQE 2XR8A 3GTEA 4QURA 1FQTA 2GBWA 1O7PA 3EN1A 2HMJA 3L73E 1UUWA 5HL4A 1WQLA 2BCCE 3VCPA 1SJGA 3VMHD 2NUKA 2XSHA 2HMKA 3BCCE 1RFSA 1L0LE 1VM9A 1ULIA 2HMNA 3H1JE 1VF5D 2HMOA 2HMMA 3EQQA 1BE3E 3DQYA 3GOBA 3L71E 3L70E 2QJKC 4HM3A 5KLIC 1KB9E 4NBBD 2NUMA 2I7FA 2E74D 4NBDD 2DE5D 2BMRA 2ZT9D 3GTSA 2YFIA 4QUPA 3VCAA 3C0DA 2BMQA 1NDOA 5CXMA 4HM1A 2JZAA 4HM5A 3FOUA 1NTKE 2JO6A 4HM0A 2E4PA 4HM4A 4H0LD 4QDDA 4HM8A 4AAYB 1UUVA 1P84E 2B24A 3H1KE 2YVJB 2E76D 4QDFB 2FYUE 3L72E 5AEUA 1NTME 2DE6D 4HJLA 3L75E 3H1IE 2NWFA 4HM2A 2CKFA 4PD4E 2D2CD 2QPZA 2YIUC 4QCKA 2IBZE 3L74E 1EG9A 3GL2A 3VMGD 2XSOA 2FYNC 3GKEA 1G8KB 4U3FE 2XRXA 1NU1E 3GZXA 3CWBE 4HKVA 1SQPE 1VCKA 1Q90C 1BCCE 2NVGA 1SQVE 2QJYC 4NB8D 2DE7D 1O7MA 1BGYE 4NBHD 4NBAD 5KKZC 4QUQA 1O7WA 3H1HE 4P1BH 4QDCA 4QDFA 1PP9E 1L0NE 1JM1A 2Q3WA 3CX5E 3CXHE 5AEWA 1SQXE 1O7GA 2HMLA 2NVFA 4EMJB 1G8JB 3GL0A 2ZYLA 5KLVE 4AIVA 4P1CH 3N0QA 3GCEA 3VMID 1ULJA 1O7HA 4H13D 2GBXA 2A06E 3GB4A 1NTZE 1ZRTE 4NB9D 4OGQD 1SQBE 2E75D 3TGUE 1O7NA 3D89A 1RIEA 4D6TE 2QJPC 4NBCD 3AZCA 2YFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFJ A;  4HM6 A;  4NBG D;  4PV1 D;  4NBF D;  2B1X A;  3GZY A;  4HM7 A;  1NYK A;  1PPJ E;  3H1L E;  4H44 D;  4NBE D;  2BMO A;  2E4Q A;  5BOK A;  1KYO E;  2NVE A;  1EZV E;  1SQQ E;  2XR8 A;  3GTE A;  4QUR A;  1FQT A;  2GBW A;  1O7P A;  3EN1 A;  2HMJ A;  3L73 E;  1UUW A;  5HL4 A;  1WQL A;  2BCC E;  3VCP A;  1SJG A;  3VMH D;  2NUK A;  2XSH A;  2HMK A;  3BCC E;  1RFS A;  1L0L E;  1VM9 A;  1ULI A;  2HMN A;  3H1J E;  1VF5 D;  2HMO A;  2HMM A;  3EQQ A;  1BE3 E;  3DQY A;  3GOB A;  3L71 E;  3L70 E;  2QJK C;  4HM3 A;  5KLI C;  1KB9 E;  4NBB D;  2NUM A;  2I7F A;  2E74 D;  4NBD D;  2DE5 D;  2BMR A;  2ZT9 D;  3GTS A;  2YFI A;  4QUP A;  3VCA A;  3C0D A;  2BMQ A;  1NDO A;  5CXM A;  4HM1 A;  2JZA A;  4HM5 A;  3FOU A;  1NTK E;  2JO6 A;  4HM0 A;  2E4P A;  4HM4 A;  4H0L D;  4QDD A;  4HM8 A;  4AAY B;  1UUV A;  1P84 E;  2B24 A;  3H1K E;  2YVJ B;  2E76 D;  4QDF B;  2FYU E;  3L72 E;  5AEU A;  1NTM E;  2DE6 D;  4HJL A;  3L75 E;  3H1I E;  2NWF A;  4HM2 A;  2CKF A;  4PD4 E;  2D2C D;  2QPZ A;  2YIU C;  4QCK A;  2IBZ E;  3L74 E;  1EG9 A;  3GL2 A;  3VMG D;  2XSO A;  2FYN C;  3GKE A;  1G8K B;  4U3F E;  2XRX A;  1NU1 E;  3GZX A;  3CWB E;  4HKV A;  1SQP E;  1VCK A;  1Q90 C;  1BCC E;  2NVG A;  1SQV E;  2QJY C;  4NB8 D;  2DE7 D;  1O7M A;  1BGY E;  4NBH D;  4NBA D;  5KKZ C;  4QUQ A;  1O7W A;  3H1H E;  4P1B H;  4QDC A;  4QDF A;  1PP9 E;  1L0N E;  1JM1 A;  2Q3W A;  3CX5 E;  3CXH E;  5AEW A;  1SQX E;  1O7G A;  2HML A;  2NVF A;  4EMJ B;  1G8J B;  3GL0 A;  2ZYL A;  5KLV E;  4AIV A;  4P1C H;  3N0Q A;  3GCE A;  3VMI D;  1ULJ A;  1O7H A;  4H13 D;  2GBX A;  2A06 E;  3GB4 A;  1NTZ E;  1ZRT E;  4NB9 D;  4OGQ D;  1SQB E;  2E75 D;  3TGU E;  1O7N A;  3D89 A;  1RIE A;  4D6T E;  2QJP C;  4NBC D;  3AZC A;  2YFL A; 
#chains in the Genus database with same CATH topology
 4NPE A;  1T8Z A;  1NYK A;  4L74 A;  1SFC C;  5TJH A;  1KZU B;  1FZB A;  2SPZ A;  3IN6 A;  2FYN B;  3RK2 B;  3PH0 A;  4K3A A;  4GT1 A;  3MGN A;  2O3J A;  4Y99 C;  4PV1 C;  2E76 B;  1VM9 A;  1M1J A;  1FZE A;  2YKQ A;  1NU1 J;  1BCC G;  4ZNC A;  3CC2 P;  4LC1 A;  4NBB D;  1ZR4 A;  1OMI A;  1PP9 G;  2YKO A;  2FFD C;  2POH A;  1YJ9 P;  2CK3 H;  1QEX A;  3AEC C;  3CXH D;  5KJ7 D;  2IFM A;  1QVG O;  1HJB A;  2DE6 D;  1GU4 A;  1PZQ A;  1OX3 A;  1NWQ A;  1FBM A;  1SQQ K;  1EG9 A;  3RBZ A;  3WMM 0;  4I7Z C;  1AQT A;  3KZI E;  5B66 E;  2JP3 A;  1N2D C;  4ASV A;  2NPS A;  5B5E H;  3P8C E;  1VPC A;  2N1T D;  3Q1M A;  2WT7 B;  3HTK A;  1S3J A;  1CI6 A;  3AEG C;  3M91 A;  2Q3W A;  1H0T A;  1LTJ A;  4GIF A;  1SFC D;  3LW5 H;  1J1D B;  2KS1 A;  1O7H A;  3EFG A;  1N73 C;  2KZI A;  4JYC A;  1OVU A;  1J1E B;  1QGK B;  1YBK A;  2FYU K;  1EC5 A;  4PV1 D;  1LTS C;  1UII A;  2M5A B;  3KXD A;  2NVE A;  1KIL B;  1QLE D;  3HD7 C;  1JMM A;  3H32 A;  1EDK A;  2YXR B;  2R5D A;  2HMK A;  5CJ0 A;  1RQU A;  3BCC E;  3IR9 A;  4UB6 H;  3GG2 A;  1G2C A;  1URQ C;  3P32 A;  1SQX K;  2I7F A;  5CJ4 A;  3GHG B;  5KLV K;  1DH3 A;  2WPV B;  4HM5 A;  1OZH A;  1RHZ B;  4PD4 H;  1BSH A;  2JDI H;  2AEM A;  3L75 D;  2YKP A;  2WPS A;  1NVO A;  4BWN A;  5AEU A;  3L72 E;  3LID A;  2W83 C;  4HM2 A;  2R3S A;  2YNY A;  1QX8 A;  5CCH A;  1DEE G;  4N3Y B;  1NU1 E;  3H1H J;  4K35 A;  3M0A A;  1SQV E;  1YYC A;  3MP7 B;  1FE6 A;  4C7N B;  5APW A;  1HUC A;  3W67 A;  2N9B A;  1OVR A;  2C0W A;  4QDC A;  2PGD A;  3CX5 D;  3Q5R A;  2D2C C;  3L73 J;  1R5S A;  2WWW A;  1VQK P;  4IFF A;  1W5C E;  3U1C A;  3OJA B;  3TF5 A;  3HD7 D;  5DJU B;  1RF0 C;  2QRX A;  1YTZ I;  4NPD A;  3II6 A;  1LGH B;  1K73 Q;  3ABV C;  1M1J B;  4H44 D;  3CCV P;  5BOK A;  3AE9 C;  2QJK B;  1N7S D;  1URQ D;  3VMZ A;  4OVN F;  1RE3 C;  1L4A D;  1Q82 Q;  4OH8 B;  1YIT P;  1IJD B;  4I1L A;  2BCC E;  4ZMD A;  3L75 G;  2FFD A;  1M8O B;  4MN4 C;  3Q5S A;  4L75 A;  1KTM A;  3JC2 2;  1FZC A;  5AVT B;  3IF4 A;  3E1R A;  1T3J A;  2AXC A;  1HJ0 A;  3KQG A;  3GTS A;  2YFI A;  5BVZ A;  4WBA A;  1KYO I;  3A0B E;  3H1K J;  2Q9I A;  2E75 C;  3M9Q A;  5KAI H;  3M06 A;  2NPS B;  1IZN B;  4GKG A;  3BVH A;  1NTM E;  5APY A;  3H1I E;  1CI6 B;  4DZO A;  1H0T B;  5APU A;  4HB1 A;  2D2C D;  2KS1 B;  5AW8 B;  3S4R A;  4WY4 D;  1G8K B;  1ZXG A;  2WPQ A;  3AE3 C;  1KYO H;  2Q1K A;  1PGJ A;  2C0X A;  1Z56 A;  3I5C A;  4QUQ A;  3EFF K;  4JPZ B;  1Q2N A;  5TIS E;  5BU5 A;  4EMJ B;  5AVQ B;  5GTH E;  1ZRT D;  3H32 B;  1Q7Y Q;  2B89 A;  2QVA A;  1FZA A;  1KB9 D;  1HF9 A;  2W6B A;  1G2C B;  1PPJ E;  1PGQ A;  1URQ A;  3QWO C;  5AW3 B;  3TYY A;  4PJ0 E;  1DD4 A;  3L73 E;  1SQP K;  1IFD A;  4C46 A;  4XE5 B;  1IFP A;  1WQL A;  1G1I A;  2QJY B;  2HG5 D;  1RY3 A;  5AVU B;  1BE3 D;  3L71 D;  2HMO A;  3B4S A;  3FXE A;  2H7H A;  1JEK A;  1NTK J;  2NUM A;  2P7J A;  3AE1 C;  2M3B A;  2I1J A;  4I6M C;  2AXT H;  3FOU A;  3G6E P;  2E43 A;  4YPC A;  4ZKU A;  1GZL A;  5APX A;  3AEE C;  2I8D A;  2H43 A;  4ZKP A;  1SFC B;  2HOD A;  2KNC A;  3AE6 C;  1SQB D;  3CWB E;  2IYO A;  3NMD A;  1BCC E;  1JTH B;  1RF0 A;  1FZF A;  1L0N D;  5AW0 B;  2LXC B;  1VF5 C;  4Y99 B;  4QDF A;  1PP9 E;  1PGO A;  3IAO A;  3O6Q A;  1NGM B;  3P7K A;  4JQ0 D;  1RE3 A;  1ULJ A;  2FKW B;  3GB4 A;  3L71 G;  2FFD B;  3P8M C;  2QJP C;  1FZC B;  2B1X A;  2R44 A;  2P1J A;  5AW7 B;  3CCE P;  3MD0 A;  2E4Q A;  1KQF B;  3UIA A;  1FDI A;  2BCC G;  4IOI H;  3S1K A;  4I7Z B;  2JJL A;  2ZVN B;  3VMH D;  2JEE A;  3H1J D;  2OYO A;  5APS A;  5B66 H;  1JY2 O;  1S5L E;  4UB8 E;  3RGU A;  3CME P;  3TNU A;  1KC8 Q;  1P84 H;  2A45 H;  1L0N G;  1SQB K;  4L76 A;  2JWD A;  1LWU C;  1N73 B;  5E79 H;  1OW7 A;  2P10 A;  3SFE C;  4PD4 D;  2KZJ A;  3TDK A;  1D7M A;  2YMK A;  2E74 C;  1AVO A;  4U3F D;  3CCS P;  2E5T A;  1BGY D;  1JY3 P;  3D71 A;  2P58 A;  2HFE D;  3Q3D A;  1FOS F;  3AE2 C;  2O01 J;  1EXI A;  1O7G A;  2FXM A;  1URQ B;  1MV8 A;  3AE4 C;  3GHG A;  3TGU D;  1KV4 A;  2GBX A;  5AVX B;  3H1J G;  2KLU A;  3L70 G;  4LLH A;  5APT A;  5KJ7 C;  4RO0 A;  2LXB A;  3KHU A;  1N8R Q;  1FAV A;  3GTE A;  3VOP A;  4QUR A;  2IDB A;  3H6P A;  2IZ1 A;  2K3R A;  1YIJ P;  3I56 P;  3RBX A;  1OW8 A;  1EDJ A;  1FDO A;  2N1T C;  2IZ0 A;  2D2C B;  2HOD B;  2KNC B;  2E74 D;  1KQS O;  2KK7 A;  4YXD C;  3T97 A;  1BGY G;  1UIX A;  1OXZ A;  3G3Z A;  3L72 J;  3VN0 A;  2RMZ A;  2FYU D;  3SWF A;  2FY8 A;  1UUV A;  1AFO A;  4QDF B;  1FJP A;  1NHL A;  3L75 E;  3HE4 A;  3W68 A;  3CWB G;  1HWT C;  1Q86 Q;  3O6Q B;  3CI9 A;  1SQV J;  3PLN A;  3L4F A;  3TGU G;  3KDP B;  1GL2 C;  2H89 C;  3RL0 B;  1OIP A;  1JB0 J;  2KI7 B;  2IPP A;  1RF1 C;  1PIX A;  1RQV A;  2DE7 D;  1SQQ G;  4QMA A;  1L0L K;  1O7W A;  3RK3 D;  1VL2 A;  1SQX D;  3CCU P;  2M0B A;  4IFM A;  3CX5 E;  3WUU A;  5KLV D;  2HML A;  3HUS C;  1GMJ A;  2B9B A;  1VQP P;  2FBW C;  1H89 A;  1KN7 A;  4NB9 D;  2KLV A;  4OGQ D;  2OYH C;  2E75 B;  5KTB A;  3CCQ P;  1EXJ A;  1WRG A;  5H2F E;  4NBC D;  4TT3 H;  3A0B H;  3A0H H;  1OW6 A;  1H88 A;  4HM7 A;  2BCC J;  5AW1 B;  3TNU B;  1U7M A;  1FQT A;  3FWN A;  1NAF A;  4H13 C;  2P2U A;  2FYU G;  4N6J A;  5AW4 B;  3K5B A;  1R8E A;  3WU2 H;  2KUB A;  5KLI C;  3GF3 A;  1CZQ A;  2HPC A;  4JF7 A;  2BMR A;  3C0D A;  2MKV A;  1GL2 D;  5CXM A;  1NTZ K;  1NTM J;  3MIW A;  1HGV A;  1BSN A;  1NO4 A;  3H1I J;  5APV A;  1L2P A;  1SQX G;  2Q7C A;  2Z5H A;  5KLV G;  4HJL A;  2QE7 H;  3L74 D;  4H44 C;  3M9H A;  3D6Y A;  3MHV A;  1N7S C;  2QPZ A;  2OTL P;  1G1J A;  1L4A C;  3V5B A;  2YXQ B;  1BDD A;  3NTN A;  2ZVO B;  2ITA A;  1PFI A;  2WMM A;  3N7N A;  5KJ7 A;  2JWA A;  2Y9Z A;  2CPS A;  3KPE A;  4AQR D;  5KAF E;  4H13 D;  4D6T D;  1NTK K;  3H1J J;  1ZRT E;  2K9J A;  3L70 J;  3VMA A;  1M7L A;  1LT1 A;  3L36 A;  4KT0 J;  2N1T A;  1M56 D;  1EZV D;  1E5W A;  1JY3 O;  2CPB A;  4IL6 X;  1SFC A;  4WY4 C;  1IK7 A;  2FXP A;  3T97 B;  4KJM A;  3VP8 A;  1JTH A;  1S5L X;  1QL1 A;  1JUN A;  1RFS A;  2K1A A;  3L74 G;  1X9V A;  1VF5 B;  1BE3 E;  1GW3 A;  3HE4 B;  3L71 E;  2KXP B;  2G8Y A;  1KOR A;  4QUP A;  1LNQ A;  3P8C D;  3B5N D;  2XDJ A;  1P84 D;  1RF1 A;  2B87 A;  1AVY A;  2PP6 A;  3AE8 C;  2WSS H;  2QJP B;  2YVJ B;  1IFJ A;  2K88 A;  3CWB J;  1BCC J;  2MJZ A;  1XTG B;  2KB7 P;  1OFC X;  3AE5 C;  1SQP D;  3CLQ A;  2XSO A;  4D6T G;  2L5G B;  1Y47 A;  1PP9 J;  1ZN5 A;  4H0L C;  3GF7 A;  1NYH A;  1FC2 C;  1SQQ J;  2ZAE B;  4NBA D;  1EZV G;  1T6A A;  1L0N E;  1JY2 N;  3VMY A;  3CXH I;  5L8R J;  3B71 A;  5B5E E;  2A06 D;  2Y9Y A;  3EQ2 A;  1O7N A;  1LTT C;  2YMY A;  1LWU B;  1N73 A;  1Y8A A;  3R2P A;  5GTI H;  2FYZ A;  1AV1 A;  1HGZ A;  1IK9 A;  2WTY A;  2XR8 A;  2C9L Y;  2HPC B;  4N78 D;  2GUS A;  2O1J A;  3N4X A;  3HD7 A;  3RK2 D;  1IFM A;  1Q90 D;  3VCP A;  3GMA A;  3S9O A;  2R32 A;  4WVZ A;  1TU3 F;  3M0D C;  1S4X A;  4HJG H;  3H1J E;  3EQQ A;  2PFX A;  3L70 E;  4CPG A;  4JBZ A;  2KIK A;  1N7S A;  3ITK A;  2R5B A;  1L4A A;  2BMQ A;  1NDO A;  5AW2 B;  1GW4 A;  3M9B A;  3JCU E;  1YQ3 C;  3LIE A;  2V7Q J;  4H0L D;  1JOC A;  2P67 A;  2B24 A;  5DJT B;  1FZG A;  2HR3 A;  1DIP A;  4PD4 E;  3CCL P;  4QCK A;  3CC4 P;  2A06 G;  1J2J B;  3C9I A;  4W7Y A;  1S9K D;  4U3F E;  3GZX A;  3NFQ A;  2G3A A;  5AW9 B;  3D6Z A;  2K9J B;  4A7P A;  1YTZ T;  1BGY E;  5KKZ C;  5CCG D;  3GLM A;  2N1T B;  1GD2 E;  3FGA D;  1LTG C;  1GTW A;  1KQG B;  4WY4 A;  1XTC C;  2W8Z A;  3VMI D;  2Q6Q A;  2WSC H;  3TGU E;  3OA7 A;  1K05 A;  3H1L D;  4PV1 B;  4W7Z A;  2VRS A;  4Y28 J;  4NBE D;  3FX0 A;  1SQQ E;  2OAR A;  1S72 P;  1CW5 A;  1KIL D;  2V4H A;  3CX5 I;  1O7P A;  2HMJ A;  5AVV B;  1NU1 K;  1RE4 C;  1X22 A;  1SQV K;  2NUK A;  1BE3 G;  3V4Q A;  2XSH A;  1RF1 B;  2B87 B;  1ZV8 A;  2WSC J;  2OYI C;  2Y0C A;  3DQY A;  5CBN A;  3AEB C;  2QJK C;  2XND H;  1GU5 A;  1PL5 A;  3IFM A;  3HUS B;  4IL6 E;  1MZ9 A;  3L75 J;  3GW6 A;  2OYH B;  2WSF J;  4HM4 A;  1GK6 A;  1VQ6 P;  3OW2 O;  2FYU E;  3KZI H;  2IBZ D;  3F5H A;  1HTL C;  4XFJ A;  1SQB G;  4U7J A;  1SS1 A;  1QVF O;  2C9N Y;  4H13 B;  3V6I A;  3BRT B;  3QH9 A;  3KYQ A;  3H1H D;  2E5Y A;  3H1L G;  2K37 A;  4C7R A;  3VTP C;  3A5T A;  2O01 H;  3MZW B;  1LTJ C;  5AVS B;  3RK3 E;  3CXH E;  1SQX E;  1YJN P;  5KLI B;  1FJK A;  1M57 D;  5KLV E;  4AIV A;  4P1C H;  3HD7 B;  1X8Y A;  2Q3E A;  1K04 A;  3M0D A;  2W27 A;  3CCR P;  2HYN A;  4HM6 A;  2IYP A;  1NTM K;  2WZ7 A;  4H44 B;  1N7S B;  4DT0 A;  2GBW A;  1IFI A;  1L4A B;  2YO3 A;  2XNX A;  3C8V A;  2WSE J;  1L0L D;  3L35 A;  5BU8 B;  2Q3I A;  2IBZ G;  3RK3 C;  2K9Y A;  3AEA C;  3ZDM A;  2ZJS E;  3GOB A;  4BXL A;  2KOG A;  3C1L A;  5AVZ B;  4RES B;  1KB9 I;  2KSJ A;  1ZR2 A;  1T3U A;  3H1H G;  2BEQ D;  3PHL A;  4OGQ C;  2PRR A;  1LTI C;  1IC2 A;  3H1K D;  1VDF A;  2NPS D;  2ZYD A;  1HVV A;  1Q81 Q;  2AXT E;  1T2K D;  4U3F G;  2YIU C;  1GK4 A;  3MUD C;  3L74 E;  1LJ2 A;  4WY4 B;  3GKE A;  2OQQ A;  5AVY B;  4OWF A;  1AJY A;  4TLF A;  1PGP A;  1VQ5 P;  1W2E A;  4LGD E;  1ZLL A;  1MKM A;  5AEW A;  3F89 A;  1VQO P;  2IFN A;  1NTZ D;  1ZW0 A;  1L0L G;  2Z4E A;  1RE4 A;  2GUV A;  1WMK A;  3SWK A;  1RIE A;  4D6T E;  2YFJ A;  2OYI A;  1KYO D;  2NZ2 A;  2RN0 A;  3VP9 A;  1E79 H;  3EWK A;  1VQL P;  1EZV E;  1YJW P;  4ASW A;  3H1K G;  1MFZ A;  1BE3 J;  2R3C A;  3L71 J;  4H0L B;  1FZC C;  2KSE A;  4I2L C;  4IFD K;  5K5G B;  1ZP0 C;  1KD1 Q;  2XU6 A;  1M1K Q;  2M8R A;  5CCH D;  1NTK D;  4XA4 A;  1DX7 A;  2JZA A;  1AQ5 A;  3V2Q A;  3JSV C;  4QDD A;  4AAY B;  1P84 E;  1LWU A;  1MUU A;  2B88 A;  3V2R A;  3B8E B;  1BDC A;  1JMB A;  2ZT9 C;  1NTZ G;  1SQB J;  3GL2 A;  3VMG D;  5E79 E;  4HKZ H;  2IBZ I;  1SQP E;  1VCK A;  3BAT A;  1YQ4 C;  2Y0D A;  1L0N J;  1R5L A;  5TIS H;  1LT9 C;  3H1L J;  2ZFC A;  5GTH H;  1USE A;  2ZXX A;  4P1B H;  2L91 A;  4O9B A;  2NVF A;  2W6J H;  1G8J B;  4PD4 I;  2QM7 A;  1HBW A;  3LW5 J;  2QM8 A;  3WUV A;  3B5N C;  2A06 E;  1PV3 A;  3BAS A;  1FOS E;  4PJ0 H;  2YFL A;  3JCU H;  2BMO A;  1NTK G;  3G9R A;  1SLQ A;  1NH4 A;  4N78 E;  1UUW A;  1MFT A;  1VQ4 P;  1JNM A;  4Z1M H;  1LTA C;  3TSI A;  1WT6 A;  5KKZ B;  3Q2Y A;  3CL3 D;  1ZOY C;  3CD6 P;  2HMM A;  2ZYG A;  1N7L A;  2O01 N;  1OWA A;  4B86 A;  1KB9 E;  3MUD A;  2DE5 D;  2J59 M;  2J58 A;  2ZT9 D;  2OGU A;  1LTB C;  3PTZ A;  4GOF A;  1U57 A;  2JO1 A;  2E4P A;  1FDM A;  2QG4 A;  2DW3 A;  3USS A;  4BRY A;  1IFN A;  2NWF A;  4U3F J;  2CKF A;  4DJG A;  1QL2 A;  1YI2 P;  2RH0 A;  2FYN C;  3RK2 C;  3PRJ A;  1KFM A;  1BGY J;  4WWI A;  2XRX A;  2ZXE B;  1GL2 A;  1Q90 C;  4AUW A;  1S9K E;  1JY2 P;  1NJI Q;  2E76 C;  4NBH D;  2OYI B;  4EYY Q;  4JYB A;  3GL0 A;  3FXD A;  3RL0 C;  3TGU J;  4DOJ A;  4M3L A;  1L0L J;  3HUS A;  5M1B A;  3PJS K;  1SQB E;  2BAS A;  5AVR B;  2OYH A;  3SSU A;  1DEB A;  2YO2 A;  4NBG D;  4IL6 H;  3GZY A;  1X79 B;  3H1L E;  3A3Y B;  1KIL E;  1S5L H;  3A0H E;  4R4L A;  3E1I A;  3BCC D;  2JR8 A;  5EFW B;  2M3E A;  4UB8 H;  2W90 A;  1EDI A;  5CCG C;  1FU1 A;  1HH0 A;  4EI2 A;  2Z5I A;  3HTK B;  2KYV A;  3RL0 g;  1LTJ B;  2FXO A;  1NKN A;  1J1D C;  2LR2 A;  2E74 B;  2XV5 A;  3G4S P;  1RH5 B;  4HYT B;  3WU2 E;  3CXH H;  2FYU J;  2V7Q H;  4HM0 A;  3MTU E;  1K8A Q;  1LT9 A;  3L72 D;  1H8A A;  1J1E C;  2A45 G;  3Q5P A;  4HM8 A;  1VQ8 P;  5APQ A;  2E76 D;  2WVR A;  1Y9B A;  1KFN A;  2N9Y B;  4GOE A;  3D70 A;  1SQP G;  1KIL C;  1NTZ J;  2IBZ E;  4NPF X;  1NU1 D;  4HH2 A;  4EOT A;  3CPW O;  1SQV D;  2AEF A;  3RL0 D;  1VQ9 P;  4HKV A;  4UB6 E;  2J5U A;  1K9M Q;  1NOH A;  3B5N A;  2Q5U A;  1JO5 A;  1LP1 A;  1O7M A;  1SQX J;  3H1H E;  2OTJ P;  3RK3 B;  5KLV J;  1CSB A;  3GHG C;  2ZYL A;  3VYI A;  3BCC G;  3N0Q A;  4OGQ B;  5AW6 B;  2E75 D;  3D89 A;  2Y0E A;  4NBF D;  5CMZ A;  1VQM P;  1FS0 E;  2YIU B;  1AA0 A;  3HE5 A;  2BCC D;  3WUT A;  3SWY A;  2LKM A;  3L72 G;  3L37 A;  4DCK A;  1L0L E;  2HMN A;  3O8Z A;  4BRY B;  1NKZ B;  2WIT A;  1EQ7 A;  3HRN A;  1NU1 G;  4RJT A;  3A7O A;  2IX7 C;  2AEJ A;  1ZME C;  1SQV G;  3TK1 A;  3SFD C;  1EZV I;  1GL2 B;  4HM1 A;  2WSF H;  4YXW H;  1VQN P;  2UWJ E;  1NTM D;  2H88 C;  2I1K A;  3H1I D;  3L74 J;  3H1K E;  1M1J C;  2H8P D;  3E7K A;  2GM4 A;  2WQY C;  3U1A A;  3R4Y A;  3CMA P;  2QSI A;  1A02 F;  5C39 A;  3V2P A;  4NB8 D;  3CX5 H;  1SVF A;  2XZR A;  1EDL A;  3AEF C;  1JM0 A;  3CCJ P;  1KQL A;  2OTK E;  3PP5 A;  1JM1 A;  1P84 I;  2JKV A;  5KAI E;  4WB4 A;  5H2F H;  4EDF A;  4EIJ A;  2A45 I;  4D6T J;  2RKL A;  1X0T A;  3V4W A;  1YHQ P;  1NTZ E;  4AYC A;  2NPS C;  3I55 P;  1DD3 A;  3L70 D;  5CCG A;  1M90 Q;  3AZC A;  1A02 J;  1PPJ D;  1USD A;  2WT7 A;  3FWL A;  2NRG A;  1T2K C;  3OAK A;  1U7J A;  1NAY A;  1KYO E;  2ZT9 B;  3L73 D;  3EN1 A;  2WSE H;  1JCD A;  5GTI E;  5HL4 A;  1NTM G;  1SJG A;  3H1I G;  1LT9 B;  1OVV A;  5AW5 B;  3H25 A;  3BRV B;  1W2B O;  4RKU J;  1ULI A;  1SP4 A;  4R4M A;  1VF5 D;  1L0N K;  1S1C X;  2M5A A;  4HM3 A;  2ZYA A;  5AVW B;  4NBD D;  1KIL A;  2QEX P;  3CCM P;  2E42 A;  3VCA A;  3A2A A;  3CC7 P;  1NTK E;  2JO6 A;  3B5N B;  4KHX A;  2O1K A;  1LP1 B;  1VQ7 P;  3NXS A;  1SQP J;  1S2E A;  3CWB D;  1BCC D;  2HLO A;  2XKM A;  3VMX A;  2NVG A;  2W6A A;  1IO4 A;  2QJY C;  4YTP C;  1PPJ G;  1PP9 D;  3U59 A;  1SQQ D;  5KAF H;  2QA4 P;  5CBO A;  2GA1 A;  3L73 G;  1JCC A;  4GOD A;  5CCH C;  2BEZ F;  3V2N A;  2QIW A;  3G71 P;  3HE5 B;  2WPR A;  1JY3 N;  3BCC J;  2PAJ A;  4W80 A;  3AE7 C;  4L73 A;  4GDO A;  3GCE A;  1KB9 H;  3AED C;  1KMI Z;  4C7N A;  1GDT A;  5CHX A;  1N86 A;  2KP8 A; 
#chains in the Genus database with same CATH homology
 2YFJ A;  4HM6 A;  4NBG D;  4PV1 D;  4NBF D;  2B1X A;  3GZY A;  4HM7 A;  1NYK A;  1PPJ E;  3H1L E;  4H44 D;  4NBE D;  2BMO A;  2E4Q A;  5BOK A;  1KYO E;  2NVE A;  1EZV E;  1SQQ E;  2XR8 A;  3GTE A;  4QUR A;  1FQT A;  2GBW A;  1O7P A;  3EN1 A;  2HMJ A;  3L73 E;  1UUW A;  5HL4 A;  1WQL A;  2BCC E;  3VCP A;  1SJG A;  3VMH D;  2NUK A;  2XSH A;  2HMK A;  3BCC E;  1RFS A;  1L0L E;  1VM9 A;  1ULI A;  2HMN A;  3H1J E;  1VF5 D;  2HMO A;  2HMM A;  3EQQ A;  1BE3 E;  3DQY A;  3GOB A;  3L71 E;  3L70 E;  2QJK C;  4HM3 A;  5KLI C;  1KB9 E;  4NBB D;  2NUM A;  2I7F A;  2E74 D;  4NBD D;  2DE5 D;  2BMR A;  2ZT9 D;  3GTS A;  2YFI A;  4QUP A;  3VCA A;  3C0D A;  2BMQ A;  1NDO A;  5CXM A;  4HM1 A;  2JZA A;  4HM5 A;  3FOU A;  1NTK E;  2JO6 A;  4HM0 A;  2E4P A;  4HM4 A;  4H0L D;  4QDD A;  4HM8 A;  4AAY B;  1UUV A;  1P84 E;  2B24 A;  3H1K E;  2YVJ B;  2E76 D;  4QDF B;  2FYU E;  3L72 E;  5AEU A;  1NTM E;  2DE6 D;  4HJL A;  3L75 E;  3H1I E;  2NWF A;  4HM2 A;  2CKF A;  4PD4 E;  2D2C D;  2QPZ A;  2YIU C;  4QCK A;  2IBZ E;  3L74 E;  1EG9 A;  3GL2 A;  3VMG D;  2XSO A;  2FYN C;  3GKE A;  1G8K B;  4U3F E;  2XRX A;  1NU1 E;  3GZX A;  3CWB E;  4HKV A;  1SQP E;  1VCK A;  1Q90 C;  1BCC E;  2NVG A;  1SQV E;  2QJY C;  4NB8 D;  2DE7 D;  1O7M A;  1BGY E;  4NBH D;  4NBA D;  5KKZ C;  4QUQ A;  1O7W A;  3H1H E;  4P1B H;  4QDC A;  4QDF A;  1PP9 E;  1L0N E;  1JM1 A;  2Q3W A;  3CX5 E;  3CXH E;  5AEW A;  1SQX E;  1O7G A;  2HML A;  2NVF A;  4EMJ B;  1G8J B;  3GL0 A;  2ZYL A;  5KLV E;  4AIV A;  4P1C H;  3N0Q A;  3GCE A;  3VMI D;  1ULJ A;  1O7H A;  4H13 D;  2GBX A;  2A06 E;  3GB4 A;  1NTZ E;  1ZRT E;  4NB9 D;  4OGQ D;  1SQB E;  2E75 D;  3TGU E;  1O7N A;  3D89 A;  1RIE A;  4D6T E;  2QJP C;  4NBC D;  3AZC A;  2YFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...