3H1LE

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1lE02
2XRXA 1KYOE 2BMQA 4NBDD 4HM0A 5CXMA 2E4QA 3CX5E 2XSHA 4NBCD 3AZCA 2NWFA 1SQBE 1ULJA 3GZXA 1EZVE 2YVJB 4PV1D 4QURA 5HL4A 2FYUE 1O7WA 2ZYLA 4NBAD 4HM6A 4H0LD 4QDCA 5KKZC 4HJLA 5AEWA 2HMKA 4AIVA 1L0NE 3L72E 2QJYC 3L74E 3D89A 3H1HE 1O7HA 2B24A 2XSOA 4NBBD 1UUVA 2HMMA 4NB8D 2FYNC 1SQXE 4NBED 1NYKA 1BE3E 3FOUA 4NBFD 3H1LE 2E75D 3DQYA 1RIEA 2HMLA 2Q3WA 2XR8A 4HM2A 1ULIA 4P1CH 3CXHE 1ZRTE 4H13D 4QDFB 1L0LE 4PD4E 4QCKA 5KLIC 3L73E 3TGUE 2GBXA 3GKEA 1NTZE 4NBHD 3BCCE 4H44D 2QJKC 1O7GA 2GBWA 3GCEA 4HM5A 2DE5D 3CWBE 5KLVE 2B1XA 2I7FA 1SQQE 3VMHD 4EMJB 5AEUA 2HMNA 3L71E 2NUKA 1UUWA 1PP9E 4NB9D 3VMID 2CKFA 4QDFA 1O7MA 3GTSA 2BCCE 3GB4A 1G8KB 3N0QA 5BOKA 3H1IE 4U3FE 1EG9A 1RFSA 1NTKE 2NUMA 2YFJA 2DE6D 4QDDA 2NVGA 3GL0A 2JZAA 4HM4A 4AAYB 2HMOA 2JO6A 2E76D 4OGQD 1BGYE 4HKVA 3H1JE 2D2CD 2QPZA 1SQPE 1VF5D 3GZYA 2YIUC 3EQQA 4D6TE 2HMJA 4QUPA 3VCPA 2YFLA 1P84E 2BMOA 4QUQA 2IBZE 3L70E 4NBGD 4HM3A 4HM1A 1NTME 1SJGA 2E4PA 4HM7A 3L75E 1VCKA 3GOBA 2BMRA 2QJPC 1BCCE 3GL2A 2NVFA 1WQLA 2NVEA 3EN1A 1PPJE 3C0DA 2ZT9D 2E74D 1JM1A 3VMGD 4HM8A 1G8JB 1NU1E 3VCAA 1NDOA 3GTEA 1SQVE 1O7NA 1VM9A 2DE7D 1O7PA 4P1BH 3H1KE 1FQTA 1Q90C 2YFIA 2A06E 1KB9E
chains in the Genus database with same CATH superfamily
2FYUG 3AE4C 4NBCD 1ULJA 1GZLA 1LWUC 1PPJG 4QURA 1SQBK 2XNDH 3M06A 3L4FA 3Q3DA 2L91A 4YPCA 1O7HA 2B24A 1VDFA 2KSEA 1SQXD 3A2AA 2Q3WA 1GL2D 1KQFB 5APTA 4QCKA 3TGUE 3MP7B 5KLVG 1KD1Q 1VL2A 1NTZD 3U1AA 2H43A 3D6ZA 4PJ0E 4RESB 2WVRA 1YBKA 5B5EE 5CJ4A 1M8OB 3KQGA 1SQQD 1PP9E 1NTKJ 4GT1A 1PGOA 1Z56A 3BRTB 5BOKA 3H1ID 1NTKK 5CHXA 4EDFA 1USDA 3CWBG 2FXOA 3HUSB 3IF4A 3CCRP 2FFDA 1FJKA 4QUQA 4D6TD 1NVOA 2GUVA 3G9RA 1HBWA 3W67A 1VQPP 1FZEA 1BCCD 2PP6A 4DT0A 4HM8A 5APYA 1FZCC 3SSUA 1LTSC 3HTKB 2QJYB 3VP8A 3VMHD 3JCUE 1NYHA 2E4QA 2ZJSE 2NRGA 2MJZA 3MUDA 3RL0D 2UWJE 1ZP0C 3HD7D 2JEEA 3AE1C 1H88A 1SQXG 3CXHH 2P7JA 3H1LE 2MKVA 4TLFA 2M5AA 2HMLA 3KDPB 1HH0A 5AW2B 1OXZA 1X8YA 1L0LE 2JWDA 3TF5A 1LTJA 5CBOA 3TGUD 1RF0C 4NBHD 2E75C 1SQQG 1O7GA 3WU2E 2P2UA 2HODA 2HMNA 2JKVA 3H1IG 1OVUA 1PP9D 2W6AA 3GB4A 1KQLA 4U3FE 2YFJA 2OYHC 1EDKA 1KILC 2C0WA 2Q1KA 1S9KE 1S2EA 4D6TG 2QG4A 5AW4B 2CPSA 1BDCA 4KHXA 1URQD 1KILE 1S4XA 2AEFA 1SQPK 2ZT9C 2NPSA 4KT0J 1BCCG 2B87B 1ZOYC 1W2BO 3D70A 2QJPC 2NVFA 1VPCA 3B5NA 1EDIA 4XA4A 1KB9H 1K9MQ 1NU1E 2KNCA 1SQVE 1YJNP 4IFFA 2BMQA 4NBDD 3CCEP 1YHQP 1LGHB 1TU3F 2HMKA 3RK3C 3L74E 1VQNP 2WQYC 5KAFE 2R32A 4R4MA 2HFED 1ZV8A 1YTZI 3B4SA 3T97B 2H8PD 4P1CH 3H1LD 1Q82Q 3TGUG 1ZMEC 2ZVNB 1L0LD 3CC4P 2FXMA 3H1JJ 1XTGB 4WY4C 2K88A 2E76B 3BCCE 1DH3A 1W5CE 1P84I 3AEEC 1PP9G 3U59A 3AE5C 4Y99C 5AW5B 1SVFA 1YI2P 1NWQA 1R5SA 1L4AB 2PGDA 2DE6D 4U3FD 4Y28J 3FGAD 4LLHA 1MUUA 1P84H 1RE4C 2YMKA 1S9KD 3PHLA 2D2CD 1NKNA 1RHZB 3CPWO 4QUPA 1KILD 2IBZE 3L70E 2WSEJ 5KTBA 3L72J 1CZQA 2GUSA 2ZT9D 4U7JA 1G8JB 2OTKE 4UB6H 4ZKUA 1NU1D 1SQVD 1VQOP 3TNUB 2KSJA 1MFZA 2YVJB 1LTIC 4H0LB 1FAVA 2OYOA 5CCHD 2ZYLA 4NBAD 2K9JB 4HJLA 1OVRA 3USSA 1HF9A 1WMKA 2KP8A 3L71J 3L74D 2K9YA 1KQSO 1U7MA 5AVVB 1FBMA 4LC1A 1NYKA 3CCSP 4QMAA 2W90A 1L0LG 3D6YA 1XTCC 4H13B 1LTJC 1ZRTE 3R2PA 3HD7A 4BWNA 3O6QB 3L73E 4XE5B 2YKQA 1FU1A 2Z5IA 2E43A 1LWUA 4H44B 1IO4A 1PGPA 2Q3EA 2ITAA 2WPRA 3MTUE 5DJUB 1IK9A 1JTHB 3BCCD 2HLOA 4OH8B 4WY4D 2CKFA 2JO1A 4HJGH 2O01H 1A02J 1R5LA 2ZFCA 3HUSC 3AE3C 1QX8A 2OQQA 1AJYA 4AAYB 1OWAA 2A45I 1KFMA 1VF5B 1M1JC 2QPZA 2ZYGA 3VTPC 3NTNA 3EQQA 1Y47A 2FYUJ 3V4QA 3AEDC 4HM3A 2ZXXA 2FBWC 2YO2A 3M91A 1J1EB 2IBZD 3L70D 2E4PA 1CI6B 1NU1G 1SQVG 2A45H 1URQA 3VCAA 3P8MC 2IDBA 2W8ZA 5H2FE 3WUUA 2HPCB 2LXCB 1SLQA 1ZXGA 1S5LE 2JR8A 1N7SB 5CXMA 3L74G 1KZUB 3RK2B 3CLQA 4BRYA 3P7KA 1RF1A 2IZ0A 4L73A 3HE5B 2PRRA 1SFCB 1UUVA 2AXCA 4NB8D 1FZCA 1T6AA 2YMYA 2P58A 3DQYA 4GIFA 3R4YA 1IFJA 2R3SA 1L0NG 4QDFB 1ZRTD 3BCCG 3FX0A 3M0DC 1FJPA 2VRSA 3L73D 3CWBJ 1GW3A 1IZNB 1AVOA 4M3LA 1G2CA 3FWNA 1GL2C 5AVQB 2GA1A 1SS1A 1E5WA 3V2RA 3BASA 2NUKA 2DW3A 3D71A 2BEZF 1MZ9A 5GTIH 2P1JA 2BCCE 1OVVA 2I1JA 1GMJA 1K05A 2Y9YA 2AEJA 4OGQB 3HRNA 2IBZG 3L70G 5C39A 3GZYA 2B89A 2SPZA 2IX7C 4W80A 4NBGD 1SJGA 1QGKB 2KYVA 2G3AA 2KZJA 4I7ZB 3AE9C 5AVUB 2J5UA 4OVNF 4YXWH 1JMMA 1KILA 4PD4I 2XSHA 1FC2C 2NWFA 1SQBE 4B86A 1FZFA 4ASVA 1N7LA 1G1IA 3G71P 4AIVA 1NKZB 4KJMA 1SQQJ 2KLUA 3P8CE 1NOHA 1PIXA 1MKMA 3RBZA 3NFQA 1S72P 1EXIA 4PD4H 2P67A 3N4XA 1HUCA 1U57A 2IFNA 1M56D 2YNYA 2FFDB 3HD7C 4MN4C 3CXHE 3S1KA 2Y0DA 1LTGC 3GKEA 4D6TJ 2YKPA 2Y9ZA 5TISH 1J1DC 2WSCJ 4C7NB 2Z4EA 4YXDC 4W7ZA 3S9OA 3QH9A 3GTSA 1LT9C 1NTKE 2NUMA 2BCCD 1H8AA 2KS1B 2OYIB 3O8ZA 4TT3H 2C0XA 3CI9A 2HMOA 3TK1A 4WY4A 1FDOA 5BU8B 2Q3IA 5AVWB 4IL6H 2M5AB 1ZR2A 1UIIA 3UIAA 4HM7A 1NAYA 3V2QA 2QSIA 1URQC 2E74B 3I56P 3EN1A 2NZ2A 3VMYA 3GTEA 1OW6A 3GLMA 3PTZA 1RE4A 3PLNA 2QRXA 1HTLC 2WPQA 1KB9E 3NMDA 3V6IA 1KN7A 1JY2P 2QVAA 2BEQD 3AZCA 1H0TA 5L8RJ 2C9LY 1JY2N 1SQBD 1RF1C 1GU5A 1N73C 2QM8A 3D89A 3CD6P 2WMMA 1PP9J 3P8CD 2HMMA 4JYCA 3CXHI 3LW5J 4N78E 2Z5HA 3MIWA 4HM2A 2NPSB 1OMIA 4RJTA 1KC8Q 1HWTC 2W83C 3CXHD 5KLIC 3IFMA 1GU4A 3HE4B 3B5NB 4K35A 1K73Q 4HM5A 3WUVA 1Q81Q 4HYTB 2WSFJ 1RE3C 2BCCG 2M3EA 4HB1A 1FDIA 3CCMP 2RN0A 1VF5C 1NTZG 1N8RQ 1NTKD 2JZAA 5BU5A 2WT7B 3IAOA 1KFNA 1SQPE 3CX5I 4A7PA 2YIUC 1NTMJ 1P84E 4L76A 2KOGA 5AVRB 3GOBA 1NTMK 2D2CC 2J58A 1K04A 2XKMA 1OW8A 1QL2A 3HUSA 2P10A 1KB9I 3CX5H 3VMZA 3K5BA 1RQVA 3W68A 1L0LJ 1M1JA 2B88A 3C1LA 4UB6E 1KB9D 4JF7A 2AEMA 2WWWA 2FYNB 1SFCC 3M9QA 4H0LD 3H1HJ 3M9BA 5APXA 2FY8A 2R3CA 3MHVA 3HTKA 1M1KQ 5CCHC 1JCCA 3KPEA 5CCGD 1KTMA 4N78D 3EFFK 3CCJP 4H13D 1OIPA 1FOSF 4CPGA 1WT6A 4H44D 3Q5PA 2R44A 2B1XA 1N2DC 3TYYA 1NTKG 4K3AA 1O7MA 5AW9B 1KV4A 3E7KA 1SQVJ 3F5HA 3GL0A 2I1KA 3M0AA 1JY3P 3M0DA 1DD4A 1Q86Q 3SWKA 1VF5D 1KMIZ 1SQPD 1JY3N 2BMOA 1GL2A 5AW7B 3GF3A 1P84D 5KAIH 1GK4A 3L74J 4I2LC 1PV3A 4C7RA 3RGUA 1Y9BA 2RMZA 1NDOA 1KYOH 4NPEA 3H1KE 4I1LA 2B87A 2N1TB 4HM0A 1JOCA 1N7SD 3ZDMA 1OW7A 1EZVE 1L0NJ 2M0BA 1NHLA 3RK2D 2O1KA 3KXDA 2HG5D 1X0TA 1L0NK 3SFDC 3TDKA 1BE3J 4JYBA 2XSOA 1SFCD 1T2KC 2LR2A 1NJIQ 4GDOA 1L2PA 3PRJA 2H89C 1OFCX 2IYOA 4L74A 1BSNA 1CSBA 1AQTA 3H1LG 2I7FA 3G6EP 4DOJA 5APVA 4AYCA 2OYIC 2KI7B 4NB9D 2W6JH 3GF7A 1FZAA 1LTTC 2KIKA 5AVXB 2R5DA 1NO4A 2NVGA 1KQGB 2W6BA 1SQPG 5GTIE 3GMAA 1VQ6P 2QM7A 5E79E 3PJSK 4OGQD 2ZAEB 1Y8AA 1T3JA 4WB4A 3L75J 2E74C 1Q2NA 4U3FG 3EQ2A 4HM1A 1HGVA 4DZOA 2WZ7A 5APSA 1FDMA 1PPJE 4AUWA 1AVYA 1LT9A 2M3BA 2WPVB 3GHGB 4W7YA 2DE7D 3BRVB 1FQTA 3FXEA 3OA7A 1EZVI 3AEBC 3H1KD 3E1RA 2WSEH 2Q9IA 3I55P 4PV1B 5GTHH 4JPZB 3CCQP 3H32B 1EZVD 4HM6A 2FYUK 2QJYC 2XDJA 2PFXA 3CL3D 3TNUA 3A0HH 3F89A 3L37A 3C8VA 2E75B 4N3YB 3IN6A 1J2JB 1T2KD 2H7HA 4PD4E 1DIPA 3PH0A 4I6MC 2YXRB 2H88C 5KLVJ 2POHA 2OYHB 3CWBE 3AE7C 1N73A 2O1JA 3MGNA 1KILB 5KLVK 3IR9A 1FOSE 5TISE 5BVZA 3GW6A 1EG9A 2V7QJ 1IFDA 4UB8H 1JTHA 2JDIH 2QJPB 4HKZH 1BGYE 4XFJA 1LP1A 2HMJA 3B8EB 3MZWB 3VP9A 1RE3A 4HH2A 1VCKA 5E79H 2O3JA 2Q6QA 1WQLA 4IL6E 1JO5A 2E74D 3VMGD 3VMXA 1LNQA 1PPJD 3H1KG 2A45G 1ZN5A 1DX7A 3RK3B 2K3RA 2YFIA 2KZIA 2A06E 1EZVG 1HGZA 2JP3A 2N9YB 1BDDA 2B9BA 1CI6A 2AXTH 1JB0J 3A0BH 2Q7CA 1FE6A 1QEXA 4QDCA 1EC5A 3AE6C 1LTAC 2HPCA 1SQXJ 1VQ7P 4WBAA 1WRGA 1NH4A 4NBFD 1H89A 1SQXK 5APUA 2QEXP 1USEA 4Y99B 1NTZJ 1MFTA 4PD4D 1LJ2A 3HE5A 1SFCA 5B66H 2RH0A 1ZLLA 2GBWA 1NTZK 4R4LA 5M1BA 1S1CX 2E5YA 3CWBD 4N6JA 1SQQK 1UUWA 4NPDA 3H1IJ 5AW6B 4QDFA 5CCHA 3L73G 1X22A 2E76C 2YKOA 2LXBA 3WMM0 1DD3A 1BGYD 1L4AC 1FZGA 1BCCJ 3VOPA 1X9VA 5CMZA 2GM4A 2HYNA 2N1TC 1S5LX 2Y0EA 1YJ9P 2IYPA 2XRXA 2A06D 1KORA 1GK6A 3CX5E 3FXDA 1HJBA 1O7WA 3A7OA 3RBXA 1LTJB 5KJ7D 1LTBC 1K8AQ 4NPFX 5KKZB 4YTPC 4NBED 2HODB 2PAJA 4H0LC 3S4RA 3L36A 3A3YB 1JMBA 4IOIH 1CW5A 3TGUJ 1IC2A 3VMAA 4GOFA 1YQ4C 2OARA 5TJHA 4EYYQ 5CCGC 3RL0g 3GCEA 1OZHA 5AW0B 2DE5D 2C9NY 1Q7YQ 4H13C 3GG2A 1M1JB 2WPSA 1HJ0A 4H44C 5DJTB 3N0QA 3MD0A 4JQ0D 3G3ZA 4IL6X 1BGYG 2WITA 1JM0A 5AW8B 4DJGA 2E76D 2WSCH 2KNCB 1YTZT 4C7NA 1ZW0A 1A02F 1PGQA 5APWA 3VCPA 3VYIA 3H25A 4RO0A 4JBZA 4GOEA 2N9BA 3GHGC 1NTME 2KS1A 2XNXA 2OYIA 3ABVC 1VQ9P 1X79B 2BMRA 2QA4P 2FKWB 1L4AD 3C0DA 1JM1A 1PGJA 4LGDE 5KAIE 1EDJA 2A06G 4PV1C 4P1BH 2R5BA 1JEKA 1J1EC 2G8YA 4IFMA 1KYOE 1BSHA 5EFWB 2N1TD 1IFIA 3CX5D 4RKUJ 2OTLP 4OWFA 3Q1MA 3A5TA 1DEBA 3H1HE 1N7SC 4NBBD 3H1LJ 5AVSB 1SP4A 3RK2C 1SQBG 2HR3A 1GL2B 1T8ZA 4PJ0H 2IPPA 1L0LK 5B5EH 1SQPJ 2QIWA 3AEAC 4ZNCA 1VQ5P 3LW5H 5CJ0A 3CMAP 2QJKB 5AVYB 1U7JA 4U3FJ 2YXQB 1PZQA 3LIEA 1AV1A 1GD2E 3HE4A 3FWLA 1VQLP 1LT1A 3BVHA 3C9IA 3Q5SA 1YYCA 3H1JE 1YITP 2WSFH 2QE7H 4WWIA 3JC22 1MV8A 1RQUA 5AW3B 1M90Q 1VQKP 1NTMD 4OGQC 4EI2A 2FYZA 1NU1J 2OTJP 3OW2O 3CCVP 2XU6A 1JY2O 2WT7A 3JCUH 1O7PA 1NU1K 1KYOI 3RK3E 1HVVA 1SQVK 3SFEC 1Q90C 1RH5B 4I7ZC 1KYOD 3RL0B 4PV1D 1YIJP 2Q5UA 5CBNA 3AE2C 3ITKA 3HD7B 1L0NE 3AE8C 3L72E 5GTHE 1LWUB 1QLED 3H1HD 3WUTA 1BE3E 3FOUA 4GKGA 1EXJA 2E75D 1RIEA 4IFDK 4GODA 1IK7A 1J1DB 3A0HE 3LIDA 1OX3A 2ZYDA 2ZVOB 4AQRD 3WU2H 2O01J 1JUNA 2I8DA 3BCCJ 5KJ7A 4Z1MH 2GBXA 3JSVC 3L35A 1LT9B 3M9HA 5K5GB 2FFDC 2V4HA 3II6A 1NAFA 4EMJB 5AEUA 2L5GB 5AW1B 3L71E 1D7MA 1S3JA 1G8KB 3CC7P 2K1AA 2ZYAA 2KUBA 4HM4A 1QVFO 3H1KJ 4L75A 1URQB 3T97A 4ZKPA 1RY3A 3L70J 4UB8E 3H1JD 1NTMG 1R8EA 3CCLP 2YFLA 3MUDC 1DEEG 3H6PA 3L75E 2Y0CA 2NVEA 3V5BA 4WVZA 1IFNA 5APQA 4BRYB 2CPBA 1RF1B 2BASA 4BXLA 1N73B 3RK3D 1M57D 2XV5A 1FZCB 2J59M 1L4AA 3GZXA 2IZ1A 1IJDB 3I5CA 2FYUE 5KAFH 3KZIE 1Q90D 2JJLA 2ZXEB 3H1HG 3NXSA 5KKZC 4ASWA 1QL1A 2YO3A 2AXTE 3A0BE 1L0ND 3L72D 3B71A 5KLIB 1QVGO 3KHUA 1EDLA 1G2CB 3QWOC 3PP5A 1GW4A 3SWYA 1GTWA 2N1TA 1LP1B 2RKLA 1BE3D 3OAKA 3AEGC 3L73J 2IFMA 1PL5A 2E5TA 2O01N 2E42A 2K37A 3AEFC 2KXPB 3SWFA 1FS0E 1FZBA 2IBZI 5KLVE 2NPSC 4C46A 5B66E 3L71D 3VMID 3V2NA 3B5NC 1JY3O 2YIUB 2K9JA 1RFSA 3Q5RA 1T3UA 1YQ3C 2XZRA 1M7LA 3P32A 3H1JG 2KK7A 2D2CB 2M8RA 5CCGA 3N7NA 5AVTB 1AFOA 2OGUA 3O6QA 3VN0A 3Q2YA 2CK3H 3L75D 3GL2A 4O9BA 1ZR4A 2ZT9B 3OJAB 2JWAA 3EFGA 1VM9A 1VQMP 2WSSH 1N86A 3BATA 3L72G 1AQ5A 5HL4A 3GHGA 2FYUD 5AEWA 4EIJA 3V4WA 1PFIA 3KYQA 1VQ4P 1BE3G 2LKMA 2FXPA 2FYNC 1SQXE 1E79H 4DCKA 3KZIH 2XR8A 2W27A 1ULIA 3H32A 3CC2P 5KJ7C 1IFMA 3EWKA 1BGYJ 1NTZE 2QJKC 3L71G 1RF0A 1GDTA 1SQQE 5KLVD 1JNMA 4WY4B 1N7SA 2BCCJ 3CCUP 2KB7P 2NPSD 3H1IE 4ZMDA 1UIXA 1YJWP 4QDDA 1EQ7A 2KLVA 2OYHA 3CMEP 3B5ND 3V2PA 2JO6A 1W2EA 4HKVA 4EOTA 4D6TE 3L75G 3TSIA 3G4SP 3U1CA 1G1JA 2V7QH 3E1IA 5H2FH 1BCCE 1H0TB 1NGMB 1IFPA 1S5LH 3AECC 1VQ8P 5AVZB 1O7NA 1AA0A 3RL0C 2WTYA 1JCDA 1SQBJ
chains in the Genus database with same CATH topology
2XRXA 1KYOE 2BMQA 4NBDD 4HM0A 5CXMA 2E4QA 3CX5E 2XSHA 4NBCD 3AZCA 2NWFA 1SQBE 1ULJA 3GZXA 1EZVE 2YVJB 4PV1D 4QURA 5HL4A 2FYUE 1O7WA 2ZYLA 4NBAD 4HM6A 4H0LD 4QDCA 5KKZC 4HJLA 5AEWA 2HMKA 4AIVA 1L0NE 3L72E 2QJYC 3L74E 3D89A 3H1HE 1O7HA 2B24A 2XSOA 4NBBD 1UUVA 2HMMA 4NB8D 2FYNC 1SQXE 4NBED 1NYKA 1BE3E 3FOUA 4NBFD 3H1LE 2E75D 3DQYA 1RIEA 2HMLA 2Q3WA 2XR8A 4HM2A 1ULIA 4P1CH 3CXHE 1ZRTE 4H13D 4QDFB 1L0LE 4PD4E 4QCKA 5KLIC 3L73E 3TGUE 2GBXA 3GKEA 1NTZE 4NBHD 3BCCE 4H44D 2QJKC 1O7GA 2GBWA 3GCEA 4HM5A 2DE5D 3CWBE 5KLVE 2B1XA 2I7FA 1SQQE 3VMHD 4EMJB 5AEUA 2HMNA 3L71E 2NUKA 1UUWA 1PP9E 4NB9D 3VMID 2CKFA 4QDFA 1O7MA 3GTSA 2BCCE 3GB4A 1G8KB 3N0QA 5BOKA 3H1IE 4U3FE 1EG9A 1RFSA 1NTKE 2NUMA 2YFJA 2DE6D 4QDDA 2NVGA 3GL0A 2JZAA 4HM4A 4AAYB 2HMOA 2JO6A 2E76D 4OGQD 1BGYE 4HKVA 3H1JE 2D2CD 2QPZA 1SQPE 1VF5D 3GZYA 2YIUC 3EQQA 4D6TE 2HMJA 4QUPA 3VCPA 2YFLA 1P84E 2BMOA 4QUQA 2IBZE 3L70E 4NBGD 4HM3A 4HM1A 1NTME 1SJGA 2E4PA 4HM7A 3L75E 1VCKA 3GOBA 2BMRA 2QJPC 1BCCE 3GL2A 2NVFA 1WQLA 2NVEA 3EN1A 1PPJE 3C0DA 2ZT9D 2E74D 1JM1A 3VMGD 4HM8A 1G8JB 1NU1E 3VCAA 1NDOA 3GTEA 1SQVE 1O7NA 1VM9A 2DE7D 1O7PA 4P1BH 3H1KE 1FQTA 1Q90C 2YFIA 2A06E 1KB9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRX A;  1KYO E;  2BMQ A;  4NBD D;  4HM0 A;  5CXM A;  2E4Q A;  3CX5 E;  2XSH A;  4NBC D;  3AZC A;  2NWF A;  1SQB E;  1ULJ A;  3GZX A;  1EZV E;  2YVJ B;  4PV1 D;  4QUR A;  5HL4 A;  2FYU E;  1O7W A;  2ZYL A;  4NBA D;  4HM6 A;  4H0L D;  4QDC A;  5KKZ C;  4HJL A;  5AEW A;  2HMK A;  4AIV A;  1L0N E;  3L72 E;  2QJY C;  3L74 E;  3D89 A;  3H1H E;  1O7H A;  2B24 A;  2XSO A;  4NBB D;  1UUV A;  2HMM A;  4NB8 D;  2FYN C;  1SQX E;  4NBE D;  1NYK A;  1BE3 E;  3FOU A;  4NBF D;  3H1L E;  2E75 D;  3DQY A;  1RIE A;  2HML A;  2Q3W A;  2XR8 A;  4HM2 A;  1ULI A;  4P1C H;  3CXH E;  1ZRT E;  4H13 D;  4QDF B;  1L0L E;  4PD4 E;  4QCK A;  5KLI C;  3L73 E;  3TGU E;  2GBX A;  3GKE A;  1NTZ E;  4NBH D;  3BCC E;  4H44 D;  2QJK C;  1O7G A;  2GBW A;  3GCE A;  4HM5 A;  2DE5 D;  3CWB E;  5KLV E;  2B1X A;  2I7F A;  1SQQ E;  3VMH D;  4EMJ B;  5AEU A;  2HMN A;  3L71 E;  2NUK A;  1UUW A;  1PP9 E;  4NB9 D;  3VMI D;  2CKF A;  4QDF A;  1O7M A;  3GTS A;  2BCC E;  3GB4 A;  1G8K B;  3N0Q A;  5BOK A;  3H1I E;  4U3F E;  1EG9 A;  1RFS A;  1NTK E;  2NUM A;  2YFJ A;  2DE6 D;  4QDD A;  2NVG A;  3GL0 A;  2JZA A;  4HM4 A;  4AAY B;  2HMO A;  2JO6 A;  2E76 D;  4OGQ D;  1BGY E;  4HKV A;  3H1J E;  2D2C D;  2QPZ A;  1SQP E;  1VF5 D;  3GZY A;  2YIU C;  3EQQ A;  4D6T E;  2HMJ A;  4QUP A;  3VCP A;  2YFL A;  1P84 E;  2BMO A;  4QUQ A;  2IBZ E;  3L70 E;  4NBG D;  4HM3 A;  4HM1 A;  1NTM E;  1SJG A;  2E4P A;  4HM7 A;  3L75 E;  1VCK A;  3GOB A;  2BMR A;  2QJP C;  1BCC E;  3GL2 A;  2NVF A;  1WQL A;  2NVE A;  3EN1 A;  1PPJ E;  3C0D A;  2ZT9 D;  2E74 D;  1JM1 A;  3VMG D;  4HM8 A;  1G8J B;  1NU1 E;  3VCA A;  1NDO A;  3GTE A;  1SQV E;  1O7N A;  1VM9 A;  2DE7 D;  1O7P A;  4P1B H;  3H1K E;  1FQT A;  1Q90 C;  2YFI A;  2A06 E;  1KB9 E; 
#chains in the Genus database with same CATH topology
 2FYU G;  3AE4 C;  4NBC D;  1ULJ A;  1GZL A;  1LWU C;  1PPJ G;  4QUR A;  1SQB K;  2XND H;  3M06 A;  3L4F A;  3Q3D A;  2L91 A;  4YPC A;  1O7H A;  2B24 A;  1VDF A;  2KSE A;  1SQX D;  3A2A A;  2Q3W A;  1GL2 D;  1KQF B;  5APT A;  4QCK A;  3TGU E;  3MP7 B;  5KLV G;  1KD1 Q;  1VL2 A;  1NTZ D;  3U1A A;  2H43 A;  3D6Z A;  4PJ0 E;  4RES B;  2WVR A;  1YBK A;  5B5E E;  5CJ4 A;  1M8O B;  3KQG A;  1SQQ D;  1PP9 E;  1NTK J;  4GT1 A;  1PGO A;  1Z56 A;  3BRT B;  5BOK A;  3H1I D;  1NTK K;  5CHX A;  4EDF A;  1USD A;  3CWB G;  2FXO A;  3HUS B;  3IF4 A;  3CCR P;  2FFD A;  1FJK A;  4QUQ A;  4D6T D;  1NVO A;  2GUV A;  3G9R A;  1HBW A;  3W67 A;  1VQP P;  1FZE A;  1BCC D;  2PP6 A;  4DT0 A;  4HM8 A;  5APY A;  1FZC C;  3SSU A;  1LTS C;  3HTK B;  2QJY B;  3VP8 A;  3VMH D;  3JCU E;  1NYH A;  2E4Q A;  2ZJS E;  2NRG A;  2MJZ A;  3MUD A;  3RL0 D;  2UWJ E;  1ZP0 C;  3HD7 D;  2JEE A;  3AE1 C;  1H88 A;  1SQX G;  3CXH H;  2P7J A;  3H1L E;  2MKV A;  4TLF A;  2M5A A;  2HML A;  3KDP B;  1HH0 A;  5AW2 B;  1OXZ A;  1X8Y A;  1L0L E;  2JWD A;  3TF5 A;  1LTJ A;  5CBO A;  3TGU D;  1RF0 C;  4NBH D;  2E75 C;  1SQQ G;  1O7G A;  3WU2 E;  2P2U A;  2HOD A;  2HMN A;  2JKV A;  3H1I G;  1OVU A;  1PP9 D;  2W6A A;  3GB4 A;  1KQL A;  4U3F E;  2YFJ A;  2OYH C;  1EDK A;  1KIL C;  2C0W A;  2Q1K A;  1S9K E;  1S2E A;  4D6T G;  2QG4 A;  5AW4 B;  2CPS A;  1BDC A;  4KHX A;  1URQ D;  1KIL E;  1S4X A;  2AEF A;  1SQP K;  2ZT9 C;  2NPS A;  4KT0 J;  1BCC G;  2B87 B;  1ZOY C;  1W2B O;  3D70 A;  2QJP C;  2NVF A;  1VPC A;  3B5N A;  1EDI A;  4XA4 A;  1KB9 H;  1K9M Q;  1NU1 E;  2KNC A;  1SQV E;  1YJN P;  4IFF A;  2BMQ A;  4NBD D;  3CCE P;  1YHQ P;  1LGH B;  1TU3 F;  2HMK A;  3RK3 C;  3L74 E;  1VQN P;  2WQY C;  5KAF E;  2R32 A;  4R4M A;  2HFE D;  1ZV8 A;  1YTZ I;  3B4S A;  3T97 B;  2H8P D;  4P1C H;  3H1L D;  1Q82 Q;  3TGU G;  1ZME C;  2ZVN B;  1L0L D;  3CC4 P;  2FXM A;  3H1J J;  1XTG B;  4WY4 C;  2K88 A;  2E76 B;  3BCC E;  1DH3 A;  1W5C E;  1P84 I;  3AEE C;  1PP9 G;  3U59 A;  3AE5 C;  4Y99 C;  5AW5 B;  1SVF A;  1YI2 P;  1NWQ A;  1R5S A;  1L4A B;  2PGD A;  2DE6 D;  4U3F D;  4Y28 J;  3FGA D;  4LLH A;  1MUU A;  1P84 H;  1RE4 C;  2YMK A;  1S9K D;  3PHL A;  2D2C D;  1NKN A;  1RHZ B;  3CPW O;  4QUP A;  1KIL D;  2IBZ E;  3L70 E;  2WSE J;  5KTB A;  3L72 J;  1CZQ A;  2GUS A;  2ZT9 D;  4U7J A;  1G8J B;  2OTK E;  4UB6 H;  4ZKU A;  1NU1 D;  1SQV D;  1VQO P;  3TNU B;  2KSJ A;  1MFZ A;  2YVJ B;  1LTI C;  4H0L B;  1FAV A;  2OYO A;  5CCH D;  2ZYL A;  4NBA D;  2K9J B;  4HJL A;  1OVR A;  3USS A;  1HF9 A;  1WMK A;  2KP8 A;  3L71 J;  3L74 D;  2K9Y A;  1KQS O;  1U7M A;  5AVV B;  1FBM A;  4LC1 A;  1NYK A;  3CCS P;  4QMA A;  2W90 A;  1L0L G;  3D6Y A;  1XTC C;  4H13 B;  1LTJ C;  1ZRT E;  3R2P A;  3HD7 A;  4BWN A;  3O6Q B;  3L73 E;  4XE5 B;  2YKQ A;  1FU1 A;  2Z5I A;  2E43 A;  1LWU A;  4H44 B;  1IO4 A;  1PGP A;  2Q3E A;  2ITA A;  2WPR A;  3MTU E;  5DJU B;  1IK9 A;  1JTH B;  3BCC D;  2HLO A;  4OH8 B;  4WY4 D;  2CKF A;  2JO1 A;  4HJG H;  2O01 H;  1A02 J;  1R5L A;  2ZFC A;  3HUS C;  3AE3 C;  1QX8 A;  2OQQ A;  1AJY A;  4AAY B;  1OWA A;  2A45 I;  1KFM A;  1VF5 B;  1M1J C;  2QPZ A;  2ZYG A;  3VTP C;  3NTN A;  3EQQ A;  1Y47 A;  2FYU J;  3V4Q A;  3AED C;  4HM3 A;  2ZXX A;  2FBW C;  2YO2 A;  3M91 A;  1J1E B;  2IBZ D;  3L70 D;  2E4P A;  1CI6 B;  1NU1 G;  1SQV G;  2A45 H;  1URQ A;  3VCA A;  3P8M C;  2IDB A;  2W8Z A;  5H2F E;  3WUU A;  2HPC B;  2LXC B;  1SLQ A;  1ZXG A;  1S5L E;  2JR8 A;  1N7S B;  5CXM A;  3L74 G;  1KZU B;  3RK2 B;  3CLQ A;  4BRY A;  3P7K A;  1RF1 A;  2IZ0 A;  4L73 A;  3HE5 B;  2PRR A;  1SFC B;  1UUV A;  2AXC A;  4NB8 D;  1FZC A;  1T6A A;  2YMY A;  2P58 A;  3DQY A;  4GIF A;  3R4Y A;  1IFJ A;  2R3S A;  1L0N G;  4QDF B;  1ZRT D;  3BCC G;  3FX0 A;  3M0D C;  1FJP A;  2VRS A;  3L73 D;  3CWB J;  1GW3 A;  1IZN B;  1AVO A;  4M3L A;  1G2C A;  3FWN A;  1GL2 C;  5AVQ B;  2GA1 A;  1SS1 A;  1E5W A;  3V2R A;  3BAS A;  2NUK A;  2DW3 A;  3D71 A;  2BEZ F;  1MZ9 A;  5GTI H;  2P1J A;  2BCC E;  1OVV A;  2I1J A;  1GMJ A;  1K05 A;  2Y9Y A;  2AEJ A;  4OGQ B;  3HRN A;  2IBZ G;  3L70 G;  5C39 A;  3GZY A;  2B89 A;  2SPZ A;  2IX7 C;  4W80 A;  4NBG D;  1SJG A;  1QGK B;  2KYV A;  2G3A A;  2KZJ A;  4I7Z B;  3AE9 C;  5AVU B;  2J5U A;  4OVN F;  4YXW H;  1JMM A;  1KIL A;  4PD4 I;  2XSH A;  1FC2 C;  2NWF A;  1SQB E;  4B86 A;  1FZF A;  4ASV A;  1N7L A;  1G1I A;  3G71 P;  4AIV A;  1NKZ B;  4KJM A;  1SQQ J;  2KLU A;  3P8C E;  1NOH A;  1PIX A;  1MKM A;  3RBZ A;  3NFQ A;  1S72 P;  1EXI A;  4PD4 H;  2P67 A;  3N4X A;  1HUC A;  1U57 A;  2IFN A;  1M56 D;  2YNY A;  2FFD B;  3HD7 C;  4MN4 C;  3CXH E;  3S1K A;  2Y0D A;  1LTG C;  3GKE A;  4D6T J;  2YKP A;  2Y9Z A;  5TIS H;  1J1D C;  2WSC J;  4C7N B;  2Z4E A;  4YXD C;  4W7Z A;  3S9O A;  3QH9 A;  3GTS A;  1LT9 C;  1NTK E;  2NUM A;  2BCC D;  1H8A A;  2KS1 B;  2OYI B;  3O8Z A;  4TT3 H;  2C0X A;  3CI9 A;  2HMO A;  3TK1 A;  4WY4 A;  1FDO A;  5BU8 B;  2Q3I A;  5AVW B;  4IL6 H;  2M5A B;  1ZR2 A;  1UII A;  3UIA A;  4HM7 A;  1NAY A;  3V2Q A;  2QSI A;  1URQ C;  2E74 B;  3I56 P;  3EN1 A;  2NZ2 A;  3VMY A;  3GTE A;  1OW6 A;  3GLM A;  3PTZ A;  1RE4 A;  3PLN A;  2QRX A;  1HTL C;  2WPQ A;  1KB9 E;  3NMD A;  3V6I A;  1KN7 A;  1JY2 P;  2QVA A;  2BEQ D;  3AZC A;  1H0T A;  5L8R J;  2C9L Y;  1JY2 N;  1SQB D;  1RF1 C;  1GU5 A;  1N73 C;  2QM8 A;  3D89 A;  3CD6 P;  2WMM A;  1PP9 J;  3P8C D;  2HMM A;  4JYC A;  3CXH I;  3LW5 J;  4N78 E;  2Z5H A;  3MIW A;  4HM2 A;  2NPS B;  1OMI A;  4RJT A;  1KC8 Q;  1HWT C;  2W83 C;  3CXH D;  5KLI C;  3IFM A;  1GU4 A;  3HE4 B;  3B5N B;  4K35 A;  1K73 Q;  4HM5 A;  3WUV A;  1Q81 Q;  4HYT B;  2WSF J;  1RE3 C;  2BCC G;  2M3E A;  4HB1 A;  1FDI A;  3CCM P;  2RN0 A;  1VF5 C;  1NTZ G;  1N8R Q;  1NTK D;  2JZA A;  5BU5 A;  2WT7 B;  3IAO A;  1KFN A;  1SQP E;  3CX5 I;  4A7P A;  2YIU C;  1NTM J;  1P84 E;  4L76 A;  2KOG A;  5AVR B;  3GOB A;  1NTM K;  2D2C C;  2J58 A;  1K04 A;  2XKM A;  1OW8 A;  1QL2 A;  3HUS A;  2P10 A;  1KB9 I;  3CX5 H;  3VMZ A;  3K5B A;  1RQV A;  3W68 A;  1L0L J;  1M1J A;  2B88 A;  3C1L A;  4UB6 E;  1KB9 D;  4JF7 A;  2AEM A;  2WWW A;  2FYN B;  1SFC C;  3M9Q A;  4H0L D;  3H1H J;  3M9B A;  5APX A;  2FY8 A;  2R3C A;  3MHV A;  3HTK A;  1M1K Q;  5CCH C;  1JCC A;  3KPE A;  5CCG D;  1KTM A;  4N78 D;  3EFF K;  3CCJ P;  4H13 D;  1OIP A;  1FOS F;  4CPG A;  1WT6 A;  4H44 D;  3Q5P A;  2R44 A;  2B1X A;  1N2D C;  3TYY A;  1NTK G;  4K3A A;  1O7M A;  5AW9 B;  1KV4 A;  3E7K A;  1SQV J;  3F5H A;  3GL0 A;  2I1K A;  3M0A A;  1JY3 P;  3M0D A;  1DD4 A;  1Q86 Q;  3SWK A;  1VF5 D;  1KMI Z;  1SQP D;  1JY3 N;  2BMO A;  1GL2 A;  5AW7 B;  3GF3 A;  1P84 D;  5KAI H;  1GK4 A;  3L74 J;  4I2L C;  1PV3 A;  4C7R A;  3RGU A;  1Y9B A;  2RMZ A;  1NDO A;  1KYO H;  4NPE A;  3H1K E;  4I1L A;  2B87 A;  2N1T B;  4HM0 A;  1JOC A;  1N7S D;  3ZDM A;  1OW7 A;  1EZV E;  1L0N J;  2M0B A;  1NHL A;  3RK2 D;  2O1K A;  3KXD A;  2HG5 D;  1X0T A;  1L0N K;  3SFD C;  3TDK A;  1BE3 J;  4JYB A;  2XSO A;  1SFC D;  1T2K C;  2LR2 A;  1NJI Q;  4GDO A;  1L2P A;  3PRJ A;  2H89 C;  1OFC X;  2IYO A;  4L74 A;  1BSN A;  1CSB A;  1AQT A;  3H1L G;  2I7F A;  3G6E P;  4DOJ A;  5APV A;  4AYC A;  2OYI C;  2KI7 B;  4NB9 D;  2W6J H;  3GF7 A;  1FZA A;  1LTT C;  2KIK A;  5AVX B;  2R5D A;  1NO4 A;  2NVG A;  1KQG B;  2W6B A;  1SQP G;  5GTI E;  3GMA A;  1VQ6 P;  2QM7 A;  5E79 E;  3PJS K;  4OGQ D;  2ZAE B;  1Y8A A;  1T3J A;  4WB4 A;  3L75 J;  2E74 C;  1Q2N A;  4U3F G;  3EQ2 A;  4HM1 A;  1HGV A;  4DZO A;  2WZ7 A;  5APS A;  1FDM A;  1PPJ E;  4AUW A;  1AVY A;  1LT9 A;  2M3B A;  2WPV B;  3GHG B;  4W7Y A;  2DE7 D;  3BRV B;  1FQT A;  3FXE A;  3OA7 A;  1EZV I;  3AEB C;  3H1K D;  3E1R A;  2WSE H;  2Q9I A;  3I55 P;  4PV1 B;  5GTH H;  4JPZ B;  3CCQ P;  3H32 B;  1EZV D;  4HM6 A;  2FYU K;  2QJY C;  2XDJ A;  2PFX A;  3CL3 D;  3TNU A;  3A0H H;  3F89 A;  3L37 A;  3C8V A;  2E75 B;  4N3Y B;  3IN6 A;  1J2J B;  1T2K D;  2H7H A;  4PD4 E;  1DIP A;  3PH0 A;  4I6M C;  2YXR B;  2H88 C;  5KLV J;  2POH A;  2OYH B;  3CWB E;  3AE7 C;  1N73 A;  2O1J A;  3MGN A;  1KIL B;  5KLV K;  3IR9 A;  1FOS E;  5TIS E;  5BVZ A;  3GW6 A;  1EG9 A;  2V7Q J;  1IFD A;  4UB8 H;  1JTH A;  2JDI H;  2QJP B;  4HKZ H;  1BGY E;  4XFJ A;  1LP1 A;  2HMJ A;  3B8E B;  3MZW B;  3VP9 A;  1RE3 A;  4HH2 A;  1VCK A;  5E79 H;  2O3J A;  2Q6Q A;  1WQL A;  4IL6 E;  1JO5 A;  2E74 D;  3VMG D;  3VMX A;  1LNQ A;  1PPJ D;  3H1K G;  2A45 G;  1ZN5 A;  1DX7 A;  3RK3 B;  2K3R A;  2YFI A;  2KZI A;  2A06 E;  1EZV G;  1HGZ A;  2JP3 A;  2N9Y B;  1BDD A;  2B9B A;  1CI6 A;  2AXT H;  1JB0 J;  3A0B H;  2Q7C A;  1FE6 A;  1QEX A;  4QDC A;  1EC5 A;  3AE6 C;  1LTA C;  2HPC A;  1SQX J;  1VQ7 P;  4WBA A;  1WRG A;  1NH4 A;  4NBF D;  1H89 A;  1SQX K;  5APU A;  2QEX P;  1USE A;  4Y99 B;  1NTZ J;  1MFT A;  4PD4 D;  1LJ2 A;  3HE5 A;  1SFC A;  5B66 H;  2RH0 A;  1ZLL A;  2GBW A;  1NTZ K;  4R4L A;  5M1B A;  1S1C X;  2E5Y A;  3CWB D;  4N6J A;  1SQQ K;  1UUW A;  4NPD A;  3H1I J;  5AW6 B;  4QDF A;  5CCH A;  3L73 G;  1X22 A;  2E76 C;  2YKO A;  2LXB A;  3WMM 0;  1DD3 A;  1BGY D;  1L4A C;  1FZG A;  1BCC J;  3VOP A;  1X9V A;  5CMZ A;  2GM4 A;  2HYN A;  2N1T C;  1S5L X;  2Y0E A;  1YJ9 P;  2IYP A;  2XRX A;  2A06 D;  1KOR A;  1GK6 A;  3CX5 E;  3FXD A;  1HJB A;  1O7W A;  3A7O A;  3RBX A;  1LTJ B;  5KJ7 D;  1LTB C;  1K8A Q;  4NPF X;  5KKZ B;  4YTP C;  4NBE D;  2HOD B;  2PAJ A;  4H0L C;  3S4R A;  3L36 A;  3A3Y B;  1JMB A;  4IOI H;  1CW5 A;  3TGU J;  1IC2 A;  3VMA A;  4GOF A;  1YQ4 C;  2OAR A;  5TJH A;  4EYY Q;  5CCG C;  3RL0 g;  3GCE A;  1OZH A;  5AW0 B;  2DE5 D;  2C9N Y;  1Q7Y Q;  4H13 C;  3GG2 A;  1M1J B;  2WPS A;  1HJ0 A;  4H44 C;  5DJT B;  3N0Q A;  3MD0 A;  4JQ0 D;  3G3Z A;  4IL6 X;  1BGY G;  2WIT A;  1JM0 A;  5AW8 B;  4DJG A;  2E76 D;  2WSC H;  2KNC B;  1YTZ T;  4C7N A;  1ZW0 A;  1A02 F;  1PGQ A;  5APW A;  3VCP A;  3VYI A;  3H25 A;  4RO0 A;  4JBZ A;  4GOE A;  2N9B A;  3GHG C;  1NTM E;  2KS1 A;  2XNX A;  2OYI A;  3ABV C;  1VQ9 P;  1X79 B;  2BMR A;  2QA4 P;  2FKW B;  1L4A D;  3C0D A;  1JM1 A;  1PGJ A;  4LGD E;  5KAI E;  1EDJ A;  2A06 G;  4PV1 C;  4P1B H;  2R5B A;  1JEK A;  1J1E C;  2G8Y A;  4IFM A;  1KYO E;  1BSH A;  5EFW B;  2N1T D;  1IFI A;  3CX5 D;  4RKU J;  2OTL P;  4OWF A;  3Q1M A;  3A5T A;  1DEB A;  3H1H E;  1N7S C;  4NBB D;  3H1L J;  5AVS B;  1SP4 A;  3RK2 C;  1SQB G;  2HR3 A;  1GL2 B;  1T8Z A;  4PJ0 H;  2IPP A;  1L0L K;  5B5E H;  1SQP J;  2QIW A;  3AEA C;  4ZNC A;  1VQ5 P;  3LW5 H;  5CJ0 A;  3CMA P;  2QJK B;  5AVY B;  1U7J A;  4U3F J;  2YXQ B;  1PZQ A;  3LIE A;  1AV1 A;  1GD2 E;  3HE4 A;  3FWL A;  1VQL P;  1LT1 A;  3BVH A;  3C9I A;  3Q5S A;  1YYC A;  3H1J E;  1YIT P;  2WSF H;  2QE7 H;  4WWI A;  3JC2 2;  1MV8 A;  1RQU A;  5AW3 B;  1M90 Q;  1VQK P;  1NTM D;  4OGQ C;  4EI2 A;  2FYZ A;  1NU1 J;  2OTJ P;  3OW2 O;  3CCV P;  2XU6 A;  1JY2 O;  2WT7 A;  3JCU H;  1O7P A;  1NU1 K;  1KYO I;  3RK3 E;  1HVV A;  1SQV K;  3SFE C;  1Q90 C;  1RH5 B;  4I7Z C;  1KYO D;  3RL0 B;  4PV1 D;  1YIJ P;  2Q5U A;  5CBN A;  3AE2 C;  3ITK A;  3HD7 B;  1L0N E;  3AE8 C;  3L72 E;  5GTH E;  1LWU B;  1QLE D;  3H1H D;  3WUT A;  1BE3 E;  3FOU A;  4GKG A;  1EXJ A;  2E75 D;  1RIE A;  4IFD K;  4GOD A;  1IK7 A;  1J1D B;  3A0H E;  3LID A;  1OX3 A;  2ZYD A;  2ZVO B;  4AQR D;  3WU2 H;  2O01 J;  1JUN A;  2I8D A;  3BCC J;  5KJ7 A;  4Z1M H;  2GBX A;  3JSV C;  3L35 A;  1LT9 B;  3M9H A;  5K5G B;  2FFD C;  2V4H A;  3II6 A;  1NAF A;  4EMJ B;  5AEU A;  2L5G B;  5AW1 B;  3L71 E;  1D7M A;  1S3J A;  1G8K B;  3CC7 P;  2K1A A;  2ZYA A;  2KUB A;  4HM4 A;  1QVF O;  3H1K J;  4L75 A;  1URQ B;  3T97 A;  4ZKP A;  1RY3 A;  3L70 J;  4UB8 E;  3H1J D;  1NTM G;  1R8E A;  3CCL P;  2YFL A;  3MUD C;  1DEE G;  3H6P A;  3L75 E;  2Y0C A;  2NVE A;  3V5B A;  4WVZ A;  1IFN A;  5APQ A;  4BRY B;  2CPB A;  1RF1 B;  2BAS A;  4BXL A;  1N73 B;  3RK3 D;  1M57 D;  2XV5 A;  1FZC B;  2J59 M;  1L4A A;  3GZX A;  2IZ1 A;  1IJD B;  3I5C A;  2FYU E;  5KAF H;  3KZI E;  1Q90 D;  2JJL A;  2ZXE B;  3H1H G;  3NXS A;  5KKZ C;  4ASW A;  1QL1 A;  2YO3 A;  2AXT E;  3A0B E;  1L0N D;  3L72 D;  3B71 A;  5KLI B;  1QVG O;  3KHU A;  1EDL A;  1G2C B;  3QWO C;  3PP5 A;  1GW4 A;  3SWY A;  1GTW A;  2N1T A;  1LP1 B;  2RKL A;  1BE3 D;  3OAK A;  3AEG C;  3L73 J;  2IFM A;  1PL5 A;  2E5T A;  2O01 N;  2E42 A;  2K37 A;  3AEF C;  2KXP B;  3SWF A;  1FS0 E;  1FZB A;  2IBZ I;  5KLV E;  2NPS C;  4C46 A;  5B66 E;  3L71 D;  3VMI D;  3V2N A;  3B5N C;  1JY3 O;  2YIU B;  2K9J A;  1RFS A;  3Q5R A;  1T3U A;  1YQ3 C;  2XZR A;  1M7L A;  3P32 A;  3H1J G;  2KK7 A;  2D2C B;  2M8R A;  5CCG A;  3N7N A;  5AVT B;  1AFO A;  2OGU A;  3O6Q A;  3VN0 A;  3Q2Y A;  2CK3 H;  3L75 D;  3GL2 A;  4O9B A;  1ZR4 A;  2ZT9 B;  3OJA B;  2JWA A;  3EFG A;  1VM9 A;  1VQM P;  2WSS H;  1N86 A;  3BAT A;  3L72 G;  1AQ5 A;  5HL4 A;  3GHG A;  2FYU D;  5AEW A;  4EIJ A;  3V4W A;  1PFI A;  3KYQ A;  1VQ4 P;  1BE3 G;  2LKM A;  2FXP A;  2FYN C;  1SQX E;  1E79 H;  4DCK A;  3KZI H;  2XR8 A;  2W27 A;  1ULI A;  3H32 A;  3CC2 P;  5KJ7 C;  1IFM A;  3EWK A;  1BGY J;  1NTZ E;  2QJK C;  3L71 G;  1RF0 A;  1GDT A;  1SQQ E;  5KLV D;  1JNM A;  4WY4 B;  1N7S A;  2BCC J;  3CCU P;  2KB7 P;  2NPS D;  3H1I E;  4ZMD A;  1UIX A;  1YJW P;  4QDD A;  1EQ7 A;  2KLV A;  2OYH A;  3CME P;  3B5N D;  3V2P A;  2JO6 A;  1W2E A;  4HKV A;  4EOT A;  4D6T E;  3L75 G;  3TSI A;  3G4S P;  3U1C A;  1G1J A;  2V7Q H;  3E1I A;  5H2F H;  1BCC E;  1H0T B;  1NGM B;  1IFP A;  1S5L H;  3AEC C;  1VQ8 P;  5AVZ B;  1O7N A;  1AA0 A;  3RL0 C;  2WTY A;  1JCD A;  1SQB J; 
#chains in the Genus database with same CATH homology
 2XRX A;  1KYO E;  2BMQ A;  4NBD D;  4HM0 A;  5CXM A;  2E4Q A;  3CX5 E;  2XSH A;  4NBC D;  3AZC A;  2NWF A;  1SQB E;  1ULJ A;  3GZX A;  1EZV E;  2YVJ B;  4PV1 D;  4QUR A;  5HL4 A;  2FYU E;  1O7W A;  2ZYL A;  4NBA D;  4HM6 A;  4H0L D;  4QDC A;  5KKZ C;  4HJL A;  5AEW A;  2HMK A;  4AIV A;  1L0N E;  3L72 E;  2QJY C;  3L74 E;  3D89 A;  3H1H E;  1O7H A;  2B24 A;  2XSO A;  4NBB D;  1UUV A;  2HMM A;  4NB8 D;  2FYN C;  1SQX E;  4NBE D;  1NYK A;  1BE3 E;  3FOU A;  4NBF D;  3H1L E;  2E75 D;  3DQY A;  1RIE A;  2HML A;  2Q3W A;  2XR8 A;  4HM2 A;  1ULI A;  4P1C H;  3CXH E;  1ZRT E;  4H13 D;  4QDF B;  1L0L E;  4PD4 E;  4QCK A;  5KLI C;  3L73 E;  3TGU E;  2GBX A;  3GKE A;  1NTZ E;  4NBH D;  3BCC E;  4H44 D;  2QJK C;  1O7G A;  2GBW A;  3GCE A;  4HM5 A;  2DE5 D;  3CWB E;  5KLV E;  2B1X A;  2I7F A;  1SQQ E;  3VMH D;  4EMJ B;  5AEU A;  2HMN A;  3L71 E;  2NUK A;  1UUW A;  1PP9 E;  4NB9 D;  3VMI D;  2CKF A;  4QDF A;  1O7M A;  3GTS A;  2BCC E;  3GB4 A;  1G8K B;  3N0Q A;  5BOK A;  3H1I E;  4U3F E;  1EG9 A;  1RFS A;  1NTK E;  2NUM A;  2YFJ A;  2DE6 D;  4QDD A;  2NVG A;  3GL0 A;  2JZA A;  4HM4 A;  4AAY B;  2HMO A;  2JO6 A;  2E76 D;  4OGQ D;  1BGY E;  4HKV A;  3H1J E;  2D2C D;  2QPZ A;  1SQP E;  1VF5 D;  3GZY A;  2YIU C;  3EQQ A;  4D6T E;  2HMJ A;  4QUP A;  3VCP A;  2YFL A;  1P84 E;  2BMO A;  4QUQ A;  2IBZ E;  3L70 E;  4NBG D;  4HM3 A;  4HM1 A;  1NTM E;  1SJG A;  2E4P A;  4HM7 A;  3L75 E;  1VCK A;  3GOB A;  2BMR A;  2QJP C;  1BCC E;  3GL2 A;  2NVF A;  1WQL A;  2NVE A;  3EN1 A;  1PPJ E;  3C0D A;  2ZT9 D;  2E74 D;  1JM1 A;  3VMG D;  4HM8 A;  1G8J B;  1NU1 E;  3VCA A;  1NDO A;  3GTE A;  1SQV E;  1O7N A;  1VM9 A;  2DE7 D;  1O7P A;  4P1B H;  3H1K E;  1FQT A;  1Q90 C;  2YFI A;  2A06 E;  1KB9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...