3H1LE

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
b'VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 43
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1lE02
3VMHD 3L74E 4HM4A 2E74D 2ZYLA 1VF5D 3L71E 1P84E 5AEWA 1NU1E 3L73E 4NB9D 4H44D 2XRXA 2HMJA 2YFIA 3N0QA 1WQLA 3VMID 1KYOE 1O7GA 4NBCD 1PP9E 4HM5A 1G8JB 4NBBD 3GTEA 1SQQE 2YFJA 2FYUE 1L0LE 3GL0A 1JM1A 2HMLA 1FQTA 5BOKA 4U3FE 2CKFA 3FOUA 2XSHA 3BCCE 2GBXA 5KKZC 4HM3A 4QCKA 3D89A 1Q90C 1KB9E 2HMMA 4HM8A 2DE6D 2YVJB 1PPJE 2E76D 1BE3E 4NBGD 2DE5D 5HL4A 3GKEA 3GCEA 3H1IE 1BCCE 5AEUA 3H1JE 4H13D 4HJLA 2NVFA 1SQPE 1G8KB 3AZCA 1ZRTE 3CWBE 2BMQA 2E75D 2QJPC 5KLIC 1VCKA 4NB8D 2DE7D 1O7PA 4EMJB 3H1HE 3L72E 4QUPA 3L70E 2QJKC 2NVEA 4NBHD 1EG9A 4QDCA 3TGUE 1EZVE 3GOBA 2E4QA 2YIUC 4P1CH 1O7MA 4QDFB 2NUMA 2XSOA 1SJGA 3CXHE 2GBWA 2D2CD 1SQVE 3GB4A 4D6TE 4H0LD 2HMOA 4QDDA 1SQBE 2NVGA 1ULJA 3GZXA 3H1LE 2QPZA 4NBDD 1SQXE 2I7FA 1NTME 4PD4E 2E4PA 3GL2A 4HM2A 5KLVE 1NDOA 2FYNC 4AAYB 1BGYE 2JO6A 4PV1D 2YFLA 1RFSA 3VMGD 4HM1A 4P1BH 4HKVA 2HMKA 2JZAA 3CX5E 1ULIA 1UUVA 2NWFA 4NBED 2HMNA 4NBFD 4HM7A 1O7WA 2B24A 1RIEA 4HM0A 3VCAA 1NYKA 2QJYC 2BMRA 4QDFA 3VCPA 1NTZE 4AIVA 3GZYA 2IBZE 3DQYA 4QUQA 1UUWA 4HM6A 3C0DA 3EQQA 4OGQD 1NTKE 2NUKA 2Q3WA 1O7HA 1VM9A 2B1XA 2XR8A 4NBAD 3GTSA 3H1KE 1L0NE 1O7NA 2BCCE 2BMOA 3L75E 5CXMA 2ZT9D 4QURA 2A06E 3EN1A
chains in the Genus database with same CATH superfamily
1PGOA 1FOSF 1AV1A 2V7QJ 1X8YA 3L71E 1M90Q 1JY2N 2FXMA 3V2QA 3OJAB 5CCHC 2R44A 2DW3A 3H1ID 4NBBD 2JJLA 3MTUE 5KAFE 1L0LE 1JM1A 3H1JD 1VF5C 1KB9E 4HM8A 4H44C 2KS1A 2DE5D 1U7MA 1NKZB 1OMIA 1KQLA 4ZMDA 1IO4A 1NTKG 1SQPE 3U1AA 1DIPA 3L35A 4D6TD 3H1KG 2QSIA 5AW5B 1O7PA 3L72E 2QJKC 4OGQB 3L73J 4O9BA 1FC2C 2IBZI 2HMOA 2ZT9B 2IFMA 1SQQG 1Q82Q 3O6QA 4EIJA 4AAYB 3EFFK 2YIUB 3BRTB 1SFCB 1BE3J 5BVZA 1RIEA 1W5CE 4YTPC 3GZYA 1DD3A 3DQYA 1IFNA 1NVOA 1LT9C 2ZXEB 2KK7A 1JTHB 2JP3A 3SFEC 2LR2A 4WVZA 1VQLP 1D7MA 1RHZB 2OYIA 3OA7A 2ZYDA 5AEWA 2FXOA 1HUCA 2XRXA 1YIJP 1N86A 4HM5A 2JO1A 1LWUB 1VQKP 2N1TA 2HMLA 3RK3B 3A5TA 2UWJE 3FWNA 1JY2P 5B5EH 3CWBD 2JEEA 4HH2A 1NOHA 2DE6D 1M8OB 4NBGD 2IZ1A 3JC22 1BCCE 1FZCA 2Q1KA 3BVHA 4N3YB 4ZNCA 1EDKA 3AZCA 3HD7A 1SQBD 3CLQA 2YMKA 3L70E 2P67A 1NTMD 3EQ2A 2P58A 3IF4A 1SQBK 1YQ3C 4Z1MH 1NTMK 1RQUA 3KQGA 3HTKB 1QVFO 2W83C 1QL1A 1RY3A 1NTZD 1OW7A 4HJGH 3G4SP 5KLVE 1J2JB 1FOSE 4Y99C 1IZNB 2BEQD 1BGYE 2JO6A 2YFLA 2Y0DA 1NTZK 2N9YB 1L4AA 1OWAA 1T3JA 3H1IJ 1URQA 3H1JJ 1SQVG 1KYOI 1UUWA 4HM6A 1SVFA 1YQ4C 4PV1C 1P84D 2B1XA 2NPSB 1OX3A 5GTHH 1LP1A 2BCCE 2Z4EA 1JUNA 2P10A 1K73Q 2FYUD 2HPCB 4Y28J 1K04A 2M3EA 3W68A 3VMHD 4D6TJ 2XV5A 2FYUK 5GTIE 1NAYA 3LIEA 2WSFH 3O8ZA 3A0HH 3S1KA 3VMID 2O1JA 3HE5B 3VTPC 5BOKA 1KYOH 2CKFA 5BU5A 1LNQA 3FOUA 3BCCE 3NFQA 2A06G 1GK6A 4WBAA 1HVVA 3NMDA 1KILA 5HL4A 1AQTA 3PP5A 3CC2P 1H0TB 1ZRTE 5AVRB 4EMJB 3UIAA 3L75G 2WTYA 4LC1A 3PJSK 1L0ND 3P8CE 3GOBA 1A02F 4P1CH 2OTKE 4MN4C 5CBOA 3CL3D 3CCRP 3KHUA 3B4SA 2C0WA 4UB6E 1KC8Q 1ZOYC 2W27A 2I1JA 3JCUH 5L8RJ 1LTBC 4KHXA 1LTAC 4P1BH 1FDIA 4NBED 3AE7C 2K9YA 3VCAA 2PP6A 1YI2P 1IK9A 3GHGC 5DJTB 3CWBJ 1VQ4P 3L71D 5CMZA 2XR8A 3TDKA 3VP8A 5CXMA 3S9OA 1KTMA 1RF0A 1L0LD 2BEZF 1EZVG 2JDIH 2E74D 1SQBJ 1L0LK 5KJ7A 1LTTC 1X79B 3B5NA 3VMZA 1GZLA 1NTMJ 4QMAA 3AEFC 3V2PA 1FZFA 1QEXA 3ITKA 1SQPD 3MUDA 2GBXA 3CMAP 4QCKA 3CI9A 3L72D 1NTZJ 1SQPK 3SFDC 3Q2YA 1GL2A 4M3LA 2IBZG 4HJLA 2M0BA 1FE6A 3G6EP 2E75D 5KLIC 1YJNP 3H6PA 3KZIE 1FZGA 3C9IA 2D2CD 1S5LE 1GL2C 2K9JB 2NVGA 2FYUJ 3PH0A 3CWBG 3E1IA 2V7QH 1YBKA 3H1HG 4U3FG 5EFWB 1SS1A 2W8ZA 2M8RA 3AEDC 1IFPA 4H13C 3HUSC 2KXPB 3P8MC 4XE5B 1FZAA 1MFTA 2Q3WA 5AVTB 4BRYB 2O01J 2R5BA 3GTSA 3R2PA 4DZOA 3RL0D 5APUA 1JTHA 4K3AA 1VDFA 3H32B 3TGUG 5CHXA 2IYOA 4HM4A 5CCGC 1ZW0A 1Q90D 3CPWO 2FYNB 2VRSA 5BU8B 4DCKA 1PP9E 5TISH 1BCCD 2OTJP 1IFDA 3D6YA 2NRGA 3GF7A 3A3YB 3QH9A 1FJPA 3VYIA 2HFED 3SWYA 1H88A 3L70D 3AE1C 4N78D 3CCMP 4C7NB 3G71P 3RK2D 2RKLA 4H13D 3B71A 5AVUB 2ZJSE 1VQMP 2BMQA 4PJ0E 1Y9BA 4IL6X 1BGYD 3L71J 3RGUA 2GM4A 3L74G 3M9QA 5KLVK 3LW5J 1RQVA 3HTKA 2JWDA 2OYHC 2W6AA 4GIFA 1N73B 5GTHE 5CCGD 3GZXA 1L0LJ 1KN7A 1SQXE 2I7FA 4WY4C 1BDCA 1TU3F 4EOTA 1FJKA 1IFJA 1HBWA 2FFDA 2WPRA 3M0DA 2BCCD 4NBFD 1FDMA 2B24A 1SLQA 1NYKA 4ZKPA 4ASWA 1SQPJ 4UB8H 1N7SA 3L72J 4YXWH 3Q1MA 1L0NE 1RE4C 3C1LA 2KZIA 1S2EA 1VQ7P 4QURA 1S1CX 3WUTA 1KQGB 2HPCA 3R4YA 1NO4A 1Y8AA 2AXTE 3TSIA 4NB9D 2XDJA 3N0QA 1M7LA 3H1LG 2QVAA 1N7SC 1DX7A 1PV3A 3GMAA 3T97A 2XSHA 2IX7C 1ZRTD 2HMMA 2B89A 2PAJA 4EDFA 1Z56A 1VQ9P 3TNUB 3P8CD 3JCUE 1LGHB 2PGDA 3PRJA 3FX0A 1KFMA 2IYPA 1FU1A 3VOPA 1Q86Q 4W7ZA 1MZ9A 1ZXGA 1FS0E 1EZVI 2FYZA 2WQYC 4KT0J 2R32A 2GBWA 2YXQB 2QM7A 3RL0B 2NPSD 2Q3IA 1J1DB 5KLIB 4CPGA 4R4LA 1CSBA 1RF1B 3CCUP 2W90A 4PD4E 1NWQA 1FZBA 4OWFA 1N7LA 1DH3A 1BCCJ 2QA4P 1FDOA 5C39A 3U59A 3N7NA 1RH5B 1LT1A 1NTKE 2WSEH 3L70J 1O7HA 5TJHA 2HODA 1KQFB 3H1KE 3RK2B 2AXCA 5CCHD 2E42A 2ZVNB 5AW0B 3EFGA 4H13B 1OIPA 2AEJA 3IN6A 1VQ8P 1AVYA 2IZ0A 1JY3P 1VF5D 4H44D 1GU4A 5KLVJ 2XNXA 1VQPP 1BGYJ 1G8JB 2CPSA 1SQQE 1M1KQ 3MHVA 1VQNP 1NYHA 1X9VA 3KPEA 3AE6C 3FGAD 3RBZA 1WMKA 1OW6A 2Q6QA 1X22A 1GD2E 3VMXA 3VMAA 3MIWA 2BCCJ 2DE7D 1LTJB 2YMYA 1CI6A 1XTGB 1HGZA 3CXHE 1BCCG 3AEGC 1IFIA 3A0BE 3L73G 2OYIC 3Q5RA 4U7JA 1M1JA 1ULJA 1DEBA 4B86A 2K9JA 3WU2E 3BCCJ 4C7RA 5KKZB 4JBZA 5AVVB 3E7KA 2GA1A 2N1TC 5APYA 1YJWP 4N78E 1BE3G 1WRGA 1P84I 1L2PA 5TISE 5AVZB 3HE4B 1FZCC 2K1AA 2YO3A 3KYQA 5KLVG 3ABVC 1BGYG 3HD7C 4JF7A 1PP9D 2MKVA 2WITA 4K35A 1KD1Q 1O7GA 5AVXB 1G1JA 1P84H 1HGVA 3GL0A 3LIDA 1PIXA 3VP9A 1L4AC 1OVRA 1JY3O 3V2NA 2E43A 1JB0J 1T2KC 1EC5A 1URQC 1Q2NA 3I5CA 2WT7B 5AW9B 3PLNA 5AW1B 1YJ9P 1FBMA 3NXSA 3QWOC 1T8ZA 3CMEP 4YPCA 3BCCG 1JCDA 1SQXD 3CX5I 3F89A 2K3RA 2YKOA 4UB8E 1SQXK 3HD7D 5DJUB 4QDFB 5CBNA 2J5UA 4GDOA 4C46A 5AW3B 1N73A 3USSA 1NU1D 4IL6H 1JNMA 3GL2A 1VF5B 4R4MA 4PV1D 4H44B 1JY2O 2P1JA 5KAIH 2P7JA 3M9BA 1BSNA 1ZR2A 3CX5H 3VCPA 3H1IG 1L0NK 1QL2A 1KILC 2KYVA 3MZWB 3H1JG 2ZYGA 1MUUA 2QJKB 1URQD 1KZUB 4NPEA 3L75E 1KB9I 1AA0A 5APXA 4AQRD 1EXJA 3F5HA 2KNCA 3D6ZA 1HJBA 4LLHA 2NZ2A 4D6TG 1JMMA 2YFIA 2YKPA 2J58A 1OW8A 2R3SA 5E79H 2W6JH 2YO2A 3M06A 1FQTA 3LW5H 5KAFH 1MKMA 5APVA 3CCLP 1KB9H 3TNUA 4DT0A 2KSEA 1LT9B 3IAOA 2NVFA 3O6QB 1KILD 3CCJP 1VCKA 4NB8D 2E76C 1S5LX 1YTZT 2NVEA 4PD4D 3Q5PA 1EZVE 1RF0C 3HRNA 1KQSO 2NUMA 1SJGA 1NH4A 3GB4A 1PP9J 1IK7A 5KJ7C 4OH8B 3B5NC 1HH0A 2WSCH 1GDTA 1RF1A 2JWAA 1NTKD 3VMGD 3MUDC 2QEXP 3KDPB 3H1KD 2OYIB 2WSSH 1NTKK 2RH0A 2L91A 3IFMA 1J1EC 2IBZE 3EQQA 3TYYA 1HJ0A 5APTA 2CK3H 3G9RA 4RJTA 3U1CA 3L37A 1SQQD 1SFCA 4OGQC 5AW4B 1SQQK 2Q7CA 1SQXJ 4RKUJ 4W7YA 2Q3EA 1SQBG 3AEAC 1WQLA 4Y99B 3HD7B 5B66H 1NTMG 5B5EE 5KJ7D 4U3FE 3JSVC 1YTZI 4L73A 2XKMA 2H88C 3II6A 1Q7YQ 2OQQA 2HYNA 1Q81Q 1SFCC 2ZYAA 3RBXA 3GKEA 4PV1B 1NTZG 1EDLA 3GLMA 4EI2A 3A2AA 3CXHD 1L0NJ 1YYCA 1GL2D 2XZRA 2QJPC 1LWUA 1L4AB 1LTJA 3AECC 4NBHD 3TGUE 1URQB 2G3AA 2XSOA 3V5BA 4QDDA 2ZXXA 4GT1A 3S4RA 1LP1B 4DJGA 2FYUG 1IJDB 4W80A 5H2FH 3MD0A 3RK3C 2H43A 4BWNA 1ULIA 1CZQA 1M56D 4NPDA 2ZFCA 2QJYC 1EQ7A 3AE9C 4GOEA 1SQXG 2N9BA 2M5AB 2B87B 2QG4A 1K05A 3V2RA 4NBAD 3C8VA 3PHLA 1RE3A 3D71A 1KILB 3M0AA 3L74E 3A0HE 4JYCA 1NU1E 2HMJA 1S9KE 1KYOE 5GTIH 1SQVD 3AE5C 3SWFA 2A45I 2YFJA 1L0NG 2Z5IA 3V4QA 2NPSA 3M91A 2Z5HA 2HG5D 1PPJE 2FFDC 3GHGB 3M0DC 2R5DA 3A7OA 2OYOA 1QX8A 2K37A 1NTKJ 3VN0A 1NJIQ 1R5SA 3H1KJ 1JOCA 4JPZB 3HE5A 3SWKA 2HR3A 4WY4D 2KZJA 2A45H 3Q3DA 4JQ0D 2IFNA 3I55P 2A06D 3L71G 1R5LA 5CCHA 3FXEA 5AW6B 1SQQJ 1KORA 3H1LE 1QGKB 1H0TA 2E4PA 1L0LG 4UB6H 1RFSA 1R8EA 2HMKA 1H8AA 3L75D 4HM7A 3B5NB 1DD4A 5E79E 1KILE 4QUQA 1VPCA 2KP8A 1SQPG 2WWWA 2NUKA 2E5YA 3D70A 2L5GB 1KFNA 3L72G 1VQ5P 1O7NA 1XTCC 1AVOA 2G8YA 4AYCA 1EXIA 1N7SD 2LKMA 2YKQA 1T6AA 1J1EB 1GL2B 4HKZH 4I2LC 2LXBA 2MJZA 4AUWA 2Q9IA 3TF5A 2KI7B 1MFZA 2O1KA 3PTZA 1OVUA 4IFFA 2ITAA 3HUSB 1ZN5A 3BRVB 4N6JA 1U57A 1USDA 3CCSP 1EDIA 2XNDH 1EZVD 1PZQA 3KXDA 2H7HA 1NHLA 2JR8A 1LT9A 5AVWB 1K9MQ 1S4XA 4EYYQ 4XA4A 1NGMB 4L74A 2B88A 1DEEG 4QUPA 2O01N 1ZP0C 2E4QA 1S3JA 1VL2A 3KZIH 2QJPB 3OW2O 5CJ4A 1S5LH 1EDJA 4ZKUA 2IBZD 2FBWC 5KTBA 4HM1A 1AQ5A 1SQVJ 1WT6A 2YXRB 5B66E 2QRXA 2CPBA 3C0DA 1FZEA 1PL5A 3P32A 3L70G 1LTGC 2KB7P 2QJYB 3H1HD 4U3FD 2FXPA 2AEMA 3WMM0 2R3CA 2OYHB 2C9LY 4WY4B 3L73E 4NBCD 4XFJA 1M1JC 5AW7B 2QIWA 2IPPA 4BRYA 2M3BA 2I8DA 4I7ZC 1IC2A 3H32A 1BE3E 2Q5UA 1GK4A 1E79H 3K5BA 3TGUD 2XU6A 1SP4A 2GUVA 2KIKA 5H2FE 1UIIA 1G8KB 4HYTB 3L75J 4RESB 1ZV8A 1OZHA 2BCCG 2GUSA 3OAKA 2FFDB 3GF3A 2KLVA 2J59M 5AW8B 2OARA 4PJ0H 2K88A 4HB1A 2N1TD 1SQVE 1UIXA 3NTNA 1G2CB 4C7NA 2WMMA 1N7SB 2RN0A 3VMYA 2RMZA 4HM2A 2FYNC 1BSHA 1OXZA 3GG2A 3RK3E 3FXDA 2IDBA 2O01H 3RL0g 4NPFX 2PRRA 1HWTC 3L74D 2M5AA 1VM9A 2B87A 3T97B 1S9KD 1IFMA 2A45G 1KYOD 2I1KA 2BMOA 1BDDA 2KSJA 1NU1K 2QM8A 1NKNA 2P2UA 2A06E 2WSEJ 4H0LC 3CC7P 2C9NY 3ZDMA 2ZYLA 3EWKA 1PPJD 2KLUA 1L4AD 1JCCA 2AXTH 3WUUA 1T2KD 3Q5SA 2KOGA 2ZAEB 1N73C 2KUBA 1X0TA 5APSA 2E74C 4HM3A 3FWLA 2KS1B 3CX5D 3GHGA 4BXLA 3H1IE 1ZMEC 5AEUA 2PFXA 3H1JE 4PD4I 3M9HA 3AEEC 2HLOA 5CJ0A 3H1LD 1GW3A 4A7PA 3AE8C 2E75C 3WUVA 2WZ7A 4D6TE 4H0LD 2W6BA 3SSUA 3H1HJ 4NBDD 4U3FJ 2HODB 1JMBA 1GW4A 3L4FA 5APQA 4PD4H 2D2CC 1KMIZ 3AE3C 5AVQB 2NWFA 2HMNA 3BATA 1GU5A 2C0XA 1KB9D 3AEBC 3GW6A 2B9BA 4RO0A 2FY8A 2Y0EA 1A02J 4IFDK 1M57D 1H89A 4YXDC 5APWA 3TGUJ 3AE4C 4IFMA 1W2BO 4WB4A 3H25A 3RL0C 1G1IA 1J1DC 1LTSC 2POHA 3G3ZA 4I1LA 2N1TB 3CCEP 3GTEA 3V4WA 1RF1C 1ZR4A 1CI6B 2BASA 4ASVA 1Q90C 3P7KA 3CCQP 1W2EA 3HUSA 1GTWA 2E76D 3IR9A 3CXHI 1LJ2A 2Y9ZA 1AJYA 4TT3H 3GCEA 1FZCB 4JYBA 1M1JB 1FAVA 3CD6P 1U7JA 1E5WA 2Y9YA 1AFOA 3CWBE 2ZT9C 4I7ZB 3B5ND 3H1HE 1K8AQ 1Y47A 2WSFJ 4IOIH 3L74J 4QDCA 3RK2C 2WPSA 5CCGA 2YIUC 2FKWB 5AVSB 1NU1J 1HF9A 1MV8A 3I56P 1LTIC 1SQBE 3CXHH 2QPZA 3V6IA 1PP9G 4GODA 3A0BH 1NTME 1NDOA 1QVGO 3TK1A 3WU2H 1N2DC 2JZAA 1UUVA 1VQ6P 4HM0A 2BMRA 1NTZE 4AIVA 4OGQD 3N4XA 1T3UA 3L73D 2H89C 1PGPA 4OVNF 2QE7H 4DOJA 4TLFA 1LWUC 3BASA 1OVVA 1LTJC 2ZT9D 1GMJA 4L76A 2OTLP 1VQOP 2OYHA 3H1LJ 1P84E 1JEKA 5M1BA 1BE3D 4WY4A 1SFCD 3MP7B 3HE4A 2JKVA 5AVYB 2FYUE 3AE2C 5K5GB 4H0LB 5KKZC 5KLVD 2ZVOB 3D89A 2AEFA 2WVRA 2YVJB 3L36A 1JM0A 4KJMA 3B8EB 1NU1G 1YITP 4GOFA 1YHQP 1CW5A 1HTLC 2E74B 2YNYA 1RE4A 4WWIA 2Y0CA 3E1RA 1PGQA 1SQVK 1RE3C 2V4HA 1PPJG 1EG9A 2E5TA 1O7MA 3CC4P 3RK3D 4IL6E 4GKGA 3CCVP 1USEA 1G2CA 2WT7A 1PGJA 4I6MC 1JY3N 2WPQA 4L75A 2O3JA 5KAIE 5AW2B 1JO5A 4HKVA 1NAFA 1QLED 2NPSC 2KNCB 3CX5E 2WSCJ 2H8PD 3BCCD 2E75B 1ZLLA 1O7WA 4QDFA 3W67A 2OGUA 2LXCB 2SPZA 2E76B 1PFIA 2WPVB 2D2CB 4LGDE 1S72P 1KV4A 1N8RQ 3MGNA 1OFCX 3EN1A
chains in the Genus database with same CATH topology
3VMHD 3L74E 4HM4A 2E74D 2ZYLA 1VF5D 3L71E 1P84E 5AEWA 1NU1E 3L73E 4NB9D 4H44D 2XRXA 2HMJA 2YFIA 3N0QA 1WQLA 3VMID 1KYOE 1O7GA 4NBCD 1PP9E 4HM5A 1G8JB 4NBBD 3GTEA 1SQQE 2YFJA 2FYUE 1L0LE 3GL0A 1JM1A 2HMLA 1FQTA 5BOKA 4U3FE 2CKFA 3FOUA 2XSHA 3BCCE 2GBXA 5KKZC 4HM3A 4QCKA 3D89A 1Q90C 1KB9E 2HMMA 4HM8A 2DE6D 2YVJB 1PPJE 2E76D 1BE3E 4NBGD 2DE5D 5HL4A 3GKEA 3GCEA 3H1IE 1BCCE 5AEUA 3H1JE 4H13D 4HJLA 2NVFA 1SQPE 1G8KB 3AZCA 1ZRTE 3CWBE 2BMQA 2E75D 2QJPC 5KLIC 1VCKA 4NB8D 2DE7D 1O7PA 4EMJB 3H1HE 3L72E 4QUPA 3L70E 2QJKC 2NVEA 4NBHD 1EG9A 4QDCA 3TGUE 1EZVE 3GOBA 2E4QA 2YIUC 4P1CH 1O7MA 4QDFB 2NUMA 2XSOA 1SJGA 3CXHE 2GBWA 2D2CD 1SQVE 3GB4A 4D6TE 4H0LD 2HMOA 4QDDA 1SQBE 2NVGA 1ULJA 3GZXA 3H1LE 2QPZA 4NBDD 1SQXE 2I7FA 1NTME 4PD4E 2E4PA 3GL2A 4HM2A 5KLVE 1NDOA 2FYNC 4AAYB 1BGYE 2JO6A 4PV1D 2YFLA 1RFSA 3VMGD 4HM1A 4P1BH 4HKVA 2HMKA 2JZAA 3CX5E 1ULIA 1UUVA 2NWFA 4NBED 2HMNA 4NBFD 4HM7A 1O7WA 2B24A 1RIEA 4HM0A 3VCAA 1NYKA 2QJYC 2BMRA 4QDFA 3VCPA 1NTZE 4AIVA 3GZYA 2IBZE 3DQYA 4QUQA 1UUWA 4HM6A 3C0DA 3EQQA 4OGQD 1NTKE 2NUKA 2Q3WA 1O7HA 1VM9A 2B1XA 2XR8A 4NBAD 3GTSA 3H1KE 1L0NE 1O7NA 2BCCE 2BMOA 3L75E 5CXMA 2ZT9D 4QURA 2A06E 3EN1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMH D;  3L74 E;  4HM4 A;  2E74 D;  2ZYL A;  1VF5 D;  3L71 E;  1P84 E;  5AEW A;  1NU1 E;  3L73 E;  4NB9 D;  4H44 D;  2XRX A;  2HMJ A;  2YFI A;  3N0Q A;  1WQL A;  3VMI D;  1KYO E;  1O7G A;  4NBC D;  1PP9 E;  4HM5 A;  1G8J B;  4NBB D;  3GTE A;  1SQQ E;  2YFJ A;  2FYU E;  1L0L E;  3GL0 A;  1JM1 A;  2HML A;  1FQT A;  5BOK A;  4U3F E;  2CKF A;  3FOU A;  2XSH A;  3BCC E;  2GBX A;  5KKZ C;  4HM3 A;  4QCK A;  3D89 A;  1Q90 C;  1KB9 E;  2HMM A;  4HM8 A;  2DE6 D;  2YVJ B;  1PPJ E;  2E76 D;  1BE3 E;  4NBG D;  2DE5 D;  5HL4 A;  3GKE A;  3GCE A;  3H1I E;  1BCC E;  5AEU A;  3H1J E;  4H13 D;  4HJL A;  2NVF A;  1SQP E;  1G8K B;  3AZC A;  1ZRT E;  3CWB E;  2BMQ A;  2E75 D;  2QJP C;  5KLI C;  1VCK A;  4NB8 D;  2DE7 D;  1O7P A;  4EMJ B;  3H1H E;  3L72 E;  4QUP A;  3L70 E;  2QJK C;  2NVE A;  4NBH D;  1EG9 A;  4QDC A;  3TGU E;  1EZV E;  3GOB A;  2E4Q A;  2YIU C;  4P1C H;  1O7M A;  4QDF B;  2NUM A;  2XSO A;  1SJG A;  3CXH E;  2GBW A;  2D2C D;  1SQV E;  3GB4 A;  4D6T E;  4H0L D;  2HMO A;  4QDD A;  1SQB E;  2NVG A;  1ULJ A;  3GZX A;  3H1L E;  2QPZ A;  4NBD D;  1SQX E;  2I7F A;  1NTM E;  4PD4 E;  2E4P A;  3GL2 A;  4HM2 A;  5KLV E;  1NDO A;  2FYN C;  4AAY B;  1BGY E;  2JO6 A;  4PV1 D;  2YFL A;  1RFS A;  3VMG D;  4HM1 A;  4P1B H;  4HKV A;  2HMK A;  2JZA A;  3CX5 E;  1ULI A;  1UUV A;  2NWF A;  4NBE D;  2HMN A;  4NBF D;  4HM7 A;  1O7W A;  2B24 A;  1RIE A;  4HM0 A;  3VCA A;  1NYK A;  2QJY C;  2BMR A;  4QDF A;  3VCP A;  1NTZ E;  4AIV A;  3GZY A;  2IBZ E;  3DQY A;  4QUQ A;  1UUW A;  4HM6 A;  3C0D A;  3EQQ A;  4OGQ D;  1NTK E;  2NUK A;  2Q3W A;  1O7H A;  1VM9 A;  2B1X A;  2XR8 A;  4NBA D;  3GTS A;  3H1K E;  1L0N E;  1O7N A;  2BCC E;  2BMO A;  3L75 E;  5CXM A;  2ZT9 D;  4QUR A;  2A06 E;  3EN1 A; 
#chains in the Genus database with same CATH topology
 1PGO A;  1FOS F;  1AV1 A;  2V7Q J;  1X8Y A;  3L71 E;  1M90 Q;  1JY2 N;  2FXM A;  3V2Q A;  3OJA B;  5CCH C;  2R44 A;  2DW3 A;  3H1I D;  4NBB D;  2JJL A;  3MTU E;  5KAF E;  1L0L E;  1JM1 A;  3H1J D;  1VF5 C;  1KB9 E;  4HM8 A;  4H44 C;  2KS1 A;  2DE5 D;  1U7M A;  1NKZ B;  1OMI A;  1KQL A;  4ZMD A;  1IO4 A;  1NTK G;  1SQP E;  3U1A A;  1DIP A;  3L35 A;  4D6T D;  3H1K G;  2QSI A;  5AW5 B;  1O7P A;  3L72 E;  2QJK C;  4OGQ B;  3L73 J;  4O9B A;  1FC2 C;  2IBZ I;  2HMO A;  2ZT9 B;  2IFM A;  1SQQ G;  1Q82 Q;  3O6Q A;  4EIJ A;  4AAY B;  3EFF K;  2YIU B;  3BRT B;  1SFC B;  1BE3 J;  5BVZ A;  1RIE A;  1W5C E;  4YTP C;  3GZY A;  1DD3 A;  3DQY A;  1IFN A;  1NVO A;  1LT9 C;  2ZXE B;  2KK7 A;  1JTH B;  2JP3 A;  3SFE C;  2LR2 A;  4WVZ A;  1VQL P;  1D7M A;  1RHZ B;  2OYI A;  3OA7 A;  2ZYD A;  5AEW A;  2FXO A;  1HUC A;  2XRX A;  1YIJ P;  1N86 A;  4HM5 A;  2JO1 A;  1LWU B;  1VQK P;  2N1T A;  2HML A;  3RK3 B;  3A5T A;  2UWJ E;  3FWN A;  1JY2 P;  5B5E H;  3CWB D;  2JEE A;  4HH2 A;  1NOH A;  2DE6 D;  1M8O B;  4NBG D;  2IZ1 A;  3JC2 2;  1BCC E;  1FZC A;  2Q1K A;  3BVH A;  4N3Y B;  4ZNC A;  1EDK A;  3AZC A;  3HD7 A;  1SQB D;  3CLQ A;  2YMK A;  3L70 E;  2P67 A;  1NTM D;  3EQ2 A;  2P58 A;  3IF4 A;  1SQB K;  1YQ3 C;  4Z1M H;  1NTM K;  1RQU A;  3KQG A;  3HTK B;  1QVF O;  2W83 C;  1QL1 A;  1RY3 A;  1NTZ D;  1OW7 A;  4HJG H;  3G4S P;  5KLV E;  1J2J B;  1FOS E;  4Y99 C;  1IZN B;  2BEQ D;  1BGY E;  2JO6 A;  2YFL A;  2Y0D A;  1NTZ K;  2N9Y B;  1L4A A;  1OWA A;  1T3J A;  3H1I J;  1URQ A;  3H1J J;  1SQV G;  1KYO I;  1UUW A;  4HM6 A;  1SVF A;  1YQ4 C;  4PV1 C;  1P84 D;  2B1X A;  2NPS B;  1OX3 A;  5GTH H;  1LP1 A;  2BCC E;  2Z4E A;  1JUN A;  2P10 A;  1K73 Q;  2FYU D;  2HPC B;  4Y28 J;  1K04 A;  2M3E A;  3W68 A;  3VMH D;  4D6T J;  2XV5 A;  2FYU K;  5GTI E;  1NAY A;  3LIE A;  2WSF H;  3O8Z A;  3A0H H;  3S1K A;  3VMI D;  2O1J A;  3HE5 B;  3VTP C;  5BOK A;  1KYO H;  2CKF A;  5BU5 A;  1LNQ A;  3FOU A;  3BCC E;  3NFQ A;  2A06 G;  1GK6 A;  4WBA A;  1HVV A;  3NMD A;  1KIL A;  5HL4 A;  1AQT A;  3PP5 A;  3CC2 P;  1H0T B;  1ZRT E;  5AVR B;  4EMJ B;  3UIA A;  3L75 G;  2WTY A;  4LC1 A;  3PJS K;  1L0N D;  3P8C E;  3GOB A;  1A02 F;  4P1C H;  2OTK E;  4MN4 C;  5CBO A;  3CL3 D;  3CCR P;  3KHU A;  3B4S A;  2C0W A;  4UB6 E;  1KC8 Q;  1ZOY C;  2W27 A;  2I1J A;  3JCU H;  5L8R J;  1LTB C;  4KHX A;  1LTA C;  4P1B H;  1FDI A;  4NBE D;  3AE7 C;  2K9Y A;  3VCA A;  2PP6 A;  1YI2 P;  1IK9 A;  3GHG C;  5DJT B;  3CWB J;  1VQ4 P;  3L71 D;  5CMZ A;  2XR8 A;  3TDK A;  3VP8 A;  5CXM A;  3S9O A;  1KTM A;  1RF0 A;  1L0L D;  2BEZ F;  1EZV G;  2JDI H;  2E74 D;  1SQB J;  1L0L K;  5KJ7 A;  1LTT C;  1X79 B;  3B5N A;  3VMZ A;  1GZL A;  1NTM J;  4QMA A;  3AEF C;  3V2P A;  1FZF A;  1QEX A;  3ITK A;  1SQP D;  3MUD A;  2GBX A;  3CMA P;  4QCK A;  3CI9 A;  3L72 D;  1NTZ J;  1SQP K;  3SFD C;  3Q2Y A;  1GL2 A;  4M3L A;  2IBZ G;  4HJL A;  2M0B A;  1FE6 A;  3G6E P;  2E75 D;  5KLI C;  1YJN P;  3H6P A;  3KZI E;  1FZG A;  3C9I A;  2D2C D;  1S5L E;  1GL2 C;  2K9J B;  2NVG A;  2FYU J;  3PH0 A;  3CWB G;  3E1I A;  2V7Q H;  1YBK A;  3H1H G;  4U3F G;  5EFW B;  1SS1 A;  2W8Z A;  2M8R A;  3AED C;  1IFP A;  4H13 C;  3HUS C;  2KXP B;  3P8M C;  4XE5 B;  1FZA A;  1MFT A;  2Q3W A;  5AVT B;  4BRY B;  2O01 J;  2R5B A;  3GTS A;  3R2P A;  4DZO A;  3RL0 D;  5APU A;  1JTH A;  4K3A A;  1VDF A;  3H32 B;  3TGU G;  5CHX A;  2IYO A;  4HM4 A;  5CCG C;  1ZW0 A;  1Q90 D;  3CPW O;  2FYN B;  2VRS A;  5BU8 B;  4DCK A;  1PP9 E;  5TIS H;  1BCC D;  2OTJ P;  1IFD A;  3D6Y A;  2NRG A;  3GF7 A;  3A3Y B;  3QH9 A;  1FJP A;  3VYI A;  2HFE D;  3SWY A;  1H88 A;  3L70 D;  3AE1 C;  4N78 D;  3CCM P;  4C7N B;  3G71 P;  3RK2 D;  2RKL A;  4H13 D;  3B71 A;  5AVU B;  2ZJS E;  1VQM P;  2BMQ A;  4PJ0 E;  1Y9B A;  4IL6 X;  1BGY D;  3L71 J;  3RGU A;  2GM4 A;  3L74 G;  3M9Q A;  5KLV K;  3LW5 J;  1RQV A;  3HTK A;  2JWD A;  2OYH C;  2W6A A;  4GIF A;  1N73 B;  5GTH E;  5CCG D;  3GZX A;  1L0L J;  1KN7 A;  1SQX E;  2I7F A;  4WY4 C;  1BDC A;  1TU3 F;  4EOT A;  1FJK A;  1IFJ A;  1HBW A;  2FFD A;  2WPR A;  3M0D A;  2BCC D;  4NBF D;  1FDM A;  2B24 A;  1SLQ A;  1NYK A;  4ZKP A;  4ASW A;  1SQP J;  4UB8 H;  1N7S A;  3L72 J;  4YXW H;  3Q1M A;  1L0N E;  1RE4 C;  3C1L A;  2KZI A;  1S2E A;  1VQ7 P;  4QUR A;  1S1C X;  3WUT A;  1KQG B;  2HPC A;  3R4Y A;  1NO4 A;  1Y8A A;  2AXT E;  3TSI A;  4NB9 D;  2XDJ A;  3N0Q A;  1M7L A;  3H1L G;  2QVA A;  1N7S C;  1DX7 A;  1PV3 A;  3GMA A;  3T97 A;  2XSH A;  2IX7 C;  1ZRT D;  2HMM A;  2B89 A;  2PAJ A;  4EDF A;  1Z56 A;  1VQ9 P;  3TNU B;  3P8C D;  3JCU E;  1LGH B;  2PGD A;  3PRJ A;  3FX0 A;  1KFM A;  2IYP A;  1FU1 A;  3VOP A;  1Q86 Q;  4W7Z A;  1MZ9 A;  1ZXG A;  1FS0 E;  1EZV I;  2FYZ A;  2WQY C;  4KT0 J;  2R32 A;  2GBW A;  2YXQ B;  2QM7 A;  3RL0 B;  2NPS D;  2Q3I A;  1J1D B;  5KLI B;  4CPG A;  4R4L A;  1CSB A;  1RF1 B;  3CCU P;  2W90 A;  4PD4 E;  1NWQ A;  1FZB A;  4OWF A;  1N7L A;  1DH3 A;  1BCC J;  2QA4 P;  1FDO A;  5C39 A;  3U59 A;  3N7N A;  1RH5 B;  1LT1 A;  1NTK E;  2WSE H;  3L70 J;  1O7H A;  5TJH A;  2HOD A;  1KQF B;  3H1K E;  3RK2 B;  2AXC A;  5CCH D;  2E42 A;  2ZVN B;  5AW0 B;  3EFG A;  4H13 B;  1OIP A;  2AEJ A;  3IN6 A;  1VQ8 P;  1AVY A;  2IZ0 A;  1JY3 P;  1VF5 D;  4H44 D;  1GU4 A;  5KLV J;  2XNX A;  1VQP P;  1BGY J;  1G8J B;  2CPS A;  1SQQ E;  1M1K Q;  3MHV A;  1VQN P;  1NYH A;  1X9V A;  3KPE A;  3AE6 C;  3FGA D;  3RBZ A;  1WMK A;  1OW6 A;  2Q6Q A;  1X22 A;  1GD2 E;  3VMX A;  3VMA A;  3MIW A;  2BCC J;  2DE7 D;  1LTJ B;  2YMY A;  1CI6 A;  1XTG B;  1HGZ A;  3CXH E;  1BCC G;  3AEG C;  1IFI A;  3A0B E;  3L73 G;  2OYI C;  3Q5R A;  4U7J A;  1M1J A;  1ULJ A;  1DEB A;  4B86 A;  2K9J A;  3WU2 E;  3BCC J;  4C7R A;  5KKZ B;  4JBZ A;  5AVV B;  3E7K A;  2GA1 A;  2N1T C;  5APY A;  1YJW P;  4N78 E;  1BE3 G;  1WRG A;  1P84 I;  1L2P A;  5TIS E;  5AVZ B;  3HE4 B;  1FZC C;  2K1A A;  2YO3 A;  3KYQ A;  5KLV G;  3ABV C;  1BGY G;  3HD7 C;  4JF7 A;  1PP9 D;  2MKV A;  2WIT A;  4K35 A;  1KD1 Q;  1O7G A;  5AVX B;  1G1J A;  1P84 H;  1HGV A;  3GL0 A;  3LID A;  1PIX A;  3VP9 A;  1L4A C;  1OVR A;  1JY3 O;  3V2N A;  2E43 A;  1JB0 J;  1T2K C;  1EC5 A;  1URQ C;  1Q2N A;  3I5C A;  2WT7 B;  5AW9 B;  3PLN A;  5AW1 B;  1YJ9 P;  1FBM A;  3NXS A;  3QWO C;  1T8Z A;  3CME P;  4YPC A;  3BCC G;  1JCD A;  1SQX D;  3CX5 I;  3F89 A;  2K3R A;  2YKO A;  4UB8 E;  1SQX K;  3HD7 D;  5DJU B;  4QDF B;  5CBN A;  2J5U A;  4GDO A;  4C46 A;  5AW3 B;  1N73 A;  3USS A;  1NU1 D;  4IL6 H;  1JNM A;  3GL2 A;  1VF5 B;  4R4M A;  4PV1 D;  4H44 B;  1JY2 O;  2P1J A;  5KAI H;  2P7J A;  3M9B A;  1BSN A;  1ZR2 A;  3CX5 H;  3VCP A;  3H1I G;  1L0N K;  1QL2 A;  1KIL C;  2KYV A;  3MZW B;  3H1J G;  2ZYG A;  1MUU A;  2QJK B;  1URQ D;  1KZU B;  4NPE A;  3L75 E;  1KB9 I;  1AA0 A;  5APX A;  4AQR D;  1EXJ A;  3F5H A;  2KNC A;  3D6Z A;  1HJB A;  4LLH A;  2NZ2 A;  4D6T G;  1JMM A;  2YFI A;  2YKP A;  2J58 A;  1OW8 A;  2R3S A;  5E79 H;  2W6J H;  2YO2 A;  3M06 A;  1FQT A;  3LW5 H;  5KAF H;  1MKM A;  5APV A;  3CCL P;  1KB9 H;  3TNU A;  4DT0 A;  2KSE A;  1LT9 B;  3IAO A;  2NVF A;  3O6Q B;  1KIL D;  3CCJ P;  1VCK A;  4NB8 D;  2E76 C;  1S5L X;  1YTZ T;  2NVE A;  4PD4 D;  3Q5P A;  1EZV E;  1RF0 C;  3HRN A;  1KQS O;  2NUM A;  1SJG A;  1NH4 A;  3GB4 A;  1PP9 J;  1IK7 A;  5KJ7 C;  4OH8 B;  3B5N C;  1HH0 A;  2WSC H;  1GDT A;  1RF1 A;  2JWA A;  1NTK D;  3VMG D;  3MUD C;  2QEX P;  3KDP B;  3H1K D;  2OYI B;  2WSS H;  1NTK K;  2RH0 A;  2L91 A;  3IFM A;  1J1E C;  2IBZ E;  3EQQ A;  3TYY A;  1HJ0 A;  5APT A;  2CK3 H;  3G9R A;  4RJT A;  3U1C A;  3L37 A;  1SQQ D;  1SFC A;  4OGQ C;  5AW4 B;  1SQQ K;  2Q7C A;  1SQX J;  4RKU J;  4W7Y A;  2Q3E A;  1SQB G;  3AEA C;  1WQL A;  4Y99 B;  3HD7 B;  5B66 H;  1NTM G;  5B5E E;  5KJ7 D;  4U3F E;  3JSV C;  1YTZ I;  4L73 A;  2XKM A;  2H88 C;  3II6 A;  1Q7Y Q;  2OQQ A;  2HYN A;  1Q81 Q;  1SFC C;  2ZYA A;  3RBX A;  3GKE A;  4PV1 B;  1NTZ G;  1EDL A;  3GLM A;  4EI2 A;  3A2A A;  3CXH D;  1L0N J;  1YYC A;  1GL2 D;  2XZR A;  2QJP C;  1LWU A;  1L4A B;  1LTJ A;  3AEC C;  4NBH D;  3TGU E;  1URQ B;  2G3A A;  2XSO A;  3V5B A;  4QDD A;  2ZXX A;  4GT1 A;  3S4R A;  1LP1 B;  4DJG A;  2FYU G;  1IJD B;  4W80 A;  5H2F H;  3MD0 A;  3RK3 C;  2H43 A;  4BWN A;  1ULI A;  1CZQ A;  1M56 D;  4NPD A;  2ZFC A;  2QJY C;  1EQ7 A;  3AE9 C;  4GOE A;  1SQX G;  2N9B A;  2M5A B;  2B87 B;  2QG4 A;  1K05 A;  3V2R A;  4NBA D;  3C8V A;  3PHL A;  1RE3 A;  3D71 A;  1KIL B;  3M0A A;  3L74 E;  3A0H E;  4JYC A;  1NU1 E;  2HMJ A;  1S9K E;  1KYO E;  5GTI H;  1SQV D;  3AE5 C;  3SWF A;  2A45 I;  2YFJ A;  1L0N G;  2Z5I A;  3V4Q A;  2NPS A;  3M91 A;  2Z5H A;  2HG5 D;  1PPJ E;  2FFD C;  3GHG B;  3M0D C;  2R5D A;  3A7O A;  2OYO A;  1QX8 A;  2K37 A;  1NTK J;  3VN0 A;  1NJI Q;  1R5S A;  3H1K J;  1JOC A;  4JPZ B;  3HE5 A;  3SWK A;  2HR3 A;  4WY4 D;  2KZJ A;  2A45 H;  3Q3D A;  4JQ0 D;  2IFN A;  3I55 P;  2A06 D;  3L71 G;  1R5L A;  5CCH A;  3FXE A;  5AW6 B;  1SQQ J;  1KOR A;  3H1L E;  1QGK B;  1H0T A;  2E4P A;  1L0L G;  4UB6 H;  1RFS A;  1R8E A;  2HMK A;  1H8A A;  3L75 D;  4HM7 A;  3B5N B;  1DD4 A;  5E79 E;  1KIL E;  4QUQ A;  1VPC A;  2KP8 A;  1SQP G;  2WWW A;  2NUK A;  2E5Y A;  3D70 A;  2L5G B;  1KFN A;  3L72 G;  1VQ5 P;  1O7N A;  1XTC C;  1AVO A;  2G8Y A;  4AYC A;  1EXI A;  1N7S D;  2LKM A;  2YKQ A;  1T6A A;  1J1E B;  1GL2 B;  4HKZ H;  4I2L C;  2LXB A;  2MJZ A;  4AUW A;  2Q9I A;  3TF5 A;  2KI7 B;  1MFZ A;  2O1K A;  3PTZ A;  1OVU A;  4IFF A;  2ITA A;  3HUS B;  1ZN5 A;  3BRV B;  4N6J A;  1U57 A;  1USD A;  3CCS P;  1EDI A;  2XND H;  1EZV D;  1PZQ A;  3KXD A;  2H7H A;  1NHL A;  2JR8 A;  1LT9 A;  5AVW B;  1K9M Q;  1S4X A;  4EYY Q;  4XA4 A;  1NGM B;  4L74 A;  2B88 A;  1DEE G;  4QUP A;  2O01 N;  1ZP0 C;  2E4Q A;  1S3J A;  1VL2 A;  3KZI H;  2QJP B;  3OW2 O;  5CJ4 A;  1S5L H;  1EDJ A;  4ZKU A;  2IBZ D;  2FBW C;  5KTB A;  4HM1 A;  1AQ5 A;  1SQV J;  1WT6 A;  2YXR B;  5B66 E;  2QRX A;  2CPB A;  3C0D A;  1FZE A;  1PL5 A;  3P32 A;  3L70 G;  1LTG C;  2KB7 P;  2QJY B;  3H1H D;  4U3F D;  2FXP A;  2AEM A;  3WMM 0;  2R3C A;  2OYH B;  2C9L Y;  4WY4 B;  3L73 E;  4NBC D;  4XFJ A;  1M1J C;  5AW7 B;  2QIW A;  2IPP A;  4BRY A;  2M3B A;  2I8D A;  4I7Z C;  1IC2 A;  3H32 A;  1BE3 E;  2Q5U A;  1GK4 A;  1E79 H;  3K5B A;  3TGU D;  2XU6 A;  1SP4 A;  2GUV A;  2KIK A;  5H2F E;  1UII A;  1G8K B;  4HYT B;  3L75 J;  4RES B;  1ZV8 A;  1OZH A;  2BCC G;  2GUS A;  3OAK A;  2FFD B;  3GF3 A;  2KLV A;  2J59 M;  5AW8 B;  2OAR A;  4PJ0 H;  2K88 A;  4HB1 A;  2N1T D;  1SQV E;  1UIX A;  3NTN A;  1G2C B;  4C7N A;  2WMM A;  1N7S B;  2RN0 A;  3VMY A;  2RMZ A;  4HM2 A;  2FYN C;  1BSH A;  1OXZ A;  3GG2 A;  3RK3 E;  3FXD A;  2IDB A;  2O01 H;  3RL0 g;  4NPF X;  2PRR A;  1HWT C;  3L74 D;  2M5A A;  1VM9 A;  2B87 A;  3T97 B;  1S9K D;  1IFM A;  2A45 G;  1KYO D;  2I1K A;  2BMO A;  1BDD A;  2KSJ A;  1NU1 K;  2QM8 A;  1NKN A;  2P2U A;  2A06 E;  2WSE J;  4H0L C;  3CC7 P;  2C9N Y;  3ZDM A;  2ZYL A;  3EWK A;  1PPJ D;  2KLU A;  1L4A D;  1JCC A;  2AXT H;  3WUU A;  1T2K D;  3Q5S A;  2KOG A;  2ZAE B;  1N73 C;  2KUB A;  1X0T A;  5APS A;  2E74 C;  4HM3 A;  3FWL A;  2KS1 B;  3CX5 D;  3GHG A;  4BXL A;  3H1I E;  1ZME C;  5AEU A;  2PFX A;  3H1J E;  4PD4 I;  3M9H A;  3AEE C;  2HLO A;  5CJ0 A;  3H1L D;  1GW3 A;  4A7P A;  3AE8 C;  2E75 C;  3WUV A;  2WZ7 A;  4D6T E;  4H0L D;  2W6B A;  3SSU A;  3H1H J;  4NBD D;  4U3F J;  2HOD B;  1JMB A;  1GW4 A;  3L4F A;  5APQ A;  4PD4 H;  2D2C C;  1KMI Z;  3AE3 C;  5AVQ B;  2NWF A;  2HMN A;  3BAT A;  1GU5 A;  2C0X A;  1KB9 D;  3AEB C;  3GW6 A;  2B9B A;  4RO0 A;  2FY8 A;  2Y0E A;  1A02 J;  4IFD K;  1M57 D;  1H89 A;  4YXD C;  5APW A;  3TGU J;  3AE4 C;  4IFM A;  1W2B O;  4WB4 A;  3H25 A;  3RL0 C;  1G1I A;  1J1D C;  1LTS C;  2POH A;  3G3Z A;  4I1L A;  2N1T B;  3CCE P;  3GTE A;  3V4W A;  1RF1 C;  1ZR4 A;  1CI6 B;  2BAS A;  4ASV A;  1Q90 C;  3P7K A;  3CCQ P;  1W2E A;  3HUS A;  1GTW A;  2E76 D;  3IR9 A;  3CXH I;  1LJ2 A;  2Y9Z A;  1AJY A;  4TT3 H;  3GCE A;  1FZC B;  4JYB A;  1M1J B;  1FAV A;  3CD6 P;  1U7J A;  1E5W A;  2Y9Y A;  1AFO A;  3CWB E;  2ZT9 C;  4I7Z B;  3B5N D;  3H1H E;  1K8A Q;  1Y47 A;  2WSF J;  4IOI H;  3L74 J;  4QDC A;  3RK2 C;  2WPS A;  5CCG A;  2YIU C;  2FKW B;  5AVS B;  1NU1 J;  1HF9 A;  1MV8 A;  3I56 P;  1LTI C;  1SQB E;  3CXH H;  2QPZ A;  3V6I A;  1PP9 G;  4GOD A;  3A0B H;  1NTM E;  1NDO A;  1QVG O;  3TK1 A;  3WU2 H;  1N2D C;  2JZA A;  1UUV A;  1VQ6 P;  4HM0 A;  2BMR A;  1NTZ E;  4AIV A;  4OGQ D;  3N4X A;  1T3U A;  3L73 D;  2H89 C;  1PGP A;  4OVN F;  2QE7 H;  4DOJ A;  4TLF A;  1LWU C;  3BAS A;  1OVV A;  1LTJ C;  2ZT9 D;  1GMJ A;  4L76 A;  2OTL P;  1VQO P;  2OYH A;  3H1L J;  1P84 E;  1JEK A;  5M1B A;  1BE3 D;  4WY4 A;  1SFC D;  3MP7 B;  3HE4 A;  2JKV A;  5AVY B;  2FYU E;  3AE2 C;  5K5G B;  4H0L B;  5KKZ C;  5KLV D;  2ZVO B;  3D89 A;  2AEF A;  2WVR A;  2YVJ B;  3L36 A;  1JM0 A;  4KJM A;  3B8E B;  1NU1 G;  1YIT P;  4GOF A;  1YHQ P;  1CW5 A;  1HTL C;  2E74 B;  2YNY A;  1RE4 A;  4WWI A;  2Y0C A;  3E1R A;  1PGQ A;  1SQV K;  1RE3 C;  2V4H A;  1PPJ G;  1EG9 A;  2E5T A;  1O7M A;  3CC4 P;  3RK3 D;  4IL6 E;  4GKG A;  3CCV P;  1USE A;  1G2C A;  2WT7 A;  1PGJ A;  4I6M C;  1JY3 N;  2WPQ A;  4L75 A;  2O3J A;  5KAI E;  5AW2 B;  1JO5 A;  4HKV A;  1NAF A;  1QLE D;  2NPS C;  2KNC B;  3CX5 E;  2WSC J;  2H8P D;  3BCC D;  2E75 B;  1ZLL A;  1O7W A;  4QDF A;  3W67 A;  2OGU A;  2LXC B;  2SPZ A;  2E76 B;  1PFI A;  2WPV B;  2D2C B;  4LGD E;  1S72 P;  1KV4 A;  1N8R Q;  3MGN A;  1OFC X;  3EN1 A; 
#chains in the Genus database with same CATH homology
 3VMH D;  3L74 E;  4HM4 A;  2E74 D;  2ZYL A;  1VF5 D;  3L71 E;  1P84 E;  5AEW A;  1NU1 E;  3L73 E;  4NB9 D;  4H44 D;  2XRX A;  2HMJ A;  2YFI A;  3N0Q A;  1WQL A;  3VMI D;  1KYO E;  1O7G A;  4NBC D;  1PP9 E;  4HM5 A;  1G8J B;  4NBB D;  3GTE A;  1SQQ E;  2YFJ A;  2FYU E;  1L0L E;  3GL0 A;  1JM1 A;  2HML A;  1FQT A;  5BOK A;  4U3F E;  2CKF A;  3FOU A;  2XSH A;  3BCC E;  2GBX A;  5KKZ C;  4HM3 A;  4QCK A;  3D89 A;  1Q90 C;  1KB9 E;  2HMM A;  4HM8 A;  2DE6 D;  2YVJ B;  1PPJ E;  2E76 D;  1BE3 E;  4NBG D;  2DE5 D;  5HL4 A;  3GKE A;  3GCE A;  3H1I E;  1BCC E;  5AEU A;  3H1J E;  4H13 D;  4HJL A;  2NVF A;  1SQP E;  1G8K B;  3AZC A;  1ZRT E;  3CWB E;  2BMQ A;  2E75 D;  2QJP C;  5KLI C;  1VCK A;  4NB8 D;  2DE7 D;  1O7P A;  4EMJ B;  3H1H E;  3L72 E;  4QUP A;  3L70 E;  2QJK C;  2NVE A;  4NBH D;  1EG9 A;  4QDC A;  3TGU E;  1EZV E;  3GOB A;  2E4Q A;  2YIU C;  4P1C H;  1O7M A;  4QDF B;  2NUM A;  2XSO A;  1SJG A;  3CXH E;  2GBW A;  2D2C D;  1SQV E;  3GB4 A;  4D6T E;  4H0L D;  2HMO A;  4QDD A;  1SQB E;  2NVG A;  1ULJ A;  3GZX A;  3H1L E;  2QPZ A;  4NBD D;  1SQX E;  2I7F A;  1NTM E;  4PD4 E;  2E4P A;  3GL2 A;  4HM2 A;  5KLV E;  1NDO A;  2FYN C;  4AAY B;  1BGY E;  2JO6 A;  4PV1 D;  2YFL A;  1RFS A;  3VMG D;  4HM1 A;  4P1B H;  4HKV A;  2HMK A;  2JZA A;  3CX5 E;  1ULI A;  1UUV A;  2NWF A;  4NBE D;  2HMN A;  4NBF D;  4HM7 A;  1O7W A;  2B24 A;  1RIE A;  4HM0 A;  3VCA A;  1NYK A;  2QJY C;  2BMR A;  4QDF A;  3VCP A;  1NTZ E;  4AIV A;  3GZY A;  2IBZ E;  3DQY A;  4QUQ A;  1UUW A;  4HM6 A;  3C0D A;  3EQQ A;  4OGQ D;  1NTK E;  2NUK A;  2Q3W A;  1O7H A;  1VM9 A;  2B1X A;  2XR8 A;  4NBA D;  3GTS A;  3H1K E;  1L0N E;  1O7N A;  2BCC E;  2BMO A;  3L75 E;  5CXM A;  2ZT9 D;  4QUR A;  2A06 E;  3EN1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...