3H1LE

Chicken cytochrome bc1 complex with ascochlorin bound at qo and qi sites
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
196
structure length
196
Chain Sequence
VHNDVTVPDFSAYRREDVMDATTSSQTSSEDRKGFSYLVTATACVATAYAAKNVVTQFISSLSASADVLALSKIEIKLSDIPEGKNVAFKWRGKPLFVRHRTQAEINQEAEVDVSKLRDPQHDLDRVKKPEWVILVGVCTHLGCVPIANSGDFGGYYCPCHGSHYDASGRIRKGPAPYNLEVPTYQFVGDDLVVVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ascochlorin is a novel, specific inhibitor of the mitochondrial cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
total genus 43
structure length 196
sequence length 196
chains with identical sequence R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2009-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3h1lE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3h1lE02
1VM9A 3DQYA 4NBGD 1ZRTE 2E4QA 3GOBA 1ULJA 2Q3WA 3H1KE 2NWFA 3FOUA 3GTEA 4AAYB 2QJKC 4HM2A 1NU1E 2BCCE 3H1JE 2B24A 1G8KB 3N0QA 1VCKA 2HMKA 4NBHD 2JZAA 1PPJE 2FYNC 1BE3E 4QDFA 1O7PA 1NDOA 4QUPA 4H44D 4HM7A 4P1CH 1PP9E 3C0DA 5CXMA 2NVEA 1Q90C 2ZYLA 4NBFD 1FQTA 4NBDD 3L71E 1UUVA 2D2CD 2GBWA 1L0NE 3BCCE 1RFSA 3EQQA 4HM8A 3L74E 4H13D 3GL2A 1L0LE 4HJLA 4EMJB 1NTME 5HL4A 3VCPA 3L70E 2I7FA 2GBXA 5KKZC 3CXHE 3H1IE 3AZCA 1JM1A 4NBCD 2YVJB 3L72E 4NBED 5AEUA 3VCAA 3L75E 2QPZA 5BOKA 2XSHA 4PD4E 3D89A 1SQXE 3GTSA 3GZYA 2NVFA 2YFIA 2DE5D 3VMHD 1UUWA 1BCCE 2CKFA 1P84E 3L73E 1O7WA 2XR8A 2QJYC 4D6TE 1O7GA 4HM5A 4QUQA 5KLVE 4NBBD 3GKEA 2XRXA 3GZXA 4QDFB 2ZT9D 4QURA 3TGUE 1BGYE 1NYKA 2BMOA 4H0LD 4PV1D 2HMMA 2HMLA 3GCEA 1ULIA 5KLIC 3VMID 2XSOA 1VF5D 1RIEA 2DE6D 2JO6A 4QDDA 4HM6A 3H1LE 1NTKE 4QDCA 2E75D 4NBAD 1EZVE 1SQPE 3EN1A 2NVGA 4QCKA 2B1XA 4HM1A 2E76D 1O7HA 2E4PA 4HM4A 4NB9D 1SQVE 1KB9E 2IBZE 3GL0A 4HM0A 2HMJA 2NUMA 1EG9A 3GB4A 2A06E 3H1HE 2FYUE 2E74D 3CWBE 1SQQE 3CX5E 1SQBE 2DE7D 2BMQA 4NB8D 1G8JB 5AEWA 1SJGA 2YFLA 4HM3A 3VMGD 2YFJA 1NTZE 1KYOE 4P1BH 2HMOA 2YIUC 4AIVA 2BMRA 1O7NA 1O7MA 2HMNA 4HKVA 2NUKA 4OGQD 2QJPC 1WQLA 4U3FE
chains in the Genus database with same CATH superfamily
3H1KE 1L0NK 3GHGA 2HR3A 2WPQA 1BE3E 2YKQA 3L37A 4QDFA 2W6JH 2W6BA 2IYOA 3KZIH 1UUVA 4TLFA 1PGQA 4C7NA 1E79H 3L74E 3V2NA 4W7ZA 2QE7H 5EFWB 3CC4P 3VCPA 1JO5A 2Q3EA 3NXSA 1QL1A 2WPRA 2KSEA 4YPCA 1DEBA 1NU1D 3V2QA 1NTKJ 3H1LJ 3L72E 1FE6A 4YXDC 3VCAA 1G1JA 2A45H 2YO3A 3L73E 1KYOI 4IOIH 1SFCA 2FXOA 4ZNCA 3ITKA 2A06G 5APSA 2V7QH 2OGUA 3AE1C 4LC1A 1OZHA 2N1TA 2M8RA 3V5BA 2R5DA 4QDDA 1QX8A 3H1HD 3CCSP 3Q3DA 4AQRD 4NPEA 2ZYGA 1QVFO 1LP1A 1VL2A 3GL0A 2E42A 3U59A 2FXPA 2FYUE 4JYBA 3B8EB 2M0BA 2OYIB 3L72G 3JCUH 2HMNA 3LIEA 3H1HJ 4HB1A 1JUNA 1JTHA 2K3RA 3CWBG 2KK7A 2P2UA 3A0HE 5CBOA 1MZ9A 2BCCE 3UIAA 4BWNA 2HFED 2PRRA 2E74B 1SQQJ 1GK6A 1USDA 2FY8A 1KQFB 5CXMA 2Y9YA 4IFDK 1JY2P 4HM8A 1EQ7A 3GL2A 1GZLA 1QGKB 1SQQG 1FOSE 2I7FA 1ZV8A 3D6ZA 3TDKA 2PP6A 2B87B 2L91A 2Q5UA 1YIJP 1K8AQ 1Y47A 2XRXA 1YQ3C 1L0ND 1YJWP 3GF3A 3F89A 3B5ND 2Y0DA 1HGVA 2O01J 4GOEA 1N7LA 3CD6P 3U1CA 2W90A 2OYHA 3AE2C 2YIUB 4BRYB 2JO6A 1MFTA 3H1JD 2Q3IA 1FJPA 1AA0A 2RN0A 3H1HE 1NTKD 3H1LD 2FYUG 1EXJA 2PGDA 4B86A 1USEA 3KQGA 3IF4A 4OGQD 1OXZA 2FYUD 4U3FE 2OTJP 2ZT9C 2J5UA 2AXTH 3CX5I 3Q1MA 1NTMJ 3A0BH 4HM2A 1BSNA 2E43A 1J1EC 1NKNA 2IDBA 2WZ7A 3GLMA 1KILB 1S5LH 5K5GB 3VYIA 4KHXA 1LP1B 3H1IJ 4PJ0H 3HD7B 3HD7A 1HUCA 3G4SP 2Z5HA 2GBWA 4JF7A 2AXCA 4H13D 4EMJB 3RBXA 3ABVC 5CBNA 3A0HH 5AVQB 1HJ0A 4IL6H 3MHVA 1JM1A 2BCCD 1PP9J 4R4MA 1L4AA 5AEUA 3CXHI 2CPSA 4M3LA 3L4FA 5CCGC 1KTMA 5CCGD 3RL0B 3Q5SA 3CMEP 2WITA 2WSEJ 4QURA 3H1JG 2FXMA 1BGYE 1ZN5A 1LT1A 1BCCG 3MUDC 1NYKA 1M7LA 3P7KA 2HMLA 1X8YA 3M06A 2WVRA 1CW5A 1SQQD 3CX5D 3AE8C 2ZVOB 2XKMA 1SS1A 2IBZG 1T8ZA 2BASA 3G6EP 3HUSB 4PJ0E 4NPDA 5AVTB 4CPGA 1LTGC 4NPFX 3AE9C 1VQLP 2E75B 1NTMK 2RH0A 1HVVA 5GTHE 3CMAP 2NWFA 3H1JE 1GW4A 3U1AA 1PZQA 4U3FD 2M3EA 1L0LG 3ZDMA 3JSVC 2YXQB 2QRXA 1Q82Q 2NVEA 3O6QB 2A45G 5E79H 3LW5J 1NTKG 3H1LG 2K88A 3G71P 2HLOA 2JKVA 3CX5H 3PHLA 2R44A 2FYNB 1IC2A 1AVYA 3AEDC 4ZKPA 4A7PA 2R5BA 1HWTC 3VMYA 1NO4A 2GUVA 1YTZI 4Y99C 2WTYA 1S4XA 4JQ0D 1JTHB 1NWQA 1EZVG 3P8CE 3TK1A 4DT0A 3CCMP 5AVZB 1SQPD 1KFMA 5KAFE 3GW6A 2HMMA 4JPZB 5KLIC 1SQBK 4WWIA 2KP8A 3TYYA 4LGDE 4PD4D 3JCUE 1S72P 2E74D 3Q5PA 2YKPA 5KAIE 1SQQE 1GL2C 3CX5E 4HKZH 1PGJA 2O3JA 4IL6E 4K35A 1LTBC 1VQMP 1KFNA 1NKZB 3BCCD 1RF0C 3L73G 3MGNA 1EDLA 2IBZI 2E4QA 2OYHC 4EDFA 1LTSC 2ZYDA 1URQA 2B87A 2LXBA 2B24A 3L71G 3RK2C 2HMKA 1R5LA 3FGAD 3L70G 2LXCB 3N7NA 2YMYA 5KLVK 2KIKA 2ZXEB 1CI6B 4DJGA 1BGYG 4RESB 2POHA 5HL4A 1OW8A 3L71J 5B5EH 2GBXA 3NTNA 2IPPA 1XTCC 3BASA 1Q81Q 2GM4A 2HODB 3L75E 1VF5B 1SQXE 1NHLA 3L73J 4DZOA 1LTAC 2I1KA 1BGYJ 2QJYC 2R32A 3PJSK 1JOCA 1O7GA 1RE4C 1T2KC 3EWKA 1VQOP 3AE3C 1T2KD 3H1HG 1FZEA 1J1DB 3B5NC 1PL5A 2AEMA 3W67A 2JR8A 2XSOA 1VF5D 2KLVA 1JCDA 2QM8A 1SQPE 3EN1A 2O1JA 4HJGH 3H25A 1M56D 4OGQB 1NAFA 2LR2A 2RKLA 1KB9E 2D2CB 2IZ0A 2K1AA 1FAVA 1L4AB 1KILA 1NU1G 2GUSA 3H1KD 4ZKUA 1LNQA 3S9OA 1OW6A 2NUKA 1GK4A 4KJMA 1N73B 1SQBG 1URQD 1HH0A 3AEGC 1VCKA 3HTKA 1GL2B 3CC7P 1PPJE 2QA4P 2K9JB 5GTIH 1WRGA 4XFJA 3VMZA 5KKZB 1RF1A 3CL3D 3CI9A 4C46A 2KSJA 2PFXA 3L71E 4UB8H 5AW2B 1DEEG 1G2CA 2BEZF 4GODA 2XNXA 4WY4C 5APTA 3L73D 3OW2O 1IK7A 2IZ1A 3TNUA 2XSHA 3QH9A 2KS1B 2HPCA 1T6AA 3S1KA 3LW5H 1S9KD 1W2BO 5KAIH 1VQ8P 1RF0A 3IR9A 2V4HA 1YBKA 1KYOH 5KLVJ 1NTMG 1PGOA 4D6TG 1ZXGA 2QEXP 2E75D 2E75C 3TGUD 4AUWA 1EC5A 2B1XA 2Y0CA 1SQXD 2KNCA 5KTBA 4Z1MH 2W27A 5AVVB 1CI6A 3BRVB 2H88C 5KLVG 1LT9B 2I8DA 1FC2C 1XTGB 3PRJA 1G1IA 2G8YA 1SVFA 1LTIC 4OH8B 1CSBA 4AYCA 1OIPA 1WQLA 3PLNA 1UIIA 2H89C 1GW3A 1JY3N 2OYIA 1PP9D 5AW1B 3AE4C 2ZXXA 1L0NJ 4KT0J 3RK3D 4I7ZC 2FYNC 4U3FG 4HYTB 1IFMA 1RE3C 3HTKB 1O7PA 1LTJA 1JMMA 1OWAA 5APYA 1NU1K 3H1ID 3HD7D 1NTZG 2FYUJ 4H13B 3G9RA 1ZLLA 1H0TB 1K05A 2ZAEB 3MZWB 2YMKA 4PD4I 2K37A 1VQ5P 2DE5D 3PH0A 3L36A 2XR8A 1MUUA 4HM5A 5AVYB 2ZT9D 1L0NG 2WQYC 4OGQC 1AVOA 4PV1B 2IBZD 2DE6D 3PTZA 1OX3A 1GD2E 1YTZT 1MV8A 1NTKE 3H1LE 5APUA 1OFCX 5B66H 5KJ7C 4L73A 3VMXA 1LWUB 1LWUA 1HGZA 2W83C 3L75G 3A2AA 1SJGA 4PD4H 1O7MA 4HKVA 1BE3J 1KB9I 1VQ9P 4NBGD 2B88A 1N7SD 1SQPK 4AAYB 5CCHC 2Q3WA 2QVAA 1JEKA 3KYQA 4N78D 2XV5A 1KB9H 4HM7A 1DD3A 2H7HA 4EYYQ 1PP9E 3R2PA 3SFDC 3B5NA 4L75A 3RK3E 3EQQA 3KDPB 1SQXJ 3GHGB 1OVRA 1SLQA 1ZW0A 1IO4A 1AFOA 3WUUA 3GG2A 3H1IE 4I6MC 3AEBC 2QIWA 4QMAA 2W8ZA 5BOKA 4XE5B 1BE3D 3HRNA 3RL0g 1RHZB 2YXRB 1JNMA 1GU5A 3M91A 3MD0A 1N73A 4LLHA 1IFNA 1L4AD 1Y8AA 3EFGA 2H8PD 1UIXA 2K9JA 1EDIA 1FZCA 4QDCA 1OMIA 1VQNP 4ZMDA 1EZVE 3HE5B 3H6PA 1AV1A 3MIWA 1URQB 3TF5A 4NB9D 1DH3A 1SQVE 2IBZE 2P58A 1LTJC 1Q7YQ 1S2EA 3E7KA 1FZFA 3T97A 1N86A 3CCRP 2BMQA 4GKGA 1SQQK 1HJBA 3TGUJ 4P1BH 2FYZA 3DQYA 1FBMA 1KILE 1ULJA 2B89A 1PIXA 3HD7C 3M9HA 2HODA 4H44B 4IL6X 1L0LD 1OVVA 3C0DA 2NPSD 1H8AA 3CXHD 2R3CA 3D71A 1PFIA 2E76B 4GIFA 4UB6H 3CCLP 3A7OA 2KLUA 2WPSA 4EOTA 1CZQA 1FJKA 4YXWH 2XDJA 3GZYA 2NVFA 2R3SA 3PP5A 1IZNB 2KB7P 5KLVE 3Q2YA 1NJIQ 2AEJA 3CC2P 1FOSF 3BRTB 1BCCD 1SQBJ 1VDFA 4L76A 4WB4A 2RMZA 2JJLA 3AECC 3M9QA 1LWUC 4HH2A 2FBWC 1A02F 4R4LA 3V2RA 4PV1C 3C8VA 2FFDC 2HMJA 2NUMA 5GTIE 1SQXK 3KHUA 1SQVD 5TJHA 3JC22 2N9YB 1K9MQ 2QJPC 2MKVA 3NMDA 1ZOYC 2P67A 1FDOA 1G8KB 2ZJSE 2XZRA 2ZVNB 4H0LB 3L72D 3R4YA 1TU3F 2J58A 2WSSH 3L72J 2O1KA 4P1CH 1QVGO 5M1BA 1K73Q 3VTPC 1YQ4C 2KXPB 3AEFC 4BRYA 1LTTC 3L35A 3L75D 1L0LE 2ZYAA 4GOFA 3Q5RA 4Y99B 3SWFA 3SWKA 1YJNP 3CXHE 2K9YA 1FZCC 1NVOA 2YVJB 2Q1KA 2C0WA 1Y9BA 3GHGC 1SQPJ 3GTSA 3CCQP 1YHQP 3KPEA 2Q6QA 3WUTA 4XA4A 1GMJA 1KZUB 1KC8Q 3AE7C 2E76C 2O01N 3O6QA 1P84D 3CCVP 5B5EE 1FZGA 4I2LC 1KB9D 2OTKE 2XNDH 1L0LK 1K04A 4QCKA 4U3FJ 3L75J 2QJKB 1ZR4A 1J1DC 1NH4A 3B5NB 1BE3G 1SQBE 2FFDA 4HM3A 3BCCG 1URQC 1VM9A 1ZRTE 1M1JB 3FXDA 1RQUA 4IFFA 4D6TJ 5CCHA 4C7NB 3L71D 3OAKA 3RK3B 1FU1A 2H43A 5L8RJ 4QUPA 1M1JA 2MJZA 1Q90C 4NBFD 4NBDD 2YO2A 1L0NE 3CCUP 1VF5C 4HJLA 4H0LC 4DOJA 1HBWA 2N9BA 1GL2D 3HE4A 5AW6B 1X9VA 1FZAA 2WMMA 1YI2P 3H32A 3H32B 2B9BA 1EXIA 2JWDA 1N7SB 2NPSA 1N8RQ 1X79B 2YKOA 2Q9IA 1Q90D 2ZFCA 2KYVA 2Z5IA 5BU5A 3A0BE 3GKEA 3SFEC 3OA7A 4BXLA 3GZXA 3TGUE 3USSA 5CHXA 2OTLP 2WSFH 4H0LD 4PV1D 1NTZJ 3VMID 4GT1A 2BCCJ 1EZVI 3CLQA 3H1IG 4YTPC 5E79E 5AW8B 1Z56A 3C9IA 1NTKK 1E5WA 1EG9A 1P84H 4L74A 4NB8D 2N1TD 1G8JB 2BCCG 3II6A 2Y9ZA 1PP9G 1KYOE 3VMAA 2YIUC 1RE3A 5BU8B 2D2CC 2PAJA 4W80A 3CWBD 1SQBD 3M0AA 3GOBA 3FOUA 3L74G 3BATA 1QLED 5H2FH 3EQ2A 2JZAA 1KQLA 4WBAA 1IFDA 1N73C 5AW0B 4WVZA 2WSCJ 1HTLC 1JB0J 4EIJA 1SP4A 2OQQA 1VQ6P 3M0DC 2FKWB 2E74C 3HUSA 1M90Q 2NPSC 2D2CD 2IYPA 3BCCE 2QJYB 4UB8E 1SFCB 1JY2O 5KKZC 4I7ZB 1KQSO 4RJTA 2OARA 2ITAA 1S3JA 1R5SA 4K3AA 5AVSB 5KAFH 3CCJP 1D7MA 3HE5A 5CCGA 5AVXB 1FZCB 2JO1A 2C9NY 3IFMA 1PGPA 3A3YB 2WWWA 3KZIE 4JBZA 1N7SA 3O8ZA 3TNUB 1VQPP 5AW3B 4OWFA 1L0LJ 1RIEA 3CXHH 4JYCA 2KOGA 3WUVA 1W2EA 3RK2D 1HF9A 1M8OB 3RL0C 5TISH 2KUBA 5AW7B 5B66E 2DW3A 3GB4A 1LJ2A 2ZT9B 3MP7B 1KN7A 1JM0A 1FS0E 3CWBJ 1U57A 3VP8A 1LGHB 1RF1C 2OYOA 3VMGD 2KZIA 2HMOA 2BMRA 2P10A 2KNCB 4N78E 3WMM0 3M0DA 3L70E 5C39A 1LT9C 1PV3A 3M9BA 4OVNF 2JP3A 2E5YA 3RL0D 1JMBA 4WY4B 4DCKA 3MTUE 3RBZA 1JY3O 3I55P 1OVUA 1NDOA 5TISE 2M5AB 3P8CD 4Y28J 1P84I 2L5GB 2C9LY 1A02J 2CPBA 1H89A 1AQ5A 1YJ9P 1SQXG 2QPZA 1PPJD 4PD4E 2FYUK 1IFJA 2YFIA 1M57D 1UUWA 2NRGA 1RQVA 2HPCB 4QDFB 5AW5B 1EZVD 3GCEA 1ULIA 1NU1J 2IFMA 2GA1A 2J59M 2A06D 4HM6A 3VOPA 1H88A 3P32A 4HM4A 3C1LA 1JCCA 4N6JA 2V7QJ 1NTZK 2KS1A 1KILD 2WSFJ 5KLIB 2YFJA 1ZMEC 2Z4EA 3E1IA 4RKUJ 3IN6A 1U7JA 3V4QA 3SSUA 3T97B 3S4RA 3HE4B 2QSIA 2YNYA 3CCEP 1FZBA 1JY2N 3N0QA 2N1TB 1GTWA 3L70D 1QEXA 1NYHA 3G3ZA 1U7MA 1N7SC 2ZYLA 1RFSA 2M5AA 2E5TA 2JDIH 1M1KQ 2Y0EA 4IFMA 3GF7A 1N2DC 5KJ7A 5KLVD 1LT9A 5CJ4A 1SFCC 1BCCE 2JWAA 4N3YB 5GTHH 1VQ4P 1AJYA 2QM7A 5AW4B 3HUSC 3VN0A 1VQKP 2SPZA 2M3BA 2BMOA 1MFZA 3WU2E 4ASVA 1VPCA 5CMZA 5DJTB 2NZ2A 5AVWB 4NBAD 1BGYD 5CJ0A 1O7HA 2E4PA 1NTZD 2WT7A 1YITP 3SWYA 4HM0A 1Q86Q 2A06E 2OYHB 4EI2A 1H0TA 3L74J 3FXEA 3KXDA 3BVHA 3RK2B 3AE5C 3TSIA 1RH5B 3I56P 1DIPA 4C7RA 4I1LA 2NPSB 3A5TA 3P8MC 1T3JA 1RF1B 1G2CB 1FDMA 1IK9A 4NBHD 5KJ7D 3H1KJ 2OYIC 5APVA 1RE4A 1S9KE 4D6TD 1BSHA 1KV4A 1KORA 2AXTE 1JY3P 1BCCJ 4TT3H 2JEEA 3WU2H 2IX7C 4H44C 1NTME 3OJAB 3BCCJ 3IAOA 3CPWO 3H1KG 1S5LE 5CCHD 1J2JB 1EDJA 3VMHD 3F5HA 1ZR2A 1L2PA 1P84E 2CKFA 1SQVK 1O7WA 5AVUB 3LIDA 1GDTA 2G3AA 4NBBD 1GU4A 5APQA 3D70A 1SQPG 1LTJB 1W5CE 1IJDB 5AVRB 2FFDB 1IFPA 3RGUA 1L4AC 2KZJA 2A45I 1GL2A 1SFCD 2HYNA 4HM1A 2E76D 2WT7B 4GDOA 1MKMA 1KD1Q 1S5LX 2WSEH 1PPJG 4UB6E 4MN4C 4WY4A 4WY4D 1ZRTD 2DE7D 1NTZE 2WSCH 3FX0A 2N1TC 3L74D 2P1JA 5AW9B 3VP9A 3W68A 3GTEA 1T3UA 3AE6C 2QJKC 1ZP0C 3AEAC 1NU1E 1DX7A 1YYCA 2WPVB 3K5BA 3V4WA 1S1CX 2AEFA 5APWA 5BVZA 1KMIZ 3V2PA 1OW7A 1WMKA 1X22A 4H44D 1DD4A 2Q7CA 2UWJE 3GMAA 1FQTA 4U7JA 1M1JC 1WT6A 4ASWA 1SQVJ 1AQTA 3QWOC 3AEEC 2KI7B 1KILC 3I5CA 3RK3C 1Q2NA 2O01H 3AZCA 2VRSA 3TGUG 3FWLA 4NBCD 1X0TA 3E1RA 5APXA 4NBED 2BEQD 3EFFK 3D89A 1FDIA 4O9BA 1BDCA 4W7YA 1NOHA 3N4XA 2HG5D 5DJUB 4D6TE 2XU6A 4QUQA 1VQ7P 4H13C 3B71A 1RY3A 2CK3H 2C0XA 1NTMD 1NAYA 4RO0A 3NFQA 1QL2A 1NGMB 2QJPB 3H1JJ 2NVGA 3L70J 2P7JA 1R8EA 5H2FE 1KQGB 1KYOD 1IFIA 3D6YA 2IFNA 1SQVG 3CWBE 5AEWA 2YFLA 2QG4A 1BDDA 2I1JA 3V6IA 2W6AA 1J1EB 1EDKA 4AIVA 2LKMA 1O7NA 3MUDA 3FWNA 3B4SA
chains in the Genus database with same CATH topology
1VM9A 3DQYA 4NBGD 1ZRTE 2E4QA 3GOBA 1ULJA 2Q3WA 3H1KE 2NWFA 3FOUA 3GTEA 4AAYB 2QJKC 4HM2A 1NU1E 2BCCE 3H1JE 2B24A 1G8KB 3N0QA 1VCKA 2HMKA 4NBHD 2JZAA 1PPJE 2FYNC 1BE3E 4QDFA 1O7PA 1NDOA 4QUPA 4H44D 4HM7A 4P1CH 1PP9E 3C0DA 5CXMA 2NVEA 1Q90C 2ZYLA 4NBFD 1FQTA 4NBDD 3L71E 1UUVA 2D2CD 2GBWA 1L0NE 3BCCE 1RFSA 3EQQA 4HM8A 3L74E 4H13D 3GL2A 1L0LE 4HJLA 4EMJB 1NTME 5HL4A 3VCPA 3L70E 2I7FA 2GBXA 5KKZC 3CXHE 3H1IE 3AZCA 1JM1A 4NBCD 2YVJB 3L72E 4NBED 5AEUA 3VCAA 3L75E 2QPZA 5BOKA 2XSHA 4PD4E 3D89A 1SQXE 3GTSA 3GZYA 2NVFA 2YFIA 2DE5D 3VMHD 1UUWA 1BCCE 2CKFA 1P84E 3L73E 1O7WA 2XR8A 2QJYC 4D6TE 1O7GA 4HM5A 4QUQA 5KLVE 4NBBD 3GKEA 2XRXA 3GZXA 4QDFB 2ZT9D 4QURA 3TGUE 1BGYE 1NYKA 2BMOA 4H0LD 4PV1D 2HMMA 2HMLA 3GCEA 1ULIA 5KLIC 3VMID 2XSOA 1VF5D 1RIEA 2DE6D 2JO6A 4QDDA 4HM6A 3H1LE 1NTKE 4QDCA 2E75D 4NBAD 1EZVE 1SQPE 3EN1A 2NVGA 4QCKA 2B1XA 4HM1A 2E76D 1O7HA 2E4PA 4HM4A 4NB9D 1SQVE 1KB9E 2IBZE 3GL0A 4HM0A 2HMJA 2NUMA 1EG9A 3GB4A 2A06E 3H1HE 2FYUE 2E74D 3CWBE 1SQQE 3CX5E 1SQBE 2DE7D 2BMQA 4NB8D 1G8JB 5AEWA 1SJGA 2YFLA 4HM3A 3VMGD 2YFJA 1NTZE 1KYOE 4P1BH 2HMOA 2YIUC 4AIVA 2BMRA 1O7NA 1O7MA 2HMNA 4HKVA 2NUKA 4OGQD 2QJPC 1WQLA 4U3FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VM9 A;  3DQY A;  4NBG D;  1ZRT E;  2E4Q A;  3GOB A;  1ULJ A;  2Q3W A;  3H1K E;  2NWF A;  3FOU A;  3GTE A;  4AAY B;  2QJK C;  4HM2 A;  1NU1 E;  2BCC E;  3H1J E;  2B24 A;  1G8K B;  3N0Q A;  1VCK A;  2HMK A;  4NBH D;  2JZA A;  1PPJ E;  2FYN C;  1BE3 E;  4QDF A;  1O7P A;  1NDO A;  4QUP A;  4H44 D;  4HM7 A;  4P1C H;  1PP9 E;  3C0D A;  5CXM A;  2NVE A;  1Q90 C;  2ZYL A;  4NBF D;  1FQT A;  4NBD D;  3L71 E;  1UUV A;  2D2C D;  2GBW A;  1L0N E;  3BCC E;  1RFS A;  3EQQ A;  4HM8 A;  3L74 E;  4H13 D;  3GL2 A;  1L0L E;  4HJL A;  4EMJ B;  1NTM E;  5HL4 A;  3VCP A;  3L70 E;  2I7F A;  2GBX A;  5KKZ C;  3CXH E;  3H1I E;  3AZC A;  1JM1 A;  4NBC D;  2YVJ B;  3L72 E;  4NBE D;  5AEU A;  3VCA A;  3L75 E;  2QPZ A;  5BOK A;  2XSH A;  4PD4 E;  3D89 A;  1SQX E;  3GTS A;  3GZY A;  2NVF A;  2YFI A;  2DE5 D;  3VMH D;  1UUW A;  1BCC E;  2CKF A;  1P84 E;  3L73 E;  1O7W A;  2XR8 A;  2QJY C;  4D6T E;  1O7G A;  4HM5 A;  4QUQ A;  5KLV E;  4NBB D;  3GKE A;  2XRX A;  3GZX A;  4QDF B;  2ZT9 D;  4QUR A;  3TGU E;  1BGY E;  1NYK A;  2BMO A;  4H0L D;  4PV1 D;  2HMM A;  2HML A;  3GCE A;  1ULI A;  5KLI C;  3VMI D;  2XSO A;  1VF5 D;  1RIE A;  2DE6 D;  2JO6 A;  4QDD A;  4HM6 A;  3H1L E;  1NTK E;  4QDC A;  2E75 D;  4NBA D;  1EZV E;  1SQP E;  3EN1 A;  2NVG A;  4QCK A;  2B1X A;  4HM1 A;  2E76 D;  1O7H A;  2E4P A;  4HM4 A;  4NB9 D;  1SQV E;  1KB9 E;  2IBZ E;  3GL0 A;  4HM0 A;  2HMJ A;  2NUM A;  1EG9 A;  3GB4 A;  2A06 E;  3H1H E;  2FYU E;  2E74 D;  3CWB E;  1SQQ E;  3CX5 E;  1SQB E;  2DE7 D;  2BMQ A;  4NB8 D;  1G8J B;  5AEW A;  1SJG A;  2YFL A;  4HM3 A;  3VMG D;  2YFJ A;  1NTZ E;  1KYO E;  4P1B H;  2HMO A;  2YIU C;  4AIV A;  2BMR A;  1O7N A;  1O7M A;  2HMN A;  4HKV A;  2NUK A;  4OGQ D;  2QJP C;  1WQL A;  4U3F E; 
#chains in the Genus database with same CATH topology
 3H1K E;  1L0N K;  3GHG A;  2HR3 A;  2WPQ A;  1BE3 E;  2YKQ A;  3L37 A;  4QDF A;  2W6J H;  2W6B A;  2IYO A;  3KZI H;  1UUV A;  4TLF A;  1PGQ A;  4C7N A;  1E79 H;  3L74 E;  3V2N A;  4W7Z A;  2QE7 H;  5EFW B;  3CC4 P;  3VCP A;  1JO5 A;  2Q3E A;  3NXS A;  1QL1 A;  2WPR A;  2KSE A;  4YPC A;  1DEB A;  1NU1 D;  3V2Q A;  1NTK J;  3H1L J;  3L72 E;  1FE6 A;  4YXD C;  3VCA A;  1G1J A;  2A45 H;  2YO3 A;  3L73 E;  1KYO I;  4IOI H;  1SFC A;  2FXO A;  4ZNC A;  3ITK A;  2A06 G;  5APS A;  2V7Q H;  2OGU A;  3AE1 C;  4LC1 A;  1OZH A;  2N1T A;  2M8R A;  3V5B A;  2R5D A;  4QDD A;  1QX8 A;  3H1H D;  3CCS P;  3Q3D A;  4AQR D;  4NPE A;  2ZYG A;  1QVF O;  1LP1 A;  1VL2 A;  3GL0 A;  2E42 A;  3U59 A;  2FXP A;  2FYU E;  4JYB A;  3B8E B;  2M0B A;  2OYI B;  3L72 G;  3JCU H;  2HMN A;  3LIE A;  3H1H J;  4HB1 A;  1JUN A;  1JTH A;  2K3R A;  3CWB G;  2KK7 A;  2P2U A;  3A0H E;  5CBO A;  1MZ9 A;  2BCC E;  3UIA A;  4BWN A;  2HFE D;  2PRR A;  2E74 B;  1SQQ J;  1GK6 A;  1USD A;  2FY8 A;  1KQF B;  5CXM A;  2Y9Y A;  4IFD K;  1JY2 P;  4HM8 A;  1EQ7 A;  3GL2 A;  1GZL A;  1QGK B;  1SQQ G;  1FOS E;  2I7F A;  1ZV8 A;  3D6Z A;  3TDK A;  2PP6 A;  2B87 B;  2L91 A;  2Q5U A;  1YIJ P;  1K8A Q;  1Y47 A;  2XRX A;  1YQ3 C;  1L0N D;  1YJW P;  3GF3 A;  3F89 A;  3B5N D;  2Y0D A;  1HGV A;  2O01 J;  4GOE A;  1N7L A;  3CD6 P;  3U1C A;  2W90 A;  2OYH A;  3AE2 C;  2YIU B;  4BRY B;  2JO6 A;  1MFT A;  3H1J D;  2Q3I A;  1FJP A;  1AA0 A;  2RN0 A;  3H1H E;  1NTK D;  3H1L D;  2FYU G;  1EXJ A;  2PGD A;  4B86 A;  1USE A;  3KQG A;  3IF4 A;  4OGQ D;  1OXZ A;  2FYU D;  4U3F E;  2OTJ P;  2ZT9 C;  2J5U A;  2AXT H;  3CX5 I;  3Q1M A;  1NTM J;  3A0B H;  4HM2 A;  1BSN A;  2E43 A;  1J1E C;  1NKN A;  2IDB A;  2WZ7 A;  3GLM A;  1KIL B;  1S5L H;  5K5G B;  3VYI A;  4KHX A;  1LP1 B;  3H1I J;  4PJ0 H;  3HD7 B;  3HD7 A;  1HUC A;  3G4S P;  2Z5H A;  2GBW A;  4JF7 A;  2AXC A;  4H13 D;  4EMJ B;  3RBX A;  3ABV C;  5CBN A;  3A0H H;  5AVQ B;  1HJ0 A;  4IL6 H;  3MHV A;  1JM1 A;  2BCC D;  1PP9 J;  4R4M A;  1L4A A;  5AEU A;  3CXH I;  2CPS A;  4M3L A;  3L4F A;  5CCG C;  1KTM A;  5CCG D;  3RL0 B;  3Q5S A;  3CME P;  2WIT A;  2WSE J;  4QUR A;  3H1J G;  2FXM A;  1BGY E;  1ZN5 A;  1LT1 A;  1BCC G;  3MUD C;  1NYK A;  1M7L A;  3P7K A;  2HML A;  1X8Y A;  3M06 A;  2WVR A;  1CW5 A;  1SQQ D;  3CX5 D;  3AE8 C;  2ZVO B;  2XKM A;  1SS1 A;  2IBZ G;  1T8Z A;  2BAS A;  3G6E P;  3HUS B;  4PJ0 E;  4NPD A;  5AVT B;  4CPG A;  1LTG C;  4NPF X;  3AE9 C;  1VQL P;  2E75 B;  1NTM K;  2RH0 A;  1HVV A;  5GTH E;  3CMA P;  2NWF A;  3H1J E;  1GW4 A;  3U1A A;  1PZQ A;  4U3F D;  2M3E A;  1L0L G;  3ZDM A;  3JSV C;  2YXQ B;  2QRX A;  1Q82 Q;  2NVE A;  3O6Q B;  2A45 G;  5E79 H;  3LW5 J;  1NTK G;  3H1L G;  2K88 A;  3G71 P;  2HLO A;  2JKV A;  3CX5 H;  3PHL A;  2R44 A;  2FYN B;  1IC2 A;  1AVY A;  3AED C;  4ZKP A;  4A7P A;  2R5B A;  1HWT C;  3VMY A;  1NO4 A;  2GUV A;  1YTZ I;  4Y99 C;  2WTY A;  1S4X A;  4JQ0 D;  1JTH B;  1NWQ A;  1EZV G;  3P8C E;  3TK1 A;  4DT0 A;  3CCM P;  5AVZ B;  1SQP D;  1KFM A;  5KAF E;  3GW6 A;  2HMM A;  4JPZ B;  5KLI C;  1SQB K;  4WWI A;  2KP8 A;  3TYY A;  4LGD E;  4PD4 D;  3JCU E;  1S72 P;  2E74 D;  3Q5P A;  2YKP A;  5KAI E;  1SQQ E;  1GL2 C;  3CX5 E;  4HKZ H;  1PGJ A;  2O3J A;  4IL6 E;  4K35 A;  1LTB C;  1VQM P;  1KFN A;  1NKZ B;  3BCC D;  1RF0 C;  3L73 G;  3MGN A;  1EDL A;  2IBZ I;  2E4Q A;  2OYH C;  4EDF A;  1LTS C;  2ZYD A;  1URQ A;  2B87 A;  2LXB A;  2B24 A;  3L71 G;  3RK2 C;  2HMK A;  1R5L A;  3FGA D;  3L70 G;  2LXC B;  3N7N A;  2YMY A;  5KLV K;  2KIK A;  2ZXE B;  1CI6 B;  4DJG A;  1BGY G;  4RES B;  2POH A;  5HL4 A;  1OW8 A;  3L71 J;  5B5E H;  2GBX A;  3NTN A;  2IPP A;  1XTC C;  3BAS A;  1Q81 Q;  2GM4 A;  2HOD B;  3L75 E;  1VF5 B;  1SQX E;  1NHL A;  3L73 J;  4DZO A;  1LTA C;  2I1K A;  1BGY J;  2QJY C;  2R32 A;  3PJS K;  1JOC A;  1O7G A;  1RE4 C;  1T2K C;  3EWK A;  1VQO P;  3AE3 C;  1T2K D;  3H1H G;  1FZE A;  1J1D B;  3B5N C;  1PL5 A;  2AEM A;  3W67 A;  2JR8 A;  2XSO A;  1VF5 D;  2KLV A;  1JCD A;  2QM8 A;  1SQP E;  3EN1 A;  2O1J A;  4HJG H;  3H25 A;  1M56 D;  4OGQ B;  1NAF A;  2LR2 A;  2RKL A;  1KB9 E;  2D2C B;  2IZ0 A;  2K1A A;  1FAV A;  1L4A B;  1KIL A;  1NU1 G;  2GUS A;  3H1K D;  4ZKU A;  1LNQ A;  3S9O A;  1OW6 A;  2NUK A;  1GK4 A;  4KJM A;  1N73 B;  1SQB G;  1URQ D;  1HH0 A;  3AEG C;  1VCK A;  3HTK A;  1GL2 B;  3CC7 P;  1PPJ E;  2QA4 P;  2K9J B;  5GTI H;  1WRG A;  4XFJ A;  3VMZ A;  5KKZ B;  1RF1 A;  3CL3 D;  3CI9 A;  4C46 A;  2KSJ A;  2PFX A;  3L71 E;  4UB8 H;  5AW2 B;  1DEE G;  1G2C A;  2BEZ F;  4GOD A;  2XNX A;  4WY4 C;  5APT A;  3L73 D;  3OW2 O;  1IK7 A;  2IZ1 A;  3TNU A;  2XSH A;  3QH9 A;  2KS1 B;  2HPC A;  1T6A A;  3S1K A;  3LW5 H;  1S9K D;  1W2B O;  5KAI H;  1VQ8 P;  1RF0 A;  3IR9 A;  2V4H A;  1YBK A;  1KYO H;  5KLV J;  1NTM G;  1PGO A;  4D6T G;  1ZXG A;  2QEX P;  2E75 D;  2E75 C;  3TGU D;  4AUW A;  1EC5 A;  2B1X A;  2Y0C A;  1SQX D;  2KNC A;  5KTB A;  4Z1M H;  2W27 A;  5AVV B;  1CI6 A;  3BRV B;  2H88 C;  5KLV G;  1LT9 B;  2I8D A;  1FC2 C;  1XTG B;  3PRJ A;  1G1I A;  2G8Y A;  1SVF A;  1LTI C;  4OH8 B;  1CSB A;  4AYC A;  1OIP A;  1WQL A;  3PLN A;  1UII A;  2H89 C;  1GW3 A;  1JY3 N;  2OYI A;  1PP9 D;  5AW1 B;  3AE4 C;  2ZXX A;  1L0N J;  4KT0 J;  3RK3 D;  4I7Z C;  2FYN C;  4U3F G;  4HYT B;  1IFM A;  1RE3 C;  3HTK B;  1O7P A;  1LTJ A;  1JMM A;  1OWA A;  5APY A;  1NU1 K;  3H1I D;  3HD7 D;  1NTZ G;  2FYU J;  4H13 B;  3G9R A;  1ZLL A;  1H0T B;  1K05 A;  2ZAE B;  3MZW B;  2YMK A;  4PD4 I;  2K37 A;  1VQ5 P;  2DE5 D;  3PH0 A;  3L36 A;  2XR8 A;  1MUU A;  4HM5 A;  5AVY B;  2ZT9 D;  1L0N G;  2WQY C;  4OGQ C;  1AVO A;  4PV1 B;  2IBZ D;  2DE6 D;  3PTZ A;  1OX3 A;  1GD2 E;  1YTZ T;  1MV8 A;  1NTK E;  3H1L E;  5APU A;  1OFC X;  5B66 H;  5KJ7 C;  4L73 A;  3VMX A;  1LWU B;  1LWU A;  1HGZ A;  2W83 C;  3L75 G;  3A2A A;  1SJG A;  4PD4 H;  1O7M A;  4HKV A;  1BE3 J;  1KB9 I;  1VQ9 P;  4NBG D;  2B88 A;  1N7S D;  1SQP K;  4AAY B;  5CCH C;  2Q3W A;  2QVA A;  1JEK A;  3KYQ A;  4N78 D;  2XV5 A;  1KB9 H;  4HM7 A;  1DD3 A;  2H7H A;  4EYY Q;  1PP9 E;  3R2P A;  3SFD C;  3B5N A;  4L75 A;  3RK3 E;  3EQQ A;  3KDP B;  1SQX J;  3GHG B;  1OVR A;  1SLQ A;  1ZW0 A;  1IO4 A;  1AFO A;  3WUU A;  3GG2 A;  3H1I E;  4I6M C;  3AEB C;  2QIW A;  4QMA A;  2W8Z A;  5BOK A;  4XE5 B;  1BE3 D;  3HRN A;  3RL0 g;  1RHZ B;  2YXR B;  1JNM A;  1GU5 A;  3M91 A;  3MD0 A;  1N73 A;  4LLH A;  1IFN A;  1L4A D;  1Y8A A;  3EFG A;  2H8P D;  1UIX A;  2K9J A;  1EDI A;  1FZC A;  4QDC A;  1OMI A;  1VQN P;  4ZMD A;  1EZV E;  3HE5 B;  3H6P A;  1AV1 A;  3MIW A;  1URQ B;  3TF5 A;  4NB9 D;  1DH3 A;  1SQV E;  2IBZ E;  2P58 A;  1LTJ C;  1Q7Y Q;  1S2E A;  3E7K A;  1FZF A;  3T97 A;  1N86 A;  3CCR P;  2BMQ A;  4GKG A;  1SQQ K;  1HJB A;  3TGU J;  4P1B H;  2FYZ A;  3DQY A;  1FBM A;  1KIL E;  1ULJ A;  2B89 A;  1PIX A;  3HD7 C;  3M9H A;  2HOD A;  4H44 B;  4IL6 X;  1L0L D;  1OVV A;  3C0D A;  2NPS D;  1H8A A;  3CXH D;  2R3C A;  3D71 A;  1PFI A;  2E76 B;  4GIF A;  4UB6 H;  3CCL P;  3A7O A;  2KLU A;  2WPS A;  4EOT A;  1CZQ A;  1FJK A;  4YXW H;  2XDJ A;  3GZY A;  2NVF A;  2R3S A;  3PP5 A;  1IZN B;  2KB7 P;  5KLV E;  3Q2Y A;  1NJI Q;  2AEJ A;  3CC2 P;  1FOS F;  3BRT B;  1BCC D;  1SQB J;  1VDF A;  4L76 A;  4WB4 A;  2RMZ A;  2JJL A;  3AEC C;  3M9Q A;  1LWU C;  4HH2 A;  2FBW C;  1A02 F;  4R4L A;  3V2R A;  4PV1 C;  3C8V A;  2FFD C;  2HMJ A;  2NUM A;  5GTI E;  1SQX K;  3KHU A;  1SQV D;  5TJH A;  3JC2 2;  2N9Y B;  1K9M Q;  2QJP C;  2MKV A;  3NMD A;  1ZOY C;  2P67 A;  1FDO A;  1G8K B;  2ZJS E;  2XZR A;  2ZVN B;  4H0L B;  3L72 D;  3R4Y A;  1TU3 F;  2J58 A;  2WSS H;  3L72 J;  2O1K A;  4P1C H;  1QVG O;  5M1B A;  1K73 Q;  3VTP C;  1YQ4 C;  2KXP B;  3AEF C;  4BRY A;  1LTT C;  3L35 A;  3L75 D;  1L0L E;  2ZYA A;  4GOF A;  3Q5R A;  4Y99 B;  3SWF A;  3SWK A;  1YJN P;  3CXH E;  2K9Y A;  1FZC C;  1NVO A;  2YVJ B;  2Q1K A;  2C0W A;  1Y9B A;  3GHG C;  1SQP J;  3GTS A;  3CCQ P;  1YHQ P;  3KPE A;  2Q6Q A;  3WUT A;  4XA4 A;  1GMJ A;  1KZU B;  1KC8 Q;  3AE7 C;  2E76 C;  2O01 N;  3O6Q A;  1P84 D;  3CCV P;  5B5E E;  1FZG A;  4I2L C;  1KB9 D;  2OTK E;  2XND H;  1L0L K;  1K04 A;  4QCK A;  4U3F J;  3L75 J;  2QJK B;  1ZR4 A;  1J1D C;  1NH4 A;  3B5N B;  1BE3 G;  1SQB E;  2FFD A;  4HM3 A;  3BCC G;  1URQ C;  1VM9 A;  1ZRT E;  1M1J B;  3FXD A;  1RQU A;  4IFF A;  4D6T J;  5CCH A;  4C7N B;  3L71 D;  3OAK A;  3RK3 B;  1FU1 A;  2H43 A;  5L8R J;  4QUP A;  1M1J A;  2MJZ A;  1Q90 C;  4NBF D;  4NBD D;  2YO2 A;  1L0N E;  3CCU P;  1VF5 C;  4HJL A;  4H0L C;  4DOJ A;  1HBW A;  2N9B A;  1GL2 D;  3HE4 A;  5AW6 B;  1X9V A;  1FZA A;  2WMM A;  1YI2 P;  3H32 A;  3H32 B;  2B9B A;  1EXI A;  2JWD A;  1N7S B;  2NPS A;  1N8R Q;  1X79 B;  2YKO A;  2Q9I A;  1Q90 D;  2ZFC A;  2KYV A;  2Z5I A;  5BU5 A;  3A0B E;  3GKE A;  3SFE C;  3OA7 A;  4BXL A;  3GZX A;  3TGU E;  3USS A;  5CHX A;  2OTL P;  2WSF H;  4H0L D;  4PV1 D;  1NTZ J;  3VMI D;  4GT1 A;  2BCC J;  1EZV I;  3CLQ A;  3H1I G;  4YTP C;  5E79 E;  5AW8 B;  1Z56 A;  3C9I A;  1NTK K;  1E5W A;  1EG9 A;  1P84 H;  4L74 A;  4NB8 D;  2N1T D;  1G8J B;  2BCC G;  3II6 A;  2Y9Z A;  1PP9 G;  1KYO E;  3VMA A;  2YIU C;  1RE3 A;  5BU8 B;  2D2C C;  2PAJ A;  4W80 A;  3CWB D;  1SQB D;  3M0A A;  3GOB A;  3FOU A;  3L74 G;  3BAT A;  1QLE D;  5H2F H;  3EQ2 A;  2JZA A;  1KQL A;  4WBA A;  1IFD A;  1N73 C;  5AW0 B;  4WVZ A;  2WSC J;  1HTL C;  1JB0 J;  4EIJ A;  1SP4 A;  2OQQ A;  1VQ6 P;  3M0D C;  2FKW B;  2E74 C;  3HUS A;  1M90 Q;  2NPS C;  2D2C D;  2IYP A;  3BCC E;  2QJY B;  4UB8 E;  1SFC B;  1JY2 O;  5KKZ C;  4I7Z B;  1KQS O;  4RJT A;  2OAR A;  2ITA A;  1S3J A;  1R5S A;  4K3A A;  5AVS B;  5KAF H;  3CCJ P;  1D7M A;  3HE5 A;  5CCG A;  5AVX B;  1FZC B;  2JO1 A;  2C9N Y;  3IFM A;  1PGP A;  3A3Y B;  2WWW A;  3KZI E;  4JBZ A;  1N7S A;  3O8Z A;  3TNU B;  1VQP P;  5AW3 B;  4OWF A;  1L0L J;  1RIE A;  3CXH H;  4JYC A;  2KOG A;  3WUV A;  1W2E A;  3RK2 D;  1HF9 A;  1M8O B;  3RL0 C;  5TIS H;  2KUB A;  5AW7 B;  5B66 E;  2DW3 A;  3GB4 A;  1LJ2 A;  2ZT9 B;  3MP7 B;  1KN7 A;  1JM0 A;  1FS0 E;  3CWB J;  1U57 A;  3VP8 A;  1LGH B;  1RF1 C;  2OYO A;  3VMG D;  2KZI A;  2HMO A;  2BMR A;  2P10 A;  2KNC B;  4N78 E;  3WMM 0;  3M0D A;  3L70 E;  5C39 A;  1LT9 C;  1PV3 A;  3M9B A;  4OVN F;  2JP3 A;  2E5Y A;  3RL0 D;  1JMB A;  4WY4 B;  4DCK A;  3MTU E;  3RBZ A;  1JY3 O;  3I55 P;  1OVU A;  1NDO A;  5TIS E;  2M5A B;  3P8C D;  4Y28 J;  1P84 I;  2L5G B;  2C9L Y;  1A02 J;  2CPB A;  1H89 A;  1AQ5 A;  1YJ9 P;  1SQX G;  2QPZ A;  1PPJ D;  4PD4 E;  2FYU K;  1IFJ A;  2YFI A;  1M57 D;  1UUW A;  2NRG A;  1RQV A;  2HPC B;  4QDF B;  5AW5 B;  1EZV D;  3GCE A;  1ULI A;  1NU1 J;  2IFM A;  2GA1 A;  2J59 M;  2A06 D;  4HM6 A;  3VOP A;  1H88 A;  3P32 A;  4HM4 A;  3C1L A;  1JCC A;  4N6J A;  2V7Q J;  1NTZ K;  2KS1 A;  1KIL D;  2WSF J;  5KLI B;  2YFJ A;  1ZME C;  2Z4E A;  3E1I A;  4RKU J;  3IN6 A;  1U7J A;  3V4Q A;  3SSU A;  3T97 B;  3S4R A;  3HE4 B;  2QSI A;  2YNY A;  3CCE P;  1FZB A;  1JY2 N;  3N0Q A;  2N1T B;  1GTW A;  3L70 D;  1QEX A;  1NYH A;  3G3Z A;  1U7M A;  1N7S C;  2ZYL A;  1RFS A;  2M5A A;  2E5T A;  2JDI H;  1M1K Q;  2Y0E A;  4IFM A;  3GF7 A;  1N2D C;  5KJ7 A;  5KLV D;  1LT9 A;  5CJ4 A;  1SFC C;  1BCC E;  2JWA A;  4N3Y B;  5GTH H;  1VQ4 P;  1AJY A;  2QM7 A;  5AW4 B;  3HUS C;  3VN0 A;  1VQK P;  2SPZ A;  2M3B A;  2BMO A;  1MFZ A;  3WU2 E;  4ASV A;  1VPC A;  5CMZ A;  5DJT B;  2NZ2 A;  5AVW B;  4NBA D;  1BGY D;  5CJ0 A;  1O7H A;  2E4P A;  1NTZ D;  2WT7 A;  1YIT P;  3SWY A;  4HM0 A;  1Q86 Q;  2A06 E;  2OYH B;  4EI2 A;  1H0T A;  3L74 J;  3FXE A;  3KXD A;  3BVH A;  3RK2 B;  3AE5 C;  3TSI A;  1RH5 B;  3I56 P;  1DIP A;  4C7R A;  4I1L A;  2NPS B;  3A5T A;  3P8M C;  1T3J A;  1RF1 B;  1G2C B;  1FDM A;  1IK9 A;  4NBH D;  5KJ7 D;  3H1K J;  2OYI C;  5APV A;  1RE4 A;  1S9K E;  4D6T D;  1BSH A;  1KV4 A;  1KOR A;  2AXT E;  1JY3 P;  1BCC J;  4TT3 H;  2JEE A;  3WU2 H;  2IX7 C;  4H44 C;  1NTM E;  3OJA B;  3BCC J;  3IAO A;  3CPW O;  3H1K G;  1S5L E;  5CCH D;  1J2J B;  1EDJ A;  3VMH D;  3F5H A;  1ZR2 A;  1L2P A;  1P84 E;  2CKF A;  1SQV K;  1O7W A;  5AVU B;  3LID A;  1GDT A;  2G3A A;  4NBB D;  1GU4 A;  5APQ A;  3D70 A;  1SQP G;  1LTJ B;  1W5C E;  1IJD B;  5AVR B;  2FFD B;  1IFP A;  3RGU A;  1L4A C;  2KZJ A;  2A45 I;  1GL2 A;  1SFC D;  2HYN A;  4HM1 A;  2E76 D;  2WT7 B;  4GDO A;  1MKM A;  1KD1 Q;  1S5L X;  2WSE H;  1PPJ G;  4UB6 E;  4MN4 C;  4WY4 A;  4WY4 D;  1ZRT D;  2DE7 D;  1NTZ E;  2WSC H;  3FX0 A;  2N1T C;  3L74 D;  2P1J A;  5AW9 B;  3VP9 A;  3W68 A;  3GTE A;  1T3U A;  3AE6 C;  2QJK C;  1ZP0 C;  3AEA C;  1NU1 E;  1DX7 A;  1YYC A;  2WPV B;  3K5B A;  3V4W A;  1S1C X;  2AEF A;  5APW A;  5BVZ A;  1KMI Z;  3V2P A;  1OW7 A;  1WMK A;  1X22 A;  4H44 D;  1DD4 A;  2Q7C A;  2UWJ E;  3GMA A;  1FQT A;  4U7J A;  1M1J C;  1WT6 A;  4ASW A;  1SQV J;  1AQT A;  3QWO C;  3AEE C;  2KI7 B;  1KIL C;  3I5C A;  3RK3 C;  1Q2N A;  2O01 H;  3AZC A;  2VRS A;  3TGU G;  3FWL A;  4NBC D;  1X0T A;  3E1R A;  5APX A;  4NBE D;  2BEQ D;  3EFF K;  3D89 A;  1FDI A;  4O9B A;  1BDC A;  4W7Y A;  1NOH A;  3N4X A;  2HG5 D;  5DJU B;  4D6T E;  2XU6 A;  4QUQ A;  1VQ7 P;  4H13 C;  3B71 A;  1RY3 A;  2CK3 H;  2C0X A;  1NTM D;  1NAY A;  4RO0 A;  3NFQ A;  1QL2 A;  1NGM B;  2QJP B;  3H1J J;  2NVG A;  3L70 J;  2P7J A;  1R8E A;  5H2F E;  1KQG B;  1KYO D;  1IFI A;  3D6Y A;  2IFN A;  1SQV G;  3CWB E;  5AEW A;  2YFL A;  2QG4 A;  1BDD A;  2I1J A;  3V6I A;  2W6A A;  1J1E B;  1EDK A;  4AIV A;  2LKM A;  1O7N A;  3MUD A;  3FWN A;  3B4S A; 
#chains in the Genus database with same CATH homology
 1VM9 A;  3DQY A;  4NBG D;  1ZRT E;  2E4Q A;  3GOB A;  1ULJ A;  2Q3W A;  3H1K E;  2NWF A;  3FOU A;  3GTE A;  4AAY B;  2QJK C;  4HM2 A;  1NU1 E;  2BCC E;  3H1J E;  2B24 A;  1G8K B;  3N0Q A;  1VCK A;  2HMK A;  4NBH D;  2JZA A;  1PPJ E;  2FYN C;  1BE3 E;  4QDF A;  1O7P A;  1NDO A;  4QUP A;  4H44 D;  4HM7 A;  4P1C H;  1PP9 E;  3C0D A;  5CXM A;  2NVE A;  1Q90 C;  2ZYL A;  4NBF D;  1FQT A;  4NBD D;  3L71 E;  1UUV A;  2D2C D;  2GBW A;  1L0N E;  3BCC E;  1RFS A;  3EQQ A;  4HM8 A;  3L74 E;  4H13 D;  3GL2 A;  1L0L E;  4HJL A;  4EMJ B;  1NTM E;  5HL4 A;  3VCP A;  3L70 E;  2I7F A;  2GBX A;  5KKZ C;  3CXH E;  3H1I E;  3AZC A;  1JM1 A;  4NBC D;  2YVJ B;  3L72 E;  4NBE D;  5AEU A;  3VCA A;  3L75 E;  2QPZ A;  5BOK A;  2XSH A;  4PD4 E;  3D89 A;  1SQX E;  3GTS A;  3GZY A;  2NVF A;  2YFI A;  2DE5 D;  3VMH D;  1UUW A;  1BCC E;  2CKF A;  1P84 E;  3L73 E;  1O7W A;  2XR8 A;  2QJY C;  4D6T E;  1O7G A;  4HM5 A;  4QUQ A;  5KLV E;  4NBB D;  3GKE A;  2XRX A;  3GZX A;  4QDF B;  2ZT9 D;  4QUR A;  3TGU E;  1BGY E;  1NYK A;  2BMO A;  4H0L D;  4PV1 D;  2HMM A;  2HML A;  3GCE A;  1ULI A;  5KLI C;  3VMI D;  2XSO A;  1VF5 D;  1RIE A;  2DE6 D;  2JO6 A;  4QDD A;  4HM6 A;  3H1L E;  1NTK E;  4QDC A;  2E75 D;  4NBA D;  1EZV E;  1SQP E;  3EN1 A;  2NVG A;  4QCK A;  2B1X A;  4HM1 A;  2E76 D;  1O7H A;  2E4P A;  4HM4 A;  4NB9 D;  1SQV E;  1KB9 E;  2IBZ E;  3GL0 A;  4HM0 A;  2HMJ A;  2NUM A;  1EG9 A;  3GB4 A;  2A06 E;  3H1H E;  2FYU E;  2E74 D;  3CWB E;  1SQQ E;  3CX5 E;  1SQB E;  2DE7 D;  2BMQ A;  4NB8 D;  1G8J B;  5AEW A;  1SJG A;  2YFL A;  4HM3 A;  3VMG D;  2YFJ A;  1NTZ E;  1KYO E;  4P1B H;  2HMO A;  2YIU C;  4AIV A;  2BMR A;  1O7N A;  1O7M A;  2HMN A;  4HKV A;  2NUK A;  4OGQ D;  2QJP C;  1WQL A;  4U3F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...