1JM1A

Crystal structure of the soluble domain of the rieske protein ii (soxf) from sulfolobus acidocaldarius
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
b'NTDGLAGFPRYKVANIQQVQQQIKSSGCAVYFFAYPLTDEPCFLVDLQALTGQQITEIPNPYYGKYAGPLGQIQTIKGVGPNGTIFAFSDVCVHLGCQLPAQVIVSSESDPGLYAKGADLHCPCHGSIYALKDGGVVVSGPAPRPLPIVILDYDSSTGDIYAVGTNAPYFSAGIPRTTPQDNLLYDPRYSYSVPNNPSCSNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rieske iron-sulfur protein soxF
publication title The structure of the soluble domain of an archaeal Rieske iron-sulfur protein at 1.1 A resolution.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Electron transport, oxidoreductase
total genus 50
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1jm1A00
3L75E 2BMOA 2Q3WA 4NBGD 1PPJE 1EZVE 1O7NA 1RIEA 3GL2A 4H0LD 2FYUE 4HM0A 4NBBD 1SQPE 1EG9A 2DE6D 1ZRTE 2E76D 3H1JE 1VCKA 2QPZA 3GZXA 3N0QA 1SQBE 3AZCA 4HM8A 3GL0A 1O7GA 4QCKA 1NU1E 2HMKA 2BMQA 3FOUA 4NB8D 4NBFD 4QDCA 3GZYA 3GCEA 4EMJB 4QDFA 3VMID 1UUWA 2E4PA 1PP9E 4AIVA 4P1CH 1UUVA 2ZT9D 1SQQE 5AEWA 2QJYC 1RFSA 3L71E 1O7MA 1ULIA 3VCPA 4HM4A 4OGQD 1O7WA 4QUPA 2CKFA 1O7PA 4HJLA 3TGUE 1NDOA 4U3FE 4QURA 1FQTA 4NBED 3GTEA 4H44D 2FYNC 2GBXA 2NUKA 3L70E 2NVGA 1ULJA 3CWBE 1SQVE 2XR8A 2D2CD 1L0LE 2B1XA 4QDFB 2BMRA 2A06E 5KLIC 3C0DA 1L0NE 1NYKA 3L72E 1NTZE 2JO6A 1G8JB 3VMHD 4QDDA 1P84E 2NWFA 4NBAD 3CX5E 1SJGA 3D89A 5KKZC 3EQQA 4NBCD 1BE3E 2YVJB 4HM7A 1KB9E 2QJPC 1O7HA 2YFIA 4HM6A 1NTME 1SQXE 3L73E 3VMGD 2HMLA 2I7FA 3GKEA 1KYOE 2XSHA 2XRXA 4AAYB 4NBDD 4HM3A 2ZYLA 1WQLA 3H1HE 4P1BH 5CXMA 3DQYA 1NTKE 2YFLA 3L74E 2JZAA 3CXHE 1VM9A 2B24A 4PD4E 1Q90C 2HMOA 2NVFA 4PV1D 2E74D 4HM5A 2DE7D 2XSOA 5KLVE 2NUMA 2HMNA 4H13D 4NB9D 1JM1A 2E4QA 4QUQA 2E75D 3GTSA 3GOBA 3H1IE 3H1KE 1G8KB 3EN1A 3BCCE 1VF5D 4HKVA 4NBHD 2GBWA 2YIUC 2QJKC 2HMJA 2BCCE 2YFJA 5BOKA 2DE5D 3GB4A 2IBZE 2NVEA 5AEUA 2HMMA 3H1LE 4HM2A 5HL4A 3VCAA 4HM1A 1BCCE
chains in the Genus database with same CATH superfamily
3L75E 2BMOA 2Q3WA 4NBGD 1PPJE 1EZVE 1O7NA 1RIEA 3GL2A 4H0LD 2FYUE 4HM0A 4NBBD 1SQPE 1EG9A 2DE6D 1ZRTE 2E76D 3H1JE 1VCKA 2QPZA 3GZXA 3N0QA 1SQBE 3AZCA 4HM8A 3GL0A 1O7GA 4QCKA 1NU1E 2HMKA 2BMQA 3FOUA 4NB8D 4NBFD 4QDCA 3GZYA 3GCEA 4EMJB 4QDFA 3VMID 1UUWA 2E4PA 1PP9E 4AIVA 4P1CH 1UUVA 2ZT9D 1SQQE 5AEWA 2QJYC 1RFSA 3L71E 1O7MA 1ULIA 3VCPA 4HM4A 4OGQD 1O7WA 4QUPA 2CKFA 1O7PA 4HJLA 3TGUE 1NDOA 4U3FE 4QURA 1FQTA 4NBED 3GTEA 4H44D 2FYNC 2GBXA 2NUKA 3L70E 2NVGA 1ULJA 3CWBE 1SQVE 2XR8A 2D2CD 1L0LE 2B1XA 4QDFB 2BMRA 2A06E 5KLIC 3C0DA 1L0NE 1NYKA 3L72E 1NTZE 2JO6A 1G8JB 3VMHD 4QDDA 1P84E 2NWFA 4NBAD 3CX5E 1SJGA 3D89A 5KKZC 3EQQA 4NBCD 1BE3E 2YVJB 4HM7A 1KB9E 2QJPC 1O7HA 2YFIA 4HM6A 1NTME 1SQXE 3L73E 3VMGD 2HMLA 2I7FA 3GKEA 1KYOE 2XSHA 2XRXA 4AAYB 4NBDD 4HM3A 2ZYLA 1WQLA 3H1HE 4P1BH 5CXMA 3DQYA 1NTKE 2YFLA 3L74E 2JZAA 3CXHE 1VM9A 2B24A 4PD4E 1Q90C 2HMOA 2NVFA 4PV1D 2E74D 4HM5A 2DE7D 2XSOA 5KLVE 2NUMA 2HMNA 4H13D 4NB9D 1JM1A 2E4QA 4QUQA 2E75D 3GTSA 3GOBA 3H1IE 3H1KE 1G8KB 3EN1A 3BCCE 1VF5D 4HKVA 4NBHD 2GBWA 2YIUC 2QJKC 2HMJA 2BCCE 2YFJA 5BOKA 2DE5D 3GB4A 2IBZE 2NVEA 5AEUA 2HMMA 3H1LE 4HM2A 5HL4A 3VCAA 4HM1A 1BCCE
chains in the Genus database with same CATH topology
3L75E 2BMOA 2Q3WA 4NBGD 1PPJE 1EZVE 1O7NA 1RIEA 3GL2A 4H0LD 2FYUE 4HM0A 4NBBD 1SQPE 1EG9A 2DE6D 1ZRTE 2E76D 3H1JE 1VCKA 2QPZA 3GZXA 3N0QA 1SQBE 3AZCA 4HM8A 3GL0A 1O7GA 4QCKA 1NU1E 2HMKA 2BMQA 3FOUA 4NB8D 4NBFD 4QDCA 3GZYA 3GCEA 4EMJB 4QDFA 3VMID 1UUWA 2E4PA 1PP9E 4AIVA 4P1CH 1UUVA 2ZT9D 1SQQE 5AEWA 2QJYC 1RFSA 3L71E 1O7MA 1ULIA 3VCPA 4HM4A 4OGQD 1O7WA 4QUPA 2CKFA 1O7PA 4HJLA 3TGUE 1NDOA 4U3FE 4QURA 1FQTA 4NBED 3GTEA 4H44D 2FYNC 2GBXA 2NUKA 3L70E 2NVGA 1ULJA 3CWBE 1SQVE 2XR8A 2D2CD 1L0LE 2B1XA 4QDFB 2BMRA 2A06E 5KLIC 3C0DA 1L0NE 1NYKA 3L72E 1NTZE 2JO6A 1G8JB 3VMHD 4QDDA 1P84E 2NWFA 4NBAD 3CX5E 1SJGA 3D89A 5KKZC 3EQQA 4NBCD 1BE3E 2YVJB 4HM7A 1KB9E 2QJPC 1O7HA 2YFIA 4HM6A 1NTME 1SQXE 3L73E 3VMGD 2HMLA 2I7FA 3GKEA 1KYOE 2XSHA 2XRXA 4AAYB 4NBDD 4HM3A 2ZYLA 1WQLA 3H1HE 4P1BH 5CXMA 3DQYA 1NTKE 2YFLA 3L74E 2JZAA 3CXHE 1VM9A 2B24A 4PD4E 1Q90C 2HMOA 2NVFA 4PV1D 2E74D 4HM5A 2DE7D 2XSOA 5KLVE 2NUMA 2HMNA 4H13D 4NB9D 1JM1A 2E4QA 4QUQA 2E75D 3GTSA 3GOBA 3H1IE 3H1KE 1G8KB 3EN1A 3BCCE 1VF5D 4HKVA 4NBHD 2GBWA 2YIUC 2QJKC 2HMJA 2BCCE 2YFJA 5BOKA 2DE5D 3GB4A 2IBZE 2NVEA 5AEUA 2HMMA 3H1LE 4HM2A 5HL4A 3VCAA 4HM1A 1BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 E;  2BMO A;  2Q3W A;  4NBG D;  1PPJ E;  1EZV E;  1O7N A;  1RIE A;  3GL2 A;  4H0L D;  2FYU E;  4HM0 A;  4NBB D;  1SQP E;  1EG9 A;  2DE6 D;  1ZRT E;  2E76 D;  3H1J E;  1VCK A;  2QPZ A;  3GZX A;  3N0Q A;  1SQB E;  3AZC A;  4HM8 A;  3GL0 A;  1O7G A;  4QCK A;  1NU1 E;  2HMK A;  2BMQ A;  3FOU A;  4NB8 D;  4NBF D;  4QDC A;  3GZY A;  3GCE A;  4EMJ B;  4QDF A;  3VMI D;  1UUW A;  2E4P A;  1PP9 E;  4AIV A;  4P1C H;  1UUV A;  2ZT9 D;  1SQQ E;  5AEW A;  2QJY C;  1RFS A;  3L71 E;  1O7M A;  1ULI A;  3VCP A;  4HM4 A;  4OGQ D;  1O7W A;  4QUP A;  2CKF A;  1O7P A;  4HJL A;  3TGU E;  1NDO A;  4U3F E;  4QUR A;  1FQT A;  4NBE D;  3GTE A;  4H44 D;  2FYN C;  2GBX A;  2NUK A;  3L70 E;  2NVG A;  1ULJ A;  3CWB E;  1SQV E;  2XR8 A;  2D2C D;  1L0L E;  2B1X A;  4QDF B;  2BMR A;  2A06 E;  5KLI C;  3C0D A;  1L0N E;  1NYK A;  3L72 E;  1NTZ E;  2JO6 A;  1G8J B;  3VMH D;  4QDD A;  1P84 E;  2NWF A;  4NBA D;  3CX5 E;  1SJG A;  3D89 A;  5KKZ C;  3EQQ A;  4NBC D;  1BE3 E;  2YVJ B;  4HM7 A;  1KB9 E;  2QJP C;  1O7H A;  2YFI A;  4HM6 A;  1NTM E;  1SQX E;  3L73 E;  3VMG D;  2HML A;  2I7F A;  3GKE A;  1KYO E;  2XSH A;  2XRX A;  4AAY B;  4NBD D;  4HM3 A;  2ZYL A;  1WQL A;  3H1H E;  4P1B H;  5CXM A;  3DQY A;  1NTK E;  2YFL A;  3L74 E;  2JZA A;  3CXH E;  1VM9 A;  2B24 A;  4PD4 E;  1Q90 C;  2HMO A;  2NVF A;  4PV1 D;  2E74 D;  4HM5 A;  2DE7 D;  2XSO A;  5KLV E;  2NUM A;  2HMN A;  4H13 D;  4NB9 D;  1JM1 A;  2E4Q A;  4QUQ A;  2E75 D;  3GTS A;  3GOB A;  3H1I E;  3H1K E;  1G8K B;  3EN1 A;  3BCC E;  1VF5 D;  4HKV A;  4NBH D;  2GBW A;  2YIU C;  2QJK C;  2HMJ A;  2BCC E;  2YFJ A;  5BOK A;  2DE5 D;  3GB4 A;  2IBZ E;  2NVE A;  5AEU A;  2HMM A;  3H1L E;  4HM2 A;  5HL4 A;  3VCA A;  4HM1 A;  1BCC E; 
#chains in the Genus database with same CATH topology
 3L75 E;  2BMO A;  2Q3W A;  4NBG D;  1PPJ E;  1EZV E;  1O7N A;  1RIE A;  3GL2 A;  4H0L D;  2FYU E;  4HM0 A;  4NBB D;  1SQP E;  1EG9 A;  2DE6 D;  1ZRT E;  2E76 D;  3H1J E;  1VCK A;  2QPZ A;  3GZX A;  3N0Q A;  1SQB E;  3AZC A;  4HM8 A;  3GL0 A;  1O7G A;  4QCK A;  1NU1 E;  2HMK A;  2BMQ A;  3FOU A;  4NB8 D;  4NBF D;  4QDC A;  3GZY A;  3GCE A;  4EMJ B;  4QDF A;  3VMI D;  1UUW A;  2E4P A;  1PP9 E;  4AIV A;  4P1C H;  1UUV A;  2ZT9 D;  1SQQ E;  5AEW A;  2QJY C;  1RFS A;  3L71 E;  1O7M A;  1ULI A;  3VCP A;  4HM4 A;  4OGQ D;  1O7W A;  4QUP A;  2CKF A;  1O7P A;  4HJL A;  3TGU E;  1NDO A;  4U3F E;  4QUR A;  1FQT A;  4NBE D;  3GTE A;  4H44 D;  2FYN C;  2GBX A;  2NUK A;  3L70 E;  2NVG A;  1ULJ A;  3CWB E;  1SQV E;  2XR8 A;  2D2C D;  1L0L E;  2B1X A;  4QDF B;  2BMR A;  2A06 E;  5KLI C;  3C0D A;  1L0N E;  1NYK A;  3L72 E;  1NTZ E;  2JO6 A;  1G8J B;  3VMH D;  4QDD A;  1P84 E;  2NWF A;  4NBA D;  3CX5 E;  1SJG A;  3D89 A;  5KKZ C;  3EQQ A;  4NBC D;  1BE3 E;  2YVJ B;  4HM7 A;  1KB9 E;  2QJP C;  1O7H A;  2YFI A;  4HM6 A;  1NTM E;  1SQX E;  3L73 E;  3VMG D;  2HML A;  2I7F A;  3GKE A;  1KYO E;  2XSH A;  2XRX A;  4AAY B;  4NBD D;  4HM3 A;  2ZYL A;  1WQL A;  3H1H E;  4P1B H;  5CXM A;  3DQY A;  1NTK E;  2YFL A;  3L74 E;  2JZA A;  3CXH E;  1VM9 A;  2B24 A;  4PD4 E;  1Q90 C;  2HMO A;  2NVF A;  4PV1 D;  2E74 D;  4HM5 A;  2DE7 D;  2XSO A;  5KLV E;  2NUM A;  2HMN A;  4H13 D;  4NB9 D;  1JM1 A;  2E4Q A;  4QUQ A;  2E75 D;  3GTS A;  3GOB A;  3H1I E;  3H1K E;  1G8K B;  3EN1 A;  3BCC E;  1VF5 D;  4HKV A;  4NBH D;  2GBW A;  2YIU C;  2QJK C;  2HMJ A;  2BCC E;  2YFJ A;  5BOK A;  2DE5 D;  3GB4 A;  2IBZ E;  2NVE A;  5AEU A;  2HMM A;  3H1L E;  4HM2 A;  5HL4 A;  3VCA A;  4HM1 A;  1BCC E; 
#chains in the Genus database with same CATH homology
 3L75 E;  2BMO A;  2Q3W A;  4NBG D;  1PPJ E;  1EZV E;  1O7N A;  1RIE A;  3GL2 A;  4H0L D;  2FYU E;  4HM0 A;  4NBB D;  1SQP E;  1EG9 A;  2DE6 D;  1ZRT E;  2E76 D;  3H1J E;  1VCK A;  2QPZ A;  3GZX A;  3N0Q A;  1SQB E;  3AZC A;  4HM8 A;  3GL0 A;  1O7G A;  4QCK A;  1NU1 E;  2HMK A;  2BMQ A;  3FOU A;  4NB8 D;  4NBF D;  4QDC A;  3GZY A;  3GCE A;  4EMJ B;  4QDF A;  3VMI D;  1UUW A;  2E4P A;  1PP9 E;  4AIV A;  4P1C H;  1UUV A;  2ZT9 D;  1SQQ E;  5AEW A;  2QJY C;  1RFS A;  3L71 E;  1O7M A;  1ULI A;  3VCP A;  4HM4 A;  4OGQ D;  1O7W A;  4QUP A;  2CKF A;  1O7P A;  4HJL A;  3TGU E;  1NDO A;  4U3F E;  4QUR A;  1FQT A;  4NBE D;  3GTE A;  4H44 D;  2FYN C;  2GBX A;  2NUK A;  3L70 E;  2NVG A;  1ULJ A;  3CWB E;  1SQV E;  2XR8 A;  2D2C D;  1L0L E;  2B1X A;  4QDF B;  2BMR A;  2A06 E;  5KLI C;  3C0D A;  1L0N E;  1NYK A;  3L72 E;  1NTZ E;  2JO6 A;  1G8J B;  3VMH D;  4QDD A;  1P84 E;  2NWF A;  4NBA D;  3CX5 E;  1SJG A;  3D89 A;  5KKZ C;  3EQQ A;  4NBC D;  1BE3 E;  2YVJ B;  4HM7 A;  1KB9 E;  2QJP C;  1O7H A;  2YFI A;  4HM6 A;  1NTM E;  1SQX E;  3L73 E;  3VMG D;  2HML A;  2I7F A;  3GKE A;  1KYO E;  2XSH A;  2XRX A;  4AAY B;  4NBD D;  4HM3 A;  2ZYL A;  1WQL A;  3H1H E;  4P1B H;  5CXM A;  3DQY A;  1NTK E;  2YFL A;  3L74 E;  2JZA A;  3CXH E;  1VM9 A;  2B24 A;  4PD4 E;  1Q90 C;  2HMO A;  2NVF A;  4PV1 D;  2E74 D;  4HM5 A;  2DE7 D;  2XSO A;  5KLV E;  2NUM A;  2HMN A;  4H13 D;  4NB9 D;  1JM1 A;  2E4Q A;  4QUQ A;  2E75 D;  3GTS A;  3GOB A;  3H1I E;  3H1K E;  1G8K B;  3EN1 A;  3BCC E;  1VF5 D;  4HKV A;  4NBH D;  2GBW A;  2YIU C;  2QJK C;  2HMJ A;  2BCC E;  2YFJ A;  5BOK A;  2DE5 D;  3GB4 A;  2IBZ E;  2NVE A;  5AEU A;  2HMM A;  3H1L E;  4HM2 A;  5HL4 A;  3VCA A;  4HM1 A;  1BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...