1JM1A

Crystal structure of the soluble domain of the rieske protein ii (soxf) from sulfolobus acidocaldarius
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
202
structure length
202
Chain Sequence
NTDGLAGFPRYKVANIQQVQQQIKSSGCAVYFFAYPLTDEPCFLVDLQALTGQQITEIPNPYYGKYAGPLGQIQTIKGVGPNGTIFAFSDVCVHLGCQLPAQVIVSSESDPGLYAKGADLHCPCHGSIYALKDGGVVVSGPAPRPLPIVILDYDSSTGDIYAVGTNAPYFSAGIPRTTPQDNLLYDPRYSYSVPNNPSCSNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the soluble domain of an archaeal Rieske iron-sulfur protein at 1.1 A resolution.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Electron transport, oxidoreductase
molecule keywords Rieske iron-sulfur protein soxF
total genus 50
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2001-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1jm1A00
2E75D 3GOBA 2E74D 4QDCA 1ULJA 1UUWA 1L0NE 1O7GA 2HMKA 1SQBE 4NBGD 1P84E 4P1BH 5HL4A 3L74E 3L75E 2JZAA 3CXHE 2XR8A 1O7PA 4QUQA 5KLIC 2NUMA 1EG9A 3CWBE 3GKEA 3H1JE 4QDDA 5BOKA 3EQQA 5AEWA 2GBWA 3DQYA 4QDFB 3TGUE 3N0QA 2ZYLA 1PPJE 2B24A 1KYOE 2CKFA 2YFLA 4NBFD 2NVFA 4PV1D 2NVEA 1G8JB 1O7MA 2QJKC 1SQQE 4NBAD 4NBED 4NBBD 5KLVE 1L0LE 4HM5A 2YIUC 1ULIA 1WQLA 2HMMA 3BCCE 3AZCA 4NB9D 1NDOA 3H1KE 4OGQD 1PP9E 3VCAA 2BMRA 3VMGD 2ZT9D 2FYUE 2I7FA 2XRXA 3GTSA 3H1LE 1Q90C 4HM2A 1NTME 4NBDD 3GL2A 2BMOA 1SJGA 1JM1A 4HM3A 4H44D 2QJYC 1BE3E 1VCKA 3GB4A 4HM8A 4AAYB 2Q3WA 1O7HA 4EMJB 3L70E 3VCPA 1O7NA 3GTEA 4HKVA 3GZXA 2DE7D 3EN1A 2HMNA 2GBXA 2BMQA 4HM7A 2DE5D 4U3FE 3H1IE 1VF5D 1O7WA 2E76D 4NBCD 4QCKA 2XSOA 3VMHD 1SQVE 3VMID 4P1CH 2NVGA 5KKZC 1SQPE 1BCCE 1NU1E 1FQTA 2IBZE 2NWFA 4NBHD 2BCCE 2D2CD 4QUPA 4HM6A 2B1XA 2E4QA 3L72E 1NTZE 3D89A 1NYKA 4AIVA 5CXMA 2QPZA 1NTKE 4HM0A 3CX5E 3GL0A 2QJPC 3L71E 2FYNC 4HM4A 4HJLA 1KB9E 2HMJA 4HM1A 3H1HE 2YFJA 2XSHA 3GZYA 3L73E 1SQXE 2A06E 2DE6D 4H0LD 2JO6A 2HMLA 2E4PA 1RFSA 3FOUA 1VM9A 1EZVE 3GCEA 1UUVA 2HMOA 2NUKA 2YFIA 3C0DA 1RIEA 5AEUA 4H13D 4PD4E 4QURA 1ZRTE 4NB8D 4QDFA 1G8KB 2YVJB
chains in the Genus database with same CATH superfamily
2E75D 3GOBA 2E74D 4QDCA 1ULJA 1UUWA 1L0NE 1O7GA 2HMKA 1SQBE 4NBGD 1P84E 4P1BH 5HL4A 3L74E 3L75E 2JZAA 3CXHE 2XR8A 1O7PA 4QUQA 5KLIC 2NUMA 1EG9A 3CWBE 3GKEA 3H1JE 4QDDA 5BOKA 3EQQA 5AEWA 2GBWA 3DQYA 4QDFB 3TGUE 3N0QA 2ZYLA 1PPJE 2B24A 1KYOE 2CKFA 2YFLA 4NBFD 2NVFA 4PV1D 2NVEA 1G8JB 1O7MA 2QJKC 1SQQE 4NBAD 4NBED 4NBBD 5KLVE 1L0LE 4HM5A 2YIUC 1ULIA 1WQLA 2HMMA 3BCCE 3AZCA 4NB9D 1NDOA 3H1KE 4OGQD 1PP9E 3VCAA 2BMRA 3VMGD 2ZT9D 2FYUE 2I7FA 2XRXA 3GTSA 3H1LE 1Q90C 4HM2A 1NTME 4NBDD 3GL2A 2BMOA 1SJGA 1JM1A 4HM3A 4H44D 2QJYC 1BE3E 1VCKA 3GB4A 4HM8A 4AAYB 2Q3WA 1O7HA 4EMJB 3L70E 3VCPA 1O7NA 3GTEA 4HKVA 3GZXA 2DE7D 3EN1A 2HMNA 2GBXA 2BMQA 4HM7A 2DE5D 4U3FE 3H1IE 1VF5D 1O7WA 2E76D 4NBCD 4QCKA 2XSOA 3VMHD 1SQVE 3VMID 4P1CH 2NVGA 5KKZC 1SQPE 1BCCE 1NU1E 1FQTA 2IBZE 2NWFA 4NBHD 2BCCE 2D2CD 4QUPA 4HM6A 2B1XA 2E4QA 3L72E 1NTZE 3D89A 1NYKA 4AIVA 5CXMA 2QPZA 1NTKE 4HM0A 3CX5E 3GL0A 2QJPC 3L71E 2FYNC 4HM4A 4HJLA 1KB9E 2HMJA 4HM1A 3H1HE 2YFJA 2XSHA 3GZYA 3L73E 1SQXE 2A06E 2DE6D 4H0LD 2JO6A 2HMLA 2E4PA 1RFSA 3FOUA 1VM9A 1EZVE 3GCEA 1UUVA 2HMOA 2NUKA 2YFIA 3C0DA 1RIEA 5AEUA 4H13D 4PD4E 4QURA 1ZRTE 4NB8D 4QDFA 1G8KB 2YVJB
chains in the Genus database with same CATH topology
2E75D 3GOBA 2E74D 4QDCA 1ULJA 1UUWA 1L0NE 1O7GA 2HMKA 1SQBE 4NBGD 1P84E 4P1BH 5HL4A 3L74E 3L75E 2JZAA 3CXHE 2XR8A 1O7PA 4QUQA 5KLIC 2NUMA 1EG9A 3CWBE 3GKEA 3H1JE 4QDDA 5BOKA 3EQQA 5AEWA 2GBWA 3DQYA 4QDFB 3TGUE 3N0QA 2ZYLA 1PPJE 2B24A 1KYOE 2CKFA 2YFLA 4NBFD 2NVFA 4PV1D 2NVEA 1G8JB 1O7MA 2QJKC 1SQQE 4NBAD 4NBED 4NBBD 5KLVE 1L0LE 4HM5A 2YIUC 1ULIA 1WQLA 2HMMA 3BCCE 3AZCA 4NB9D 1NDOA 3H1KE 4OGQD 1PP9E 3VCAA 2BMRA 3VMGD 2ZT9D 2FYUE 2I7FA 2XRXA 3GTSA 3H1LE 1Q90C 4HM2A 1NTME 4NBDD 3GL2A 2BMOA 1SJGA 1JM1A 4HM3A 4H44D 2QJYC 1BE3E 1VCKA 3GB4A 4HM8A 4AAYB 2Q3WA 1O7HA 4EMJB 3L70E 3VCPA 1O7NA 3GTEA 4HKVA 3GZXA 2DE7D 3EN1A 2HMNA 2GBXA 2BMQA 4HM7A 2DE5D 4U3FE 3H1IE 1VF5D 1O7WA 2E76D 4NBCD 4QCKA 2XSOA 3VMHD 1SQVE 3VMID 4P1CH 2NVGA 5KKZC 1SQPE 1BCCE 1NU1E 1FQTA 2IBZE 2NWFA 4NBHD 2BCCE 2D2CD 4QUPA 4HM6A 2B1XA 2E4QA 3L72E 1NTZE 3D89A 1NYKA 4AIVA 5CXMA 2QPZA 1NTKE 4HM0A 3CX5E 3GL0A 2QJPC 3L71E 2FYNC 4HM4A 4HJLA 1KB9E 2HMJA 4HM1A 3H1HE 2YFJA 2XSHA 3GZYA 3L73E 1SQXE 2A06E 2DE6D 4H0LD 2JO6A 2HMLA 2E4PA 1RFSA 3FOUA 1VM9A 1EZVE 3GCEA 1UUVA 2HMOA 2NUKA 2YFIA 3C0DA 1RIEA 5AEUA 4H13D 4PD4E 4QURA 1ZRTE 4NB8D 4QDFA 1G8KB 2YVJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 D;  3GOB A;  2E74 D;  4QDC A;  1ULJ A;  1UUW A;  1L0N E;  1O7G A;  2HMK A;  1SQB E;  4NBG D;  1P84 E;  4P1B H;  5HL4 A;  3L74 E;  3L75 E;  2JZA A;  3CXH E;  2XR8 A;  1O7P A;  4QUQ A;  5KLI C;  2NUM A;  1EG9 A;  3CWB E;  3GKE A;  3H1J E;  4QDD A;  5BOK A;  3EQQ A;  5AEW A;  2GBW A;  3DQY A;  4QDF B;  3TGU E;  3N0Q A;  2ZYL A;  1PPJ E;  2B24 A;  1KYO E;  2CKF A;  2YFL A;  4NBF D;  2NVF A;  4PV1 D;  2NVE A;  1G8J B;  1O7M A;  2QJK C;  1SQQ E;  4NBA D;  4NBE D;  4NBB D;  5KLV E;  1L0L E;  4HM5 A;  2YIU C;  1ULI A;  1WQL A;  2HMM A;  3BCC E;  3AZC A;  4NB9 D;  1NDO A;  3H1K E;  4OGQ D;  1PP9 E;  3VCA A;  2BMR A;  3VMG D;  2ZT9 D;  2FYU E;  2I7F A;  2XRX A;  3GTS A;  3H1L E;  1Q90 C;  4HM2 A;  1NTM E;  4NBD D;  3GL2 A;  2BMO A;  1SJG A;  1JM1 A;  4HM3 A;  4H44 D;  2QJY C;  1BE3 E;  1VCK A;  3GB4 A;  4HM8 A;  4AAY B;  2Q3W A;  1O7H A;  4EMJ B;  3L70 E;  3VCP A;  1O7N A;  3GTE A;  4HKV A;  3GZX A;  2DE7 D;  3EN1 A;  2HMN A;  2GBX A;  2BMQ A;  4HM7 A;  2DE5 D;  4U3F E;  3H1I E;  1VF5 D;  1O7W A;  2E76 D;  4NBC D;  4QCK A;  2XSO A;  3VMH D;  1SQV E;  3VMI D;  4P1C H;  2NVG A;  5KKZ C;  1SQP E;  1BCC E;  1NU1 E;  1FQT A;  2IBZ E;  2NWF A;  4NBH D;  2BCC E;  2D2C D;  4QUP A;  4HM6 A;  2B1X A;  2E4Q A;  3L72 E;  1NTZ E;  3D89 A;  1NYK A;  4AIV A;  5CXM A;  2QPZ A;  1NTK E;  4HM0 A;  3CX5 E;  3GL0 A;  2QJP C;  3L71 E;  2FYN C;  4HM4 A;  4HJL A;  1KB9 E;  2HMJ A;  4HM1 A;  3H1H E;  2YFJ A;  2XSH A;  3GZY A;  3L73 E;  1SQX E;  2A06 E;  2DE6 D;  4H0L D;  2JO6 A;  2HML A;  2E4P A;  1RFS A;  3FOU A;  1VM9 A;  1EZV E;  3GCE A;  1UUV A;  2HMO A;  2NUK A;  2YFI A;  3C0D A;  1RIE A;  5AEU A;  4H13 D;  4PD4 E;  4QUR A;  1ZRT E;  4NB8 D;  4QDF A;  1G8K B;  2YVJ B; 
#chains in the Genus database with same CATH topology
 2E75 D;  3GOB A;  2E74 D;  4QDC A;  1ULJ A;  1UUW A;  1L0N E;  1O7G A;  2HMK A;  1SQB E;  4NBG D;  1P84 E;  4P1B H;  5HL4 A;  3L74 E;  3L75 E;  2JZA A;  3CXH E;  2XR8 A;  1O7P A;  4QUQ A;  5KLI C;  2NUM A;  1EG9 A;  3CWB E;  3GKE A;  3H1J E;  4QDD A;  5BOK A;  3EQQ A;  5AEW A;  2GBW A;  3DQY A;  4QDF B;  3TGU E;  3N0Q A;  2ZYL A;  1PPJ E;  2B24 A;  1KYO E;  2CKF A;  2YFL A;  4NBF D;  2NVF A;  4PV1 D;  2NVE A;  1G8J B;  1O7M A;  2QJK C;  1SQQ E;  4NBA D;  4NBE D;  4NBB D;  5KLV E;  1L0L E;  4HM5 A;  2YIU C;  1ULI A;  1WQL A;  2HMM A;  3BCC E;  3AZC A;  4NB9 D;  1NDO A;  3H1K E;  4OGQ D;  1PP9 E;  3VCA A;  2BMR A;  3VMG D;  2ZT9 D;  2FYU E;  2I7F A;  2XRX A;  3GTS A;  3H1L E;  1Q90 C;  4HM2 A;  1NTM E;  4NBD D;  3GL2 A;  2BMO A;  1SJG A;  1JM1 A;  4HM3 A;  4H44 D;  2QJY C;  1BE3 E;  1VCK A;  3GB4 A;  4HM8 A;  4AAY B;  2Q3W A;  1O7H A;  4EMJ B;  3L70 E;  3VCP A;  1O7N A;  3GTE A;  4HKV A;  3GZX A;  2DE7 D;  3EN1 A;  2HMN A;  2GBX A;  2BMQ A;  4HM7 A;  2DE5 D;  4U3F E;  3H1I E;  1VF5 D;  1O7W A;  2E76 D;  4NBC D;  4QCK A;  2XSO A;  3VMH D;  1SQV E;  3VMI D;  4P1C H;  2NVG A;  5KKZ C;  1SQP E;  1BCC E;  1NU1 E;  1FQT A;  2IBZ E;  2NWF A;  4NBH D;  2BCC E;  2D2C D;  4QUP A;  4HM6 A;  2B1X A;  2E4Q A;  3L72 E;  1NTZ E;  3D89 A;  1NYK A;  4AIV A;  5CXM A;  2QPZ A;  1NTK E;  4HM0 A;  3CX5 E;  3GL0 A;  2QJP C;  3L71 E;  2FYN C;  4HM4 A;  4HJL A;  1KB9 E;  2HMJ A;  4HM1 A;  3H1H E;  2YFJ A;  2XSH A;  3GZY A;  3L73 E;  1SQX E;  2A06 E;  2DE6 D;  4H0L D;  2JO6 A;  2HML A;  2E4P A;  1RFS A;  3FOU A;  1VM9 A;  1EZV E;  3GCE A;  1UUV A;  2HMO A;  2NUK A;  2YFI A;  3C0D A;  1RIE A;  5AEU A;  4H13 D;  4PD4 E;  4QUR A;  1ZRT E;  4NB8 D;  4QDF A;  1G8K B;  2YVJ B; 
#chains in the Genus database with same CATH homology
 2E75 D;  3GOB A;  2E74 D;  4QDC A;  1ULJ A;  1UUW A;  1L0N E;  1O7G A;  2HMK A;  1SQB E;  4NBG D;  1P84 E;  4P1B H;  5HL4 A;  3L74 E;  3L75 E;  2JZA A;  3CXH E;  2XR8 A;  1O7P A;  4QUQ A;  5KLI C;  2NUM A;  1EG9 A;  3CWB E;  3GKE A;  3H1J E;  4QDD A;  5BOK A;  3EQQ A;  5AEW A;  2GBW A;  3DQY A;  4QDF B;  3TGU E;  3N0Q A;  2ZYL A;  1PPJ E;  2B24 A;  1KYO E;  2CKF A;  2YFL A;  4NBF D;  2NVF A;  4PV1 D;  2NVE A;  1G8J B;  1O7M A;  2QJK C;  1SQQ E;  4NBA D;  4NBE D;  4NBB D;  5KLV E;  1L0L E;  4HM5 A;  2YIU C;  1ULI A;  1WQL A;  2HMM A;  3BCC E;  3AZC A;  4NB9 D;  1NDO A;  3H1K E;  4OGQ D;  1PP9 E;  3VCA A;  2BMR A;  3VMG D;  2ZT9 D;  2FYU E;  2I7F A;  2XRX A;  3GTS A;  3H1L E;  1Q90 C;  4HM2 A;  1NTM E;  4NBD D;  3GL2 A;  2BMO A;  1SJG A;  1JM1 A;  4HM3 A;  4H44 D;  2QJY C;  1BE3 E;  1VCK A;  3GB4 A;  4HM8 A;  4AAY B;  2Q3W A;  1O7H A;  4EMJ B;  3L70 E;  3VCP A;  1O7N A;  3GTE A;  4HKV A;  3GZX A;  2DE7 D;  3EN1 A;  2HMN A;  2GBX A;  2BMQ A;  4HM7 A;  2DE5 D;  4U3F E;  3H1I E;  1VF5 D;  1O7W A;  2E76 D;  4NBC D;  4QCK A;  2XSO A;  3VMH D;  1SQV E;  3VMI D;  4P1C H;  2NVG A;  5KKZ C;  1SQP E;  1BCC E;  1NU1 E;  1FQT A;  2IBZ E;  2NWF A;  4NBH D;  2BCC E;  2D2C D;  4QUP A;  4HM6 A;  2B1X A;  2E4Q A;  3L72 E;  1NTZ E;  3D89 A;  1NYK A;  4AIV A;  5CXM A;  2QPZ A;  1NTK E;  4HM0 A;  3CX5 E;  3GL0 A;  2QJP C;  3L71 E;  2FYN C;  4HM4 A;  4HJL A;  1KB9 E;  2HMJ A;  4HM1 A;  3H1H E;  2YFJ A;  2XSH A;  3GZY A;  3L73 E;  1SQX E;  2A06 E;  2DE6 D;  4H0L D;  2JO6 A;  2HML A;  2E4P A;  1RFS A;  3FOU A;  1VM9 A;  1EZV E;  3GCE A;  1UUV A;  2HMO A;  2NUK A;  2YFI A;  3C0D A;  1RIE A;  5AEU A;  4H13 D;  4PD4 E;  4QUR A;  1ZRT E;  4NB8 D;  4QDF A;  1G8K B;  2YVJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...