3CX5E

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
total genus 48
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cx5E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cx5E02
1VF5D 2BCCE 1O7GA 1RIEA 3AZCA 1FQTA 2IBZE 1VCKA 1NYKA 2B1XA 2HMJA 2B24A 4P1CH 3GTSA 1SQQE 1O7HA 3VMGD 2D2CD 3CWBE 1BCCE 2CKFA 2NVFA 2ZYLA 3GTEA 4H0LD 2HMNA 3L74E 4HM2A 4NBCD 2GBXA 1Q90C 1PPJE 2E4QA 3BCCE 4NB9D 3GOBA 3H1JE 4QURA 2BMOA 1KYOE 2E4PA 4PV1D 5KLIC 2HMOA 4QUQA 5HL4A 2YFLA 4NB8D 4QCKA 1ZRTE 3L70E 3VCPA 2NVGA 3GZYA 4HM6A 1RFSA 1SQPE 2Q3WA 2HMKA 4NBAD 1JM1A 1BE3E 1O7NA 5KLVE 2YFJA 2BMQA 2HMLA 1KB9E 4HM5A 1NU1E 3L71E 1UUVA 3VCAA 1NTKE 1SQVE 2HMMA 2YVJB 3TGUE 2JZAA 3D89A 4NBHD 1NTZE 3GCEA 3VMHD 3L73E 1EZVE 2XSHA 5CXMA 2NVEA 2DE7D 1O7PA 3CX5E 2YIUC 3L75E 4QDFA 3H1HE 2NUMA 3C0DA 2FYUE 1ULJA 4NBGD 4H44D 2YFIA 1L0NE 4AIVA 2XRXA 4AAYB 3L72E 1O7MA 3H1IE 1VM9A 1G8JB 4HM8A 2NUKA 4U3FE 1UUWA 2BMRA 4NBDD 4P1BH 4QDCA 4EMJB 4NBED 2GBWA 2QJKC 2XR8A 3EN1A 3CXHE 2E76D 4HM3A 3GL2A 3GZXA 4D6TE 4QDDA 1NDOA 2A06E 2I7FA 3GKEA 1PP9E 5AEUA 4QDFB 5KKZC 2E75D 3DQYA 2QJPC 4QUPA 5BOKA 4HM1A 4HJLA 1SQBE 2NWFA 3H1KE 4PD4E 3N0QA 4HKVA 4NBBD 3H1LE 1ULIA 2QPZA 2DE5D 4H13D 2XSOA 3GL0A 4OGQD 1WQLA 4NBFD 3VMID 3EQQA 2DE6D 1EG9A 1G8KB 2FYNC 1O7WA 3GB4A 1SJGA 2E74D 2QJYC 1BGYE 1L0LE 1SQXE 5AEWA 2JO6A 2ZT9D 3FOUA 1P84E 4HM0A 1NTME 4HM4A 4HM7A
chains in the Genus database with same CATH superfamily
5AW5B 1M7LA 3D71A 2IBZE 4IL6H 2QRXA 2W8ZA 1OVRA 3BVHA 4KJMA 2FYNB 3L74E 3VMZA 3VOPA 3HE5A 2Z4EA 2E4QA 3NXSA 2QM8A 2BMOA 1KYOE 3MTUE 1SQBG 1RY3A 2WT7B 1RF1C 1SQPE 2Y9YA 1X9VA 3CMEP 1GK6A 1ZXGA 3CCMP 4UB6H 1S9KD 1Y47A 1FOSF 4BXLA 3HTKB 4WWIA 1PL5A 1RE4A 2C0WA 2NVEA 3V5BA 5BVZA 1H8AA 2R3CA 3L71G 2WQYC 1GL2C 3T97B 3G3ZA 2KOGA 1CI6A 4H44D 1AJYA 3GG2A 5AVQB 4AIVA 1NO4A 1N86A 3AE8C 1ZV8A 2FFDB 1LTJB 3A3YB 1USEA 3H1IJ 1JNMA 1KD1Q 1FJPA 1HWTC 2UWJE 1MFTA 1YJ9P 2HLOA 2W27A 1JTHA 1QGKB 2QJPC 3KDPB 3BASA 3S1KA 1XTCC 4NPDA 3HRNA 2OYIA 5GTHE 3EQQA 2KK7A 3CLQA 3BATA 2XV5A 3LW5J 2JWDA 4PV1B 1JY3P 3A0HH 2JDIH 4YTPC 4IFFA 3L4FA 2ZYLA 3NFQA 4NBCD 1VQ4P 3GHGA 3BCCE 4EIJA 4NB9D 2CK3H 4PV1D 2FKWB 1CI6B 2H7HA 3SFDC 1LP1A 1AVYA 3CX5I 3H1JJ 2WPQA 2IYOA 1NTKE 2YVJB 3TGUE 2W6JH 5CCHD 4WY4D 1YHQP 3A0BE 4GOEA 1L0ND 3AE3C 3Q1MA 3IFMA 2FYUD 3H1HD 3VTPC 4BRYB 2LXCB 3S9OA 1J1EB 4AAYB 5AVTB 2WSEJ 1OFCX 2OARA 4U3FE 1BCCD 2M0BA 4YXWH 4QDCA 1SVFA 3L71D 4NBED 5B5EH 1W2BO 2ITAA 1NH4A 3M0AA 1NTZJ 3GLMA 1PP9E 3IR9A 5KKZC 1KQSO 2E75D 1M90Q 1VQ6P 3P8CE 2WWWA 4WY4B 3I55P 3JCUH 4D6TD 1SQQD 5CBNA 1E79H 1GW4A 1GW3A 1LWUA 1O7WA 3GB4A 3CX5H 1GU4A 3HE5B 3RK2D 2E5YA 2P2UA 1FZGA 5AW0B 1L0LK 3Q3DA 2W90A 1NTKG 1T8ZA 2QG4A 2P67A 2E75C 2PAJA 2E4PA 5E79E 5CHXA 3KYQA 1FOSE 1BE3E 2KP8A 5KLVE 3HUSC 1H88A 5M1BA 2IPPA 1OX3A 2B87A 1K9MQ 3L73D 1YI2P 3N4XA 1SQBK 3M0DA 3CCSP 3CWBD 1N7SB 3BCCJ 2LR2A 2KSJA 5KLVK 1PPJD 1RE3A 3B5NC 4H44B 1SQXG 1IFJA 1RF1A 2NRGA 2FFDA 4H13B 1L0NJ 2N9BA 5EFWB 1SLQA 1S72P 1X79B 3CXHE 3HD7A 2CPBA 1NTKJ 2N9YB 3GZXA 4U3FJ 1NWQA 4PV1C 1S5LE 1MFZA 4GT1A 4PD4E 1HF9A 1A02F 1M57D 3OW2O 2BCCG 3LW5H 3SWFA 1ZN5A 3L75D 2XKMA 1VPCA 1CW5A 4L73A 1KTMA 1SQBD 1SQXE 2ZT9D 5AW4B 1SQQK 3TGUD 1OW7A 2QJYB 1FZAA 2OTKE 2GUSA 3HUSB 1SQVG 1RF1B 1NTMJ 3QWOC 3P8MC 1HGVA 5KJ7A 1Q7YQ 1KILB 1PGPA 4M3LA 4DCKA 2CPSA 2Q3EA 2C9LY 2YFLA 4DZOA 3F5HA 3CMAP 3V4QA 2JWAA 3CC4P 1KB9E 3EQ2A 3JCUE 2IBZG 1GK4A 3H6PA 1YJWP 4DJGA 2FYUK 1S9KE 2WSCH 3MUDA 5CCGC 4KT0J 2OYIC 1JCDA 1QVFO 4O9BA 1SQQJ 1OVVA 2Z5IA 1ULJA 5KAFH 1OWAA 1NTKK 5TJHA 3PLNA 2XRXA 3H1JD 3VMXA 1YTZT 1K04A 4I1LA 3MP7B 2B9BA 2WVRA 1J1DC 4PJ0E 1S3JA 1SQVJ 4MN4C 1XTGB 1EDJA 2YXQB 1Q81Q 3B5ND 4H44C 3V6IA 4K35A 3G71P 1VQ9P 1VQNP 2HR3A 2YO2A 3E1IA 4NBFD 3GHGC 2DE6D 2JJLA 1DX7A 2G8YA 3QH9A 1SFCD 2OYOA 5AVUB 1BSHA 3B71A 1FJKA 1L4AA 4GIFA 2ZXXA 1OW6A 2JR8A 3JSVC 2Q1KA 3VMYA 2FBWC 3AECC 4TLFA 5AW2B 3GTSA 2K9JB 1JM0A 1MZ9A 1KYOH 4Y99C 1L4AC 1UIIA 2JEEA 1IC2A 3P32A 3TGUJ 2NVGA 1NAYA 1SS1A 2OTLP 3L37A 3C9IA 4HM5A 2FXOA 1D7MA 1IFMA 2ZFCA 3D89A 3GF7A 4UB6E 3O6QA 3G4SP 2D2CB 2YIUC 3L75E 1J2JB 2K1AA 1FZCA 1LTSC 1SQVK 5K5GB 2AEJA 4PD4D 2GA1A 3U59A 5AVWB 2POHA 1EZVD 1NTMD 4NBDD 3H32B 5APQA 2R5DA 4C7RA 4JBZA 1PGOA 5KKZB 1WT6A 1M1JC 3NMDA 1EXJA 2P58A 1SQBE 1Q90D 1RF0C 2OYIB 3TYYA 2DE5D 1URQB 2M8RA 3EWKA 1JEKA 1YQ3C 2QJYC 5AEWA 2AEMA 3B5NA 4H0LB 1SQXK 1HTLC 1VCKA 3G9RA 1T3JA 4WY4C 2Y0DA 1H89A 1LTIC 4HB1A 4I2LC 3PHLA 3GTEA 1RE3C 1LTJA 3H1KD 4RESB 1PPJE 1JY2O 1FU1A 4N3YB 4QURA 1NHLA 5KLIC 3K5BA 1PFIA 4QCKA 4CPGA 1JMBA 3GF3A 2N1TA 4W7YA 5KJ7C 3A0BH 3FGAD 1LJ2A 5AW8B 1AA0A 1KQGB 5BU8B 2O3JA 1EZVE 3ZDMA 1GL2D 1SFCB 5B66H 2XU6A 1O7PA 1SQXD 3P7KA 1KFMA 3L74G 1NU1G 2WPRA 1PZQA 2J58A 2A45G 3AEFC 3KPEA 1DEBA 3FX0A 1VQOP 5E79H 3CX5D 2M5AA 4HM8A 1ZMEC 1KORA 2LXBA 2MJZA 1ZR2A 1SFCC 3O6QB 3VYIA 2KLUA 3MD0A 4BRYA 3HTKA 2A45I 3A0HE 4QDDA 5KAFE 1FZBA 1USDA 2ZT9C 2FYUG 4HM1A 2D2CC 2YIUB 1CZQA 3M06A 3H1LE 1N7LA 3L70J 2Y0CA 2R5BA 4WBAA 1EDIA 3RK3D 1AVOA 1BGYE 1L0LE 2N1TB 3L35A 3FOUA 3E7KA 1QVGO 1S2EA 4HYTB 4Z1MH 2OTJP 1EC5A 3CCLP 3USSA 1L4AB 4C46A 1R5SA 1GZLA 3IF4A 1M1JA 5CCGD 2KYVA 3KQGA 2Q7CA 3VCPA 2OYHA 3V2QA 2BEQD 1PPJG 2E76C 2ZYDA 4JPZB 1IFNA 1JMMA 1VQPP 3E1RA 1TU3F 1YYCA 2FY8A 2E5TA 4UB8E 4EI2A 4IL6X 5AW6B 1KMIZ 4RJTA 2HPCA 4DT0A 2IYPA 3CC7P 3H25A 4XFJA 2V7QH 2QEXP 3P8CD 3VP8A 1NU1D 2GBWA 3TF5A 5AVYB 5KLVJ 1FZCC 2XR8A 2WSSH 3HE4A 4HM3A 2O01H 1ZW0A 3RK2C 3ITKA 2KNCB 1N73A 2AXCA 2WITA 3T97A 3Q5PA 3BRTB 3KXDA 4GKGA 2QJKB 2WSFH 1QL2A 1PP9G 3GW6A 1J1EC 2Y9ZA 1FE6A 2FXPA 1G1IA 2Q3IA 2OGUA 1N73C 3OA7A 4XE5B 4N78D 1L4AD 4HM7A 2BCCE 2XNDH 1ZP0C 3Q5RA 3U1AA 5AVRB 3RL0g 3II6A 2QA4P 2Q9IA 1URQD 2C9NY 1MV8A 3WUVA 1JB0J 3V2PA 3BCCG 1PGJA 2M3BA 1HGZA 3FXEA 2J59M 1T2KD 3RBXA 2IBZI 1NTZD 3L74D 1L0NG 1ZRTE 3BRVB 2HPCB 4A7PA 2YMKA 1NKNA 5APTA 1R8EA 2BMQA 3TGUG 1VQLP 1ZLLA 3TDKA 3CI9A 1UUVA 1G2CB 2P10A 2O1KA 2H43A 4ASWA 4D6TJ 5APUA 3AE1C 3KHUA 1KYOI 1RF0A 2KUBA 3CXHH 1MKMA 3AEGC 3GMAA 2QM7A 1BCCG 3Q5SA 3HD7C 3M9QA 1WRGA 5CJ0A 4OGQC 1SQPD 3AEEC 2K9JA 2OYHB 3VP9A 3A5TA 2AXTE 3AEDC 4QMAA 2HYNA 1IJDB 1RQVA 3CD6P 1YIJP 2JP3A 4ZKUA 4IFDK 1BE3G 2R44A 1W2EA 2QJKC 1EDKA 1IK7A 1SQPK 4AQRD 1S4XA 4IOIH 5GTIE 3DQYA 4QUPA 4YPCA 1RQUA 2V4HA 1RE4C 4H13D 2PGDA 4Y28J 4RKUJ 2VRSA 3VMID 1AFOA 2KZJA 1LT9B 1LGHB 1JOCA 3N7NA 1LTBC 4HM4A 3CWBJ 1FZEA 1HJBA 1O7GA 1IFIA 1RIEA 4PD4I 1SP4A 1JY2P 2KZIA 1KFNA 3AEBC 1Y9BA 2HG5D 4HM6A 1BDCA 3VN0A 5AW1B 1P84H 2HMLA 3MIWA 3I56P 1GD2E 1SQVE 3GCEA 4LC1A 1SQVD 1NKZB 4R4MA 2RMZA 2NUMA 3C0DA 2FYUE 3C1LA 4KHXA 3L73J 4DOJA 2M5AB 1KN7A 3HD7B 1L0NE 2MKVA 1HBWA 2Z5HA 1K8AQ 1EQ7A 2WZ7A 4JYBA 2ZXEB 4P1BH 1H0TA 2H88C 3MHVA 3U1CA 1VF5C 2BASA 1ZOYC 1NTZK 2A06E 3GKEA 2NZ2A 4I7ZB 4QDFB 2QJPB 5BOKA 5CCHC 3H1KE 1BGYJ 1L0LJ 3FWLA 2LKMA 1EZVG 3L70G 1LTJC 5CCHA 2WSCJ 4YXDC 5APWA 2HODB 2YKPA 5KAIH 1IZNB 1X8YA 5KLVD 3H32A 1H0TB 4P1CH 1HH0A 4LLHA 2QIWA 2HODA 1NAFA 2RKLA 3R4YA 4EOTA 1GTWA 2GBXA 1X0TA 2V7QJ 2KB7P 1KB9I 4B86A 2Q5UA 4ZMDA 1RFSA 2Q3WA 1LT1A 1LTTC 4GODA 3KZIH 3VMHD 2JO1A 1SQBJ 1L0NK 1JY3O 5B66E 1JCCA 3JC22 3H1IE 1BDDA 2BCCD 1FZCB 1BSNA 1PP9D 2BCCJ 1AQ5A 1OZHA 3IN6A 1KC8Q 2ZYAA 2M3EA 1QL1A 3L71J 1ZRTD 1G1JA 1Z56A 1E5WA 4WY4A 2KLVA 4HJLA 4OVNF 3L72D 1LT9C 5AVVB 1KB9H 4HKVA 3PRJA 5AVSB 3CCJP 2WT7A 3H1IG 3EFGA 3AE7C 1NYHA 3LIDA 2E74D 3AE4C 1U7JA 1NTMK 1U57A 1Q82Q 1FDOA 3L74J 3W67A 2B1XA 2C0XA 4OH8B 1DD4A 2YKOA 1A02J 4H0LD 3D6YA 1KV4A 3H1ID 4I6MC 1EZVI 3CPWO 3L70E 2I8DA 3B5NB 4NBAD 1M8OB 1JM1A 5L8RJ 2IX7C 1LP1B 1NU1E 4HH2A 3CXHI 4L74A 2QSIA 1DIPA 3AE2C 4QDFA 5APYA 1BCCJ 1CSBA 1KQLA 1LNQA 1FBMA 2Q6QA 3R2PA 4R4LA 3W68A 4I7ZC 4AUWA 1GL2B 1UUWA 4EYYQ 4N78E 1N2DC 1OVUA 2ZVOB 3RL0D 1AQTA 2A06G 2E76D 2K3RA 3GL2A 1LTGC 1YQ4C 1Q86Q 1S5LX 5KLIB 1G2CA 3SWKA 2IFNA 1P84D 3F89A 3N0QA 2J5UA 1JTHB 1NJIQ 1ULIA 3GL0A 2P7JA 1VF5B 3H1LD 1LTAC 2I1KA 3L36A 1NTZG 1IFDA 1KILA 2KNCA 3CCRP 2YXRB 4HM0A 4WB4A 1PV3A 1K73Q 4W80A 3A2AA 3HUSA 1FDMA 4U3FG 2N1TD 2B24A 2KSEA 1SQQE 1O7HA 2IDBA 2ZAEB 2RH0A 1KYOD 3B8EB 2FFDC 3GOBA 2O01N 2ZYGA 1M56D 2G3AA 2IZ1A 1LT9A 1VDFA 3FXDA 5TISE 2ZVNB 3TSIA 3TNUA 1QEXA 1N73B 3TK1A 4U3FD 2JZAA 2K37A 1KILD 4NBHD 4L76A 4W7ZA 4IL6E 5CXMA 1URQC 1NTMG 3CX5E 1PIXA 5AW3B 3MGNA 3H1LJ 2KIKA 3RGUA 2E76B 1OIPA 2WSEH 4TT3H 1W5CE 2GUVA 1M1JB 2O1JA 2AEFA 1IK9A 3L75J 3KZIE 3L72G 2B88A 5APVA 1DEEG 2HFED 3EN1A 2IFMA 3AEAC 3AE5C 2R32A 1QX8A 3CL3D 1FDIA 1NU1K 3B4SA 2K9YA 3WU2H 2W6AA 1SQXJ 5GTIH 3IAOA 4C7NB 3H1KG 2NPSA 5AVZB 2JKVA 3TNUB 1KZUB 4JYCA 2WPVB 2A06D 4EDFA 1HJ0A 1FQTA 5CJ4A 4LGDE 1Q2NA 2KI7B 2HMJA 3H1LG 4N6JA 2SPZA 2D2CD 1OXZA 1SQPJ 1Q90C 1BE3J 1LWUB 2AXTH 5GTHH 4QUQA 4NB8D 3RK3B 2HMKA 4HJGH 3M91A 2NPSD 2YFJA 1YJNP 1NVOA 1RHZB 3D6ZA 4ZNCA 3OAKA 3PP5A 2L91A 1KILE 3G6EP 2R3SA 1JO5A 3SFEC 3BCCD 1R5LA 2WSFJ 3H1HE 3AE9C 5CBOA 1PGQA 1FZFA 2O01J 2KS1A 4EMJB 1SQQG 2E75B 2PRRA 3D70A 2QE7H 1N7SA 2I7FA 1SQPG 2E74B 3RBZA 2K88A 2FXMA 1URQA 2ZJSE 2P1JA 4OGQD 1GU5A 2WMMA 3M9HA 2FYNC 1T6AA 2JO6A 3Q2YA 4OWFA 1P84E 4GOFA 5H2FE 2WTYA 1GL2A 1ZR4A 1VF5D 2L5GB 3WMM0 5CCGA 4PD4H 5KAIE 1GDTA 3L73G 3CCEP 1HUCA 3VMGD 2CKFA 2PFXA 1RH5B 4HM2A 1T2KC 1N7SD 1HVVA 3H1JE 1U7MA 3MUDC 3GZYA 3V4WA 2PP6A 1AV1A 1GMJA 1FS0E 2A45H 1KILC 2NPSC 5AW7B 3EFFK 1NTZE 2Y0EA 4ZKPA 2W83C 1VL2A 1KB9D 5AVXB 3S4RA 3RK3C 2IBZD 3I5CA 2ZT9B 2BMRA 2XZRA 1EDLA 1PP9J 3CCQP 1VQ5P 2FYZA 2IZ0A 1N8RQ 3L75G 5B5EE 4AYCA 3VMAA 4Y99B 1DH3A 2YNYA 5AW9B 4H13C 4NBBD 1JUNA 1S1CX 2XDJA 4ASVA 4C7NA 2OYHC 1YITP 1WQLA 1EG9A 4K3AA 3M9BA 5APXA 2I1JA 1IFPA 5CMZA 1X22A 3WU2E 1NYKA 3GHGB 1JY3N 3H1HJ 1S5LH 1FAVA 3ABVC 2FYUJ 3RL0B 4WVZA 5KJ7D 2NVFA 3WUTA 1SFCA 3CC2P 2H8PD 1KQFB 1L2PA 3H1JG 2XNXA 1BE3D 4GDOA 1WMKA 3L73E 2XSHA 2QVAA 2DE7D 1BGYD 1L0LD 3RK3E 3PJSK 2YO3A 4XA4A 1FC2C 5H2FH 1UIXA 3PH0A 3V2NA 3CCVP 4NBGD 2DW3A 4H0LC 3OJAB 3L72E 1VM9A 4HKZH 3FWNA 5BU5A 4BWNA 3RK2B 4IFMA 2WPSA 2GM4A 3L72J 3O8ZA 1NU1J 3H1HG 2E74C 1NDOA 3CCUP 5AEUA 1OW8A 3A7OA 2RN0A 2QPZA 1OMIA 4U7JA 3CXHD 1G8KB 1SJGA 3H1KJ 1VQ7P 3RL0C 3PTZA 3AE6C 2KS1B 3V2RA 3SWYA 4OGQB 3AZCA 4PJ0H 3HE4B 1VQKP 4L75A 4D6TG 2BEZF 3C8VA 2N1TC 2W6BA 3CWBE 1BCCE 2HMNA 1VQ8P 1LWUC 2HMOA 5HL4A 5C39A 5DJUB 5APSA 4JF7A 2B89A 4NPEA 1IO4A 3WUUA 1JY2N 1O7NA 1P84I 3L71E 3VCAA 2HMMA 1T3UA 1QLED 4JQ0D 5KTBA 1NTKD 3NTNA 1N7SC 2KXPB 3UIAA 3SSUA 2YFIA 1VQMP 1Y8AA 1EXIA 1O7MA 1G8JB 2NUKA 1YBKA 1BGYG 1L0LG 1DD3A 3CWBG 1J1DB 2E42A 1NGMB 2NPSB 2YKQA 3HD7D 3L70D 4RO0A 4D6TE 1K05A 2B87B 2NWFA 2YMYA 5DJTB 3MZWB 5KLVG 4UB8H 2XSOA 1NOHA 4NPFX 1YTZI 3M0DC 1MUUA 3LIEA 2E43A 1M1KQ 1NTME 5TISH 2H89C 2OQQA
chains in the Genus database with same CATH topology
1VF5D 2BCCE 1O7GA 1RIEA 3AZCA 1FQTA 2IBZE 1VCKA 1NYKA 2B1XA 2HMJA 2B24A 4P1CH 3GTSA 1SQQE 1O7HA 3VMGD 2D2CD 3CWBE 1BCCE 2CKFA 2NVFA 2ZYLA 3GTEA 4H0LD 2HMNA 3L74E 4HM2A 4NBCD 2GBXA 1Q90C 1PPJE 2E4QA 3BCCE 4NB9D 3GOBA 3H1JE 4QURA 2BMOA 1KYOE 2E4PA 4PV1D 5KLIC 2HMOA 4QUQA 5HL4A 2YFLA 4NB8D 4QCKA 1ZRTE 3L70E 3VCPA 2NVGA 3GZYA 4HM6A 1RFSA 1SQPE 2Q3WA 2HMKA 4NBAD 1JM1A 1BE3E 1O7NA 5KLVE 2YFJA 2BMQA 2HMLA 1KB9E 4HM5A 1NU1E 3L71E 1UUVA 3VCAA 1NTKE 1SQVE 2HMMA 2YVJB 3TGUE 2JZAA 3D89A 4NBHD 1NTZE 3GCEA 3VMHD 3L73E 1EZVE 2XSHA 5CXMA 2NVEA 2DE7D 1O7PA 3CX5E 2YIUC 3L75E 4QDFA 3H1HE 2NUMA 3C0DA 2FYUE 1ULJA 4NBGD 4H44D 2YFIA 1L0NE 4AIVA 2XRXA 4AAYB 3L72E 1O7MA 3H1IE 1VM9A 1G8JB 4HM8A 2NUKA 4U3FE 1UUWA 2BMRA 4NBDD 4P1BH 4QDCA 4EMJB 4NBED 2GBWA 2QJKC 2XR8A 3EN1A 3CXHE 2E76D 4HM3A 3GL2A 3GZXA 4D6TE 4QDDA 1NDOA 2A06E 2I7FA 3GKEA 1PP9E 5AEUA 4QDFB 5KKZC 2E75D 3DQYA 2QJPC 4QUPA 5BOKA 4HM1A 4HJLA 1SQBE 2NWFA 3H1KE 4PD4E 3N0QA 4HKVA 4NBBD 3H1LE 1ULIA 2QPZA 2DE5D 4H13D 2XSOA 3GL0A 4OGQD 1WQLA 4NBFD 3VMID 3EQQA 2DE6D 1EG9A 1G8KB 2FYNC 1O7WA 3GB4A 1SJGA 2E74D 2QJYC 1BGYE 1L0LE 1SQXE 5AEWA 2JO6A 2ZT9D 3FOUA 1P84E 4HM0A 1NTME 4HM4A 4HM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 D;  2BCC E;  1O7G A;  1RIE A;  3AZC A;  1FQT A;  2IBZ E;  1VCK A;  1NYK A;  2B1X A;  2HMJ A;  2B24 A;  4P1C H;  3GTS A;  1SQQ E;  1O7H A;  3VMG D;  2D2C D;  3CWB E;  1BCC E;  2CKF A;  2NVF A;  2ZYL A;  3GTE A;  4H0L D;  2HMN A;  3L74 E;  4HM2 A;  4NBC D;  2GBX A;  1Q90 C;  1PPJ E;  2E4Q A;  3BCC E;  4NB9 D;  3GOB A;  3H1J E;  4QUR A;  2BMO A;  1KYO E;  2E4P A;  4PV1 D;  5KLI C;  2HMO A;  4QUQ A;  5HL4 A;  2YFL A;  4NB8 D;  4QCK A;  1ZRT E;  3L70 E;  3VCP A;  2NVG A;  3GZY A;  4HM6 A;  1RFS A;  1SQP E;  2Q3W A;  2HMK A;  4NBA D;  1JM1 A;  1BE3 E;  1O7N A;  5KLV E;  2YFJ A;  2BMQ A;  2HML A;  1KB9 E;  4HM5 A;  1NU1 E;  3L71 E;  1UUV A;  3VCA A;  1NTK E;  1SQV E;  2HMM A;  2YVJ B;  3TGU E;  2JZA A;  3D89 A;  4NBH D;  1NTZ E;  3GCE A;  3VMH D;  3L73 E;  1EZV E;  2XSH A;  5CXM A;  2NVE A;  2DE7 D;  1O7P A;  3CX5 E;  2YIU C;  3L75 E;  4QDF A;  3H1H E;  2NUM A;  3C0D A;  2FYU E;  1ULJ A;  4NBG D;  4H44 D;  2YFI A;  1L0N E;  4AIV A;  2XRX A;  4AAY B;  3L72 E;  1O7M A;  3H1I E;  1VM9 A;  1G8J B;  4HM8 A;  2NUK A;  4U3F E;  1UUW A;  2BMR A;  4NBD D;  4P1B H;  4QDC A;  4EMJ B;  4NBE D;  2GBW A;  2QJK C;  2XR8 A;  3EN1 A;  3CXH E;  2E76 D;  4HM3 A;  3GL2 A;  3GZX A;  4D6T E;  4QDD A;  1NDO A;  2A06 E;  2I7F A;  3GKE A;  1PP9 E;  5AEU A;  4QDF B;  5KKZ C;  2E75 D;  3DQY A;  2QJP C;  4QUP A;  5BOK A;  4HM1 A;  4HJL A;  1SQB E;  2NWF A;  3H1K E;  4PD4 E;  3N0Q A;  4HKV A;  4NBB D;  3H1L E;  1ULI A;  2QPZ A;  2DE5 D;  4H13 D;  2XSO A;  3GL0 A;  4OGQ D;  1WQL A;  4NBF D;  3VMI D;  3EQQ A;  2DE6 D;  1EG9 A;  1G8K B;  2FYN C;  1O7W A;  3GB4 A;  1SJG A;  2E74 D;  2QJY C;  1BGY E;  1L0L E;  1SQX E;  5AEW A;  2JO6 A;  2ZT9 D;  3FOU A;  1P84 E;  4HM0 A;  1NTM E;  4HM4 A;  4HM7 A; 
#chains in the Genus database with same CATH topology
 5AW5 B;  1M7L A;  3D71 A;  2IBZ E;  4IL6 H;  2QRX A;  2W8Z A;  1OVR A;  3BVH A;  4KJM A;  2FYN B;  3L74 E;  3VMZ A;  3VOP A;  3HE5 A;  2Z4E A;  2E4Q A;  3NXS A;  2QM8 A;  2BMO A;  1KYO E;  3MTU E;  1SQB G;  1RY3 A;  2WT7 B;  1RF1 C;  1SQP E;  2Y9Y A;  1X9V A;  3CME P;  1GK6 A;  1ZXG A;  3CCM P;  4UB6 H;  1S9K D;  1Y47 A;  1FOS F;  4BXL A;  3HTK B;  4WWI A;  1PL5 A;  1RE4 A;  2C0W A;  2NVE A;  3V5B A;  5BVZ A;  1H8A A;  2R3C A;  3L71 G;  2WQY C;  1GL2 C;  3T97 B;  3G3Z A;  2KOG A;  1CI6 A;  4H44 D;  1AJY A;  3GG2 A;  5AVQ B;  4AIV A;  1NO4 A;  1N86 A;  3AE8 C;  1ZV8 A;  2FFD B;  1LTJ B;  3A3Y B;  1USE A;  3H1I J;  1JNM A;  1KD1 Q;  1FJP A;  1HWT C;  2UWJ E;  1MFT A;  1YJ9 P;  2HLO A;  2W27 A;  1JTH A;  1QGK B;  2QJP C;  3KDP B;  3BAS A;  3S1K A;  1XTC C;  4NPD A;  3HRN A;  2OYI A;  5GTH E;  3EQQ A;  2KK7 A;  3CLQ A;  3BAT A;  2XV5 A;  3LW5 J;  2JWD A;  4PV1 B;  1JY3 P;  3A0H H;  2JDI H;  4YTP C;  4IFF A;  3L4F A;  2ZYL A;  3NFQ A;  4NBC D;  1VQ4 P;  3GHG A;  3BCC E;  4EIJ A;  4NB9 D;  2CK3 H;  4PV1 D;  2FKW B;  1CI6 B;  2H7H A;  3SFD C;  1LP1 A;  1AVY A;  3CX5 I;  3H1J J;  2WPQ A;  2IYO A;  1NTK E;  2YVJ B;  3TGU E;  2W6J H;  5CCH D;  4WY4 D;  1YHQ P;  3A0B E;  4GOE A;  1L0N D;  3AE3 C;  3Q1M A;  3IFM A;  2FYU D;  3H1H D;  3VTP C;  4BRY B;  2LXC B;  3S9O A;  1J1E B;  4AAY B;  5AVT B;  2WSE J;  1OFC X;  2OAR A;  4U3F E;  1BCC D;  2M0B A;  4YXW H;  4QDC A;  1SVF A;  3L71 D;  4NBE D;  5B5E H;  1W2B O;  2ITA A;  1NH4 A;  3M0A A;  1NTZ J;  3GLM A;  1PP9 E;  3IR9 A;  5KKZ C;  1KQS O;  2E75 D;  1M90 Q;  1VQ6 P;  3P8C E;  2WWW A;  4WY4 B;  3I55 P;  3JCU H;  4D6T D;  1SQQ D;  5CBN A;  1E79 H;  1GW4 A;  1GW3 A;  1LWU A;  1O7W A;  3GB4 A;  3CX5 H;  1GU4 A;  3HE5 B;  3RK2 D;  2E5Y A;  2P2U A;  1FZG A;  5AW0 B;  1L0L K;  3Q3D A;  2W90 A;  1NTK G;  1T8Z A;  2QG4 A;  2P67 A;  2E75 C;  2PAJ A;  2E4P A;  5E79 E;  5CHX A;  3KYQ A;  1FOS E;  1BE3 E;  2KP8 A;  5KLV E;  3HUS C;  1H88 A;  5M1B A;  2IPP A;  1OX3 A;  2B87 A;  1K9M Q;  3L73 D;  1YI2 P;  3N4X A;  1SQB K;  3M0D A;  3CCS P;  3CWB D;  1N7S B;  3BCC J;  2LR2 A;  2KSJ A;  5KLV K;  1PPJ D;  1RE3 A;  3B5N C;  4H44 B;  1SQX G;  1IFJ A;  1RF1 A;  2NRG A;  2FFD A;  4H13 B;  1L0N J;  2N9B A;  5EFW B;  1SLQ A;  1S72 P;  1X79 B;  3CXH E;  3HD7 A;  2CPB A;  1NTK J;  2N9Y B;  3GZX A;  4U3F J;  1NWQ A;  4PV1 C;  1S5L E;  1MFZ A;  4GT1 A;  4PD4 E;  1HF9 A;  1A02 F;  1M57 D;  3OW2 O;  2BCC G;  3LW5 H;  3SWF A;  1ZN5 A;  3L75 D;  2XKM A;  1VPC A;  1CW5 A;  4L73 A;  1KTM A;  1SQB D;  1SQX E;  2ZT9 D;  5AW4 B;  1SQQ K;  3TGU D;  1OW7 A;  2QJY B;  1FZA A;  2OTK E;  2GUS A;  3HUS B;  1SQV G;  1RF1 B;  1NTM J;  3QWO C;  3P8M C;  1HGV A;  5KJ7 A;  1Q7Y Q;  1KIL B;  1PGP A;  4M3L A;  4DCK A;  2CPS A;  2Q3E A;  2C9L Y;  2YFL A;  4DZO A;  3F5H A;  3CMA P;  3V4Q A;  2JWA A;  3CC4 P;  1KB9 E;  3EQ2 A;  3JCU E;  2IBZ G;  1GK4 A;  3H6P A;  1YJW P;  4DJG A;  2FYU K;  1S9K E;  2WSC H;  3MUD A;  5CCG C;  4KT0 J;  2OYI C;  1JCD A;  1QVF O;  4O9B A;  1SQQ J;  1OVV A;  2Z5I A;  1ULJ A;  5KAF H;  1OWA A;  1NTK K;  5TJH A;  3PLN A;  2XRX A;  3H1J D;  3VMX A;  1YTZ T;  1K04 A;  4I1L A;  3MP7 B;  2B9B A;  2WVR A;  1J1D C;  4PJ0 E;  1S3J A;  1SQV J;  4MN4 C;  1XTG B;  1EDJ A;  2YXQ B;  1Q81 Q;  3B5N D;  4H44 C;  3V6I A;  4K35 A;  3G71 P;  1VQ9 P;  1VQN P;  2HR3 A;  2YO2 A;  3E1I A;  4NBF D;  3GHG C;  2DE6 D;  2JJL A;  1DX7 A;  2G8Y A;  3QH9 A;  1SFC D;  2OYO A;  5AVU B;  1BSH A;  3B71 A;  1FJK A;  1L4A A;  4GIF A;  2ZXX A;  1OW6 A;  2JR8 A;  3JSV C;  2Q1K A;  3VMY A;  2FBW C;  3AEC C;  4TLF A;  5AW2 B;  3GTS A;  2K9J B;  1JM0 A;  1MZ9 A;  1KYO H;  4Y99 C;  1L4A C;  1UII A;  2JEE A;  1IC2 A;  3P32 A;  3TGU J;  2NVG A;  1NAY A;  1SS1 A;  2OTL P;  3L37 A;  3C9I A;  4HM5 A;  2FXO A;  1D7M A;  1IFM A;  2ZFC A;  3D89 A;  3GF7 A;  4UB6 E;  3O6Q A;  3G4S P;  2D2C B;  2YIU C;  3L75 E;  1J2J B;  2K1A A;  1FZC A;  1LTS C;  1SQV K;  5K5G B;  2AEJ A;  4PD4 D;  2GA1 A;  3U59 A;  5AVW B;  2POH A;  1EZV D;  1NTM D;  4NBD D;  3H32 B;  5APQ A;  2R5D A;  4C7R A;  4JBZ A;  1PGO A;  5KKZ B;  1WT6 A;  1M1J C;  3NMD A;  1EXJ A;  2P58 A;  1SQB E;  1Q90 D;  1RF0 C;  2OYI B;  3TYY A;  2DE5 D;  1URQ B;  2M8R A;  3EWK A;  1JEK A;  1YQ3 C;  2QJY C;  5AEW A;  2AEM A;  3B5N A;  4H0L B;  1SQX K;  1HTL C;  1VCK A;  3G9R A;  1T3J A;  4WY4 C;  2Y0D A;  1H89 A;  1LTI C;  4HB1 A;  4I2L C;  3PHL A;  3GTE A;  1RE3 C;  1LTJ A;  3H1K D;  4RES B;  1PPJ E;  1JY2 O;  1FU1 A;  4N3Y B;  4QUR A;  1NHL A;  5KLI C;  3K5B A;  1PFI A;  4QCK A;  4CPG A;  1JMB A;  3GF3 A;  2N1T A;  4W7Y A;  5KJ7 C;  3A0B H;  3FGA D;  1LJ2 A;  5AW8 B;  1AA0 A;  1KQG B;  5BU8 B;  2O3J A;  1EZV E;  3ZDM A;  1GL2 D;  1SFC B;  5B66 H;  2XU6 A;  1O7P A;  1SQX D;  3P7K A;  1KFM A;  3L74 G;  1NU1 G;  2WPR A;  1PZQ A;  2J58 A;  2A45 G;  3AEF C;  3KPE A;  1DEB A;  3FX0 A;  1VQO P;  5E79 H;  3CX5 D;  2M5A A;  4HM8 A;  1ZME C;  1KOR A;  2LXB A;  2MJZ A;  1ZR2 A;  1SFC C;  3O6Q B;  3VYI A;  2KLU A;  3MD0 A;  4BRY A;  3HTK A;  2A45 I;  3A0H E;  4QDD A;  5KAF E;  1FZB A;  1USD A;  2ZT9 C;  2FYU G;  4HM1 A;  2D2C C;  2YIU B;  1CZQ A;  3M06 A;  3H1L E;  1N7L A;  3L70 J;  2Y0C A;  2R5B A;  4WBA A;  1EDI A;  3RK3 D;  1AVO A;  1BGY E;  1L0L E;  2N1T B;  3L35 A;  3FOU A;  3E7K A;  1QVG O;  1S2E A;  4HYT B;  4Z1M H;  2OTJ P;  1EC5 A;  3CCL P;  3USS A;  1L4A B;  4C46 A;  1R5S A;  1GZL A;  3IF4 A;  1M1J A;  5CCG D;  2KYV A;  3KQG A;  2Q7C A;  3VCP A;  2OYH A;  3V2Q A;  2BEQ D;  1PPJ G;  2E76 C;  2ZYD A;  4JPZ B;  1IFN A;  1JMM A;  1VQP P;  3E1R A;  1TU3 F;  1YYC A;  2FY8 A;  2E5T A;  4UB8 E;  4EI2 A;  4IL6 X;  5AW6 B;  1KMI Z;  4RJT A;  2HPC A;  4DT0 A;  2IYP A;  3CC7 P;  3H25 A;  4XFJ A;  2V7Q H;  2QEX P;  3P8C D;  3VP8 A;  1NU1 D;  2GBW A;  3TF5 A;  5AVY B;  5KLV J;  1FZC C;  2XR8 A;  2WSS H;  3HE4 A;  4HM3 A;  2O01 H;  1ZW0 A;  3RK2 C;  3ITK A;  2KNC B;  1N73 A;  2AXC A;  2WIT A;  3T97 A;  3Q5P A;  3BRT B;  3KXD A;  4GKG A;  2QJK B;  2WSF H;  1QL2 A;  1PP9 G;  3GW6 A;  1J1E C;  2Y9Z A;  1FE6 A;  2FXP A;  1G1I A;  2Q3I A;  2OGU A;  1N73 C;  3OA7 A;  4XE5 B;  4N78 D;  1L4A D;  4HM7 A;  2BCC E;  2XND H;  1ZP0 C;  3Q5R A;  3U1A A;  5AVR B;  3RL0 g;  3II6 A;  2QA4 P;  2Q9I A;  1URQ D;  2C9N Y;  1MV8 A;  3WUV A;  1JB0 J;  3V2P A;  3BCC G;  1PGJ A;  2M3B A;  1HGZ A;  3FXE A;  2J59 M;  1T2K D;  3RBX A;  2IBZ I;  1NTZ D;  3L74 D;  1L0N G;  1ZRT E;  3BRV B;  2HPC B;  4A7P A;  2YMK A;  1NKN A;  5APT A;  1R8E A;  2BMQ A;  3TGU G;  1VQL P;  1ZLL A;  3TDK A;  3CI9 A;  1UUV A;  1G2C B;  2P10 A;  2O1K A;  2H43 A;  4ASW A;  4D6T J;  5APU A;  3AE1 C;  3KHU A;  1KYO I;  1RF0 A;  2KUB A;  3CXH H;  1MKM A;  3AEG C;  3GMA A;  2QM7 A;  1BCC G;  3Q5S A;  3HD7 C;  3M9Q A;  1WRG A;  5CJ0 A;  4OGQ C;  1SQP D;  3AEE C;  2K9J A;  2OYH B;  3VP9 A;  3A5T A;  2AXT E;  3AED C;  4QMA A;  2HYN A;  1IJD B;  1RQV A;  3CD6 P;  1YIJ P;  2JP3 A;  4ZKU A;  4IFD K;  1BE3 G;  2R44 A;  1W2E A;  2QJK C;  1EDK A;  1IK7 A;  1SQP K;  4AQR D;  1S4X A;  4IOI H;  5GTI E;  3DQY A;  4QUP A;  4YPC A;  1RQU A;  2V4H A;  1RE4 C;  4H13 D;  2PGD A;  4Y28 J;  4RKU J;  2VRS A;  3VMI D;  1AFO A;  2KZJ A;  1LT9 B;  1LGH B;  1JOC A;  3N7N A;  1LTB C;  4HM4 A;  3CWB J;  1FZE A;  1HJB A;  1O7G A;  1IFI A;  1RIE A;  4PD4 I;  1SP4 A;  1JY2 P;  2KZI A;  1KFN A;  3AEB C;  1Y9B A;  2HG5 D;  4HM6 A;  1BDC A;  3VN0 A;  5AW1 B;  1P84 H;  2HML A;  3MIW A;  3I56 P;  1GD2 E;  1SQV E;  3GCE A;  4LC1 A;  1SQV D;  1NKZ B;  4R4M A;  2RMZ A;  2NUM A;  3C0D A;  2FYU E;  3C1L A;  4KHX A;  3L73 J;  4DOJ A;  2M5A B;  1KN7 A;  3HD7 B;  1L0N E;  2MKV A;  1HBW A;  2Z5H A;  1K8A Q;  1EQ7 A;  2WZ7 A;  4JYB A;  2ZXE B;  4P1B H;  1H0T A;  2H88 C;  3MHV A;  3U1C A;  1VF5 C;  2BAS A;  1ZOY C;  1NTZ K;  2A06 E;  3GKE A;  2NZ2 A;  4I7Z B;  4QDF B;  2QJP B;  5BOK A;  5CCH C;  3H1K E;  1BGY J;  1L0L J;  3FWL A;  2LKM A;  1EZV G;  3L70 G;  1LTJ C;  5CCH A;  2WSC J;  4YXD C;  5APW A;  2HOD B;  2YKP A;  5KAI H;  1IZN B;  1X8Y A;  5KLV D;  3H32 A;  1H0T B;  4P1C H;  1HH0 A;  4LLH A;  2QIW A;  2HOD A;  1NAF A;  2RKL A;  3R4Y A;  4EOT A;  1GTW A;  2GBX A;  1X0T A;  2V7Q J;  2KB7 P;  1KB9 I;  4B86 A;  2Q5U A;  4ZMD A;  1RFS A;  2Q3W A;  1LT1 A;  1LTT C;  4GOD A;  3KZI H;  3VMH D;  2JO1 A;  1SQB J;  1L0N K;  1JY3 O;  5B66 E;  1JCC A;  3JC2 2;  3H1I E;  1BDD A;  2BCC D;  1FZC B;  1BSN A;  1PP9 D;  2BCC J;  1AQ5 A;  1OZH A;  3IN6 A;  1KC8 Q;  2ZYA A;  2M3E A;  1QL1 A;  3L71 J;  1ZRT D;  1G1J A;  1Z56 A;  1E5W A;  4WY4 A;  2KLV A;  4HJL A;  4OVN F;  3L72 D;  1LT9 C;  5AVV B;  1KB9 H;  4HKV A;  3PRJ A;  5AVS B;  3CCJ P;  2WT7 A;  3H1I G;  3EFG A;  3AE7 C;  1NYH A;  3LID A;  2E74 D;  3AE4 C;  1U7J A;  1NTM K;  1U57 A;  1Q82 Q;  1FDO A;  3L74 J;  3W67 A;  2B1X A;  2C0X A;  4OH8 B;  1DD4 A;  2YKO A;  1A02 J;  4H0L D;  3D6Y A;  1KV4 A;  3H1I D;  4I6M C;  1EZV I;  3CPW O;  3L70 E;  2I8D A;  3B5N B;  4NBA D;  1M8O B;  1JM1 A;  5L8R J;  2IX7 C;  1LP1 B;  1NU1 E;  4HH2 A;  3CXH I;  4L74 A;  2QSI A;  1DIP A;  3AE2 C;  4QDF A;  5APY A;  1BCC J;  1CSB A;  1KQL A;  1LNQ A;  1FBM A;  2Q6Q A;  3R2P A;  4R4L A;  3W68 A;  4I7Z C;  4AUW A;  1GL2 B;  1UUW A;  4EYY Q;  4N78 E;  1N2D C;  1OVU A;  2ZVO B;  3RL0 D;  1AQT A;  2A06 G;  2E76 D;  2K3R A;  3GL2 A;  1LTG C;  1YQ4 C;  1Q86 Q;  1S5L X;  5KLI B;  1G2C A;  3SWK A;  2IFN A;  1P84 D;  3F89 A;  3N0Q A;  2J5U A;  1JTH B;  1NJI Q;  1ULI A;  3GL0 A;  2P7J A;  1VF5 B;  3H1L D;  1LTA C;  2I1K A;  3L36 A;  1NTZ G;  1IFD A;  1KIL A;  2KNC A;  3CCR P;  2YXR B;  4HM0 A;  4WB4 A;  1PV3 A;  1K73 Q;  4W80 A;  3A2A A;  3HUS A;  1FDM A;  4U3F G;  2N1T D;  2B24 A;  2KSE A;  1SQQ E;  1O7H A;  2IDB A;  2ZAE B;  2RH0 A;  1KYO D;  3B8E B;  2FFD C;  3GOB A;  2O01 N;  2ZYG A;  1M56 D;  2G3A A;  2IZ1 A;  1LT9 A;  1VDF A;  3FXD A;  5TIS E;  2ZVN B;  3TSI A;  3TNU A;  1QEX A;  1N73 B;  3TK1 A;  4U3F D;  2JZA A;  2K37 A;  1KIL D;  4NBH D;  4L76 A;  4W7Z A;  4IL6 E;  5CXM A;  1URQ C;  1NTM G;  3CX5 E;  1PIX A;  5AW3 B;  3MGN A;  3H1L J;  2KIK A;  3RGU A;  2E76 B;  1OIP A;  2WSE H;  4TT3 H;  1W5C E;  2GUV A;  1M1J B;  2O1J A;  2AEF A;  1IK9 A;  3L75 J;  3KZI E;  3L72 G;  2B88 A;  5APV A;  1DEE G;  2HFE D;  3EN1 A;  2IFM A;  3AEA C;  3AE5 C;  2R32 A;  1QX8 A;  3CL3 D;  1FDI A;  1NU1 K;  3B4S A;  2K9Y A;  3WU2 H;  2W6A A;  1SQX J;  5GTI H;  3IAO A;  4C7N B;  3H1K G;  2NPS A;  5AVZ B;  2JKV A;  3TNU B;  1KZU B;  4JYC A;  2WPV B;  2A06 D;  4EDF A;  1HJ0 A;  1FQT A;  5CJ4 A;  4LGD E;  1Q2N A;  2KI7 B;  2HMJ A;  3H1L G;  4N6J A;  2SPZ A;  2D2C D;  1OXZ A;  1SQP J;  1Q90 C;  1BE3 J;  1LWU B;  2AXT H;  5GTH H;  4QUQ A;  4NB8 D;  3RK3 B;  2HMK A;  4HJG H;  3M91 A;  2NPS D;  2YFJ A;  1YJN P;  1NVO A;  1RHZ B;  3D6Z A;  4ZNC A;  3OAK A;  3PP5 A;  2L91 A;  1KIL E;  3G6E P;  2R3S A;  1JO5 A;  3SFE C;  3BCC D;  1R5L A;  2WSF J;  3H1H E;  3AE9 C;  5CBO A;  1PGQ A;  1FZF A;  2O01 J;  2KS1 A;  4EMJ B;  1SQQ G;  2E75 B;  2PRR A;  3D70 A;  2QE7 H;  1N7S A;  2I7F A;  1SQP G;  2E74 B;  3RBZ A;  2K88 A;  2FXM A;  1URQ A;  2ZJS E;  2P1J A;  4OGQ D;  1GU5 A;  2WMM A;  3M9H A;  2FYN C;  1T6A A;  2JO6 A;  3Q2Y A;  4OWF A;  1P84 E;  4GOF A;  5H2F E;  2WTY A;  1GL2 A;  1ZR4 A;  1VF5 D;  2L5G B;  3WMM 0;  5CCG A;  4PD4 H;  5KAI E;  1GDT A;  3L73 G;  3CCE P;  1HUC A;  3VMG D;  2CKF A;  2PFX A;  1RH5 B;  4HM2 A;  1T2K C;  1N7S D;  1HVV A;  3H1J E;  1U7M A;  3MUD C;  3GZY A;  3V4W A;  2PP6 A;  1AV1 A;  1GMJ A;  1FS0 E;  2A45 H;  1KIL C;  2NPS C;  5AW7 B;  3EFF K;  1NTZ E;  2Y0E A;  4ZKP A;  2W83 C;  1VL2 A;  1KB9 D;  5AVX B;  3S4R A;  3RK3 C;  2IBZ D;  3I5C A;  2ZT9 B;  2BMR A;  2XZR A;  1EDL A;  1PP9 J;  3CCQ P;  1VQ5 P;  2FYZ A;  2IZ0 A;  1N8R Q;  3L75 G;  5B5E E;  4AYC A;  3VMA A;  4Y99 B;  1DH3 A;  2YNY A;  5AW9 B;  4H13 C;  4NBB D;  1JUN A;  1S1C X;  2XDJ A;  4ASV A;  4C7N A;  2OYH C;  1YIT P;  1WQL A;  1EG9 A;  4K3A A;  3M9B A;  5APX A;  2I1J A;  1IFP A;  5CMZ A;  1X22 A;  3WU2 E;  1NYK A;  3GHG B;  1JY3 N;  3H1H J;  1S5L H;  1FAV A;  3ABV C;  2FYU J;  3RL0 B;  4WVZ A;  5KJ7 D;  2NVF A;  3WUT A;  1SFC A;  3CC2 P;  2H8P D;  1KQF B;  1L2P A;  3H1J G;  2XNX A;  1BE3 D;  4GDO A;  1WMK A;  3L73 E;  2XSH A;  2QVA A;  2DE7 D;  1BGY D;  1L0L D;  3RK3 E;  3PJS K;  2YO3 A;  4XA4 A;  1FC2 C;  5H2F H;  1UIX A;  3PH0 A;  3V2N A;  3CCV P;  4NBG D;  2DW3 A;  4H0L C;  3OJA B;  3L72 E;  1VM9 A;  4HKZ H;  3FWN A;  5BU5 A;  4BWN A;  3RK2 B;  4IFM A;  2WPS A;  2GM4 A;  3L72 J;  3O8Z A;  1NU1 J;  3H1H G;  2E74 C;  1NDO A;  3CCU P;  5AEU A;  1OW8 A;  3A7O A;  2RN0 A;  2QPZ A;  1OMI A;  4U7J A;  3CXH D;  1G8K B;  1SJG A;  3H1K J;  1VQ7 P;  3RL0 C;  3PTZ A;  3AE6 C;  2KS1 B;  3V2R A;  3SWY A;  4OGQ B;  3AZC A;  4PJ0 H;  3HE4 B;  1VQK P;  4L75 A;  4D6T G;  2BEZ F;  3C8V A;  2N1T C;  2W6B A;  3CWB E;  1BCC E;  2HMN A;  1VQ8 P;  1LWU C;  2HMO A;  5HL4 A;  5C39 A;  5DJU B;  5APS A;  4JF7 A;  2B89 A;  4NPE A;  1IO4 A;  3WUU A;  1JY2 N;  1O7N A;  1P84 I;  3L71 E;  3VCA A;  2HMM A;  1T3U A;  1QLE D;  4JQ0 D;  5KTB A;  1NTK D;  3NTN A;  1N7S C;  2KXP B;  3UIA A;  3SSU A;  2YFI A;  1VQM P;  1Y8A A;  1EXI A;  1O7M A;  1G8J B;  2NUK A;  1YBK A;  1BGY G;  1L0L G;  1DD3 A;  3CWB G;  1J1D B;  2E42 A;  1NGM B;  2NPS B;  2YKQ A;  3HD7 D;  3L70 D;  4RO0 A;  4D6T E;  1K05 A;  2B87 B;  2NWF A;  2YMY A;  5DJT B;  3MZW B;  5KLV G;  4UB8 H;  2XSO A;  1NOH A;  4NPF X;  1YTZ I;  3M0D C;  1MUU A;  3LIE A;  2E43 A;  1M1K Q;  1NTM E;  5TIS H;  2H89 C;  2OQQ A; 
#chains in the Genus database with same CATH homology
 1VF5 D;  2BCC E;  1O7G A;  1RIE A;  3AZC A;  1FQT A;  2IBZ E;  1VCK A;  1NYK A;  2B1X A;  2HMJ A;  2B24 A;  4P1C H;  3GTS A;  1SQQ E;  1O7H A;  3VMG D;  2D2C D;  3CWB E;  1BCC E;  2CKF A;  2NVF A;  2ZYL A;  3GTE A;  4H0L D;  2HMN A;  3L74 E;  4HM2 A;  4NBC D;  2GBX A;  1Q90 C;  1PPJ E;  2E4Q A;  3BCC E;  4NB9 D;  3GOB A;  3H1J E;  4QUR A;  2BMO A;  1KYO E;  2E4P A;  4PV1 D;  5KLI C;  2HMO A;  4QUQ A;  5HL4 A;  2YFL A;  4NB8 D;  4QCK A;  1ZRT E;  3L70 E;  3VCP A;  2NVG A;  3GZY A;  4HM6 A;  1RFS A;  1SQP E;  2Q3W A;  2HMK A;  4NBA D;  1JM1 A;  1BE3 E;  1O7N A;  5KLV E;  2YFJ A;  2BMQ A;  2HML A;  1KB9 E;  4HM5 A;  1NU1 E;  3L71 E;  1UUV A;  3VCA A;  1NTK E;  1SQV E;  2HMM A;  2YVJ B;  3TGU E;  2JZA A;  3D89 A;  4NBH D;  1NTZ E;  3GCE A;  3VMH D;  3L73 E;  1EZV E;  2XSH A;  5CXM A;  2NVE A;  2DE7 D;  1O7P A;  3CX5 E;  2YIU C;  3L75 E;  4QDF A;  3H1H E;  2NUM A;  3C0D A;  2FYU E;  1ULJ A;  4NBG D;  4H44 D;  2YFI A;  1L0N E;  4AIV A;  2XRX A;  4AAY B;  3L72 E;  1O7M A;  3H1I E;  1VM9 A;  1G8J B;  4HM8 A;  2NUK A;  4U3F E;  1UUW A;  2BMR A;  4NBD D;  4P1B H;  4QDC A;  4EMJ B;  4NBE D;  2GBW A;  2QJK C;  2XR8 A;  3EN1 A;  3CXH E;  2E76 D;  4HM3 A;  3GL2 A;  3GZX A;  4D6T E;  4QDD A;  1NDO A;  2A06 E;  2I7F A;  3GKE A;  1PP9 E;  5AEU A;  4QDF B;  5KKZ C;  2E75 D;  3DQY A;  2QJP C;  4QUP A;  5BOK A;  4HM1 A;  4HJL A;  1SQB E;  2NWF A;  3H1K E;  4PD4 E;  3N0Q A;  4HKV A;  4NBB D;  3H1L E;  1ULI A;  2QPZ A;  2DE5 D;  4H13 D;  2XSO A;  3GL0 A;  4OGQ D;  1WQL A;  4NBF D;  3VMI D;  3EQQ A;  2DE6 D;  1EG9 A;  1G8K B;  2FYN C;  1O7W A;  3GB4 A;  1SJG A;  2E74 D;  2QJY C;  1BGY E;  1L0L E;  1SQX E;  5AEW A;  2JO6 A;  2ZT9 D;  3FOU A;  1P84 E;  4HM0 A;  1NTM E;  4HM4 A;  4HM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...