3CX5E

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cx5E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cx5E02
3GZYA 4QUQA 1EG9A 4HJLA 1RFSA 4HM3A 4NBGD 1BE3E 1NTZE 3GKEA 2XSHA 3GTSA 1VCKA 4NBHD 1SQBE 2YVJB 2XR8A 4NB8D 2HMMA 2YFIA 2XRXA 4EMJB 1O7MA 2A06E 3D89A 2DE7D 1L0NE 2YFJA 4HM2A 3L74E 1WQLA 3VCPA 3VMID 1G8JB 2NVFA 2HMJA 3GOBA 4U3FE 4PV1D 2FYUE 4QDFA 1SQQE 1NDOA 1ZRTE 5BOKA 2BMRA 3GZXA 1SJGA 4HM7A 4QDFB 3H1IE 2E75D 4NBAD 2HMOA 3CXHE 4NB9D 1SQPE 1KB9E 4D6TE 3H1JE 2GBWA 4HM4A 2HMKA 1UUWA 2GBXA 4HM1A 3EQQA 3L70E 2XSOA 3H1LE 1NYKA 1ULJA 4NBDD 3FOUA 2YIUC 1JM1A 4AAYB 3VCAA 1NU1E 2JO6A 2QJKC 4H44D 3TGUE 3VMHD 2FYNC 5HL4A 1RIEA 3AZCA 2DE6D 4QUPA 3DQYA 3VMGD 4NBCD 2B24A 4HKVA 4OGQD 3H1KE 5KLIC 2QPZA 2NVEA 3GL2A 1Q90C 3H1HE 1VM9A 1UUVA 1O7WA 2E4PA 3N0QA 1KYOE 3L75E 2NUKA 2HMNA 4HM5A 1PPJE 4NBFD 5AEWA 5KKZC 2E76D 3L72E 3L73E 4HM6A 1O7NA 4HM0A 1O7HA 5AEUA 3GTEA 4QCKA 3GCEA 1BGYE 4QDDA 1G8KB 2DE5D 2HMLA 1PP9E 3C0DA 4P1BH 2BCCE 2QJYC 3EN1A 3BCCE 4QURA 2BMOA 1P84E 3L71E 1BCCE 2B1XA 4H0LD 1NTKE 2BMQA 1SQXE 1FQTA 2NWFA 4QDCA 1NTME 3CWBE 2I7FA 4H13D 2NVGA 2ZYLA 4AIVA 2E4QA 5KLVE 2NUMA 1L0LE 3GL0A 4HM8A 4P1CH 2D2CD 3CX5E 1O7PA 2CKFA 2JZAA 2E74D 2YFLA 1O7GA 1SQVE 1ULIA 1EZVE 4PD4E 4NBED 5CXMA 2QJPC 2IBZE 2ZT9D 3GB4A 4NBBD 2Q3WA 1VF5D
chains in the Genus database with same CATH superfamily
1SQVK 1KMIZ 1EG9A 5AW0B 5APUA 4PD4I 4AYCA 1VCKA 3A2AA 1SQBE 3V2QA 2YKPA 3CCQP 1RQUA 2RMZA 3BASA 1SJGA 5CCHA 2KS1A 1NU1K 4NB9D 1JY3N 1SQBD 4K3AA 1HBWA 1SLQA 4NPDA 4NBDD 2QG4A 1DH3A 3WU2E 1T2KD 3CI9A 1ZP0C 2Q6QA 4XA4A 5KLVG 3LIDA 2ZXXA 3SWFA 1AVYA 2QSIA 2MKVA 1JO5A 1KYOE 3L75E 1JY2O 1IO4A 1AJYA 2N1TD 2QJKB 3PTZA 2J59M 2FFDB 2JJLA 1JNMA 3RK2B 3CCUP 4QURA 1KYOD 3L75D 3RL0C 1GL2C 1T3JA 4QDCA 2Y9YA 5KJ7D 2AEMA 2IYPA 5AW4B 3EFGA 1LTIC 3CX5E 1W2BO 2E74B 3N7NA 4L73A 3T97B 4DT0A 1EC5A 3S1KA 2WZ7A 1WRGA 4HM3A 1BE3E 3JC22 3WMM0 4M3LA 4NB8D 3CX5D 3Q1MA 1RH5B 2H8PD 3VCPA 1RY3A 3U1CA 1LTTC 4PV1D 1SQQE 4L75A 2HODA 3M9HA 5BOKA 5KLVJ 1FZCC 2E75C 2LXBA 1BE3D 5CCGC 1FS0E 1T3UA 3U59A 4JYBA 4N3YB 2XSOA 3BATA 3M0AA 1NYKA 2YXQB 3C9IA 2C9NY 3RL0g 2WVRA 2P67A 1SQQD 1L4AB 3F5HA 3GHGC 1YTZT 1IFDA 1N86A 5CBOA 1GTWA 2JKVA 2NPSB 3CD6P 1PIXA 3G9RA 2FXOA 1LT9C 3WUVA 3L37A 3L73E 1GU5A 4WY4D 3H1LG 1SFCD 1ZN5A 3AEDC 3HE4A 1H0TA 3P7KA 3I5CA 1HUCA 3O6QA 3AE7C 4OH8B 2FKWB 1URQD 5AVQB 2NWFA 3M06A 1NTME 3L73D 3FXEA 3H1HG 5AVZB 1FDOA 2C0XA 1NVOA 1S5LX 1X22A 4IFFA 2D2CB 1O7PA 1SQVE 4PD4E 1EXIA 5APYA 1HVVA 1YJNP 2XV5A 2IBZE 1N8RQ 5GTIH 2Q1KA 1EDIA 3OA7A 3WU2H 1RFSA 4HB1A 1VF5C 1NTMD 3CCJP 5CCHC 1E79H 3AE5C 1J1DC 1SQVD 4W80A 2JEEA 4PD4D 2OTJP 2P7JA 1SQXJ 3M9QA 2IBZD 4AUWA 2FYUE 1KYOH 2L91A 2WSCH 3B4SA 1GK6A 1ZW0A 1IFNA 3RK3C 2QVAA 4YTPC 1OW8A 1SQPE 2QRXA 2HMKA 1LGHB 3II6A 4IFDK 4OVNF 3FOUA 2FYUD 3CMEP 3JCUH 3H1LJ 4IFMA 1RF1B 1SQPD 3CX5H 1Q90D 2V4HA 4OGQC 4EDFA 4D6TG 1FOSE 2YIUB 3H1HJ 1LWUB 4ZMDA 1USEA 3MIWA 2XZRA 3AE9C 5AVXB 1WMKA 1EDJA 2QE7H 2NZ2A 3AE1C 1KFNA 1DD3A 2K88A 2HR3A 3HUSB 4H13C 3RGUA 1JY2N 2CKFA 2JZAA 1X79B 2N1TB 1EZVE 5B5EE 3HE5B 2O01H 4GKGA 2OYHB 3D6ZA 3L72J 2WTYA 1NU1G 3CC2P 1G1IA 1AV1A 3KXDA 2BCCJ 1EZVD 2HMJA 1RF1A 4U3FE 1VQKP 2XU6A 4I2LC 1NYHA 4JF7A 1FOSF 3A3YB 3HD7D 1GMJA 2E42A 2WPVB 4D6TJ 3M9BA 3CXHI 3L71G 3CPWO 1BCCG 3V5BA 2E76C 4U3FD 3SWYA 2RKLA 2A45G 4PV1B 4RESB 3IN6A 1QVFO 3AZCA 3CCLP 2HPCB 1Y8AA 5KLIC 3H1KE 2OYIA 1RHZB 2OTLP 4GT1A 1O7WA 3Q5PA 2KNCB 5APVA 4GDOA 3R2PA 1DX7A 1KILB 3R4YA 4QCKA 2KLVA 2N9BA 3H1KD 4P1BH 1YJWP 1YITP 1NU1J 2OGUA 1FQTA 1S5LH 1HGZA 2NVGA 1NAFA 1ZR2A 2YFLA 2E74D 4N78E 4WY4B 3MUDA 1SFCB 3Q5SA 2ZYDA 3KPEA 2W90A 1AQ5A 2JWAA 4UB8E 1DD4A 2QJYB 2ZT9C 2FXMA 1FZFA 2Q3WA 4O9BA 4NBHD 2XRXA 2A06E 3D89A 4N78D 3L71J 1BCCJ 2P10A 2I1JA 2Q3IA 4K35A 3O8ZA 2W6JH 1KZUB 1PL5A 3WUUA 2V7QH 2PRRA 2Q3EA 3CX5I 1BGYG 3EFFK 3CCVP 2A06D 1FE6A 3TSIA 1W5CE 1L4AD 3V2RA 3PJSK 3L4FA 1VQ8P 1JTHB 1NKZB 5BVZA 3CCRP 4QUPA 5CJ0A 3IAOA 1J1EB 1KV4A 1KQFB 5TISH 2ZAEB 4HM5A 1O7NA 1HH0A 3U1AA 4BWNA 1IC2A 1K04A 1URQA 1L0LK 3L36A 2B9BA 1N73B 1LTJA 1M1JB 4IL6E 1QL2A 2ZYAA 5KKZB 2OARA 2E4QA 5KLVE 1QEXA 1LP1B 2D2CD 1NTZK 3L70G 1U7JA 3MZWB 1FAVA 2R32A 1MZ9A 1BGYJ 5KLVD 2WPRA 4ASWA 2XNXA 4HM2A 4R4MA 2QJPB 3KZIE 2M5AA 4DOJA 3VMYA 2ZFCA 3CXHE 1NKNA 4ZNCA 2AXTH 3H1JE 4EOTA 5TJHA 3RBZA 2OYIC 3A0BE 2PFXA 2IBZI 2JO6A 2YKOA 3CXHD 3TK1A 4H44C 2JDIH 2DE6D 3H1JD 1Z56A 3LW5J 3HD7B 1IFIA 2ITAA 4BRYA 4UB8H 4NBFD 5APXA 2YMYA 3GMAA 5GTIE 2KLUA 3L70J 2FYNB 3MUDC 3B5NB 1T6AA 3GF3A 3CC7P 2NRGA 1LT1A 1SQXE 2JWDA 4H0LC 1KORA 3BVHA 4I7ZC 4NBED 4Y99B 3GB4A 1IJDB 2R5DA 3B71A 1SQXD 3JCUE 3CC4P 1NGMB 1GZLA 1U57A 5CMZA 3MP7B 4N6JA 3C8VA 3GF7A 1WQLA 4GIFA 1Q82Q 1Q2NA 2XKMA 4C7NB 2K3RA 3AECC 3CCMP 1VPCA 1FJPA 3KQGA 5AVSB 3SWKA 1EQ7A 1A02J 3VMZA 2GBXA 1EZVI 1PP9G 3EQQA 2LXCB 2WWWA 1YTZI 2ZYGA 3P8CE 4IL6H 3JSVC 2W83C 1PGOA 1KILE 1OVUA 2JO1A 1URQC 2B24A 2QPZA 3W67A 4R4LA 4GOFA 1LTJC 1VM9A 2O1JA 2E4PA 1PZQA 3P8CD 3L72E 2FFDA 2QEXP 1NTKK 3PRJA 1IK9A 4HJGH 1KILD 1R5SA 3VYIA 3HTKB 2OTKE 2Y0EA 2BCCE 5AVRB 3VOPA 5AVYB 3RL0D 1GL2D 1P84E 3KZIH 2YNYA 4LGDE 3NMDA 2BEZF 4XE5B 3L72D 4AIVA 3CXHH 3FXDA 2NUMA 4Z1MH 1M1KQ 1MKMA 3T97A 1PGQA 5CXMA 2FYZA 3A0BH 2BCCD 2W27A 1P84D 4HJLA 1GW3A 2E5YA 2WSEH 2WSEJ 3GKEA 2XSHA 2I8DA 1PP9J 5E79E 1KTMA 2YFIA 4EMJB 1OVRA 2DE7D 3NFQA 3VMID 1N7SB 3PHLA 5APTA 1VQ7P 4HM7A 4QDFB 1HJ0A 2E75D 2E5TA 2HMOA 3TDKA 1G2CB 2KZJA 1NWQA 1KB9E 1FZBA 2O3JA 2R44A 4JQ0D 2WSFJ 1MV8A 4L74A 5AW6B 4W7YA 2YMKA 1L4AA 3IF4A 2R3SA 5AW7B 5KTBA 1NU1E 1QVGO 1XTGB 1L0LG 2NPSA 3V2NA 1KB9D 1S5LE 1SQQG 2QM8A 4HKVA 1R5LA 1VQLP 3V2PA 1HGVA 1NU1D 1NTZG 4WBAA 1QGKB 1K8AQ 1VL2A 3GCEA 3L74G 3EWKA 5EFWB 2Y9ZA 2PGDA 2BMOA 3L71E 1BCCE 3M91A 2WT7B 2I7FA 3VN0A 3H32B 3D6YA 1GD2E 1HWTC 1L0NK 2IZ1A 3RK3E 3L71D 1VF5D 1BCCD 3TGUG 5AVUB 5CCHD 3Q3DA 5KAFE 3CMAP 3IR9A 2OYOA 1NTMG 1Q86Q 1JB0J 4JBZA 2VRSA 2B87B 1USDA 3RK3D 1S72P 1L0LJ 1OMIA 5TISE 1R8EA 3TYYA 3Q5RA 2Y0CA 3GW6A 2KIKA 1OW7A 3SFDC 2P58A 1M8OB 1P84H 4AAYB 4DJGA 1OVVA 1NTZJ 2QJKC 3V4QA 3L74J 2K37A 3RK2C 4NBCD 1SVFA 4OGQD 2O1KA 2YXRB 3PLNA 2KSEA 1LWUA 2GUSA 3A7OA 1YYCA 4HM6A 3H6PA 1QX8A 2E74C 2LR2A 3GTEA 5E79H 4IOIH 1BGYE 5APQA 2H43A 3B5ND 2M8RA 5AW1B 2POHA 1MFZA 3B8EB 3D70A 1ZV8A 2AEFA 3TGUJ 2B1XA 3H1IG 3HUSA 3CWBE 4H13D 2IFNA 2N1TA 3H25A 4HM8A 1KB9H 4P1CH 3OAKA 3HE5A 1NTMJ 1SQBK 2AXTE 1BGYD 2OYHA 1VQMP 5AVVB 2ZVNB 1N2DC 1IK7A 4NBBD 3VTPC 4WB4A 3RL0B 1GL2B 3CWBD 5KJ7A 3G3ZA 3VMAA 4JYCA 1OX3A 1CSBA 1L4AC 1G8JB 1FDMA 5APWA 1S3JA 3BRTB 1OZHA 2L5GB 5DJTB 2RH0A 5AW9B 2NPSC 3CCEP 3L70E 4QMAA 1IZNB 3C1LA 1S9KE 4UB6E 1NTKG 3V6IA 3VCAA 2H88C 2A45H 4WVZA 3VMHD 2HPCA 2C9LY 1FZCB 2E75B 5AW8B 4EYYQ 4ZKPA 2NVEA 3L70D 2KNCA 1KQGB 4DZOA 1S9KD 2M3EA 3H1IJ 3N0QA 3GG2A 2G3AA 2CPSA 1YHQP 1KILA 2D2CC 4HH2A 3GHGB 5H2FE 5KAFH 1CZQA 2K1AA 1ZXGA 3OJAB 1EDKA 3CL3D 1BSNA 4WWIA 1GW4A 1LT9B 2ZYLA 1OIPA 4WY4A 1SFCA 1FZGA 3TF5A 1HJBA 4GODA 1M56D 2JP3A 2MJZA 2ZT9D 2KK7A 2GM4A 3NXSA 1K73Q 1HTLC 1CI6B 3GZYA 1SQQK 2Y0DA 3NTNA 2E43A 4NBGD 3OW2O 2WPSA 2ZXEB 5GTHE 1SP4A 2XDJA 2HG5D 2W6BA 1QL1A 3AE4C 1N7SD 1NTKJ 3ITKA 1AA0A 1YQ4C 1P84I 1PPJG 3GZXA 2G8YA 2IDBA 4NBAD 1RF1C 2YO2A 1VF5B 2HYNA 3I55P 2GBWA 2KS1B 4HM1A 1EDLA 1J1DB 3BCCG 3AEGC 2YIUC 4YPCA 5CJ4A 1JTHA 1LWUC 1T2KC 1X0TA 2P2UA 4GOEA 3RK3B 5HL4A 1KQLA 1KC8Q 1KN7A 3VMXA 4RJTA 1OW6A 3FX0A 3VMGD 1M7LA 1RF0A 1JY3P 2QM7A 3D71A 2M3BA 3LIEA 1RE3A 2IX7C 3HUSC 2IZ0A 1NTMK 1KB9I 2N1TC 2QIWA 1TU3F 4PJ0H 1K9MQ 1L0NG 4B86A 1N73A 4Y28J 2K9YA 2DE5D 1M1JA 1PP9E 3E1IA 2OYHC 2FBWC 5B66E 3LW5H 2O01N 1FU1A 4OGQB 4YXDC 1DIPA 1LP1A 5KJ7C 4U7JA 1QLED 2PP6A 1ULIA 1PP9D 2KXPB 1ZLLA 4UB6H 1JCDA 1JM0A 2XNDH 2FYUK 1OFCX 2KYVA 1FBMA 2XR8A 2HMMA 1Q81Q 4H13B 1JCCA 1SQPK 3BCCJ 2IYOA 2J5UA 2B88A 3FGAD 2UWJE 2NVFA 1ZRTE 4PV1C 3AEBC 2Q5UA 1IFJA 2A45I 4I1LA 4HKZH 2HODB 2KOGA 5AVTB 5AW2B 5AW3B 2BASA 5H2FH 3H1LE 5DJUB 1VQOP 4LLHA 1ZRTD 5AVWB 3Q2YA 3G6EP 4H44D 1KILC 2KB7P 1L0NJ 1M57D 3HD7A 3S9OA 3P8MC 3GL2A 2K9JB 1W2EA 3P32A 1Y9BA 3H1LD 3H1HE 1MUUA 1UUVA 3AEEC 1RE4A 3H1JG 3FWNA 5AEWA 2E76B 1K05A 1SQBG 1O7HA 4WY4C 5AEUA 3B5NA 1SFCC 1GU4A 3EQ2A 5GTHH 3HE4B 1H0TB 2HMLA 1PV3A 2QJYC 5KLIB 1U7MA 3H1HD 3O6QB 1SS1A 4C7RA 4CPGA 4H0LD 2KSJA 2W6AA 3WUTA 4NPEA 1L0LE 3QWOC 3GL0A 2R3CA 5C39A 5AW5B 1VQ9P 3AE6C 1CW5A 4QUQA 3N4XA 1NTZE 1L2PA 1L0LD 2AEJA 1SQXG 1BDDA 3L74E 2JR8A 4C7NA 2Q7CA 3L75G 4EIJA 1VQNP 2HLOA 2BMRA 1KQSO 2ZT9B 2K9JA 2IPPA 3KDPB 1NTZD 4D6TE 3AE8C 4HM4A 3A0HE 1J1EC 1H8AA 1E5WA 1RF0C 3L74D 5B66H 3H1JJ 1J2JB 1RE3C 3RBXA 1SQBJ 3TGUE 5L8RJ 1NOHA 1KFMA 4D6TD 1NH4A 1N73C 4KT0J 5CCGD 2WQYC 1M1JC 1UIXA 1Q90C 4BXLA 1PGJA 1DEBA 2WSFH 2B89A 4XFJA 5KKZC 3AEFC 3USSA 3CCSP 1BE3G 1VQPP 3TGUD 1YQ3C 3HTKA 2WPQA 3C0DA 4MN4C 5BU8B 1YIJP 1YBKA 3VP9A 3KHUA 3MD0A 4RKUJ 4JPZB 2CPBA 1X9VA 3L75J 4C46A 4NPFX 3L72G 2QJPC 2WSCJ 3A5TA 4KHXA 3E7KA 3AEAC 1JOCA 4AQRD 2BCCG 1S2EA 2PAJA 2YVJB 2H89C 1FC2C 2Z5IA 1O7MA 1FZAA 1BDCA 1N7SA 1ZMEC 1JY2P 4QDFA 1FDIA 2AXCA 1S1CX 3L73G 1G2CA 3H1IE 1LJ2A 1H89A 1AQTA 1LTBC 3HD7C 1UUWA 2DW3A 3I56P 4ZKUA 2Q9IA 1VQ5P 4OWFA 2N9YB 1RE4C 1BE3J 3MGNA 3H1ID 1N7LA 2BEQD 2FYNC 1RIEA 1SQVG 3B5NC 2HFED 3DQYA 2OQQA 1SQQJ 2IBZG 1GDTA 2OYIB 1PFIA 3HRNA 3AE2C 2P1JA 1VDFA 1GK4A 2Z5HA 4HM0A 2QA4P 3W68A 4H44B 1IFPA 2O01J 5KLVK 4LC1A 2FFDC 4Y99C 5KAIE 2FYUG 4TLFA 2WT7A 5CBNA 1NTKE 2BMQA 3H32A 1NAYA 3FWLA 1SQPG 1T8ZA 3E1RA 4ASVA 1EXJA 3A0HH 5CHXA 1JY3O 3L73J 3SSUA 3M0DA 3IFMA 1NTKD 1OXZA 1LTAC 3GTSA 4H0LB 1OWAA 1NO4A 1UIIA 2IFMA 1D7MA 2B87A 4I7ZB 4L76A 1LNQA 1BSHA 3GOBA 1NDOA 2WSSH 1JMMA 4TT3H 1SQVJ 4PD4H 2SPZA 3KYQA 4PJ0E 2H7HA 1JM1A 1ZOYC 2ZVOB 1MFTA 2FY8A 3RK2D 1PGPA 1EZVG 4A7PA 4I6MC 2I1KA 2FYUJ 2GA1A 2LKMA 1G1JA 1KD1Q 2GUVA 3VP8A 1PPJE 4YXWH 2W8ZA 1SQPJ 2E76D 1ZR4A 1VQ4P 1JUNA 1SQXK 1YJ9P 2C0WA 1KYOI 3SFEC 1G8KB 1URQB 2ZJSE 3EN1A 4U3FG 3BCCE 3MHVA 1LTJB 1FZEA 2FXPA 1PPJD 5BU5A 2KUBA 1NJIQ 1FJKA 3UIAA 2RN0A 3K5BA 1H88A 2Z4EA 1O7GA 1DEEG 1N7SC 1JMBA 2R5BA 3BCCD 1IFMA 2V7QJ 1GL2A 1M90Q 5K5GB 1JEKA 3ZDMA 3H1KG 1L0NE 2YFJA 3MTUE 3CWBG 3GLMA 4IL6X 3TNUB 1Q7YQ 3PH0A 4DCKA 3CLQA 2NPSD 1VQ6P 2M5AB 1WT6A 5B5EH 2WMMA 3G4SP 1L0ND 1Y47A 5M1BA 5KAIH 3S4RA 3BRVB 4HYTB 2J58A 1ULJA 4EI2A 3QH9A 2YKQA 1FZCA 1LTGC 2KZIA 5CCGA 4KJMA 1RQVA 3G71P 2M0BA 1LTSC 2YO3A 4U3FJ 2KP8A 3F89A 2NUKA 2HMNA 2KI7B 4BRYB 3GHGA 5APSA 1XTCC 3V4WA 2A06G 4QDDA 4RO0A 3ABVC 3L35A 2CK3H 1LT9A 3AE3C 1S4XA 3M0DC 1AVOA 3H1KJ 1AFOA 1A02F 3TNUA 1YI2P 1HF9A 1NHLA 3CWBJ 1X8YA 2WITA 1CI6A 3PP5A 4W7ZA
chains in the Genus database with same CATH topology
3GZYA 4QUQA 1EG9A 4HJLA 1RFSA 4HM3A 4NBGD 1BE3E 1NTZE 3GKEA 2XSHA 3GTSA 1VCKA 4NBHD 1SQBE 2YVJB 2XR8A 4NB8D 2HMMA 2YFIA 2XRXA 4EMJB 1O7MA 2A06E 3D89A 2DE7D 1L0NE 2YFJA 4HM2A 3L74E 1WQLA 3VCPA 3VMID 1G8JB 2NVFA 2HMJA 3GOBA 4U3FE 4PV1D 2FYUE 4QDFA 1SQQE 1NDOA 1ZRTE 5BOKA 2BMRA 3GZXA 1SJGA 4HM7A 4QDFB 3H1IE 2E75D 4NBAD 2HMOA 3CXHE 4NB9D 1SQPE 1KB9E 4D6TE 3H1JE 2GBWA 4HM4A 2HMKA 1UUWA 2GBXA 4HM1A 3EQQA 3L70E 2XSOA 3H1LE 1NYKA 1ULJA 4NBDD 3FOUA 2YIUC 1JM1A 4AAYB 3VCAA 1NU1E 2JO6A 2QJKC 4H44D 3TGUE 3VMHD 2FYNC 5HL4A 1RIEA 3AZCA 2DE6D 4QUPA 3DQYA 3VMGD 4NBCD 2B24A 4HKVA 4OGQD 3H1KE 5KLIC 2QPZA 2NVEA 3GL2A 1Q90C 3H1HE 1VM9A 1UUVA 1O7WA 2E4PA 3N0QA 1KYOE 3L75E 2NUKA 2HMNA 4HM5A 1PPJE 4NBFD 5AEWA 5KKZC 2E76D 3L72E 3L73E 4HM6A 1O7NA 4HM0A 1O7HA 5AEUA 3GTEA 4QCKA 3GCEA 1BGYE 4QDDA 1G8KB 2DE5D 2HMLA 1PP9E 3C0DA 4P1BH 2BCCE 2QJYC 3EN1A 3BCCE 4QURA 2BMOA 1P84E 3L71E 1BCCE 2B1XA 4H0LD 1NTKE 2BMQA 1SQXE 1FQTA 2NWFA 4QDCA 1NTME 3CWBE 2I7FA 4H13D 2NVGA 2ZYLA 4AIVA 2E4QA 5KLVE 2NUMA 1L0LE 3GL0A 4HM8A 4P1CH 2D2CD 3CX5E 1O7PA 2CKFA 2JZAA 2E74D 2YFLA 1O7GA 1SQVE 1ULIA 1EZVE 4PD4E 4NBED 5CXMA 2QJPC 2IBZE 2ZT9D 3GB4A 4NBBD 2Q3WA 1VF5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZY A;  4QUQ A;  1EG9 A;  4HJL A;  1RFS A;  4HM3 A;  4NBG D;  1BE3 E;  1NTZ E;  3GKE A;  2XSH A;  3GTS A;  1VCK A;  4NBH D;  1SQB E;  2YVJ B;  2XR8 A;  4NB8 D;  2HMM A;  2YFI A;  2XRX A;  4EMJ B;  1O7M A;  2A06 E;  3D89 A;  2DE7 D;  1L0N E;  2YFJ A;  4HM2 A;  3L74 E;  1WQL A;  3VCP A;  3VMI D;  1G8J B;  2NVF A;  2HMJ A;  3GOB A;  4U3F E;  4PV1 D;  2FYU E;  4QDF A;  1SQQ E;  1NDO A;  1ZRT E;  5BOK A;  2BMR A;  3GZX A;  1SJG A;  4HM7 A;  4QDF B;  3H1I E;  2E75 D;  4NBA D;  2HMO A;  3CXH E;  4NB9 D;  1SQP E;  1KB9 E;  4D6T E;  3H1J E;  2GBW A;  4HM4 A;  2HMK A;  1UUW A;  2GBX A;  4HM1 A;  3EQQ A;  3L70 E;  2XSO A;  3H1L E;  1NYK A;  1ULJ A;  4NBD D;  3FOU A;  2YIU C;  1JM1 A;  4AAY B;  3VCA A;  1NU1 E;  2JO6 A;  2QJK C;  4H44 D;  3TGU E;  3VMH D;  2FYN C;  5HL4 A;  1RIE A;  3AZC A;  2DE6 D;  4QUP A;  3DQY A;  3VMG D;  4NBC D;  2B24 A;  4HKV A;  4OGQ D;  3H1K E;  5KLI C;  2QPZ A;  2NVE A;  3GL2 A;  1Q90 C;  3H1H E;  1VM9 A;  1UUV A;  1O7W A;  2E4P A;  3N0Q A;  1KYO E;  3L75 E;  2NUK A;  2HMN A;  4HM5 A;  1PPJ E;  4NBF D;  5AEW A;  5KKZ C;  2E76 D;  3L72 E;  3L73 E;  4HM6 A;  1O7N A;  4HM0 A;  1O7H A;  5AEU A;  3GTE A;  4QCK A;  3GCE A;  1BGY E;  4QDD A;  1G8K B;  2DE5 D;  2HML A;  1PP9 E;  3C0D A;  4P1B H;  2BCC E;  2QJY C;  3EN1 A;  3BCC E;  4QUR A;  2BMO A;  1P84 E;  3L71 E;  1BCC E;  2B1X A;  4H0L D;  1NTK E;  2BMQ A;  1SQX E;  1FQT A;  2NWF A;  4QDC A;  1NTM E;  3CWB E;  2I7F A;  4H13 D;  2NVG A;  2ZYL A;  4AIV A;  2E4Q A;  5KLV E;  2NUM A;  1L0L E;  3GL0 A;  4HM8 A;  4P1C H;  2D2C D;  3CX5 E;  1O7P A;  2CKF A;  2JZA A;  2E74 D;  2YFL A;  1O7G A;  1SQV E;  1ULI A;  1EZV E;  4PD4 E;  4NBE D;  5CXM A;  2QJP C;  2IBZ E;  2ZT9 D;  3GB4 A;  4NBB D;  2Q3W A;  1VF5 D; 
#chains in the Genus database with same CATH topology
 1SQV K;  1KMI Z;  1EG9 A;  5AW0 B;  5APU A;  4PD4 I;  4AYC A;  1VCK A;  3A2A A;  1SQB E;  3V2Q A;  2YKP A;  3CCQ P;  1RQU A;  2RMZ A;  3BAS A;  1SJG A;  5CCH A;  2KS1 A;  1NU1 K;  4NB9 D;  1JY3 N;  1SQB D;  4K3A A;  1HBW A;  1SLQ A;  4NPD A;  4NBD D;  2QG4 A;  1DH3 A;  3WU2 E;  1T2K D;  3CI9 A;  1ZP0 C;  2Q6Q A;  4XA4 A;  5KLV G;  3LID A;  2ZXX A;  3SWF A;  1AVY A;  2QSI A;  2MKV A;  1JO5 A;  1KYO E;  3L75 E;  1JY2 O;  1IO4 A;  1AJY A;  2N1T D;  2QJK B;  3PTZ A;  2J59 M;  2FFD B;  2JJL A;  1JNM A;  3RK2 B;  3CCU P;  4QUR A;  1KYO D;  3L75 D;  3RL0 C;  1GL2 C;  1T3J A;  4QDC A;  2Y9Y A;  5KJ7 D;  2AEM A;  2IYP A;  5AW4 B;  3EFG A;  1LTI C;  3CX5 E;  1W2B O;  2E74 B;  3N7N A;  4L73 A;  3T97 B;  4DT0 A;  1EC5 A;  3S1K A;  2WZ7 A;  1WRG A;  4HM3 A;  1BE3 E;  3JC2 2;  3WMM 0;  4M3L A;  4NB8 D;  3CX5 D;  3Q1M A;  1RH5 B;  2H8P D;  3VCP A;  1RY3 A;  3U1C A;  1LTT C;  4PV1 D;  1SQQ E;  4L75 A;  2HOD A;  3M9H A;  5BOK A;  5KLV J;  1FZC C;  2E75 C;  2LXB A;  1BE3 D;  5CCG C;  1FS0 E;  1T3U A;  3U59 A;  4JYB A;  4N3Y B;  2XSO A;  3BAT A;  3M0A A;  1NYK A;  2YXQ B;  3C9I A;  2C9N Y;  3RL0 g;  2WVR A;  2P67 A;  1SQQ D;  1L4A B;  3F5H A;  3GHG C;  1YTZ T;  1IFD A;  1N86 A;  5CBO A;  1GTW A;  2JKV A;  2NPS B;  3CD6 P;  1PIX A;  3G9R A;  2FXO A;  1LT9 C;  3WUV A;  3L37 A;  3L73 E;  1GU5 A;  4WY4 D;  3H1L G;  1SFC D;  1ZN5 A;  3AED C;  3HE4 A;  1H0T A;  3P7K A;  3I5C A;  1HUC A;  3O6Q A;  3AE7 C;  4OH8 B;  2FKW B;  1URQ D;  5AVQ B;  2NWF A;  3M06 A;  1NTM E;  3L73 D;  3FXE A;  3H1H G;  5AVZ B;  1FDO A;  2C0X A;  1NVO A;  1S5L X;  1X22 A;  4IFF A;  2D2C B;  1O7P A;  1SQV E;  4PD4 E;  1EXI A;  5APY A;  1HVV A;  1YJN P;  2XV5 A;  2IBZ E;  1N8R Q;  5GTI H;  2Q1K A;  1EDI A;  3OA7 A;  3WU2 H;  1RFS A;  4HB1 A;  1VF5 C;  1NTM D;  3CCJ P;  5CCH C;  1E79 H;  3AE5 C;  1J1D C;  1SQV D;  4W80 A;  2JEE A;  4PD4 D;  2OTJ P;  2P7J A;  1SQX J;  3M9Q A;  2IBZ D;  4AUW A;  2FYU E;  1KYO H;  2L91 A;  2WSC H;  3B4S A;  1GK6 A;  1ZW0 A;  1IFN A;  3RK3 C;  2QVA A;  4YTP C;  1OW8 A;  1SQP E;  2QRX A;  2HMK A;  1LGH B;  3II6 A;  4IFD K;  4OVN F;  3FOU A;  2FYU D;  3CME P;  3JCU H;  3H1L J;  4IFM A;  1RF1 B;  1SQP D;  3CX5 H;  1Q90 D;  2V4H A;  4OGQ C;  4EDF A;  4D6T G;  1FOS E;  2YIU B;  3H1H J;  1LWU B;  4ZMD A;  1USE A;  3MIW A;  2XZR A;  3AE9 C;  5AVX B;  1WMK A;  1EDJ A;  2QE7 H;  2NZ2 A;  3AE1 C;  1KFN A;  1DD3 A;  2K88 A;  2HR3 A;  3HUS B;  4H13 C;  3RGU A;  1JY2 N;  2CKF A;  2JZA A;  1X79 B;  2N1T B;  1EZV E;  5B5E E;  3HE5 B;  2O01 H;  4GKG A;  2OYH B;  3D6Z A;  3L72 J;  2WTY A;  1NU1 G;  3CC2 P;  1G1I A;  1AV1 A;  3KXD A;  2BCC J;  1EZV D;  2HMJ A;  1RF1 A;  4U3F E;  1VQK P;  2XU6 A;  4I2L C;  1NYH A;  4JF7 A;  1FOS F;  3A3Y B;  3HD7 D;  1GMJ A;  2E42 A;  2WPV B;  4D6T J;  3M9B A;  3CXH I;  3L71 G;  3CPW O;  1BCC G;  3V5B A;  2E76 C;  4U3F D;  3SWY A;  2RKL A;  2A45 G;  4PV1 B;  4RES B;  3IN6 A;  1QVF O;  3AZC A;  3CCL P;  2HPC B;  1Y8A A;  5KLI C;  3H1K E;  2OYI A;  1RHZ B;  2OTL P;  4GT1 A;  1O7W A;  3Q5P A;  2KNC B;  5APV A;  4GDO A;  3R2P A;  1DX7 A;  1KIL B;  3R4Y A;  4QCK A;  2KLV A;  2N9B A;  3H1K D;  4P1B H;  1YJW P;  1YIT P;  1NU1 J;  2OGU A;  1FQT A;  1S5L H;  1HGZ A;  2NVG A;  1NAF A;  1ZR2 A;  2YFL A;  2E74 D;  4N78 E;  4WY4 B;  3MUD A;  1SFC B;  3Q5S A;  2ZYD A;  3KPE A;  2W90 A;  1AQ5 A;  2JWA A;  4UB8 E;  1DD4 A;  2QJY B;  2ZT9 C;  2FXM A;  1FZF A;  2Q3W A;  4O9B A;  4NBH D;  2XRX A;  2A06 E;  3D89 A;  4N78 D;  3L71 J;  1BCC J;  2P10 A;  2I1J A;  2Q3I A;  4K35 A;  3O8Z A;  2W6J H;  1KZU B;  1PL5 A;  3WUU A;  2V7Q H;  2PRR A;  2Q3E A;  3CX5 I;  1BGY G;  3EFF K;  3CCV P;  2A06 D;  1FE6 A;  3TSI A;  1W5C E;  1L4A D;  3V2R A;  3PJS K;  3L4F A;  1VQ8 P;  1JTH B;  1NKZ B;  5BVZ A;  3CCR P;  4QUP A;  5CJ0 A;  3IAO A;  1J1E B;  1KV4 A;  1KQF B;  5TIS H;  2ZAE B;  4HM5 A;  1O7N A;  1HH0 A;  3U1A A;  4BWN A;  1IC2 A;  1K04 A;  1URQ A;  1L0L K;  3L36 A;  2B9B A;  1N73 B;  1LTJ A;  1M1J B;  4IL6 E;  1QL2 A;  2ZYA A;  5KKZ B;  2OAR A;  2E4Q A;  5KLV E;  1QEX A;  1LP1 B;  2D2C D;  1NTZ K;  3L70 G;  1U7J A;  3MZW B;  1FAV A;  2R32 A;  1MZ9 A;  1BGY J;  5KLV D;  2WPR A;  4ASW A;  2XNX A;  4HM2 A;  4R4M A;  2QJP B;  3KZI E;  2M5A A;  4DOJ A;  3VMY A;  2ZFC A;  3CXH E;  1NKN A;  4ZNC A;  2AXT H;  3H1J E;  4EOT A;  5TJH A;  3RBZ A;  2OYI C;  3A0B E;  2PFX A;  2IBZ I;  2JO6 A;  2YKO A;  3CXH D;  3TK1 A;  4H44 C;  2JDI H;  2DE6 D;  3H1J D;  1Z56 A;  3LW5 J;  3HD7 B;  1IFI A;  2ITA A;  4BRY A;  4UB8 H;  4NBF D;  5APX A;  2YMY A;  3GMA A;  5GTI E;  2KLU A;  3L70 J;  2FYN B;  3MUD C;  3B5N B;  1T6A A;  3GF3 A;  3CC7 P;  2NRG A;  1LT1 A;  1SQX E;  2JWD A;  4H0L C;  1KOR A;  3BVH A;  4I7Z C;  4NBE D;  4Y99 B;  3GB4 A;  1IJD B;  2R5D A;  3B71 A;  1SQX D;  3JCU E;  3CC4 P;  1NGM B;  1GZL A;  1U57 A;  5CMZ A;  3MP7 B;  4N6J A;  3C8V A;  3GF7 A;  1WQL A;  4GIF A;  1Q82 Q;  1Q2N A;  2XKM A;  4C7N B;  2K3R A;  3AEC C;  3CCM P;  1VPC A;  1FJP A;  3KQG A;  5AVS B;  3SWK A;  1EQ7 A;  1A02 J;  3VMZ A;  2GBX A;  1EZV I;  1PP9 G;  3EQQ A;  2LXC B;  2WWW A;  1YTZ I;  2ZYG A;  3P8C E;  4IL6 H;  3JSV C;  2W83 C;  1PGO A;  1KIL E;  1OVU A;  2JO1 A;  1URQ C;  2B24 A;  2QPZ A;  3W67 A;  4R4L A;  4GOF A;  1LTJ C;  1VM9 A;  2O1J A;  2E4P A;  1PZQ A;  3P8C D;  3L72 E;  2FFD A;  2QEX P;  1NTK K;  3PRJ A;  1IK9 A;  4HJG H;  1KIL D;  1R5S A;  3VYI A;  3HTK B;  2OTK E;  2Y0E A;  2BCC E;  5AVR B;  3VOP A;  5AVY B;  3RL0 D;  1GL2 D;  1P84 E;  3KZI H;  2YNY A;  4LGD E;  3NMD A;  2BEZ F;  4XE5 B;  3L72 D;  4AIV A;  3CXH H;  3FXD A;  2NUM A;  4Z1M H;  1M1K Q;  1MKM A;  3T97 A;  1PGQ A;  5CXM A;  2FYZ A;  3A0B H;  2BCC D;  2W27 A;  1P84 D;  4HJL A;  1GW3 A;  2E5Y A;  2WSE H;  2WSE J;  3GKE A;  2XSH A;  2I8D A;  1PP9 J;  5E79 E;  1KTM A;  2YFI A;  4EMJ B;  1OVR A;  2DE7 D;  3NFQ A;  3VMI D;  1N7S B;  3PHL A;  5APT A;  1VQ7 P;  4HM7 A;  4QDF B;  1HJ0 A;  2E75 D;  2E5T A;  2HMO A;  3TDK A;  1G2C B;  2KZJ A;  1NWQ A;  1KB9 E;  1FZB A;  2O3J A;  2R44 A;  4JQ0 D;  2WSF J;  1MV8 A;  4L74 A;  5AW6 B;  4W7Y A;  2YMK A;  1L4A A;  3IF4 A;  2R3S A;  5AW7 B;  5KTB A;  1NU1 E;  1QVG O;  1XTG B;  1L0L G;  2NPS A;  3V2N A;  1KB9 D;  1S5L E;  1SQQ G;  2QM8 A;  4HKV A;  1R5L A;  1VQL P;  3V2P A;  1HGV A;  1NU1 D;  1NTZ G;  4WBA A;  1QGK B;  1K8A Q;  1VL2 A;  3GCE A;  3L74 G;  3EWK A;  5EFW B;  2Y9Z A;  2PGD A;  2BMO A;  3L71 E;  1BCC E;  3M91 A;  2WT7 B;  2I7F A;  3VN0 A;  3H32 B;  3D6Y A;  1GD2 E;  1HWT C;  1L0N K;  2IZ1 A;  3RK3 E;  3L71 D;  1VF5 D;  1BCC D;  3TGU G;  5AVU B;  5CCH D;  3Q3D A;  5KAF E;  3CMA P;  3IR9 A;  2OYO A;  1NTM G;  1Q86 Q;  1JB0 J;  4JBZ A;  2VRS A;  2B87 B;  1USD A;  3RK3 D;  1S72 P;  1L0L J;  1OMI A;  5TIS E;  1R8E A;  3TYY A;  3Q5R A;  2Y0C A;  3GW6 A;  2KIK A;  1OW7 A;  3SFD C;  2P58 A;  1M8O B;  1P84 H;  4AAY B;  4DJG A;  1OVV A;  1NTZ J;  2QJK C;  3V4Q A;  3L74 J;  2K37 A;  3RK2 C;  4NBC D;  1SVF A;  4OGQ D;  2O1K A;  2YXR B;  3PLN A;  2KSE A;  1LWU A;  2GUS A;  3A7O A;  1YYC A;  4HM6 A;  3H6P A;  1QX8 A;  2E74 C;  2LR2 A;  3GTE A;  5E79 H;  4IOI H;  1BGY E;  5APQ A;  2H43 A;  3B5N D;  2M8R A;  5AW1 B;  2POH A;  1MFZ A;  3B8E B;  3D70 A;  1ZV8 A;  2AEF A;  3TGU J;  2B1X A;  3H1I G;  3HUS A;  3CWB E;  4H13 D;  2IFN A;  2N1T A;  3H25 A;  4HM8 A;  1KB9 H;  4P1C H;  3OAK A;  3HE5 A;  1NTM J;  1SQB K;  2AXT E;  1BGY D;  2OYH A;  1VQM P;  5AVV B;  2ZVN B;  1N2D C;  1IK7 A;  4NBB D;  3VTP C;  4WB4 A;  3RL0 B;  1GL2 B;  3CWB D;  5KJ7 A;  3G3Z A;  3VMA A;  4JYC A;  1OX3 A;  1CSB A;  1L4A C;  1G8J B;  1FDM A;  5APW A;  1S3J A;  3BRT B;  1OZH A;  2L5G B;  5DJT B;  2RH0 A;  5AW9 B;  2NPS C;  3CCE P;  3L70 E;  4QMA A;  1IZN B;  3C1L A;  1S9K E;  4UB6 E;  1NTK G;  3V6I A;  3VCA A;  2H88 C;  2A45 H;  4WVZ A;  3VMH D;  2HPC A;  2C9L Y;  1FZC B;  2E75 B;  5AW8 B;  4EYY Q;  4ZKP A;  2NVE A;  3L70 D;  2KNC A;  1KQG B;  4DZO A;  1S9K D;  2M3E A;  3H1I J;  3N0Q A;  3GG2 A;  2G3A A;  2CPS A;  1YHQ P;  1KIL A;  2D2C C;  4HH2 A;  3GHG B;  5H2F E;  5KAF H;  1CZQ A;  2K1A A;  1ZXG A;  3OJA B;  1EDK A;  3CL3 D;  1BSN A;  4WWI A;  1GW4 A;  1LT9 B;  2ZYL A;  1OIP A;  4WY4 A;  1SFC A;  1FZG A;  3TF5 A;  1HJB A;  4GOD A;  1M56 D;  2JP3 A;  2MJZ A;  2ZT9 D;  2KK7 A;  2GM4 A;  3NXS A;  1K73 Q;  1HTL C;  1CI6 B;  3GZY A;  1SQQ K;  2Y0D A;  3NTN A;  2E43 A;  4NBG D;  3OW2 O;  2WPS A;  2ZXE B;  5GTH E;  1SP4 A;  2XDJ A;  2HG5 D;  2W6B A;  1QL1 A;  3AE4 C;  1N7S D;  1NTK J;  3ITK A;  1AA0 A;  1YQ4 C;  1P84 I;  1PPJ G;  3GZX A;  2G8Y A;  2IDB A;  4NBA D;  1RF1 C;  2YO2 A;  1VF5 B;  2HYN A;  3I55 P;  2GBW A;  2KS1 B;  4HM1 A;  1EDL A;  1J1D B;  3BCC G;  3AEG C;  2YIU C;  4YPC A;  5CJ4 A;  1JTH A;  1LWU C;  1T2K C;  1X0T A;  2P2U A;  4GOE A;  3RK3 B;  5HL4 A;  1KQL A;  1KC8 Q;  1KN7 A;  3VMX A;  4RJT A;  1OW6 A;  3FX0 A;  3VMG D;  1M7L A;  1RF0 A;  1JY3 P;  2QM7 A;  3D71 A;  2M3B A;  3LIE A;  1RE3 A;  2IX7 C;  3HUS C;  2IZ0 A;  1NTM K;  1KB9 I;  2N1T C;  2QIW A;  1TU3 F;  4PJ0 H;  1K9M Q;  1L0N G;  4B86 A;  1N73 A;  4Y28 J;  2K9Y A;  2DE5 D;  1M1J A;  1PP9 E;  3E1I A;  2OYH C;  2FBW C;  5B66 E;  3LW5 H;  2O01 N;  1FU1 A;  4OGQ B;  4YXD C;  1DIP A;  1LP1 A;  5KJ7 C;  4U7J A;  1QLE D;  2PP6 A;  1ULI A;  1PP9 D;  2KXP B;  1ZLL A;  4UB6 H;  1JCD A;  1JM0 A;  2XND H;  2FYU K;  1OFC X;  2KYV A;  1FBM A;  2XR8 A;  2HMM A;  1Q81 Q;  4H13 B;  1JCC A;  1SQP K;  3BCC J;  2IYO A;  2J5U A;  2B88 A;  3FGA D;  2UWJ E;  2NVF A;  1ZRT E;  4PV1 C;  3AEB C;  2Q5U A;  1IFJ A;  2A45 I;  4I1L A;  4HKZ H;  2HOD B;  2KOG A;  5AVT B;  5AW2 B;  5AW3 B;  2BAS A;  5H2F H;  3H1L E;  5DJU B;  1VQO P;  4LLH A;  1ZRT D;  5AVW B;  3Q2Y A;  3G6E P;  4H44 D;  1KIL C;  2KB7 P;  1L0N J;  1M57 D;  3HD7 A;  3S9O A;  3P8M C;  3GL2 A;  2K9J B;  1W2E A;  3P32 A;  1Y9B A;  3H1L D;  3H1H E;  1MUU A;  1UUV A;  3AEE C;  1RE4 A;  3H1J G;  3FWN A;  5AEW A;  2E76 B;  1K05 A;  1SQB G;  1O7H A;  4WY4 C;  5AEU A;  3B5N A;  1SFC C;  1GU4 A;  3EQ2 A;  5GTH H;  3HE4 B;  1H0T B;  2HML A;  1PV3 A;  2QJY C;  5KLI B;  1U7M A;  3H1H D;  3O6Q B;  1SS1 A;  4C7R A;  4CPG A;  4H0L D;  2KSJ A;  2W6A A;  3WUT A;  4NPE A;  1L0L E;  3QWO C;  3GL0 A;  2R3C A;  5C39 A;  5AW5 B;  1VQ9 P;  3AE6 C;  1CW5 A;  4QUQ A;  3N4X A;  1NTZ E;  1L2P A;  1L0L D;  2AEJ A;  1SQX G;  1BDD A;  3L74 E;  2JR8 A;  4C7N A;  2Q7C A;  3L75 G;  4EIJ A;  1VQN P;  2HLO A;  2BMR A;  1KQS O;  2ZT9 B;  2K9J A;  2IPP A;  3KDP B;  1NTZ D;  4D6T E;  3AE8 C;  4HM4 A;  3A0H E;  1J1E C;  1H8A A;  1E5W A;  1RF0 C;  3L74 D;  5B66 H;  3H1J J;  1J2J B;  1RE3 C;  3RBX A;  1SQB J;  3TGU E;  5L8R J;  1NOH A;  1KFM A;  4D6T D;  1NH4 A;  1N73 C;  4KT0 J;  5CCG D;  2WQY C;  1M1J C;  1UIX A;  1Q90 C;  4BXL A;  1PGJ A;  1DEB A;  2WSF H;  2B89 A;  4XFJ A;  5KKZ C;  3AEF C;  3USS A;  3CCS P;  1BE3 G;  1VQP P;  3TGU D;  1YQ3 C;  3HTK A;  2WPQ A;  3C0D A;  4MN4 C;  5BU8 B;  1YIJ P;  1YBK A;  3VP9 A;  3KHU A;  3MD0 A;  4RKU J;  4JPZ B;  2CPB A;  1X9V A;  3L75 J;  4C46 A;  4NPF X;  3L72 G;  2QJP C;  2WSC J;  3A5T A;  4KHX A;  3E7K A;  3AEA C;  1JOC A;  4AQR D;  2BCC G;  1S2E A;  2PAJ A;  2YVJ B;  2H89 C;  1FC2 C;  2Z5I A;  1O7M A;  1FZA A;  1BDC A;  1N7S A;  1ZME C;  1JY2 P;  4QDF A;  1FDI A;  2AXC A;  1S1C X;  3L73 G;  1G2C A;  3H1I E;  1LJ2 A;  1H89 A;  1AQT A;  1LTB C;  3HD7 C;  1UUW A;  2DW3 A;  3I56 P;  4ZKU A;  2Q9I A;  1VQ5 P;  4OWF A;  2N9Y B;  1RE4 C;  1BE3 J;  3MGN A;  3H1I D;  1N7L A;  2BEQ D;  2FYN C;  1RIE A;  1SQV G;  3B5N C;  2HFE D;  3DQY A;  2OQQ A;  1SQQ J;  2IBZ G;  1GDT A;  2OYI B;  1PFI A;  3HRN A;  3AE2 C;  2P1J A;  1VDF A;  1GK4 A;  2Z5H A;  4HM0 A;  2QA4 P;  3W68 A;  4H44 B;  1IFP A;  2O01 J;  5KLV K;  4LC1 A;  2FFD C;  4Y99 C;  5KAI E;  2FYU G;  4TLF A;  2WT7 A;  5CBN A;  1NTK E;  2BMQ A;  3H32 A;  1NAY A;  3FWL A;  1SQP G;  1T8Z A;  3E1R A;  4ASV A;  1EXJ A;  3A0H H;  5CHX A;  1JY3 O;  3L73 J;  3SSU A;  3M0D A;  3IFM A;  1NTK D;  1OXZ A;  1LTA C;  3GTS A;  4H0L B;  1OWA A;  1NO4 A;  1UII A;  2IFM A;  1D7M A;  2B87 A;  4I7Z B;  4L76 A;  1LNQ A;  1BSH A;  3GOB A;  1NDO A;  2WSS H;  1JMM A;  4TT3 H;  1SQV J;  4PD4 H;  2SPZ A;  3KYQ A;  4PJ0 E;  2H7H A;  1JM1 A;  1ZOY C;  2ZVO B;  1MFT A;  2FY8 A;  3RK2 D;  1PGP A;  1EZV G;  4A7P A;  4I6M C;  2I1K A;  2FYU J;  2GA1 A;  2LKM A;  1G1J A;  1KD1 Q;  2GUV A;  3VP8 A;  1PPJ E;  4YXW H;  2W8Z A;  1SQP J;  2E76 D;  1ZR4 A;  1VQ4 P;  1JUN A;  1SQX K;  1YJ9 P;  2C0W A;  1KYO I;  3SFE C;  1G8K B;  1URQ B;  2ZJS E;  3EN1 A;  4U3F G;  3BCC E;  3MHV A;  1LTJ B;  1FZE A;  2FXP A;  1PPJ D;  5BU5 A;  2KUB A;  1NJI Q;  1FJK A;  3UIA A;  2RN0 A;  3K5B A;  1H88 A;  2Z4E A;  1O7G A;  1DEE G;  1N7S C;  1JMB A;  2R5B A;  3BCC D;  1IFM A;  2V7Q J;  1GL2 A;  1M90 Q;  5K5G B;  1JEK A;  3ZDM A;  3H1K G;  1L0N E;  2YFJ A;  3MTU E;  3CWB G;  3GLM A;  4IL6 X;  3TNU B;  1Q7Y Q;  3PH0 A;  4DCK A;  3CLQ A;  2NPS D;  1VQ6 P;  2M5A B;  1WT6 A;  5B5E H;  2WMM A;  3G4S P;  1L0N D;  1Y47 A;  5M1B A;  5KAI H;  3S4R A;  3BRV B;  4HYT B;  2J58 A;  1ULJ A;  4EI2 A;  3QH9 A;  2YKQ A;  1FZC A;  1LTG C;  2KZI A;  5CCG A;  4KJM A;  1RQV A;  3G71 P;  2M0B A;  1LTS C;  2YO3 A;  4U3F J;  2KP8 A;  3F89 A;  2NUK A;  2HMN A;  2KI7 B;  4BRY B;  3GHG A;  5APS A;  1XTC C;  3V4W A;  2A06 G;  4QDD A;  4RO0 A;  3ABV C;  3L35 A;  2CK3 H;  1LT9 A;  3AE3 C;  1S4X A;  3M0D C;  1AVO A;  3H1K J;  1AFO A;  1A02 F;  3TNU A;  1YI2 P;  1HF9 A;  1NHL A;  3CWB J;  1X8Y A;  2WIT A;  1CI6 A;  3PP5 A;  4W7Z A; 
#chains in the Genus database with same CATH homology
 3GZY A;  4QUQ A;  1EG9 A;  4HJL A;  1RFS A;  4HM3 A;  4NBG D;  1BE3 E;  1NTZ E;  3GKE A;  2XSH A;  3GTS A;  1VCK A;  4NBH D;  1SQB E;  2YVJ B;  2XR8 A;  4NB8 D;  2HMM A;  2YFI A;  2XRX A;  4EMJ B;  1O7M A;  2A06 E;  3D89 A;  2DE7 D;  1L0N E;  2YFJ A;  4HM2 A;  3L74 E;  1WQL A;  3VCP A;  3VMI D;  1G8J B;  2NVF A;  2HMJ A;  3GOB A;  4U3F E;  4PV1 D;  2FYU E;  4QDF A;  1SQQ E;  1NDO A;  1ZRT E;  5BOK A;  2BMR A;  3GZX A;  1SJG A;  4HM7 A;  4QDF B;  3H1I E;  2E75 D;  4NBA D;  2HMO A;  3CXH E;  4NB9 D;  1SQP E;  1KB9 E;  4D6T E;  3H1J E;  2GBW A;  4HM4 A;  2HMK A;  1UUW A;  2GBX A;  4HM1 A;  3EQQ A;  3L70 E;  2XSO A;  3H1L E;  1NYK A;  1ULJ A;  4NBD D;  3FOU A;  2YIU C;  1JM1 A;  4AAY B;  3VCA A;  1NU1 E;  2JO6 A;  2QJK C;  4H44 D;  3TGU E;  3VMH D;  2FYN C;  5HL4 A;  1RIE A;  3AZC A;  2DE6 D;  4QUP A;  3DQY A;  3VMG D;  4NBC D;  2B24 A;  4HKV A;  4OGQ D;  3H1K E;  5KLI C;  2QPZ A;  2NVE A;  3GL2 A;  1Q90 C;  3H1H E;  1VM9 A;  1UUV A;  1O7W A;  2E4P A;  3N0Q A;  1KYO E;  3L75 E;  2NUK A;  2HMN A;  4HM5 A;  1PPJ E;  4NBF D;  5AEW A;  5KKZ C;  2E76 D;  3L72 E;  3L73 E;  4HM6 A;  1O7N A;  4HM0 A;  1O7H A;  5AEU A;  3GTE A;  4QCK A;  3GCE A;  1BGY E;  4QDD A;  1G8K B;  2DE5 D;  2HML A;  1PP9 E;  3C0D A;  4P1B H;  2BCC E;  2QJY C;  3EN1 A;  3BCC E;  4QUR A;  2BMO A;  1P84 E;  3L71 E;  1BCC E;  2B1X A;  4H0L D;  1NTK E;  2BMQ A;  1SQX E;  1FQT A;  2NWF A;  4QDC A;  1NTM E;  3CWB E;  2I7F A;  4H13 D;  2NVG A;  2ZYL A;  4AIV A;  2E4Q A;  5KLV E;  2NUM A;  1L0L E;  3GL0 A;  4HM8 A;  4P1C H;  2D2C D;  3CX5 E;  1O7P A;  2CKF A;  2JZA A;  2E74 D;  2YFL A;  1O7G A;  1SQV E;  1ULI A;  1EZV E;  4PD4 E;  4NBE D;  5CXM A;  2QJP C;  2IBZ E;  2ZT9 D;  3GB4 A;  4NBB D;  2Q3W A;  1VF5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...