3CX5E

Structure of complex iii with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'KSTYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structure of complex III with bound cytochrome c in reduced state and definition of a minimal core interface for electron transfer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 48
structure length 185
sequence length 185
chains with identical sequence P
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2008-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3cx5E01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3cx5E02
3DQYA 3GOBA 4U3FE 3VCPA 4QDDA 3L75E 1VF5D 2YFLA 1NDOA 2QJKC 2YFIA 5KLVE 4AAYB 3GZXA 5CXMA 2NVGA 2B1XA 2B24A 4NBGD 5KLIC 2HMLA 2XR8A 1ULJA 2BMQA 3CWBE 4NB8D 3H1IE 2E4QA 4HM1A 1PP9E 2QPZA 2BCCE 4QCKA 3H1LE 2JO6A 1O7PA 2YVJB 3AZCA 4NBAD 1FQTA 4HJLA 4NBDD 3VCAA 2I7FA 2D2CD 1UUVA 5AEWA 1UUWA 2FYNC 2QJYC 4H13D 3VMID 1O7HA 4NB9D 3GTSA 2E75D 2YFJA 3GZYA 2GBXA 1NTKE 1VCKA 2XSHA 2CKFA 2E74D 1RIEA 1G8KB 3FOUA 2A06E 3EN1A 3C0DA 3BCCE 2Q3WA 3GL2A 4HM0A 1NTME 5AEUA 4QUQA 4HM2A 4NBBD 2BMRA 2XRXA 4HM4A 4PV1D 2NUKA 3GB4A 1SQVE 4HM5A 1L0LE 1SQXE 4NBED 1O7MA 1SQBE 3H1JE 4QDFB 4AIVA 1L0NE 3GCEA 3CXHE 3H1KE 4H44D 1PPJE 2BMOA 1ZRTE 2DE6D 1KYOE 3EQQA 4NBCD 1BCCE 4QDCA 2NUMA 3N0QA 2IBZE 3L74E 1EZVE 1WQLA 2HMKA 2JZAA 2NVFA 2XSOA 1P84E 2NVEA 2ZT9D 1ULIA 2HMOA 1G8JB 3L72E 4QUPA 3H1HE 1O7NA 1BE3E 4HM3A 2ZYLA 3GTEA 4HKVA 4P1CH 2HMMA 2DE5D 4D6TE 2FYUE 1RFSA 4HM7A 4NBFD 2E76D 5BOKA 5KKZC 1NU1E 1SQPE 2NWFA 3L70E 1SJGA 4HM8A 4P1BH 2E4PA 5HL4A 4PD4E 1VM9A 4QURA 3CX5E 3GKEA 1EG9A 1KB9E 1BGYE 2GBWA 1NYKA 1Q90C 2HMJA 3GL0A 2DE7D 4QDFA 3VMHD 3D89A 2HMNA 2QJPC 3VMGD 2YIUC 3L71E 4OGQD 4EMJB 1SQQE 4HM6A 3L73E 4NBHD 4H0LD 1NTZE 1JM1A 1O7WA 1O7GA 3TGUE
chains in the Genus database with same CATH superfamily
2FFDB 2OTLP 5DJTB 3RK3C 2NZ2A 3R2PA 1QX8A 2QPZA 4ASVA 3G3ZA 1QVFO 3CCQP 1G2CA 4H13C 1FZCC 5CMZA 3IN6A 2GBXA 1VCKA 1L0ND 1SQBJ 3H1KJ 1BDCA 2JR8A 1PL5A 3P7KA 1BCCD 2IBZI 3L74D 2W6JH 3BVHA 1O7MA 3P8CD 3GHGA 2FYUK 1IFNA 1ZV8A 2O01H 3TYYA 1VQ7P 3CXHI 1VQ5P 2M5AB 2FYUG 2NUMA 2Q5UA 1M1KQ 1YTZT 3A0BH 2NPSA 1HWTC 3RL0B 3WUUA 2ZYLA 1JTHA 1SQQD 4IL6E 3LIDA 3D6YA 3L71G 2KIKA 1Y9BA 4C46A 1ZMEC 1LTSC 2A06D 3MHVA 2E5TA 3M06A 2HG5D 1NTKG 3D89A 4WY4B 2YIUC 3RGUA 3S9OA 1R8EA 1LGHB 2OYHA 1NTZE 4K35A 3VMYA 1JO5A 5AVTB 1SQVD 2GA1A 1Q86Q 3CCSP 2QA4P 4H13B 1FZCB 2YXQB 2ZFCA 3D70A 4QCKA 2YVJB 3AZCA 2ZVOB 1USEA 1PGPA 3PP5A 1KC8Q 3AE4C 1N7SC 1FZFA 1LT9A 4NB9D 4BRYB 1GD2E 1DD4A 3H1JD 1RIEA 1IFDA 2XZRA 1FZAA 1PPJD 4QMAA 2R44A 1KYOD 1NTME 1KFMA 1N73A 4NPEA 4OVNF 4W80A 3A5TA 1DIPA 1L4AD 1BE3D 1NKNA 3FXDA 1SQXE 3L72J 1KQLA 3BASA 3U1CA 1GMJA 1SQPD 1DX7A 1SQBK 2ZYAA 1IFIA 3IFMA 2WSFH 1NU1J 1IC2A 2AEFA 2WQYC 5GTHH 3N0QA 2IBZE 2B89A 2AEMA 3HTKA 5DJUB 1DEBA 1IZNB 4AQRD 1LTTC 5BU8B 1RF0A 2YIUB 5TISH 1KB9H 2C9LY 3TGUG 1FOSF 3L75G 1CI6A 2IX7C 2KI7B 1QVGO 2WITA 5AVZB 4GDOA 4GKGA 5AW2B 3I55P 1N7SB 3CCJP 3VOPA 2BMQA 1MZ9A 2GUSA 5KTBA 4I7ZC 2KOGA 3E7KA 1M1JA 2RH0A 2W8ZA 5GTIE 2IZ1A 3ITKA 5AEWA 4O9BA 1FOSE 2IDBA 1GU5A 4XFJA 1S5LE 3P32A 2XU6A 2E74D 1L0LJ 5CCGD 1SFCD 1USDA 2RKLA 2K37A 1YJWP 1NKZB 1KQGB 1WRGA 1M56D 3I56P 2BMRA 3NMDA 1NYHA 5AW4B 3A3YB 4I6MC 3CX5H 1EZVG 1DD3A 1L0NE 1HH0A 3B5NC 1RQUA 3U1AA 2KZJA 2XV5A 1KB9D 1BCCE 1LTGC 3L74E 3H32B 3HUSA 4Y99C 1G8JB 1X79B 3NTNA 1NWQA 2JO1A 3P8CE 4IFDK 4R4LA 1NO4A 3CCRP 1KV4A 1RE4A 1M7LA 3II6A 5KAIE 1NU1K 1KQFB 2O3JA 2Q6QA 1JB0J 5B5EE 3VMHD 2OTJP 1GZLA 2JEEA 4LGDE 3CCVP 1PP9J 1SQQE 2E5YA 1JM1A 3M0DC 5AW5B 4ZKPA 4AUWA 4I7ZB 2NVGA 4NB8D 3EWKA 1ULJA 2HPCA 2CPBA 3B4SA 5E79H 1FJKA 1VPCA 3BCCD 4NBAD 4C7NB 1URQC 1K9MQ 1M8OB 2D2CD 5APXA 3VMID 1O7HA 2E75C 2HYNA 2YFJA 2ITAA 1N2DC 1NTKE 1LJ2A 4YPCA 2XSHA 1PGJA 2CKFA 2ZXXA 3V4WA 1LTBC 4I2LC 3B5NB 2FXMA 2OYIA 4PV1D 2YNYA 4HM5A 2ZAEB 1SLQA 3VMAA 4D6TD 3H1JE 4EYYQ 2K9JB 1KILC 1SFCA 2KS1B 4H44C 4KJMA 3L70D 1PPJE 1JOCA 3MUDC 1KYOE 1BGYD 2KB7P 2ZT9C 1WQLA 1RE3A 3A0HE 3G4SP 3WU2H 1XTCC 1EZVI 3HD7A 3SFDC 3FWLA 1BE3E 1MFTA 2WT7B 2YMYA 4HM7A 2QM7A 5AVUB 3VMZA 3WUVA 2YKQA 4I1LA 1NTZK 1GTWA 1SQPE 1LP1B 1MFZA 1NYKA 2HMJA 1NTZG 2QM8A 1L2PA 1K04A 2Z5IA 3H1LD 3JSVC 3TDKA 4DOJA 1YTZI 2Q3IA 1LTIC 1QEXA 3O6QA 1NDOA 1URQB 3VP9A 5CCGC 1QL2A 3CCLP 5KJ7A 2E75B 4U7JA 5B66H 1PGQA 2K1AA 1N7LA 1JY2P 2CK3H 1NTMK 1VQLP 1WMKA 2C9NY 4JYCA 2Z5HA 1SQXK 1S9KD 1NTMG 3H1HG 1W2EA 1KTMA 1PFIA 1RF1C 1ZRTD 1JNMA 3HRNA 1KILB 1SQXG 4ZKUA 3MP7B 4HM2A 2M0BA 3H1HD 2ZT9B 3Q3DA 2N1TA 4LC1A 3QH9A 1VQNP 2FYUJ 3CMEP 1YYCA 1OXZA 3IF4A 2AXCA 5APYA 1EDKA 5AVRB 2W6AA 3M9BA 5GTHE 1ULIA 3F89A 3PLNA 1YIJP 3SSUA 4HKZH 3GTEA 5APQA 2DE5D 1LWUA 2NPSD 1PGOA 3L71J 1OIPA 3M9QA 1KB9E 2GBWA 1NTKJ 4GOEA 3CWBD 3Q1MA 2FXPA 2IYOA 3HE5B 1DEEG 1YHQP 1NVOA 2QJKC 2HMLA 2OTKE 1RHZB 1PIXA 2E4QA 1NH4A 2BEZF 2JJLA 3T97A 1H0TA 3Q5SA 4DZOA 1RF1B 4PV1C 2YO3A 1FZCA 1VL2A 3EFGA 1UUVA 1UUWA 2O1KA 4W7YA 3GZYA 2KSEA 4OH8B 2A45H 1FC2C 2IPPA 4WY4C 1FAVA 1Z56A 1J1DC 3BCCE 2Q3WA 3RK2C 1JY3O 3IAOA 5H2FH 1L0NG 4KHXA 1J2JB 3HE4B 2YXRB 1BCCG 2WSEH 1ZLLA 4PD4H 4QDFB 3L74G 3CI9A 1FU1A 3NXSA 2JWAA 1AJYA 2WPVB 1IO4A 2K9YA 3CCMP 1P84H 1LTAC 1W2BO 3GF3A 2FXOA 4UB6H 1Q7YQ 4Z1MH 5CCHC 4D6TE 1VQ4P 4NBFD 3L73D 1SQQK 3L70E 3KZIE 4HM8A 2M3BA 5KLVD 3TGUJ 1BGYE 1SQQG 2B87A 3L75J 1OWAA 3H1ID 4LLHA 2QJKB 3Q5PA 1OMIA 2OQQA 2YMKA 4OGQC 3TSIA 3FXEA 3AE6C 1AQTA 2A06G 1O7WA 4UB8H 1VF5C 4PV1B 2WWWA 1NTKK 3P8MC 5KAFE 1SQVG 1YJNP 3H1LE 2JO6A 1LNQA 1ZN5A 1K05A 1FS0E 2ZJSE 3SWKA 1LTJB 1N7SA 1QL1A 3A2AA 1J1DB 1HVVA 2UWJE 3RK2B 1OVVA 2J59M 3S4RA 1ZXGA 3V2PA 1VQMP 4YXDC 5AW3B 3H1JG 4HM0A 1P84D 1PPJG 1S1CX 1M57D 4U3FD 2HODA 2I8DA 1ZRTE 1BE3G 2Q3EA 1R5SA 3S1KA 2XSOA 1SQPG 3H1HE 4HM3A 1FBMA 2OYHC 4ZMDA 2C0XA 4OGQB 3CC2P 1GW4A 5CHXA 4IOIH 2FYNB 1BDDA 2H8PD 1G2CB 3W68A 2L5GB 1VF5B 2YKOA 1M90Q 2JDIH 2BCCD 2JKVA 2FYZA 4H0LD 1H8AA 4QDDA 2ZYDA 3AE8C 2O1JA 1GL2D 3CWBE 3MIWA 2KSJA 4HM1A 1LT1A 3V2RA 1A02F 3GHGB 3KXDA 5CJ4A 1KFNA 4B86A 2R3SA 1UIXA 4TLFA 3C8VA 3Q2YA 2P7JA 2JP3A 1MKMA 4WBAA 1HJ0A 5AVWB 4JYBA 1NOHA 2B88A 2KYVA 4RJTA 1SQBD 5TJHA 1H89A 3H1KD 4RO0A 1JTHB 5KKZB 1EXIA 1IFMA 5AW9B 3JC22 2Y9ZA 3SWFA 4L76A 2Z4EA 2XNXA 3GCEA 1RF0C 3V2QA 2OYHB 2RN0A 2HLOA 2FBWC 2R32A 3JCUH 3EQ2A 5CJ0A 4IL6X 1OVRA 1KYOI 3NFQA 2FKWB 3H1LJ 1KZUB 1GK6A 1QLED 1YJ9P 3HD7D 1MUUA 4HB1A 5APUA 1G1JA 1VQ6P 3AECC 3TNUB 2NWFA 1NTZJ 4P1BH 4ZNCA 3AE3C 2WT7A 4JPZB 1KQSO 1OVUA 1Q90D 1IFPA 2KNCA 2W90A 2ZVNB 2DE7D 1RQVA 3L73E 2POHA 1M1JC 2IFMA 1SP4A 1NAFA 1NJIQ 5KLVE 2B24A 4NBGD 3PHLA 3H1IE 2J58A 5KJ7D 4XE5B 1R5LA 1URQA 4HJLA 1YQ3C 1QGKB 1XTGB 1AV1A 2KLUA 1NTMJ 2OARA 3H1HJ 5APTA 1KN7A 3BCCG 4L73A 1FZBA 2GM4A 4NPDA 3HTKB 1GL2A 5L8RJ 4R4MA 1E5WA 1SQXJ 5EFWB 3FOUA 2A06E 1S3JA 4Y28J 5AEUA 3VTPC 2JWDA 4HM4A 1L4AC 3L72D 4IL6H 3PJSK 1SQVE 1KILA 2QSIA 3FWNA 4JQ0D 3PH0A 2PFXA 1CI6B 1NU1D 2P58A 1FJPA 2N1TD 2DE6D 1RE4C 3AEBC 3CX5D 4D6TG 1TU3F 1P84E 2LXCB 3L70G 1BGYG 3L37A 1T2KD 2E76D 2KZIA 2LR2A 2WSSH 4BWNA 3FX0A 2G8YA 2HFED 1AQ5A 4EOTA 1M1JB 1YBKA 4KT0J 1KB9I 4W7ZA 3RL0D 3OA7A 1RH5B 4OWFA 3GW6A 4IFMA 3L4FA 3A0BE 2WSCJ 3GOBA 5APSA 3H1LG 3RK3D 1X0TA 2H89C 2AXTH 4MN4C 1EDLA 3C1LA 2BCCE 1S2EA 1O7PA 4NBDD 2R3CA 1HJBA 4H13D 2OYIC 1K8AQ 1L0LD 3HUSB 3CC4P 1L4AB 2E74C 2L91A 1SFCC 2QG4A 1L0NJ 2FFDA 3V5BA 2M8RA 2GUVA 1FZGA 1RE3C 2J5UA 1BCCJ 3I5CA 3L74J 3Q5RA 3CXHH 1SQBE 1SS1A 2C0WA 3BATA 3MGNA 3H1KE 3MTUE 3CL3D 3CX5I 2QEXP 5KLVJ 3GG2A 4NBCD 3W67A 2LXBA 1PV3A 1FDMA 1JY3P 2HPCB 1HTLC 5BOKA 1SQQJ 2RMZA 4GOFA 2E4PA 1VM9A 1EG9A 3M0AA 2H7HA 2WSCH 3KHUA 1PP9D 1T3UA 2K3RA 5GTIH 3VMGD 2Y0DA 3QWOC 3CWBG 2M5AA 1HGZA 1S5LH 3H25A 3R4YA 2PRRA 1SQVJ 5AVXB 2B1XA 2OYIB 1D7MA 2E43A 5TISE 2E74B 1U57A 2IBZD 3BRTB 1SFCB 2OYOA 4IFFA 2AEJA 2D2CC 5M1BA 1OFCX 1N7SD 2KLVA 3VMXA 5K5GB 4K3AA 3HD7B 2P10A 4WY4A 3CXHD 4DCKA 4RKUJ 3H1JJ 2O01J 4L74A 4NBBD 2I1JA 1IK9A 1BSNA 2Y0EA 2NUKA 1EC5A 1LWUC 1BE3J 5KAIH 5BVZA 4YTPC 4N78D 1LTJC 1L0NK 3OJAB 4C7RA 5B5EH 1SQPJ 2CPSA 2JZAA 3LW5J 3O6QB 4BRYA 2NVFA 1W5CE 2HMOA 3L72E 2ZXEB 1H88A 4NPFX 1JY2N 3AEDC 1RY3A 1NU1E 3CLQA 3K5BA 3LIEA 3CX5E 5KLVK 3L73G 1CW5A 1UIIA 2IZ0A 1FZEA 5KLVG 4HM6A 4HYTB 4NBHD 3H1IG 3AEGC 1JY3N 1E79H 2YFLA 1HBWA 2D2CB 5CXMA 3CPWO 1CZQA 1X9VA 3RL0g 2V4HA 1CSBA 3H6PA 2N1TB 3PTZA 2P1JA 2A45G 2FYNC 2KXPB 3RK3E 2IYPA 2ZYGA 3KPEA 4A7PA 1SQVK 4EDFA 3OAKA 2E76B 1KYOH 1G8KB 1ZW0A 3B71A 3A0HH 1LWUB 2PGDA 3C0DA 1KD1Q 1NGMB 1VDFA 5E79E 2XRXA 1DH3A 2WSFJ 3O8ZA 1L0LE 2PP6A 2FYUD 3LW5H 1PZQA 3GHGC 3RK3B 3B5ND 4PD4D 1OW6A 1EDJA 1FDOA 4U3FG 5AW7B 4QUPA 2V7QJ 4HKVA 2K88A 5AVSB 3L71D 2P2UA 2NPSC 3WMM0 1OW8A 3T97B 1NHLA 5KKZC 2WVRA 3KQGA 4N6JA 3G71P 1S9KE 1H0TB 2Y0CA 1NTKD 5HL4A 1JCDA 3MD0A 4M3LA 3CMAP 1SQPK 1JM0A 4EIJA 3TNUA 2SPZA 3WU2E 1GW3A 1T6AA 3M91A 3GKEA 2BCCG 1K73Q 1MV8A 4PJ0H 4AAYB 3H32A 1IK7A 1FDIA 3VYIA 2AXTE 5KLIC 3A7OA 1PP9E 2WZ7A 4HH2A 1IFJA 1FQTA 1OW7A 1KMIZ 1GU4A 3BCCJ 2FY8A 1URQD 2YO2A 2QJYC 2H88C 3GTSA 2E75D 1VQOP 1LT9C 4N3YB 1Y47A 3GMAA 4BXLA 1U7JA 3OW2O 5AW1B 5AVVB 3VN0A 2A45I 3EN1A 4L75A 1U7MA 1SQBG 5B66E 3M9HA 4QUQA 3H1KG 1N73C 2B87B 4NBED 2WMMA 1IJDB 1GK4A 3CXHE 4C7NA 1KILD 4D6TJ 4H44D 1AVYA 2V7QH 2NPSB 4PD4I 4ASWA 3EQQA 3L70J 3B8EB 4QDCA 1VQKP 2ZT9D 4GT1A 1BGYJ 2PAJA 1P84I 2H43A 2HMMA 1RFSA 3G6EP 2KUBA 3FGAD 2G3AA 3TGUD 3B5NA 4N78E 1S4XA 3L75D 4QURA 1S72P 5AW8B 4XA4A 3C9IA 2WPRA 1OX3A 4GODA 3N4XA 4WWIA 5CBOA 5KLIB 2K9JA 2Q1KA 4JF7A 2KS1A 2WTYA 3SWYA 1JCCA 3V4QA 3USSA 3CD6P 1O7GA 1KORA 2M3EA 2KP8A 1Y8AA 2KK7A 2XR8A 3GLMA 2QJYB 5AVQB 4DJGA 1J1EC 1LT9B 1JEKA 3KDPB 3L36A 2HODB 2OGUA 1LP1A 3M0DA 4WB4A 1YQ4C 1N73B 2N9YB 3AEFC 5AW6B 5BU5A 1L4AA 1EZVD 1VQ9P 1AFOA 1OZHA 1ZR2A 1YITP 5APVA 1SVFA 3KZIH 1WT6A 2WPSA 4AIVA 3WUTA 3ABVC 3L72G 1N86A 2NRGA 2W83C 3PRJA 2B9BA 5APWA 3VP8A 2BASA 2HMKA 3RBZA 1NU1G 3EFFK 2YKPA 1ZP0C 3HUSC 3AEAC 1Q82Q 5H2FE 1T3JA 2FYUE 3V6IA 4TT3H 1BSHA 5KAFH 4PD4E 3MUDA 2N9BA 1JUNA 2VRSA 3CWBJ 2HMNA 2QJPC 3L71E 4H0LC 1J1EB 1VQ8P 2P67A 4UB6E 3DQYA 4U3FE 2YFIA 3GZXA 3IR9A 3F5HA 1G1IA 1GL2C 4GIFA 1NAYA 2XKMA 2E42A 1FE6A 1VQPP 2I7FA 3AEEC 4YXWH 1HUCA 1JMMA 4Y99B 1X22A 1Q2NA 2W27A 2W6BA 5CCGA 1A02J 1L0LK 4UB8E 2O01N 3HE5A 2Q7CA 4WY4D 2R5BA 1L0LG 3RK2D 3GL2A 3D71A 1EQ7A 3TK1A 1S5LX 1Q81Q 3KYQA 4DT0A 3GB4A 3L35A 2KNCB 3D6ZA 1RF1A 2MJZA 1AVOA 3CC7P 3AE9C 2I1KA 2QRXA 5AVYB 5C39A 4P1CH 1HGVA 3G9RA 3HD7C 5CCHD 1NTZD 1KILE 2QJPB 3L73J 1EXJA 5AW0B 1SJGA 4H0LB 3V2NA 3E1RA 1GDTA 1Q90C 3HE4A 1EDIA 4AYCA 4QDFA 3ZDMA 1GL2B 3H1IJ 2QIWA 4OGQD 1PP9G 1T8ZA 3TGUE 3VCPA 3L75E 1VF5D 4PJ0E 4JBZA 2DW3A 3SFEC 4H44B 1AA0A 4RESB 1YI2P 5KJ7C 3RBXA 2FFDC 1NTMD 3VCAA 4HJGH 3UIAA 2MKVA 2IBZG 3TF5A 1SQXD 2Q9IA 3BRVB 1ZOYC 2QVAA 4EI2A 2WSEJ 3CCEP 4CPGA 2XNDH 3E1IA 1ZR4A 1JMBA 2WPQA 2XDJA 3AE5C 1N8RQ 1LTJA 2N1TC 4U3FJ 2BMOA 1EZVE 2NVEA 1X8YA 2BEQD 3MZWB 4WVZA 1O7NA 1T2KC 2E76C 5CBNA 3AE7C 2QE7H 2Y9YA 2R5DA 2IFNA 2LKMA 3RL0C 2HR3A 1JY2O 1HF9A 3GL0A 3CCUP 3JCUE 3U59A 5CCHA 4EMJB 2BCCJ 3AE1C 3AE2C 3N7NA 3GF7A
chains in the Genus database with same CATH topology
3DQYA 3GOBA 4U3FE 3VCPA 4QDDA 3L75E 1VF5D 2YFLA 1NDOA 2QJKC 2YFIA 5KLVE 4AAYB 3GZXA 5CXMA 2NVGA 2B1XA 2B24A 4NBGD 5KLIC 2HMLA 2XR8A 1ULJA 2BMQA 3CWBE 4NB8D 3H1IE 2E4QA 4HM1A 1PP9E 2QPZA 2BCCE 4QCKA 3H1LE 2JO6A 1O7PA 2YVJB 3AZCA 4NBAD 1FQTA 4HJLA 4NBDD 3VCAA 2I7FA 2D2CD 1UUVA 5AEWA 1UUWA 2FYNC 2QJYC 4H13D 3VMID 1O7HA 4NB9D 3GTSA 2E75D 2YFJA 3GZYA 2GBXA 1NTKE 1VCKA 2XSHA 2CKFA 2E74D 1RIEA 1G8KB 3FOUA 2A06E 3EN1A 3C0DA 3BCCE 2Q3WA 3GL2A 4HM0A 1NTME 5AEUA 4QUQA 4HM2A 4NBBD 2BMRA 2XRXA 4HM4A 4PV1D 2NUKA 3GB4A 1SQVE 4HM5A 1L0LE 1SQXE 4NBED 1O7MA 1SQBE 3H1JE 4QDFB 4AIVA 1L0NE 3GCEA 3CXHE 3H1KE 4H44D 1PPJE 2BMOA 1ZRTE 2DE6D 1KYOE 3EQQA 4NBCD 1BCCE 4QDCA 2NUMA 3N0QA 2IBZE 3L74E 1EZVE 1WQLA 2HMKA 2JZAA 2NVFA 2XSOA 1P84E 2NVEA 2ZT9D 1ULIA 2HMOA 1G8JB 3L72E 4QUPA 3H1HE 1O7NA 1BE3E 4HM3A 2ZYLA 3GTEA 4HKVA 4P1CH 2HMMA 2DE5D 4D6TE 2FYUE 1RFSA 4HM7A 4NBFD 2E76D 5BOKA 5KKZC 1NU1E 1SQPE 2NWFA 3L70E 1SJGA 4HM8A 4P1BH 2E4PA 5HL4A 4PD4E 1VM9A 4QURA 3CX5E 3GKEA 1EG9A 1KB9E 1BGYE 2GBWA 1NYKA 1Q90C 2HMJA 3GL0A 2DE7D 4QDFA 3VMHD 3D89A 2HMNA 2QJPC 3VMGD 2YIUC 3L71E 4OGQD 4EMJB 1SQQE 4HM6A 3L73E 4NBHD 4H0LD 1NTZE 1JM1A 1O7WA 1O7GA 3TGUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQY A;  3GOB A;  4U3F E;  3VCP A;  4QDD A;  3L75 E;  1VF5 D;  2YFL A;  1NDO A;  2QJK C;  2YFI A;  5KLV E;  4AAY B;  3GZX A;  5CXM A;  2NVG A;  2B1X A;  2B24 A;  4NBG D;  5KLI C;  2HML A;  2XR8 A;  1ULJ A;  2BMQ A;  3CWB E;  4NB8 D;  3H1I E;  2E4Q A;  4HM1 A;  1PP9 E;  2QPZ A;  2BCC E;  4QCK A;  3H1L E;  2JO6 A;  1O7P A;  2YVJ B;  3AZC A;  4NBA D;  1FQT A;  4HJL A;  4NBD D;  3VCA A;  2I7F A;  2D2C D;  1UUV A;  5AEW A;  1UUW A;  2FYN C;  2QJY C;  4H13 D;  3VMI D;  1O7H A;  4NB9 D;  3GTS A;  2E75 D;  2YFJ A;  3GZY A;  2GBX A;  1NTK E;  1VCK A;  2XSH A;  2CKF A;  2E74 D;  1RIE A;  1G8K B;  3FOU A;  2A06 E;  3EN1 A;  3C0D A;  3BCC E;  2Q3W A;  3GL2 A;  4HM0 A;  1NTM E;  5AEU A;  4QUQ A;  4HM2 A;  4NBB D;  2BMR A;  2XRX A;  4HM4 A;  4PV1 D;  2NUK A;  3GB4 A;  1SQV E;  4HM5 A;  1L0L E;  1SQX E;  4NBE D;  1O7M A;  1SQB E;  3H1J E;  4QDF B;  4AIV A;  1L0N E;  3GCE A;  3CXH E;  3H1K E;  4H44 D;  1PPJ E;  2BMO A;  1ZRT E;  2DE6 D;  1KYO E;  3EQQ A;  4NBC D;  1BCC E;  4QDC A;  2NUM A;  3N0Q A;  2IBZ E;  3L74 E;  1EZV E;  1WQL A;  2HMK A;  2JZA A;  2NVF A;  2XSO A;  1P84 E;  2NVE A;  2ZT9 D;  1ULI A;  2HMO A;  1G8J B;  3L72 E;  4QUP A;  3H1H E;  1O7N A;  1BE3 E;  4HM3 A;  2ZYL A;  3GTE A;  4HKV A;  4P1C H;  2HMM A;  2DE5 D;  4D6T E;  2FYU E;  1RFS A;  4HM7 A;  4NBF D;  2E76 D;  5BOK A;  5KKZ C;  1NU1 E;  1SQP E;  2NWF A;  3L70 E;  1SJG A;  4HM8 A;  4P1B H;  2E4P A;  5HL4 A;  4PD4 E;  1VM9 A;  4QUR A;  3CX5 E;  3GKE A;  1EG9 A;  1KB9 E;  1BGY E;  2GBW A;  1NYK A;  1Q90 C;  2HMJ A;  3GL0 A;  2DE7 D;  4QDF A;  3VMH D;  3D89 A;  2HMN A;  2QJP C;  3VMG D;  2YIU C;  3L71 E;  4OGQ D;  4EMJ B;  1SQQ E;  4HM6 A;  3L73 E;  4NBH D;  4H0L D;  1NTZ E;  1JM1 A;  1O7W A;  1O7G A;  3TGU E; 
#chains in the Genus database with same CATH topology
 2FFD B;  2OTL P;  5DJT B;  3RK3 C;  2NZ2 A;  3R2P A;  1QX8 A;  2QPZ A;  4ASV A;  3G3Z A;  1QVF O;  3CCQ P;  1G2C A;  4H13 C;  1FZC C;  5CMZ A;  3IN6 A;  2GBX A;  1VCK A;  1L0N D;  1SQB J;  3H1K J;  1BDC A;  2JR8 A;  1PL5 A;  3P7K A;  1BCC D;  2IBZ I;  3L74 D;  2W6J H;  3BVH A;  1O7M A;  3P8C D;  3GHG A;  2FYU K;  1IFN A;  1ZV8 A;  2O01 H;  3TYY A;  1VQ7 P;  3CXH I;  1VQ5 P;  2M5A B;  2FYU G;  2NUM A;  2Q5U A;  1M1K Q;  1YTZ T;  3A0B H;  2NPS A;  1HWT C;  3RL0 B;  3WUU A;  2ZYL A;  1JTH A;  1SQQ D;  4IL6 E;  3LID A;  3D6Y A;  3L71 G;  2KIK A;  1Y9B A;  4C46 A;  1ZME C;  1LTS C;  2A06 D;  3MHV A;  2E5T A;  3M06 A;  2HG5 D;  1NTK G;  3D89 A;  4WY4 B;  2YIU C;  3RGU A;  3S9O A;  1R8E A;  1LGH B;  2OYH A;  1NTZ E;  4K35 A;  3VMY A;  1JO5 A;  5AVT B;  1SQV D;  2GA1 A;  1Q86 Q;  3CCS P;  2QA4 P;  4H13 B;  1FZC B;  2YXQ B;  2ZFC A;  3D70 A;  4QCK A;  2YVJ B;  3AZC A;  2ZVO B;  1USE A;  1PGP A;  3PP5 A;  1KC8 Q;  3AE4 C;  1N7S C;  1FZF A;  1LT9 A;  4NB9 D;  4BRY B;  1GD2 E;  1DD4 A;  3H1J D;  1RIE A;  1IFD A;  2XZR A;  1FZA A;  1PPJ D;  4QMA A;  2R44 A;  1KYO D;  1NTM E;  1KFM A;  1N73 A;  4NPE A;  4OVN F;  4W80 A;  3A5T A;  1DIP A;  1L4A D;  1BE3 D;  1NKN A;  3FXD A;  1SQX E;  3L72 J;  1KQL A;  3BAS A;  3U1C A;  1GMJ A;  1SQP D;  1DX7 A;  1SQB K;  2ZYA A;  1IFI A;  3IFM A;  2WSF H;  1NU1 J;  1IC2 A;  2AEF A;  2WQY C;  5GTH H;  3N0Q A;  2IBZ E;  2B89 A;  2AEM A;  3HTK A;  5DJU B;  1DEB A;  1IZN B;  4AQR D;  1LTT C;  5BU8 B;  1RF0 A;  2YIU B;  5TIS H;  1KB9 H;  2C9L Y;  3TGU G;  1FOS F;  3L75 G;  1CI6 A;  2IX7 C;  2KI7 B;  1QVG O;  2WIT A;  5AVZ B;  4GDO A;  4GKG A;  5AW2 B;  3I55 P;  1N7S B;  3CCJ P;  3VOP A;  2BMQ A;  1MZ9 A;  2GUS A;  5KTB A;  4I7Z C;  2KOG A;  3E7K A;  1M1J A;  2RH0 A;  2W8Z A;  5GTI E;  2IZ1 A;  3ITK A;  5AEW A;  4O9B A;  1FOS E;  2IDB A;  1GU5 A;  4XFJ A;  1S5L E;  3P32 A;  2XU6 A;  2E74 D;  1L0L J;  5CCG D;  1SFC D;  1USD A;  2RKL A;  2K37 A;  1YJW P;  1NKZ B;  1KQG B;  1WRG A;  1M56 D;  3I56 P;  2BMR A;  3NMD A;  1NYH A;  5AW4 B;  3A3Y B;  4I6M C;  3CX5 H;  1EZV G;  1DD3 A;  1L0N E;  1HH0 A;  3B5N C;  1RQU A;  3U1A A;  2KZJ A;  2XV5 A;  1KB9 D;  1BCC E;  1LTG C;  3L74 E;  3H32 B;  3HUS A;  4Y99 C;  1G8J B;  1X79 B;  3NTN A;  1NWQ A;  2JO1 A;  3P8C E;  4IFD K;  4R4L A;  1NO4 A;  3CCR P;  1KV4 A;  1RE4 A;  1M7L A;  3II6 A;  5KAI E;  1NU1 K;  1KQF B;  2O3J A;  2Q6Q A;  1JB0 J;  5B5E E;  3VMH D;  2OTJ P;  1GZL A;  2JEE A;  4LGD E;  3CCV P;  1PP9 J;  1SQQ E;  2E5Y A;  1JM1 A;  3M0D C;  5AW5 B;  4ZKP A;  4AUW A;  4I7Z B;  2NVG A;  4NB8 D;  3EWK A;  1ULJ A;  2HPC A;  2CPB A;  3B4S A;  5E79 H;  1FJK A;  1VPC A;  3BCC D;  4NBA D;  4C7N B;  1URQ C;  1K9M Q;  1M8O B;  2D2C D;  5APX A;  3VMI D;  1O7H A;  2E75 C;  2HYN A;  2YFJ A;  2ITA A;  1N2D C;  1NTK E;  1LJ2 A;  4YPC A;  2XSH A;  1PGJ A;  2CKF A;  2ZXX A;  3V4W A;  1LTB C;  4I2L C;  3B5N B;  2FXM A;  2OYI A;  4PV1 D;  2YNY A;  4HM5 A;  2ZAE B;  1SLQ A;  3VMA A;  4D6T D;  3H1J E;  4EYY Q;  2K9J B;  1KIL C;  1SFC A;  2KS1 B;  4H44 C;  4KJM A;  3L70 D;  1PPJ E;  1JOC A;  3MUD C;  1KYO E;  1BGY D;  2KB7 P;  2ZT9 C;  1WQL A;  1RE3 A;  3A0H E;  3G4S P;  3WU2 H;  1XTC C;  1EZV I;  3HD7 A;  3SFD C;  3FWL A;  1BE3 E;  1MFT A;  2WT7 B;  2YMY A;  4HM7 A;  2QM7 A;  5AVU B;  3VMZ A;  3WUV A;  2YKQ A;  4I1L A;  1NTZ K;  1GTW A;  1SQP E;  1LP1 B;  1MFZ A;  1NYK A;  2HMJ A;  1NTZ G;  2QM8 A;  1L2P A;  1K04 A;  2Z5I A;  3H1L D;  3JSV C;  3TDK A;  4DOJ A;  1YTZ I;  2Q3I A;  1LTI C;  1QEX A;  3O6Q A;  1NDO A;  1URQ B;  3VP9 A;  5CCG C;  1QL2 A;  3CCL P;  5KJ7 A;  2E75 B;  4U7J A;  5B66 H;  1PGQ A;  2K1A A;  1N7L A;  1JY2 P;  2CK3 H;  1NTM K;  1VQL P;  1WMK A;  2C9N Y;  4JYC A;  2Z5H A;  1SQX K;  1S9K D;  1NTM G;  3H1H G;  1W2E A;  1KTM A;  1PFI A;  1RF1 C;  1ZRT D;  1JNM A;  3HRN A;  1KIL B;  1SQX G;  4ZKU A;  3MP7 B;  4HM2 A;  2M0B A;  3H1H D;  2ZT9 B;  3Q3D A;  2N1T A;  4LC1 A;  3QH9 A;  1VQN P;  2FYU J;  3CME P;  1YYC A;  1OXZ A;  3IF4 A;  2AXC A;  5APY A;  1EDK A;  5AVR B;  2W6A A;  3M9B A;  5GTH E;  1ULI A;  3F89 A;  3PLN A;  1YIJ P;  3SSU A;  4HKZ H;  3GTE A;  5APQ A;  2DE5 D;  1LWU A;  2NPS D;  1PGO A;  3L71 J;  1OIP A;  3M9Q A;  1KB9 E;  2GBW A;  1NTK J;  4GOE A;  3CWB D;  3Q1M A;  2FXP A;  2IYO A;  3HE5 B;  1DEE G;  1YHQ P;  1NVO A;  2QJK C;  2HML A;  2OTK E;  1RHZ B;  1PIX A;  2E4Q A;  1NH4 A;  2BEZ F;  2JJL A;  3T97 A;  1H0T A;  3Q5S A;  4DZO A;  1RF1 B;  4PV1 C;  2YO3 A;  1FZC A;  1VL2 A;  3EFG A;  1UUV A;  1UUW A;  2O1K A;  4W7Y A;  3GZY A;  2KSE A;  4OH8 B;  2A45 H;  1FC2 C;  2IPP A;  4WY4 C;  1FAV A;  1Z56 A;  1J1D C;  3BCC E;  2Q3W A;  3RK2 C;  1JY3 O;  3IAO A;  5H2F H;  1L0N G;  4KHX A;  1J2J B;  3HE4 B;  2YXR B;  1BCC G;  2WSE H;  1ZLL A;  4PD4 H;  4QDF B;  3L74 G;  3CI9 A;  1FU1 A;  3NXS A;  2JWA A;  1AJY A;  2WPV B;  1IO4 A;  2K9Y A;  3CCM P;  1P84 H;  1LTA C;  1W2B O;  3GF3 A;  2FXO A;  4UB6 H;  1Q7Y Q;  4Z1M H;  5CCH C;  4D6T E;  1VQ4 P;  4NBF D;  3L73 D;  1SQQ K;  3L70 E;  3KZI E;  4HM8 A;  2M3B A;  5KLV D;  3TGU J;  1BGY E;  1SQQ G;  2B87 A;  3L75 J;  1OWA A;  3H1I D;  4LLH A;  2QJK B;  3Q5P A;  1OMI A;  2OQQ A;  2YMK A;  4OGQ C;  3TSI A;  3FXE A;  3AE6 C;  1AQT A;  2A06 G;  1O7W A;  4UB8 H;  1VF5 C;  4PV1 B;  2WWW A;  1NTK K;  3P8M C;  5KAF E;  1SQV G;  1YJN P;  3H1L E;  2JO6 A;  1LNQ A;  1ZN5 A;  1K05 A;  1FS0 E;  2ZJS E;  3SWK A;  1LTJ B;  1N7S A;  1QL1 A;  3A2A A;  1J1D B;  1HVV A;  2UWJ E;  3RK2 B;  1OVV A;  2J59 M;  3S4R A;  1ZXG A;  3V2P A;  1VQM P;  4YXD C;  5AW3 B;  3H1J G;  4HM0 A;  1P84 D;  1PPJ G;  1S1C X;  1M57 D;  4U3F D;  2HOD A;  2I8D A;  1ZRT E;  1BE3 G;  2Q3E A;  1R5S A;  3S1K A;  2XSO A;  1SQP G;  3H1H E;  4HM3 A;  1FBM A;  2OYH C;  4ZMD A;  2C0X A;  4OGQ B;  3CC2 P;  1GW4 A;  5CHX A;  4IOI H;  2FYN B;  1BDD A;  2H8P D;  1G2C B;  3W68 A;  2L5G B;  1VF5 B;  2YKO A;  1M90 Q;  2JDI H;  2BCC D;  2JKV A;  2FYZ A;  4H0L D;  1H8A A;  4QDD A;  2ZYD A;  3AE8 C;  2O1J A;  1GL2 D;  3CWB E;  3MIW A;  2KSJ A;  4HM1 A;  1LT1 A;  3V2R A;  1A02 F;  3GHG B;  3KXD A;  5CJ4 A;  1KFN A;  4B86 A;  2R3S A;  1UIX A;  4TLF A;  3C8V A;  3Q2Y A;  2P7J A;  2JP3 A;  1MKM A;  4WBA A;  1HJ0 A;  5AVW B;  4JYB A;  1NOH A;  2B88 A;  2KYV A;  4RJT A;  1SQB D;  5TJH A;  1H89 A;  3H1K D;  4RO0 A;  1JTH B;  5KKZ B;  1EXI A;  1IFM A;  5AW9 B;  3JC2 2;  2Y9Z A;  3SWF A;  4L76 A;  2Z4E A;  2XNX A;  3GCE A;  1RF0 C;  3V2Q A;  2OYH B;  2RN0 A;  2HLO A;  2FBW C;  2R32 A;  3JCU H;  3EQ2 A;  5CJ0 A;  4IL6 X;  1OVR A;  1KYO I;  3NFQ A;  2FKW B;  3H1L J;  1KZU B;  1GK6 A;  1QLE D;  1YJ9 P;  3HD7 D;  1MUU A;  4HB1 A;  5APU A;  1G1J A;  1VQ6 P;  3AEC C;  3TNU B;  2NWF A;  1NTZ J;  4P1B H;  4ZNC A;  3AE3 C;  2WT7 A;  4JPZ B;  1KQS O;  1OVU A;  1Q90 D;  1IFP A;  2KNC A;  2W90 A;  2ZVN B;  2DE7 D;  1RQV A;  3L73 E;  2POH A;  1M1J C;  2IFM A;  1SP4 A;  1NAF A;  1NJI Q;  5KLV E;  2B24 A;  4NBG D;  3PHL A;  3H1I E;  2J58 A;  5KJ7 D;  4XE5 B;  1R5L A;  1URQ A;  4HJL A;  1YQ3 C;  1QGK B;  1XTG B;  1AV1 A;  2KLU A;  1NTM J;  2OAR A;  3H1H J;  5APT A;  1KN7 A;  3BCC G;  4L73 A;  1FZB A;  2GM4 A;  4NPD A;  3HTK B;  1GL2 A;  5L8R J;  4R4M A;  1E5W A;  1SQX J;  5EFW B;  3FOU A;  2A06 E;  1S3J A;  4Y28 J;  5AEU A;  3VTP C;  2JWD A;  4HM4 A;  1L4A C;  3L72 D;  4IL6 H;  3PJS K;  1SQV E;  1KIL A;  2QSI A;  3FWN A;  4JQ0 D;  3PH0 A;  2PFX A;  1CI6 B;  1NU1 D;  2P58 A;  1FJP A;  2N1T D;  2DE6 D;  1RE4 C;  3AEB C;  3CX5 D;  4D6T G;  1TU3 F;  1P84 E;  2LXC B;  3L70 G;  1BGY G;  3L37 A;  1T2K D;  2E76 D;  2KZI A;  2LR2 A;  2WSS H;  4BWN A;  3FX0 A;  2G8Y A;  2HFE D;  1AQ5 A;  4EOT A;  1M1J B;  1YBK A;  4KT0 J;  1KB9 I;  4W7Z A;  3RL0 D;  3OA7 A;  1RH5 B;  4OWF A;  3GW6 A;  4IFM A;  3L4F A;  3A0B E;  2WSC J;  3GOB A;  5APS A;  3H1L G;  3RK3 D;  1X0T A;  2H89 C;  2AXT H;  4MN4 C;  1EDL A;  3C1L A;  2BCC E;  1S2E A;  1O7P A;  4NBD D;  2R3C A;  1HJB A;  4H13 D;  2OYI C;  1K8A Q;  1L0L D;  3HUS B;  3CC4 P;  1L4A B;  2E74 C;  2L91 A;  1SFC C;  2QG4 A;  1L0N J;  2FFD A;  3V5B A;  2M8R A;  2GUV A;  1FZG A;  1RE3 C;  2J5U A;  1BCC J;  3I5C A;  3L74 J;  3Q5R A;  3CXH H;  1SQB E;  1SS1 A;  2C0W A;  3BAT A;  3MGN A;  3H1K E;  3MTU E;  3CL3 D;  3CX5 I;  2QEX P;  5KLV J;  3GG2 A;  4NBC D;  3W67 A;  2LXB A;  1PV3 A;  1FDM A;  1JY3 P;  2HPC B;  1HTL C;  5BOK A;  1SQQ J;  2RMZ A;  4GOF A;  2E4P A;  1VM9 A;  1EG9 A;  3M0A A;  2H7H A;  2WSC H;  3KHU A;  1PP9 D;  1T3U A;  2K3R A;  5GTI H;  3VMG D;  2Y0D A;  3QWO C;  3CWB G;  2M5A A;  1HGZ A;  1S5L H;  3H25 A;  3R4Y A;  2PRR A;  1SQV J;  5AVX B;  2B1X A;  2OYI B;  1D7M A;  2E43 A;  5TIS E;  2E74 B;  1U57 A;  2IBZ D;  3BRT B;  1SFC B;  2OYO A;  4IFF A;  2AEJ A;  2D2C C;  5M1B A;  1OFC X;  1N7S D;  2KLV A;  3VMX A;  5K5G B;  4K3A A;  3HD7 B;  2P10 A;  4WY4 A;  3CXH D;  4DCK A;  4RKU J;  3H1J J;  2O01 J;  4L74 A;  4NBB D;  2I1J A;  1IK9 A;  1BSN A;  2Y0E A;  2NUK A;  1EC5 A;  1LWU C;  1BE3 J;  5KAI H;  5BVZ A;  4YTP C;  4N78 D;  1LTJ C;  1L0N K;  3OJA B;  4C7R A;  5B5E H;  1SQP J;  2CPS A;  2JZA A;  3LW5 J;  3O6Q B;  4BRY A;  2NVF A;  1W5C E;  2HMO A;  3L72 E;  2ZXE B;  1H88 A;  4NPF X;  1JY2 N;  3AED C;  1RY3 A;  1NU1 E;  3CLQ A;  3K5B A;  3LIE A;  3CX5 E;  5KLV K;  3L73 G;  1CW5 A;  1UII A;  2IZ0 A;  1FZE A;  5KLV G;  4HM6 A;  4HYT B;  4NBH D;  3H1I G;  3AEG C;  1JY3 N;  1E79 H;  2YFL A;  1HBW A;  2D2C B;  5CXM A;  3CPW O;  1CZQ A;  1X9V A;  3RL0 g;  2V4H A;  1CSB A;  3H6P A;  2N1T B;  3PTZ A;  2P1J A;  2A45 G;  2FYN C;  2KXP B;  3RK3 E;  2IYP A;  2ZYG A;  3KPE A;  4A7P A;  1SQV K;  4EDF A;  3OAK A;  2E76 B;  1KYO H;  1G8K B;  1ZW0 A;  3B71 A;  3A0H H;  1LWU B;  2PGD A;  3C0D A;  1KD1 Q;  1NGM B;  1VDF A;  5E79 E;  2XRX A;  1DH3 A;  2WSF J;  3O8Z A;  1L0L E;  2PP6 A;  2FYU D;  3LW5 H;  1PZQ A;  3GHG C;  3RK3 B;  3B5N D;  4PD4 D;  1OW6 A;  1EDJ A;  1FDO A;  4U3F G;  5AW7 B;  4QUP A;  2V7Q J;  4HKV A;  2K88 A;  5AVS B;  3L71 D;  2P2U A;  2NPS C;  3WMM 0;  1OW8 A;  3T97 B;  1NHL A;  5KKZ C;  2WVR A;  3KQG A;  4N6J A;  3G71 P;  1S9K E;  1H0T B;  2Y0C A;  1NTK D;  5HL4 A;  1JCD A;  3MD0 A;  4M3L A;  3CMA P;  1SQP K;  1JM0 A;  4EIJ A;  3TNU A;  2SPZ A;  3WU2 E;  1GW3 A;  1T6A A;  3M91 A;  3GKE A;  2BCC G;  1K73 Q;  1MV8 A;  4PJ0 H;  4AAY B;  3H32 A;  1IK7 A;  1FDI A;  3VYI A;  2AXT E;  5KLI C;  3A7O A;  1PP9 E;  2WZ7 A;  4HH2 A;  1IFJ A;  1FQT A;  1OW7 A;  1KMI Z;  1GU4 A;  3BCC J;  2FY8 A;  1URQ D;  2YO2 A;  2QJY C;  2H88 C;  3GTS A;  2E75 D;  1VQO P;  1LT9 C;  4N3Y B;  1Y47 A;  3GMA A;  4BXL A;  1U7J A;  3OW2 O;  5AW1 B;  5AVV B;  3VN0 A;  2A45 I;  3EN1 A;  4L75 A;  1U7M A;  1SQB G;  5B66 E;  3M9H A;  4QUQ A;  3H1K G;  1N73 C;  2B87 B;  4NBE D;  2WMM A;  1IJD B;  1GK4 A;  3CXH E;  4C7N A;  1KIL D;  4D6T J;  4H44 D;  1AVY A;  2V7Q H;  2NPS B;  4PD4 I;  4ASW A;  3EQQ A;  3L70 J;  3B8E B;  4QDC A;  1VQK P;  2ZT9 D;  4GT1 A;  1BGY J;  2PAJ A;  1P84 I;  2H43 A;  2HMM A;  1RFS A;  3G6E P;  2KUB A;  3FGA D;  2G3A A;  3TGU D;  3B5N A;  4N78 E;  1S4X A;  3L75 D;  4QUR A;  1S72 P;  5AW8 B;  4XA4 A;  3C9I A;  2WPR A;  1OX3 A;  4GOD A;  3N4X A;  4WWI A;  5CBO A;  5KLI B;  2K9J A;  2Q1K A;  4JF7 A;  2KS1 A;  2WTY A;  3SWY A;  1JCC A;  3V4Q A;  3USS A;  3CD6 P;  1O7G A;  1KOR A;  2M3E A;  2KP8 A;  1Y8A A;  2KK7 A;  2XR8 A;  3GLM A;  2QJY B;  5AVQ B;  4DJG A;  1J1E C;  1LT9 B;  1JEK A;  3KDP B;  3L36 A;  2HOD B;  2OGU A;  1LP1 A;  3M0D A;  4WB4 A;  1YQ4 C;  1N73 B;  2N9Y B;  3AEF C;  5AW6 B;  5BU5 A;  1L4A A;  1EZV D;  1VQ9 P;  1AFO A;  1OZH A;  1ZR2 A;  1YIT P;  5APV A;  1SVF A;  3KZI H;  1WT6 A;  2WPS A;  4AIV A;  3WUT A;  3ABV C;  3L72 G;  1N86 A;  2NRG A;  2W83 C;  3PRJ A;  2B9B A;  5APW A;  3VP8 A;  2BAS A;  2HMK A;  3RBZ A;  1NU1 G;  3EFF K;  2YKP A;  1ZP0 C;  3HUS C;  3AEA C;  1Q82 Q;  5H2F E;  1T3J A;  2FYU E;  3V6I A;  4TT3 H;  1BSH A;  5KAF H;  4PD4 E;  3MUD A;  2N9B A;  1JUN A;  2VRS A;  3CWB J;  2HMN A;  2QJP C;  3L71 E;  4H0L C;  1J1E B;  1VQ8 P;  2P67 A;  4UB6 E;  3DQY A;  4U3F E;  2YFI A;  3GZX A;  3IR9 A;  3F5H A;  1G1I A;  1GL2 C;  4GIF A;  1NAY A;  2XKM A;  2E42 A;  1FE6 A;  1VQP P;  2I7F A;  3AEE C;  4YXW H;  1HUC A;  1JMM A;  4Y99 B;  1X22 A;  1Q2N A;  2W27 A;  2W6B A;  5CCG A;  1A02 J;  1L0L K;  4UB8 E;  2O01 N;  3HE5 A;  2Q7C A;  4WY4 D;  2R5B A;  1L0L G;  3RK2 D;  3GL2 A;  3D71 A;  1EQ7 A;  3TK1 A;  1S5L X;  1Q81 Q;  3KYQ A;  4DT0 A;  3GB4 A;  3L35 A;  2KNC B;  3D6Z A;  1RF1 A;  2MJZ A;  1AVO A;  3CC7 P;  3AE9 C;  2I1K A;  2QRX A;  5AVY B;  5C39 A;  4P1C H;  1HGV A;  3G9R A;  3HD7 C;  5CCH D;  1NTZ D;  1KIL E;  2QJP B;  3L73 J;  1EXJ A;  5AW0 B;  1SJG A;  4H0L B;  3V2N A;  3E1R A;  1GDT A;  1Q90 C;  3HE4 A;  1EDI A;  4AYC A;  4QDF A;  3ZDM A;  1GL2 B;  3H1I J;  2QIW A;  4OGQ D;  1PP9 G;  1T8Z A;  3TGU E;  3VCP A;  3L75 E;  1VF5 D;  4PJ0 E;  4JBZ A;  2DW3 A;  3SFE C;  4H44 B;  1AA0 A;  4RES B;  1YI2 P;  5KJ7 C;  3RBX A;  2FFD C;  1NTM D;  3VCA A;  4HJG H;  3UIA A;  2MKV A;  2IBZ G;  3TF5 A;  1SQX D;  2Q9I A;  3BRV B;  1ZOY C;  2QVA A;  4EI2 A;  2WSE J;  3CCE P;  4CPG A;  2XND H;  3E1I A;  1ZR4 A;  1JMB A;  2WPQ A;  2XDJ A;  3AE5 C;  1N8R Q;  1LTJ A;  2N1T C;  4U3F J;  2BMO A;  1EZV E;  2NVE A;  1X8Y A;  2BEQ D;  3MZW B;  4WVZ A;  1O7N A;  1T2K C;  2E76 C;  5CBN A;  3AE7 C;  2QE7 H;  2Y9Y A;  2R5D A;  2IFN A;  2LKM A;  3RL0 C;  2HR3 A;  1JY2 O;  1HF9 A;  3GL0 A;  3CCU P;  3JCU E;  3U59 A;  5CCH A;  4EMJ B;  2BCC J;  3AE1 C;  3AE2 C;  3N7N A;  3GF7 A; 
#chains in the Genus database with same CATH homology
 3DQY A;  3GOB A;  4U3F E;  3VCP A;  4QDD A;  3L75 E;  1VF5 D;  2YFL A;  1NDO A;  2QJK C;  2YFI A;  5KLV E;  4AAY B;  3GZX A;  5CXM A;  2NVG A;  2B1X A;  2B24 A;  4NBG D;  5KLI C;  2HML A;  2XR8 A;  1ULJ A;  2BMQ A;  3CWB E;  4NB8 D;  3H1I E;  2E4Q A;  4HM1 A;  1PP9 E;  2QPZ A;  2BCC E;  4QCK A;  3H1L E;  2JO6 A;  1O7P A;  2YVJ B;  3AZC A;  4NBA D;  1FQT A;  4HJL A;  4NBD D;  3VCA A;  2I7F A;  2D2C D;  1UUV A;  5AEW A;  1UUW A;  2FYN C;  2QJY C;  4H13 D;  3VMI D;  1O7H A;  4NB9 D;  3GTS A;  2E75 D;  2YFJ A;  3GZY A;  2GBX A;  1NTK E;  1VCK A;  2XSH A;  2CKF A;  2E74 D;  1RIE A;  1G8K B;  3FOU A;  2A06 E;  3EN1 A;  3C0D A;  3BCC E;  2Q3W A;  3GL2 A;  4HM0 A;  1NTM E;  5AEU A;  4QUQ A;  4HM2 A;  4NBB D;  2BMR A;  2XRX A;  4HM4 A;  4PV1 D;  2NUK A;  3GB4 A;  1SQV E;  4HM5 A;  1L0L E;  1SQX E;  4NBE D;  1O7M A;  1SQB E;  3H1J E;  4QDF B;  4AIV A;  1L0N E;  3GCE A;  3CXH E;  3H1K E;  4H44 D;  1PPJ E;  2BMO A;  1ZRT E;  2DE6 D;  1KYO E;  3EQQ A;  4NBC D;  1BCC E;  4QDC A;  2NUM A;  3N0Q A;  2IBZ E;  3L74 E;  1EZV E;  1WQL A;  2HMK A;  2JZA A;  2NVF A;  2XSO A;  1P84 E;  2NVE A;  2ZT9 D;  1ULI A;  2HMO A;  1G8J B;  3L72 E;  4QUP A;  3H1H E;  1O7N A;  1BE3 E;  4HM3 A;  2ZYL A;  3GTE A;  4HKV A;  4P1C H;  2HMM A;  2DE5 D;  4D6T E;  2FYU E;  1RFS A;  4HM7 A;  4NBF D;  2E76 D;  5BOK A;  5KKZ C;  1NU1 E;  1SQP E;  2NWF A;  3L70 E;  1SJG A;  4HM8 A;  4P1B H;  2E4P A;  5HL4 A;  4PD4 E;  1VM9 A;  4QUR A;  3CX5 E;  3GKE A;  1EG9 A;  1KB9 E;  1BGY E;  2GBW A;  1NYK A;  1Q90 C;  2HMJ A;  3GL0 A;  2DE7 D;  4QDF A;  3VMH D;  3D89 A;  2HMN A;  2QJP C;  3VMG D;  2YIU C;  3L71 E;  4OGQ D;  4EMJ B;  1SQQ E;  4HM6 A;  3L73 E;  4NBH D;  4H0L D;  1NTZ E;  1JM1 A;  1O7W A;  1O7G A;  3TGU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...