5BOKA

Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
b'ENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALCTPLTQDIKTYPVKIENMRVMLKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2
rcsb
source organism Diaphorobacter sp. ds2
molecule tags Metal binding protein
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5bokA00
5HL4A 1VCKA 4QDCA 1ULJA 2NVGA 3L74E 1NTKE 4HM5A 4NBHD 1FQTA 4AAYB 4NB9D 4NB8D 3L72E 3C0DA 3H1IE 5BOKA 1KB9E 3H1KE 1NDOA 2ZT9D 1SQXE 3VMID 2NUKA 4QUQA 1Q90C 3L70E 2B24A 1JM1A 3L73E 2YFIA 3L71E 3BCCE 4OGQD 2QJPC 2FYNC 2HMJA 4HM1A 1O7MA 4QURA 4AIVA 4H13D 4P1CH 4H44D 4QDFA 4HM2A 2BMRA 1KYOE 1SQBE 3VCAA 3CX5E 3GTEA 2E74D 3FOUA 1VM9A 2YFLA 3H1JE 3N0QA 4QDDA 2E76D 2B1XA 1RFSA 3VMGD 2I7FA 2XSHA 5AEUA 1RIEA 2JZAA 2E4PA 2BMOA 2QPZA 2E4QA 1ULIA 2IBZE 2NVFA 3CWBE 2A06E 2HMMA 4PV1D 3GB4A 4QUPA 1NTZE 1O7WA 1NYKA 4HM0A 2HMNA 1SQPE 2FYUE 4NBFD 4NBAD 2D2CD 2DE6D 3DQYA 3EQQA 3GL0A 3L75E 2YIUC 3GCEA 1PP9E 1NU1E 2NUMA 1L0NE 2HMKA 2NWFA 1O7NA 3TGUE 2Q3WA 2GBXA 2YVJB 4HM7A 1L0LE 4P1BH 3VCPA 3VMHD 1O7GA 1G8KB 2CKFA 2XSOA 3CXHE 2DE5D 2GBWA 2QJKC 1NTME 3GTSA 1G8JB 4HM4A 3GOBA 1ZRTE 1O7PA 4HM6A 1PPJE 4HM8A 3GL2A 1VF5D 4EMJB 2XR8A 2HMOA 1EG9A 2XRXA 3H1HE 1WQLA 2HMLA 1O7HA 1SJGA 1BCCE 3H1LE 3GZXA 1BE3E 1UUWA 4H0LD 2JO6A 4NBBD 4QCKA 1EZVE 1P84E 4NBGD 4PD4E 3EN1A 3AZCA 5AEWA 4QDFB 2QJYC 4NBED 2DE7D 2BMQA 2YFJA 4U3FE 4HM3A 1SQQE 4NBCD 3D89A 3GKEA 4NBDD 5KLVE 5KLIC 3GZYA 1SQVE 2E75D 1UUVA 4HKVA 5KKZC 2NVEA 2ZYLA 5CXMA 4HJLA 2BCCE
chains in the Genus database with same CATH superfamily
5HL4A 1VCKA 4QDCA 1ULJA 2NVGA 3L74E 1NTKE 4HM5A 4NBHD 1FQTA 4AAYB 4NB9D 4NB8D 3L72E 3C0DA 3H1IE 5BOKA 1KB9E 3H1KE 1NDOA 2ZT9D 1SQXE 3VMID 2NUKA 4QUQA 1Q90C 3L70E 2B24A 1JM1A 3L73E 2YFIA 3L71E 3BCCE 4OGQD 2QJPC 2FYNC 2HMJA 4HM1A 1O7MA 4QURA 4AIVA 4H13D 4P1CH 4H44D 4QDFA 4HM2A 2BMRA 1KYOE 1SQBE 3VCAA 3CX5E 3GTEA 2E74D 3FOUA 1VM9A 2YFLA 3H1JE 3N0QA 4QDDA 2E76D 2B1XA 1RFSA 3VMGD 2I7FA 2XSHA 5AEUA 1RIEA 2JZAA 2E4PA 2BMOA 2QPZA 2E4QA 1ULIA 2IBZE 2NVFA 3CWBE 2A06E 2HMMA 4PV1D 3GB4A 4QUPA 1NTZE 1O7WA 1NYKA 4HM0A 2HMNA 1SQPE 2FYUE 4NBFD 4NBAD 2D2CD 2DE6D 3DQYA 3EQQA 3GL0A 3L75E 2YIUC 3GCEA 1PP9E 1NU1E 2NUMA 1L0NE 2HMKA 2NWFA 1O7NA 3TGUE 2Q3WA 2GBXA 2YVJB 4HM7A 1L0LE 4P1BH 3VCPA 3VMHD 1O7GA 1G8KB 2CKFA 2XSOA 3CXHE 2DE5D 2GBWA 2QJKC 1NTME 3GTSA 1G8JB 4HM4A 3GOBA 1ZRTE 1O7PA 4HM6A 1PPJE 4HM8A 3GL2A 1VF5D 4EMJB 2XR8A 2HMOA 1EG9A 2XRXA 3H1HE 1WQLA 2HMLA 1O7HA 1SJGA 1BCCE 3H1LE 3GZXA 1BE3E 1UUWA 4H0LD 2JO6A 4NBBD 4QCKA 1EZVE 1P84E 4NBGD 4PD4E 3EN1A 3AZCA 5AEWA 4QDFB 2QJYC 4NBED 2DE7D 2BMQA 2YFJA 4U3FE 4HM3A 1SQQE 4NBCD 3D89A 3GKEA 4NBDD 5KLVE 5KLIC 3GZYA 1SQVE 2E75D 1UUVA 4HKVA 5KKZC 2NVEA 2ZYLA 5CXMA 4HJLA 2BCCE
chains in the Genus database with same CATH topology
5HL4A 1VCKA 4QDCA 1ULJA 2NVGA 3L74E 1NTKE 4HM5A 4NBHD 1FQTA 4AAYB 4NB9D 4NB8D 3L72E 3C0DA 3H1IE 5BOKA 1KB9E 3H1KE 1NDOA 2ZT9D 1SQXE 3VMID 2NUKA 4QUQA 1Q90C 3L70E 2B24A 1JM1A 3L73E 2YFIA 3L71E 3BCCE 4OGQD 2QJPC 2FYNC 2HMJA 4HM1A 1O7MA 4QURA 4AIVA 4H13D 4P1CH 4H44D 4QDFA 4HM2A 2BMRA 1KYOE 1SQBE 3VCAA 3CX5E 3GTEA 2E74D 3FOUA 1VM9A 2YFLA 3H1JE 3N0QA 4QDDA 2E76D 2B1XA 1RFSA 3VMGD 2I7FA 2XSHA 5AEUA 1RIEA 2JZAA 2E4PA 2BMOA 2QPZA 2E4QA 1ULIA 2IBZE 2NVFA 3CWBE 2A06E 2HMMA 4PV1D 3GB4A 4QUPA 1NTZE 1O7WA 1NYKA 4HM0A 2HMNA 1SQPE 2FYUE 4NBFD 4NBAD 2D2CD 2DE6D 3DQYA 3EQQA 3GL0A 3L75E 2YIUC 3GCEA 1PP9E 1NU1E 2NUMA 1L0NE 2HMKA 2NWFA 1O7NA 3TGUE 2Q3WA 2GBXA 2YVJB 4HM7A 1L0LE 4P1BH 3VCPA 3VMHD 1O7GA 1G8KB 2CKFA 2XSOA 3CXHE 2DE5D 2GBWA 2QJKC 1NTME 3GTSA 1G8JB 4HM4A 3GOBA 1ZRTE 1O7PA 4HM6A 1PPJE 4HM8A 3GL2A 1VF5D 4EMJB 2XR8A 2HMOA 1EG9A 2XRXA 3H1HE 1WQLA 2HMLA 1O7HA 1SJGA 1BCCE 3H1LE 3GZXA 1BE3E 1UUWA 4H0LD 2JO6A 4NBBD 4QCKA 1EZVE 1P84E 4NBGD 4PD4E 3EN1A 3AZCA 5AEWA 4QDFB 2QJYC 4NBED 2DE7D 2BMQA 2YFJA 4U3FE 4HM3A 1SQQE 4NBCD 3D89A 3GKEA 4NBDD 5KLVE 5KLIC 3GZYA 1SQVE 2E75D 1UUVA 4HKVA 5KKZC 2NVEA 2ZYLA 5CXMA 4HJLA 2BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL4 A;  1VCK A;  4QDC A;  1ULJ A;  2NVG A;  3L74 E;  1NTK E;  4HM5 A;  4NBH D;  1FQT A;  4AAY B;  4NB9 D;  4NB8 D;  3L72 E;  3C0D A;  3H1I E;  5BOK A;  1KB9 E;  3H1K E;  1NDO A;  2ZT9 D;  1SQX E;  3VMI D;  2NUK A;  4QUQ A;  1Q90 C;  3L70 E;  2B24 A;  1JM1 A;  3L73 E;  2YFI A;  3L71 E;  3BCC E;  4OGQ D;  2QJP C;  2FYN C;  2HMJ A;  4HM1 A;  1O7M A;  4QUR A;  4AIV A;  4H13 D;  4P1C H;  4H44 D;  4QDF A;  4HM2 A;  2BMR A;  1KYO E;  1SQB E;  3VCA A;  3CX5 E;  3GTE A;  2E74 D;  3FOU A;  1VM9 A;  2YFL A;  3H1J E;  3N0Q A;  4QDD A;  2E76 D;  2B1X A;  1RFS A;  3VMG D;  2I7F A;  2XSH A;  5AEU A;  1RIE A;  2JZA A;  2E4P A;  2BMO A;  2QPZ A;  2E4Q A;  1ULI A;  2IBZ E;  2NVF A;  3CWB E;  2A06 E;  2HMM A;  4PV1 D;  3GB4 A;  4QUP A;  1NTZ E;  1O7W A;  1NYK A;  4HM0 A;  2HMN A;  1SQP E;  2FYU E;  4NBF D;  4NBA D;  2D2C D;  2DE6 D;  3DQY A;  3EQQ A;  3GL0 A;  3L75 E;  2YIU C;  3GCE A;  1PP9 E;  1NU1 E;  2NUM A;  1L0N E;  2HMK A;  2NWF A;  1O7N A;  3TGU E;  2Q3W A;  2GBX A;  2YVJ B;  4HM7 A;  1L0L E;  4P1B H;  3VCP A;  3VMH D;  1O7G A;  1G8K B;  2CKF A;  2XSO A;  3CXH E;  2DE5 D;  2GBW A;  2QJK C;  1NTM E;  3GTS A;  1G8J B;  4HM4 A;  3GOB A;  1ZRT E;  1O7P A;  4HM6 A;  1PPJ E;  4HM8 A;  3GL2 A;  1VF5 D;  4EMJ B;  2XR8 A;  2HMO A;  1EG9 A;  2XRX A;  3H1H E;  1WQL A;  2HML A;  1O7H A;  1SJG A;  1BCC E;  3H1L E;  3GZX A;  1BE3 E;  1UUW A;  4H0L D;  2JO6 A;  4NBB D;  4QCK A;  1EZV E;  1P84 E;  4NBG D;  4PD4 E;  3EN1 A;  3AZC A;  5AEW A;  4QDF B;  2QJY C;  4NBE D;  2DE7 D;  2BMQ A;  2YFJ A;  4U3F E;  4HM3 A;  1SQQ E;  4NBC D;  3D89 A;  3GKE A;  4NBD D;  5KLV E;  5KLI C;  3GZY A;  1SQV E;  2E75 D;  1UUV A;  4HKV A;  5KKZ C;  2NVE A;  2ZYL A;  5CXM A;  4HJL A;  2BCC E; 
#chains in the Genus database with same CATH topology
 5HL4 A;  1VCK A;  4QDC A;  1ULJ A;  2NVG A;  3L74 E;  1NTK E;  4HM5 A;  4NBH D;  1FQT A;  4AAY B;  4NB9 D;  4NB8 D;  3L72 E;  3C0D A;  3H1I E;  5BOK A;  1KB9 E;  3H1K E;  1NDO A;  2ZT9 D;  1SQX E;  3VMI D;  2NUK A;  4QUQ A;  1Q90 C;  3L70 E;  2B24 A;  1JM1 A;  3L73 E;  2YFI A;  3L71 E;  3BCC E;  4OGQ D;  2QJP C;  2FYN C;  2HMJ A;  4HM1 A;  1O7M A;  4QUR A;  4AIV A;  4H13 D;  4P1C H;  4H44 D;  4QDF A;  4HM2 A;  2BMR A;  1KYO E;  1SQB E;  3VCA A;  3CX5 E;  3GTE A;  2E74 D;  3FOU A;  1VM9 A;  2YFL A;  3H1J E;  3N0Q A;  4QDD A;  2E76 D;  2B1X A;  1RFS A;  3VMG D;  2I7F A;  2XSH A;  5AEU A;  1RIE A;  2JZA A;  2E4P A;  2BMO A;  2QPZ A;  2E4Q A;  1ULI A;  2IBZ E;  2NVF A;  3CWB E;  2A06 E;  2HMM A;  4PV1 D;  3GB4 A;  4QUP A;  1NTZ E;  1O7W A;  1NYK A;  4HM0 A;  2HMN A;  1SQP E;  2FYU E;  4NBF D;  4NBA D;  2D2C D;  2DE6 D;  3DQY A;  3EQQ A;  3GL0 A;  3L75 E;  2YIU C;  3GCE A;  1PP9 E;  1NU1 E;  2NUM A;  1L0N E;  2HMK A;  2NWF A;  1O7N A;  3TGU E;  2Q3W A;  2GBX A;  2YVJ B;  4HM7 A;  1L0L E;  4P1B H;  3VCP A;  3VMH D;  1O7G A;  1G8K B;  2CKF A;  2XSO A;  3CXH E;  2DE5 D;  2GBW A;  2QJK C;  1NTM E;  3GTS A;  1G8J B;  4HM4 A;  3GOB A;  1ZRT E;  1O7P A;  4HM6 A;  1PPJ E;  4HM8 A;  3GL2 A;  1VF5 D;  4EMJ B;  2XR8 A;  2HMO A;  1EG9 A;  2XRX A;  3H1H E;  1WQL A;  2HML A;  1O7H A;  1SJG A;  1BCC E;  3H1L E;  3GZX A;  1BE3 E;  1UUW A;  4H0L D;  2JO6 A;  4NBB D;  4QCK A;  1EZV E;  1P84 E;  4NBG D;  4PD4 E;  3EN1 A;  3AZC A;  5AEW A;  4QDF B;  2QJY C;  4NBE D;  2DE7 D;  2BMQ A;  2YFJ A;  4U3F E;  4HM3 A;  1SQQ E;  4NBC D;  3D89 A;  3GKE A;  4NBD D;  5KLV E;  5KLI C;  3GZY A;  1SQV E;  2E75 D;  1UUV A;  4HKV A;  5KKZ C;  2NVE A;  2ZYL A;  5CXM A;  4HJL A;  2BCC E; 
#chains in the Genus database with same CATH homology
 5HL4 A;  1VCK A;  4QDC A;  1ULJ A;  2NVG A;  3L74 E;  1NTK E;  4HM5 A;  4NBH D;  1FQT A;  4AAY B;  4NB9 D;  4NB8 D;  3L72 E;  3C0D A;  3H1I E;  5BOK A;  1KB9 E;  3H1K E;  1NDO A;  2ZT9 D;  1SQX E;  3VMI D;  2NUK A;  4QUQ A;  1Q90 C;  3L70 E;  2B24 A;  1JM1 A;  3L73 E;  2YFI A;  3L71 E;  3BCC E;  4OGQ D;  2QJP C;  2FYN C;  2HMJ A;  4HM1 A;  1O7M A;  4QUR A;  4AIV A;  4H13 D;  4P1C H;  4H44 D;  4QDF A;  4HM2 A;  2BMR A;  1KYO E;  1SQB E;  3VCA A;  3CX5 E;  3GTE A;  2E74 D;  3FOU A;  1VM9 A;  2YFL A;  3H1J E;  3N0Q A;  4QDD A;  2E76 D;  2B1X A;  1RFS A;  3VMG D;  2I7F A;  2XSH A;  5AEU A;  1RIE A;  2JZA A;  2E4P A;  2BMO A;  2QPZ A;  2E4Q A;  1ULI A;  2IBZ E;  2NVF A;  3CWB E;  2A06 E;  2HMM A;  4PV1 D;  3GB4 A;  4QUP A;  1NTZ E;  1O7W A;  1NYK A;  4HM0 A;  2HMN A;  1SQP E;  2FYU E;  4NBF D;  4NBA D;  2D2C D;  2DE6 D;  3DQY A;  3EQQ A;  3GL0 A;  3L75 E;  2YIU C;  3GCE A;  1PP9 E;  1NU1 E;  2NUM A;  1L0N E;  2HMK A;  2NWF A;  1O7N A;  3TGU E;  2Q3W A;  2GBX A;  2YVJ B;  4HM7 A;  1L0L E;  4P1B H;  3VCP A;  3VMH D;  1O7G A;  1G8K B;  2CKF A;  2XSO A;  3CXH E;  2DE5 D;  2GBW A;  2QJK C;  1NTM E;  3GTS A;  1G8J B;  4HM4 A;  3GOB A;  1ZRT E;  1O7P A;  4HM6 A;  1PPJ E;  4HM8 A;  3GL2 A;  1VF5 D;  4EMJ B;  2XR8 A;  2HMO A;  1EG9 A;  2XRX A;  3H1H E;  1WQL A;  2HML A;  1O7H A;  1SJG A;  1BCC E;  3H1L E;  3GZX A;  1BE3 E;  1UUW A;  4H0L D;  2JO6 A;  4NBB D;  4QCK A;  1EZV E;  1P84 E;  4NBG D;  4PD4 E;  3EN1 A;  3AZC A;  5AEW A;  4QDF B;  2QJY C;  4NBE D;  2DE7 D;  2BMQ A;  2YFJ A;  4U3F E;  4HM3 A;  1SQQ E;  4NBC D;  3D89 A;  3GKE A;  4NBD D;  5KLV E;  5KLI C;  3GZY A;  1SQV E;  2E75 D;  1UUV A;  4HKV A;  5KKZ C;  2NVE A;  2ZYL A;  5CXM A;  4HJL A;  2BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...