5BOKA

Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
ENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALCTPLTQDIKTYPVKIENMRVMLKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2
rcsb
source organism Diaphorobacter sp. ds2
molecule tags Metal binding protein
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5bokA00
1ZRTE 2DE7D 3EQQA 1O7GA 4NBFD 1NTME 2YFIA 5HL4A 3L70E 4HM1A 1O7HA 2GBXA 2HMJA 1Q90C 4AIVA 2BCCE 4H0LD 3H1IE 1O7WA 2D2CD 2FYUE 2E4QA 1BE3E 1NDOA 3VMID 4HM8A 2NVEA 3GCEA 2HMNA 5KLIC 1RIEA 3VMGD 3EN1A 4NB8D 5KLVE 1L0LE 4U3FE 2NWFA 2YVJB 1VCKA 2NVFA 1ULIA 1UUVA 4HKVA 1KB9E 4NBBD 1JM1A 4NBGD 4QDDA 2XR8A 2NVGA 3L71E 5CXMA 2QPZA 1FQTA 3VCPA 2I7FA 1SQVE 4QDCA 3GTEA 1NYKA 5KKZC 2E74D 3FOUA 3GTSA 1PPJE 2QJYC 2BMOA 3H1LE 2ZYLA 1VF5D 2IBZE 2FYNC 1P84E 2DE5D 2BMQA 2JO6A 3CWBE 1VM9A 3L73E 4NBAD 3H1JE 4HM2A 1SQXE 4HM7A 4EMJB 2YIUC 1EG9A 1UUWA 1SJGA 4QCKA 3VCAA 4NBDD 3TGUE 1WQLA 2XSHA 2CKFA 2YFJA 4P1BH 1ULJA 4HM0A 1SQQE 4PD4E 3CX5E 4NBCD 2NUMA 2DE6D 1NTKE 2A06E 1PP9E 3AZCA 3D89A 2E4PA 2NUKA 3H1HE 2GBWA 3GZXA 3GOBA 4HM3A 3L72E 4QUPA 2HMKA 3H1KE 3CXHE 3L74E 2B1XA 2XRXA 4NB9D 4NBED 4QDFB 3GZYA 2Q3WA 2QJPC 3BCCE 4NBHD 5BOKA 3DQYA 4H13D 4QDFA 1O7NA 2E75D 2HMLA 4P1CH 1NTZE 2E76D 2QJKC 4HM5A 4PV1D 2B24A 2HMMA 4QURA 1O7PA 3GKEA 2HMOA 1EZVE 3GL0A 1O7MA 5AEWA 2XSOA 4OGQD 5AEUA 1G8JB 4HM4A 3VMHD 2ZT9D 1G8KB 2BMRA 3GL2A 1BCCE 2YFLA 1SQBE 3GB4A 4H44D 4QUQA 3C0DA 4AAYB 4HM6A 1L0NE 1RFSA 3N0QA 2JZAA 1NU1E 1SQPE 3L75E 4HJLA 1KYOE
chains in the Genus database with same CATH superfamily
1ZRTE 2DE7D 3EQQA 1O7GA 4NBFD 1NTME 2YFIA 5HL4A 3L70E 4HM1A 1O7HA 2GBXA 2HMJA 1Q90C 4AIVA 2BCCE 4H0LD 3H1IE 1O7WA 2D2CD 2FYUE 2E4QA 1BE3E 1NDOA 3VMID 4HM8A 2NVEA 3GCEA 2HMNA 5KLIC 1RIEA 3VMGD 3EN1A 4NB8D 5KLVE 1L0LE 4U3FE 2NWFA 2YVJB 1VCKA 2NVFA 1ULIA 1UUVA 4HKVA 1KB9E 4NBBD 1JM1A 4NBGD 4QDDA 2XR8A 2NVGA 3L71E 5CXMA 2QPZA 1FQTA 3VCPA 2I7FA 1SQVE 4QDCA 3GTEA 1NYKA 5KKZC 2E74D 3FOUA 3GTSA 1PPJE 2QJYC 2BMOA 3H1LE 2ZYLA 1VF5D 2IBZE 2FYNC 1P84E 2DE5D 2BMQA 2JO6A 3CWBE 1VM9A 3L73E 4NBAD 3H1JE 4HM2A 1SQXE 4HM7A 4EMJB 2YIUC 1EG9A 1UUWA 1SJGA 4QCKA 3VCAA 4NBDD 3TGUE 1WQLA 2XSHA 2CKFA 2YFJA 4P1BH 1ULJA 4HM0A 1SQQE 4PD4E 3CX5E 4NBCD 2NUMA 2DE6D 1NTKE 2A06E 1PP9E 3AZCA 3D89A 2E4PA 2NUKA 3H1HE 2GBWA 3GZXA 3GOBA 4HM3A 3L72E 4QUPA 2HMKA 3H1KE 3CXHE 3L74E 2B1XA 2XRXA 4NB9D 4NBED 4QDFB 3GZYA 2Q3WA 2QJPC 3BCCE 4NBHD 5BOKA 3DQYA 4H13D 4QDFA 1O7NA 2E75D 2HMLA 4P1CH 1NTZE 2E76D 2QJKC 4HM5A 4PV1D 2B24A 2HMMA 4QURA 1O7PA 3GKEA 2HMOA 1EZVE 3GL0A 1O7MA 5AEWA 2XSOA 4OGQD 5AEUA 1G8JB 4HM4A 3VMHD 2ZT9D 1G8KB 2BMRA 3GL2A 1BCCE 2YFLA 1SQBE 3GB4A 4H44D 4QUQA 3C0DA 4AAYB 4HM6A 1L0NE 1RFSA 3N0QA 2JZAA 1NU1E 1SQPE 3L75E 4HJLA 1KYOE
chains in the Genus database with same CATH topology
1ZRTE 2DE7D 3EQQA 1O7GA 4NBFD 1NTME 2YFIA 5HL4A 3L70E 4HM1A 1O7HA 2GBXA 2HMJA 1Q90C 4AIVA 2BCCE 4H0LD 3H1IE 1O7WA 2D2CD 2FYUE 2E4QA 1BE3E 1NDOA 3VMID 4HM8A 2NVEA 3GCEA 2HMNA 5KLIC 1RIEA 3VMGD 3EN1A 4NB8D 5KLVE 1L0LE 4U3FE 2NWFA 2YVJB 1VCKA 2NVFA 1ULIA 1UUVA 4HKVA 1KB9E 4NBBD 1JM1A 4NBGD 4QDDA 2XR8A 2NVGA 3L71E 5CXMA 2QPZA 1FQTA 3VCPA 2I7FA 1SQVE 4QDCA 3GTEA 1NYKA 5KKZC 2E74D 3FOUA 3GTSA 1PPJE 2QJYC 2BMOA 3H1LE 2ZYLA 1VF5D 2IBZE 2FYNC 1P84E 2DE5D 2BMQA 2JO6A 3CWBE 1VM9A 3L73E 4NBAD 3H1JE 4HM2A 1SQXE 4HM7A 4EMJB 2YIUC 1EG9A 1UUWA 1SJGA 4QCKA 3VCAA 4NBDD 3TGUE 1WQLA 2XSHA 2CKFA 2YFJA 4P1BH 1ULJA 4HM0A 1SQQE 4PD4E 3CX5E 4NBCD 2NUMA 2DE6D 1NTKE 2A06E 1PP9E 3AZCA 3D89A 2E4PA 2NUKA 3H1HE 2GBWA 3GZXA 3GOBA 4HM3A 3L72E 4QUPA 2HMKA 3H1KE 3CXHE 3L74E 2B1XA 2XRXA 4NB9D 4NBED 4QDFB 3GZYA 2Q3WA 2QJPC 3BCCE 4NBHD 5BOKA 3DQYA 4H13D 4QDFA 1O7NA 2E75D 2HMLA 4P1CH 1NTZE 2E76D 2QJKC 4HM5A 4PV1D 2B24A 2HMMA 4QURA 1O7PA 3GKEA 2HMOA 1EZVE 3GL0A 1O7MA 5AEWA 2XSOA 4OGQD 5AEUA 1G8JB 4HM4A 3VMHD 2ZT9D 1G8KB 2BMRA 3GL2A 1BCCE 2YFLA 1SQBE 3GB4A 4H44D 4QUQA 3C0DA 4AAYB 4HM6A 1L0NE 1RFSA 3N0QA 2JZAA 1NU1E 1SQPE 3L75E 4HJLA 1KYOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  2DE7 D;  3EQQ A;  1O7G A;  4NBF D;  1NTM E;  2YFI A;  5HL4 A;  3L70 E;  4HM1 A;  1O7H A;  2GBX A;  2HMJ A;  1Q90 C;  4AIV A;  2BCC E;  4H0L D;  3H1I E;  1O7W A;  2D2C D;  2FYU E;  2E4Q A;  1BE3 E;  1NDO A;  3VMI D;  4HM8 A;  2NVE A;  3GCE A;  2HMN A;  5KLI C;  1RIE A;  3VMG D;  3EN1 A;  4NB8 D;  5KLV E;  1L0L E;  4U3F E;  2NWF A;  2YVJ B;  1VCK A;  2NVF A;  1ULI A;  1UUV A;  4HKV A;  1KB9 E;  4NBB D;  1JM1 A;  4NBG D;  4QDD A;  2XR8 A;  2NVG A;  3L71 E;  5CXM A;  2QPZ A;  1FQT A;  3VCP A;  2I7F A;  1SQV E;  4QDC A;  3GTE A;  1NYK A;  5KKZ C;  2E74 D;  3FOU A;  3GTS A;  1PPJ E;  2QJY C;  2BMO A;  3H1L E;  2ZYL A;  1VF5 D;  2IBZ E;  2FYN C;  1P84 E;  2DE5 D;  2BMQ A;  2JO6 A;  3CWB E;  1VM9 A;  3L73 E;  4NBA D;  3H1J E;  4HM2 A;  1SQX E;  4HM7 A;  4EMJ B;  2YIU C;  1EG9 A;  1UUW A;  1SJG A;  4QCK A;  3VCA A;  4NBD D;  3TGU E;  1WQL A;  2XSH A;  2CKF A;  2YFJ A;  4P1B H;  1ULJ A;  4HM0 A;  1SQQ E;  4PD4 E;  3CX5 E;  4NBC D;  2NUM A;  2DE6 D;  1NTK E;  2A06 E;  1PP9 E;  3AZC A;  3D89 A;  2E4P A;  2NUK A;  3H1H E;  2GBW A;  3GZX A;  3GOB A;  4HM3 A;  3L72 E;  4QUP A;  2HMK A;  3H1K E;  3CXH E;  3L74 E;  2B1X A;  2XRX A;  4NB9 D;  4NBE D;  4QDF B;  3GZY A;  2Q3W A;  2QJP C;  3BCC E;  4NBH D;  5BOK A;  3DQY A;  4H13 D;  4QDF A;  1O7N A;  2E75 D;  2HML A;  4P1C H;  1NTZ E;  2E76 D;  2QJK C;  4HM5 A;  4PV1 D;  2B24 A;  2HMM A;  4QUR A;  1O7P A;  3GKE A;  2HMO A;  1EZV E;  3GL0 A;  1O7M A;  5AEW A;  2XSO A;  4OGQ D;  5AEU A;  1G8J B;  4HM4 A;  3VMH D;  2ZT9 D;  1G8K B;  2BMR A;  3GL2 A;  1BCC E;  2YFL A;  1SQB E;  3GB4 A;  4H44 D;  4QUQ A;  3C0D A;  4AAY B;  4HM6 A;  1L0N E;  1RFS A;  3N0Q A;  2JZA A;  1NU1 E;  1SQP E;  3L75 E;  4HJL A;  1KYO E; 
#chains in the Genus database with same CATH topology
 1ZRT E;  2DE7 D;  3EQQ A;  1O7G A;  4NBF D;  1NTM E;  2YFI A;  5HL4 A;  3L70 E;  4HM1 A;  1O7H A;  2GBX A;  2HMJ A;  1Q90 C;  4AIV A;  2BCC E;  4H0L D;  3H1I E;  1O7W A;  2D2C D;  2FYU E;  2E4Q A;  1BE3 E;  1NDO A;  3VMI D;  4HM8 A;  2NVE A;  3GCE A;  2HMN A;  5KLI C;  1RIE A;  3VMG D;  3EN1 A;  4NB8 D;  5KLV E;  1L0L E;  4U3F E;  2NWF A;  2YVJ B;  1VCK A;  2NVF A;  1ULI A;  1UUV A;  4HKV A;  1KB9 E;  4NBB D;  1JM1 A;  4NBG D;  4QDD A;  2XR8 A;  2NVG A;  3L71 E;  5CXM A;  2QPZ A;  1FQT A;  3VCP A;  2I7F A;  1SQV E;  4QDC A;  3GTE A;  1NYK A;  5KKZ C;  2E74 D;  3FOU A;  3GTS A;  1PPJ E;  2QJY C;  2BMO A;  3H1L E;  2ZYL A;  1VF5 D;  2IBZ E;  2FYN C;  1P84 E;  2DE5 D;  2BMQ A;  2JO6 A;  3CWB E;  1VM9 A;  3L73 E;  4NBA D;  3H1J E;  4HM2 A;  1SQX E;  4HM7 A;  4EMJ B;  2YIU C;  1EG9 A;  1UUW A;  1SJG A;  4QCK A;  3VCA A;  4NBD D;  3TGU E;  1WQL A;  2XSH A;  2CKF A;  2YFJ A;  4P1B H;  1ULJ A;  4HM0 A;  1SQQ E;  4PD4 E;  3CX5 E;  4NBC D;  2NUM A;  2DE6 D;  1NTK E;  2A06 E;  1PP9 E;  3AZC A;  3D89 A;  2E4P A;  2NUK A;  3H1H E;  2GBW A;  3GZX A;  3GOB A;  4HM3 A;  3L72 E;  4QUP A;  2HMK A;  3H1K E;  3CXH E;  3L74 E;  2B1X A;  2XRX A;  4NB9 D;  4NBE D;  4QDF B;  3GZY A;  2Q3W A;  2QJP C;  3BCC E;  4NBH D;  5BOK A;  3DQY A;  4H13 D;  4QDF A;  1O7N A;  2E75 D;  2HML A;  4P1C H;  1NTZ E;  2E76 D;  2QJK C;  4HM5 A;  4PV1 D;  2B24 A;  2HMM A;  4QUR A;  1O7P A;  3GKE A;  2HMO A;  1EZV E;  3GL0 A;  1O7M A;  5AEW A;  2XSO A;  4OGQ D;  5AEU A;  1G8J B;  4HM4 A;  3VMH D;  2ZT9 D;  1G8K B;  2BMR A;  3GL2 A;  1BCC E;  2YFL A;  1SQB E;  3GB4 A;  4H44 D;  4QUQ A;  3C0D A;  4AAY B;  4HM6 A;  1L0N E;  1RFS A;  3N0Q A;  2JZA A;  1NU1 E;  1SQP E;  3L75 E;  4HJL A;  1KYO E; 
#chains in the Genus database with same CATH homology
 1ZRT E;  2DE7 D;  3EQQ A;  1O7G A;  4NBF D;  1NTM E;  2YFI A;  5HL4 A;  3L70 E;  4HM1 A;  1O7H A;  2GBX A;  2HMJ A;  1Q90 C;  4AIV A;  2BCC E;  4H0L D;  3H1I E;  1O7W A;  2D2C D;  2FYU E;  2E4Q A;  1BE3 E;  1NDO A;  3VMI D;  4HM8 A;  2NVE A;  3GCE A;  2HMN A;  5KLI C;  1RIE A;  3VMG D;  3EN1 A;  4NB8 D;  5KLV E;  1L0L E;  4U3F E;  2NWF A;  2YVJ B;  1VCK A;  2NVF A;  1ULI A;  1UUV A;  4HKV A;  1KB9 E;  4NBB D;  1JM1 A;  4NBG D;  4QDD A;  2XR8 A;  2NVG A;  3L71 E;  5CXM A;  2QPZ A;  1FQT A;  3VCP A;  2I7F A;  1SQV E;  4QDC A;  3GTE A;  1NYK A;  5KKZ C;  2E74 D;  3FOU A;  3GTS A;  1PPJ E;  2QJY C;  2BMO A;  3H1L E;  2ZYL A;  1VF5 D;  2IBZ E;  2FYN C;  1P84 E;  2DE5 D;  2BMQ A;  2JO6 A;  3CWB E;  1VM9 A;  3L73 E;  4NBA D;  3H1J E;  4HM2 A;  1SQX E;  4HM7 A;  4EMJ B;  2YIU C;  1EG9 A;  1UUW A;  1SJG A;  4QCK A;  3VCA A;  4NBD D;  3TGU E;  1WQL A;  2XSH A;  2CKF A;  2YFJ A;  4P1B H;  1ULJ A;  4HM0 A;  1SQQ E;  4PD4 E;  3CX5 E;  4NBC D;  2NUM A;  2DE6 D;  1NTK E;  2A06 E;  1PP9 E;  3AZC A;  3D89 A;  2E4P A;  2NUK A;  3H1H E;  2GBW A;  3GZX A;  3GOB A;  4HM3 A;  3L72 E;  4QUP A;  2HMK A;  3H1K E;  3CXH E;  3L74 E;  2B1X A;  2XRX A;  4NB9 D;  4NBE D;  4QDF B;  3GZY A;  2Q3W A;  2QJP C;  3BCC E;  4NBH D;  5BOK A;  3DQY A;  4H13 D;  4QDF A;  1O7N A;  2E75 D;  2HML A;  4P1C H;  1NTZ E;  2E76 D;  2QJK C;  4HM5 A;  4PV1 D;  2B24 A;  2HMM A;  4QUR A;  1O7P A;  3GKE A;  2HMO A;  1EZV E;  3GL0 A;  1O7M A;  5AEW A;  2XSO A;  4OGQ D;  5AEU A;  1G8J B;  4HM4 A;  3VMH D;  2ZT9 D;  1G8K B;  2BMR A;  3GL2 A;  1BCC E;  2YFL A;  1SQB E;  3GB4 A;  4H44 D;  4QUQ A;  3C0D A;  4AAY B;  4HM6 A;  1L0N E;  1RFS A;  3N0Q A;  2JZA A;  1NU1 E;  1SQP E;  3L75 E;  4HJL A;  1KYO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...