4OGQD

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome b6
total genus 36
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4ogqD02
2HMNA 4HM6A 1PPJE 3GKEA 4HM3A 1RFSA 2NUMA 3GZXA 4HM1A 3FOUA 3CXHE 4NBED 2FYNC 1L0NE 2QJYC 1NDOA 4NBAD 2CKFA 4OGQD 2B24A 4H13C 1VM9A 1WQLA 3CX5E 1UUVA 4QDCA 1SJGA 1NTKE 2HMOA 2YFJA 4HKVA 1VF5C 3AZCA 3EQQA 3H1JE 3CWBE 4NBBD 4I7ZC 3L75E 4H0LC 4QDFB 3VCPA 2QJKC 1EZVE 5KKZC 2DE5D 2YMKA 2XRXA 2IBZE 2BMQA 2NUKA 4NBHD 1SQXE 3L70E 2HMJA 2E76D 1NYKA 4AAYB 3GB4A 1VCKA 1O7PA 2E75D 2JZAA 1P84E 1FQTA 2E75C 2I7FA 3GOBA 4EMJB 2YVJB 3BCCE 2E76C 2QPZA 3L73E 1PP9E 1O7GA 3GZYA 5BOKA 3GL2A 4H44C 2GBXA 2E74D 5HL4A 4H44D 2XSOA 4PD4E 2NVEA 3GTEA 1KYOE 4U3FE 1ULJA 1BCCE 3GL0A 2HMLA 4HM7A 3N0QA 3GCEA 4NBCD 2DE7D 1BE3E 3TGUE 2E74C 1SQVE 4H0LD 3D89A 3L71E 1KB9E 2DE6D 2YFIA 4P1CH 3VMID 1JM1A 3DQYA 4NB9D 1VF5D 2FYUE 4NB8D 2E4PA 4HM5A 4OGQC 3EN1A 4QUQA 5AEWA 5AEUA 5KLIC 2ZYLA 3H1LE 4H13D 1ZRTE 2NWFA 3L74E 1G8JB 2BCCE 1Q90C 4HM8A 3GTSA 1O7HA 5CXMA 2QJPC 1G8KB 1RIEA 3H1KE 4NBDD 1O7MA 1UUWA 2GBWA 1ULIA 2YFLA 2XR8A 1EG9A 4QCKA 4AIVA 4HM0A 4QDFA 1NTZE 2ZT9D 2B1XA 3H1HE 4QUPA 2Q3WA 1L0LE 1NTME 2HMKA 2D2CC 1SQQE 2BMRA 2YIUC 2A06E 2BMOA 3C0DA 4HM2A 2JO6A 4QDDA 1SQBE 2NVGA 3VMHD 4NBGD 3VCAA 1SQPE 3H1IE 3VMGD 1O7NA 2XSHA 4HJLA 4NBFD 2HMMA 4QURA 4PV1D 2ZT9C 2E4QA 4P1BH 4HM4A 1O7WA 4PV1C 2D2CD 1NU1E 5KLVE 3L72E 2NVFA
chains in the Genus database with same CATH superfamily
2WSFH 1DEBA 1SQXD 3V4QA 3L72J 4H44B 3VMXA 1WT6A 2YIUB 1EXJA 1YQ4C 2M5AB 4UB6H 1Q90D 3BRVB 1IK9A 1KYOH 1BDCA 3CX5E 5AVQB 4RKUJ 1KFNA 3I5CA 1QL1A 1NTKK 2QJKC 1OVVA 1ZR4A 2OYHB 2XRXA 3H1LJ 5KLVD 1VCKA 5BU5A 5AVRB 1SFCB 1FQTA 1LTTC 5AW9B 3AEFC 4D6TG 2KK7A 5AVUB 2H88C 3NMDA 1VQLP 5BOKA 1NU1J 1KYOE 3PRJA 1SQXK 1VQ9P 1SQPG 2H7HA 2JEEA 4IFDK 3EWKA 1BGYE 2E5TA 1A02J 3PHLA 4OVNF 1K8AQ 3CCJP 2AEFA 3L72D 4HM8A 2AXTE 1NAYA 1JTHB 3QWOC 5CBNA 2OTLP 4N78D 1KILC 4QMAA 1YHQP 1USDA 1PPJG 4HM2A 1IK7A 3SFDC 3VMZA 4IFMA 4EOTA 4UB8E 4XA4A 4DJGA 1KQLA 1O7WA 1Q2NA 1DEEG 3O8ZA 1GD2E 1X22A 3BCCG 1CZQA 4N78E 2HODA 1VQ6P 1KQSO 4GOEA 5L8RJ 5TISH 2GA1A 2ZVNB 1LTBC 3A0BE 1SQXG 1VM9A 1R5LA 3P8MC 4M3LA 1FS0E 3CCUP 1SFCD 1SQPD 1T8ZA 1PL5A 1URQA 1LTAC 3G3ZA 2XV5A 1VQ8P 2WPSA 2WSEH 1KYOD 1BE3G 1VQ4P 5APTA 3QH9A 2FYUK 1RE3A 3GOBA 2YNYA 1M7LA 5EFWB 2FY8A 1N7LA 1USEA 1SVFA 5TISE 1SQVG 5KLVG 1AQ5A 5CJ0A 3G4SP 3HUSC 2R3SA 4NPDA 5AW3B 5GTHH 3A0HE 1X0TA 2M0BA 4RO0A 3CCEP 4H0LB 1LT9B 1KB9H 1RY3A 5AVWB 1LTSC 2K88A 1KQGB 2JWDA 5CCHA 1K04A 4IOIH 2R3CA 3G9RA 5K5GB 3I56P 2KLVA 1LWUA 3H1HE 1L0NJ 1N8RQ 1LT1A 2ZVOB 3EFFK 1M1KQ 1U7MA 3L71G 3NTNA 3MP7B 3OAKA 1IFPA 2WITA 3A0HH 2YXRB 4IFFA 1VQOP 1JY2N 3V2QA 4RJTA 3RK2D 1ZR2A 3OA7A 4ZKUA 1ZV8A 3L70G 1E79H 3TGUD 5KJ7A 1IFDA 2IZ1A 2B9BA 1HJ0A 3TYYA 3A2AA 1PIXA 1VDFA 4IL6X 3U1CA 2DW3A 2B87B 1P84D 3RK2C 1KB9I 4BWNA 2I7FA 2QJPB 3FWNA 3V2NA 3GTEA 1CW5A 4U3FG 2HFED 2DE7D 2I1KA 1AVOA 2N1TD 2DE6D 2PFXA 1N7SC 1SQVJ 1FE6A 2IBZG 2Z4EA 3GTSA 2P10A 1SQPK 2A06G 1FZBA 2W6BA 4BRYB 3L74D 1T6AA 2KNCB 1OXZA 4HJGH 2W6AA 5AW7B 2A06E 1OZHA 3L71J 2AEJA 1RE4C 4GDOA 4ASVA 3S1KA 3HRNA 3RGUA 1K9MQ 3E1IA 3RK2B 3E1RA 1M1JC 2FYNB 3D6YA 2ZYDA 3WU2E 4W80A 1YJ9P 1KFMA 4GT1A 1NO4A 4JBZA 1L0NE 1N7SD 1NOHA 4YPCA 4PV1B 1L0LG 2XZRA 3MTUE 3B5ND 1S5LH 1Y9BA 2OYOA 1X8YA 2HPCB 4I7ZB 3PJSK 1EZVE 1XTCC 1NKNA 3M91A 3OJAB 3TF5A 1M1JB 3C9IA 1NYKA 1EDIA 1YTZT 3GF7A 2Q5UA 2E75C 4I6MC 2PP6A 2YVJB 3CMEP 1GDTA 5AVXB 2OGUA 5HL4A 1DD3A 4N6JA 1EZVD 3V2RA 3VMID 2KIKA 1SQXJ 2KYVA 3IN6A 3HE4B 4K35A 1VPCA 3CI9A 5CXMA 3JCUE 4O9BA 2P58A 1L4AC 1LP1B 2A45G 2FFDC 4QDFA 4R4MA 3VYIA 3HUSB 1H8AA 1BE3J 4W7YA 4D6TD 2B87A 3C0DA 1N73B 1HGVA 2HG5D 3AE9C 1GW3A 3L75D 1ZRTD 4I1LA 4NBFD 5KLVJ 4ZNCA 3SFEC 1HWTC 1FZGA 2KS1A 1EDJA 3PP5A 3L37A 2RH0A 1JM0A 2H8PD 4DOJA 1RFSA 1VL2A 2O01H 1NTZJ 1NDOA 4OGQD 3Q5PA 1M56D 1S5LX 2K37A 4H13B 3A7OA 3CLQA 1BDDA 2J58A 3L35A 1EZVI 2BASA 2J59M 3CCQP 1X9VA 2RMZA 2KSEA 3NFQA 2NUKA 1IFJA 1FOSF 1KMIZ 1LT9A 4KT0J 3GB4A 1O7PA 2E5YA 1HH0A 5B66E 3Q3DA 2WSCJ 3AE4C 3AE3C 1NTMJ 1DH3A 3H1HD 1YITP 3UIAA 1JOCA 3V2PA 3KYQA 2E4PA 1S9KE 3GF3A 1CSBA 2H43A 2W6JH 1YIJP 1QVGO 1EZVG 3EFGA 3BRTB 2C0WA 3BCCD 3ZDMA 2V7QH 1MFZA 2C9NY 1SQQE 2FXPA 3LIEA 4HKZH 1LWUC 1HUCA 1UIIA 2R5BA 2QSIA 1RF1B 3JCUH 1U7JA 4EI2A 3VMYA 1NU1E 5AVVB 1OW6A 2NRGA 1URQC 2FFDA 2W8ZA 3KQGA 2XU6A 4HM1A 3MUDA 3H1HJ 3U59A 1NTKJ 3CXHI 1EXIA 2B89A 1N86A 2WSSH 2WVRA 1DIPA 2HMOA 3CWBE 1VQPP 2QIWA 3AECC 1AFOA 2HMJA 2FXMA 1W2BO 3F89A 2P67A 1YYCA 3CMAP 3CX5H 4RESB 2FYUG 5KLVK 3LW5H 1JO5A 1HJBA 3H1KD 2XSOA 1NU1G 4LLHA 1HF9A 1SQVK 4U3FE 1GW4A 2HODB 5KAFH 3N4XA 1SQBD 3M0AA 5KJ7D 4EIJA 2FYUE 1SQPJ 5KAIH 3IFMA 3VTPC 4OGQC 3EN1A 5AEWA 1PFIA 2IBZD 1URQD 1L0LK 1FZEA 3L73D 3HE5A 1FU1A 4MN4C 3H1KE 3IAOA 1ZXGA 2Q7CA 2LXCB 1RHZB 2WSEJ 1TU3F 4C46A 5KTBA 1FOSE 2MKVA 4EYYQ 4JPZB 1JUNA 1IFIA 1GU4A 4WVZA 5KAFE 2A06D 3VMHD 3H1IE 3M9BA 1O7NA 2XSHA 3AEEC 4PV1D 4P1BH 2CPSA 3B8EB 2OYHA 1MZ9A 4U3FJ 5AW0B 3USSA 2YKQA 3BCCJ 1VQ5P 2I8DA 1NYHA 1ZOYC 1LNQA 1NH4A 1WRGA 2ZT9B 4GOFA 2XNXA 2ZXXA 3TNUA 1QEXA 2P2UA 1DD4A 4YXWH 2JP3A 4U7JA 3BASA 5APUA 2FXOA 2E75D 4C7RA 4DCKA 1P84E 2K9JA 3ITKA 5AW2B 2OYIC 3WMM0 2GBXA 3A3YB 2R32A 4H44D 1NTKD 1ZP0C 2NVEA 3AEGC 3GL0A 3L4FA 3TGUE 1SQVE 2E74C 3V5BA 2YKOA 3DQYA 3FXEA 4Z1MH 3H1IJ 3D71A 2Q9IA 2Y9ZA 3RK3E 1W5CE 5KLIC 1GU5A 1P84I 1BSNA 1KB9D 5TJHA 3AE2C 3VOPA 1UUWA 1S4XA 2YFLA 3W67A 1NTZE 3IR9A 3JC22 1LT9C 5C39A 1FBMA 2YO2A 3GMAA 2NVGA 1OWAA 1L0NK 4TT3H 1Q7YQ 5M1BA 2NPSB 2C9LY 3P8CD 1RQUA 2HLOA 3L74J 1NU1D 2FYZA 1YJNP 1RH5B 5E79H 1FZAA 4QDCA 2N1TC 2KSJA 4Y28J 3SWYA 2YXQB 1OW7A 1VF5C 1GL2A 1UIXA 2ZFCA 1W2EA 3Q5RA 1P84H 2LXBA 5AVZB 2CPBA 2BEZF 3V6IA 3O6QA 1M90Q 3GL2A 3TK1A 2Y0DA 1YJWP 2GUSA 5GTHE 2D2CB 1HTLC 1T2KC 1BE3D 1ULJA 2LR2A 3H1JJ 2ITAA 3AE5C 1VQ7P 3H1IG 1KB9E 2YFIA 4NB9D 2WPVB 4HM5A 1IFMA 5AEUA 1JMMA 1OVUA 1NTMK 2NWFA 3L74E 1H0TB 1KILD 1J1DB 2H89C 1J2JB 4I2LC 1RIEA 5BVZA 2O01N 1O7MA 4ZMDA 2LKMA 4AIVA 3RBXA 2Q3IA 1NGMB 3HD7C 5B5EE 1L0LE 1J1DC 2YKPA 4QDDA 3KHUA 1OX3A 2IYPA 2QE7H 5CBOA 1NU1K 1M1JA 1GK6A 5H2FE 4JYBA 4JYCA 1CI6B 1L4AA 1J1EC 3ABVC 4HM3A 2OTKE 3B5NA 1VQKP 1AQTA 5B66H 5CCGC 1OIPA 1OMIA 4GKGA 4L73A 3CXHD 1IFNA 5APSA 2Q1KA 2QJKB 1L2PA 5DJTB 3L74G 5KKZC 3AE1C 4YTPC 3L75J 1H89A 2Q6QA 1KTMA 3KDPB 3R2PA 4GODA 4DZOA 4WWIA 3H32A 4OH8B 2L5GB 1JB0J 2KOGA 3HTKB 1OFCX 3AE7C 2MJZA 4BRYA 4W7ZA 1YQ3C 2IZ0A 3CL3D 5AW5B 1KC8Q 1PGOA 3VP8A 2JO1A 1SQQD 4N3YB 1SQQG 1N73C 2L91A 4H13D 1YBKA 3H1HG 2ZAEB 1FDMA 1O7HA 4Y99B 3VMAA 2QM7A 4DT0A 2OYIB 2GBWA 2QVAA 3SWFA 1HVVA 5APQA 1RF0A 4PJ0E 3T97B 1BCCD 5AVSB 1EDLA 3MGNA 4WY4C 4QUPA 1Q82Q 1FDOA 3GHGA 2V4HA 2YIUC 1OW8A 1LTJB 3R4YA 2JO6A 2BCCG 3KXDA 1KQFB 5APYA 2ZT9C 4TLFA 1Q81Q 2D2CD 4LGDE 2SPZA 2WWWA 3CWBD 3FGAD 3H1KJ 2OYHC 3KZIE 2R5DA 2RKLA 2O3JA 3FOUA 1KORA 1AVYA 4AYCA 2HYNA 1NTZG 4KHXA 1KILB 4LC1A 2NPSD 2A45I 1UUVA 2K9JB 1JNMA 3AZCA 4I7ZC 1L4AD 3T97A 3L75G 2BMQA 2CK3H 3M0DA 1IJDB 4KJMA 3AE6C 2PAJA 1Y8AA 1GK4A 4EMJB 3BCCE 2E76C 3CXHH 1FZCA 3KPEA 2KZIA 3L36A 1N2DC 2AEMA 2KB7P 1LTJC 2OYIA 1T2KD 2O1KA 1N7SB 4WY4B 2HMLA 4PD4H 3N0QA 1PP9D 2RN0A 3TSIA 1AA0A 2E74B 3B5NB 4NB8D 2ZYLA 1G8JB 3D6ZA 2QA4P 2QJPC 2J5UA 2XR8A 2K3RA 2BEQD 4QCKA 1VQMP 3VP9A 3LW5J 3CC4P 2M3EA 2OARA 4WBAA 1K05A 3VCAA 4OGQB 4JF7A 1Q86Q 4JQ0D 2FKWB 3M9QA 4IL6H 1NJIQ 3KZIH 2KZJA 3GG2A 1RF0C 4NPEA 1KN7A 3S9OA 1GTWA 2E43A 1URQB 4NBAD 1PGPA 5GTIE 2Y9YA 4B86A 3AEBC 3H1KG 1KD1Q 4ZKPA 2YFJA 1G2CB 3FX0A 4QDFB 3LIDA 3H1ID 3VCPA 2IDBA 4UB6E 4YXDC 2PGDA 3H25A 5AVYB 5CJ4A 4U3FD 3GHGB 5AW1B 2JJLA 2E74D 2VRSA 2YMYA 1L0LJ 1LTGC 3GCEA 5AW6B 1D7MA 3MUDC 1EQ7A 1EDKA 5APWA 1RE3C 1ZRTE 3CWBG 1Q90C 3W68A 1LTIC 1LTJA 1IO4A 2M5AA 1X79B 2N9YB 4WB4A 4ASWA 3S4RA 5E79E 2NZ2A 2AXCA 2BMRA 3TDKA 1XTGB 5KKZB 2A45H 1FJPA 3VMGD 3P7KA 1ZLLA 2QM8A 1Y47A 1LGHB 3L70D 3GLMA 5AVTB 2CKFA 3G71P 2XNDH 3CD6P 4HYTB 1FZCB 3RK3D 4H0LC 2E42A 2YMKA 2WPRA 2NPSC 3L70E 3N7NA 1PGQA 1S9KD 2BCCJ 3HTKA 2QRXA 1CI6A 1L4AB 3M06A 3GZYA 4H44C 4PD4I 5CMZA 1DX7A 3BVHA 5KJ7C 5CCGD 3RL0g 1BCCG 5B5EH 3B71A 1LP1A 1S2EA 3HD7A 3FWLA 1GL2C 3L71E 1U57A 3II6A 2IYOA 2R44A 2W90A 2B88A 5AW8B 2WSFJ 1KYOI 2IBZI 2AXTH 1H88A 2IFMA 5KAIE 1G2CA 2K9YA 4XE5B 5CCGA 2XDJA 2HMKA 3O6QB 1L0LD 2YO3A 3A0BH 3G6EP 4QURA 2N1TB 1IZNB 1BGYD 3TNUB 2ZYAA 1ZW0A 4PV1C 1BSHA 5KLVE 3L72E 1PPJD 2NVFA 1KILE 1T3UA 1PPJE 1WMKA 3E7KA 2NUMA 4NBED 2FYNC 3PTZA 3MIWA 2QJYC 2KI7B 3L73G 3VN0A 3P32A 1QL2A 3MHVA 3C8VA 1SQQJ 1R5SA 1QGKB 2XKMA 3AEDC 1SJGA 1A02F 4AUWA 3L75E 2GM4A 2OQQA 2WZ7A 4NBHD 1SQXE 2W83C 1BGYG 1KZUB 2JDIH 2E76D 4AAYB 3B5NC 2JZAA 4R4LA 1SS1A 3WUTA 3Q5SA 3L73E 3M0DC 1BCCJ 3RL0C 1M8OB 1S1CX 2IX7C 2M3BA 1SLQA 3RL0B 1PGJA 1KILA 5KLIB 3CC2P 1BCCE 4XFJA 4AQRD 1LJ2A 4NBCD 3L72G 1AV1A 2Q3EA 2WT7B 1QVFO 2WPQA 4QUQA 2O01J 3OW2O 5APXA 3EQ2A 2BCCE 1SQQK 3HD7D 2G8YA 3CCSP 1NHLA 5BU8B 1QX8A 2N1TA 1G8KB 3A5TA 4L76A 1ZN5A 2E75B 1OVRA 1L0NG 2ZT9D 1JY3P 5CCHC 3H1LG 2Z5HA 1S3JA 2JWAA 2C0XA 1SQBE 1JY3N 2IFNA 3I55P 1SQPE 3WUUA 1AJYA 1N73A 2E4QA 1RF1A 1SQBJ 3GW6A 2QEXP 1JY3O 3CXHE 3L73J 2KXPB 1NTMG 2M8RA 2QJYB 1NTKE 4C7NA 2DE5D 2GUVA 1BGYJ 1J1EB 2IBZE 3F5HA 2IPPA 3CWBJ 1JTHA 2V7QJ 1MV8A 1MFTA 1JMBA 1S5LE 1KV4A 3CCLP 3SSUA 3V4WA 3IF4A 3M9HA 4K3AA 1O7GA 3CX5D 1Z56A 1SQBK 1LWUB 1NKZB 3SWKA 3B4SA 1JM1A 3FXDA 1IC2A 4Y99C 3H1LE 1S72P 2W27A 3CCRP 2PRRA 1FC2C 1FZCC 1G1IA 2FBWC 4WY4A 1ULIA 1EG9A 1FAVA 2WQYC 4HM0A 1NTKG 1NAFA 5H2FH 1NTME 3K5BA 2D2CC 1M57D 1NTMD 3TGUJ 3MZWB 2BMOA 1PP9J 2UWJE 3U1AA 2JKVA 1E5WA 2KLUA 2WTYA 1FJKA 4WY4D 3GKEA 3D70A 1SQBG 1NWQA 4L74A 3HD7B 4H13C 1WQLA 2JR8A 1SQVD 3H1JD 1EC5A 1RF1C 1HBWA 4HKVA 3H1JE 3EQQA 1JCDA 1L0ND 4NBBD 2FYUJ 2WSCH 2KS1B 2Z5IA 2OTJP 3RBZA 2ZYGA 1GL2B 3P8CE 1PP9E 3HUSA 3CCMP 4PD4E 1MUUA 2POHA 1SFCA 4PD4D 5APVA 4CPGA 2QG4A 4HM7A 4BXLA 1BE3E 3PH0A 2FFDB 5DJUB 1GMJA 3CPWO 4NPFX 3L70J 4PJ0H 2HPCA 3H1JG 2K1AA 1VF5B 3AEAC 3HE5B 2ZXEB 4A7PA 3CCVP 1R8EA 2N9BA 1FZFA 2FYUD 2WT7A 2KP8A 1QLED 1VQNP 2Y0CA 5CCHD 1N7SA 4HJLA 2HMMA 2O1JA 1GZLA 3CC7P 4HM4A 1NTZK 1YI2P 1JY2P 2I1JA 2NPSA 4HH2A 3TGUG 1NVOA 1G1JA 1PP9G 1RQVA 2HMNA 4HM6A 1SP4A 3PLNA 3GZXA 3AE8C 2E76B 2B24A 4L75A 3H32B 1RE4A 5CHXA 2WMMA 1JCCA 3RL0D 4OWFA 1K73Q 1GL2D 3L71D 3NXSA 3WU2H 4HB1A 5GTIH 3RK3C 2QPZA 2P7JA 1PV3A 1JEKA 4D6TJ 1YTZI 3WUVA 1PZQA 4EDFA 3MD0A 1MKMA 1JY2O 4D6TE 3Q1MA 3HE4A 4C7NB 2KUBA 5AW4B 4H0LD 3D89A 4P1CH 3H6PA 3GHGC 1VF5D 2P1JA 1ZMEC 3JSVC 2G3AA 2BCCD 3BATA 4NBDD 3RK3B 3Q2YA 3C1LA 2KNCA 1NTZD 1SFCC 3H1LD 1HGZA 2B1XA 1FDIA 2Q3WA 4IL6E 3CX5I 4NBGD 4GIFA 1H0TA 2Y0EA 2HR3A 2ZJSE 4UB8H 1T3JA
chains in the Genus database with same CATH topology
3ABVC 1PPJE 4HM3A 1WMKA 1RFSA 2NUMA 1VL2A 4H44B 4NBED 2FYNC 1EXJA 2QJYC 1YQ4C 1NDOA 4OGQD 3Q5PA 1Q90D 1S5LX 1OMIA 3C8VA 4H13B 3CX5E 3AEDC 1SJGA 4RKUJ 3L75E 2QJKC 5KKZC 2XRXA 2OQQA 3AE1C 2NUKA 4NBHD 1SQXE 4YTPC 1KMIZ 2E76D 4AAYB 4KT0J 3GB4A 1VCKA 1O7PA 1KTMA 2JZAA 4R4LA 1FQTA 3AEFC 3Q5SA 2H88C 3L73E 1JB0J 5BOKA 3Q3DA 1S1CX 3AE7C 2WSCJ 3AE4C 1KYOE 1YQ3C 3AE3C 1BCCE 4XFJA 4NBCD 2JO1A 3EWKA 2E4PA 4QUQA 3GF3A 2O01J 4H13D 2BCCE 2G8YA 4HM8A 1O7HA 1G8KB 2GBWA 2E75B 3T97B 2ZT9D 4QUPA 1FDOA 2FXPA 2YIUC 1SQQE 1OW8A 3R4YA 4HM2A 2JO6A 1IK7A 1SQBE 3SFDC 1SQPE 1AJYA 2QSIA 1KQFB 2ZT9C 2E4QA 1O7WA 2D2CD 1NU1E 1OW6A 3FGAD 4HM1A 3FOUA 3CXHE 5L8RJ 1KORA 1EXIA 1VM9A 1UUVA 1DIPA 1NTKE 2HMOA 3AZCA 3CWBE 4I7ZC 1PL5A 2DE5D 2QIWA 2IBZE 3AECC 2BMQA 2HMJA 2V7QJ 3AE6C 3GOBA 4EMJB 3BCCE 2E76C 1O7GA 2XSOA 1HF9A 4U3FE 2HMLA 3N0QA 1JM1A 2FYUE 2E74B 4NB8D 4OGQC 3EN1A 5AEWA 2ZYLA 3H1LE 1G8JB 3D6ZA 4H0LB 2QJPC 2J5UA 3H1KE 3IAOA 1KQGB 2FBWC 1ULIA 2XR8A 1K04A 2BEQD 1EG9A 2WQYC 4QCKA 3G9RA 2WSEJ 3LW5J 4HM0A 1TU3F 3H1HE 2MKVA 1NTME 2D2CC 2BMOA 1K05A 3VMHD 3VCAA 4OGQB 3H1IE 1O7NA 2XSHA 3AEEC 4PV1D 4P1BH 3GKEA 3D70A 3S9OA 4NBAD 1NYHA 1ZOYC 4H13C 1WQLA 3AEBC 2ZT9B 2YFJA 4HKVA 3EQQA 3H1JE 4NBBD 4QDFB 1HJ0A 3VCPA 1DD4A 2IDBA 1PIXA 4IL6X 4YXDC 2JP3A 3H25A 4U7JA 2E75D 1P84E 2I7FA 1PP9E 2GBXA 2E74D 4H44D 1ZP0C 4PD4E 2NVEA 3GTEA 3AEGC 3GL0A 4HM7A 3GCEA 3TGUE 2DE7D 1BE3E 2E74C 1SQVE 1GMJA 2DE6D 3DQYA 4Z1MH 3D71A 3RK3E 5KLIC 1ZRTE 1Q90C 3GTSA 2P10A 1VF5B 3AE2C 3AEAC 1UUWA 2YFLA 1R8EA 1NTZE 2NZ2A 2BMRA 2A06E 3GMAA 2NVGA 4GDOA 3VMGD 4HJLA 2HMMA 4HM4A 4TT3H 5M1BA 3D6YA 1RQVA 2HMNA 4HM6A 3GZXA 3AE8C 1RQUA 2E76B 3GLMA 1L0NE 2CKFA 2B24A 4PV1B 4QDCA 4Y28J 1OW7A 1Y9BA 1VF5C 4I7ZB 4H0LC 1UIXA 1EZVE 2YMKA 3L70E 3Q5RA 1NYKA 3GF7A 2BEZF 2E75C 2YVJB 3O6QA 2QPZA 1PV3A 3GZYA 3GL2A 4H44C 5HL4A 3RL0g 1DD3A 1MKMA 3B71A 2D2CB 3Q1MA 1ULJA 3AE5C 4H0LD 3D89A 3L71E 1KB9E 4P1CH 2YFIA 3VMID 1U57A 4NB9D 1VF5D 2WPVB 4HM5A 1ZMEC 5AEUA 2NWFA 3L74E 2G3AA 3IN6A 2WSFJ 2H89C 5CXMA 1RIEA 4NBDD 1O7MA 3Q2YA 4AIVA 4QDFA 2K9YA 4R4MA 1NGMB 2B1XA 1FDIA 2Q3WA 1L0LE 2HMKA 3C0DA 3AE9C 4QDDA 4NBGD 4NBFD 4QURA 3SFEC 4PV1C 5KLVE 3L72E 2NVFA 1KILE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMN A;  4HM6 A;  1PPJ E;  3GKE A;  4HM3 A;  1RFS A;  2NUM A;  3GZX A;  4HM1 A;  3FOU A;  3CXH E;  4NBE D;  2FYN C;  1L0N E;  2QJY C;  1NDO A;  4NBA D;  2CKF A;  4OGQ D;  2B24 A;  4H13 C;  1VM9 A;  1WQL A;  3CX5 E;  1UUV A;  4QDC A;  1SJG A;  1NTK E;  2HMO A;  2YFJ A;  4HKV A;  1VF5 C;  3AZC A;  3EQQ A;  3H1J E;  3CWB E;  4NBB D;  4I7Z C;  3L75 E;  4H0L C;  4QDF B;  3VCP A;  2QJK C;  1EZV E;  5KKZ C;  2DE5 D;  2YMK A;  2XRX A;  2IBZ E;  2BMQ A;  2NUK A;  4NBH D;  1SQX E;  3L70 E;  2HMJ A;  2E76 D;  1NYK A;  4AAY B;  3GB4 A;  1VCK A;  1O7P A;  2E75 D;  2JZA A;  1P84 E;  1FQT A;  2E75 C;  2I7F A;  3GOB A;  4EMJ B;  2YVJ B;  3BCC E;  2E76 C;  2QPZ A;  3L73 E;  1PP9 E;  1O7G A;  3GZY A;  5BOK A;  3GL2 A;  4H44 C;  2GBX A;  2E74 D;  5HL4 A;  4H44 D;  2XSO A;  4PD4 E;  2NVE A;  3GTE A;  1KYO E;  4U3F E;  1ULJ A;  1BCC E;  3GL0 A;  2HML A;  4HM7 A;  3N0Q A;  3GCE A;  4NBC D;  2DE7 D;  1BE3 E;  3TGU E;  2E74 C;  1SQV E;  4H0L D;  3D89 A;  3L71 E;  1KB9 E;  2DE6 D;  2YFI A;  4P1C H;  3VMI D;  1JM1 A;  3DQY A;  4NB9 D;  1VF5 D;  2FYU E;  4NB8 D;  2E4P A;  4HM5 A;  4OGQ C;  3EN1 A;  4QUQ A;  5AEW A;  5AEU A;  5KLI C;  2ZYL A;  3H1L E;  4H13 D;  1ZRT E;  2NWF A;  3L74 E;  1G8J B;  2BCC E;  1Q90 C;  4HM8 A;  3GTS A;  1O7H A;  5CXM A;  2QJP C;  1G8K B;  1RIE A;  3H1K E;  4NBD D;  1O7M A;  1UUW A;  2GBW A;  1ULI A;  2YFL A;  2XR8 A;  1EG9 A;  4QCK A;  4AIV A;  4HM0 A;  4QDF A;  1NTZ E;  2ZT9 D;  2B1X A;  3H1H E;  4QUP A;  2Q3W A;  1L0L E;  1NTM E;  2HMK A;  2D2C C;  1SQQ E;  2BMR A;  2YIU C;  2A06 E;  2BMO A;  3C0D A;  4HM2 A;  2JO6 A;  4QDD A;  1SQB E;  2NVG A;  3VMH D;  4NBG D;  3VCA A;  1SQP E;  3H1I E;  3VMG D;  1O7N A;  2XSH A;  4HJL A;  4NBF D;  2HMM A;  4QUR A;  4PV1 D;  2ZT9 C;  2E4Q A;  4P1B H;  4HM4 A;  1O7W A;  4PV1 C;  2D2C D;  1NU1 E;  5KLV E;  3L72 E;  2NVF A; 
#chains in the Genus database with same CATH topology
 2WSF H;  1DEB A;  1SQX D;  3V4Q A;  3L72 J;  4H44 B;  3VMX A;  1WT6 A;  2YIU B;  1EXJ A;  1YQ4 C;  2M5A B;  4UB6 H;  1Q90 D;  3BRV B;  1IK9 A;  1KYO H;  1BDC A;  3CX5 E;  5AVQ B;  4RKU J;  1KFN A;  3I5C A;  1QL1 A;  1NTK K;  2QJK C;  1OVV A;  1ZR4 A;  2OYH B;  2XRX A;  3H1L J;  5KLV D;  1VCK A;  5BU5 A;  5AVR B;  1SFC B;  1FQT A;  1LTT C;  5AW9 B;  3AEF C;  4D6T G;  2KK7 A;  5AVU B;  2H88 C;  3NMD A;  1VQL P;  5BOK A;  1NU1 J;  1KYO E;  3PRJ A;  1SQX K;  1VQ9 P;  1SQP G;  2H7H A;  2JEE A;  4IFD K;  3EWK A;  1BGY E;  2E5T A;  1A02 J;  3PHL A;  4OVN F;  1K8A Q;  3CCJ P;  2AEF A;  3L72 D;  4HM8 A;  2AXT E;  1NAY A;  1JTH B;  3QWO C;  5CBN A;  2OTL P;  4N78 D;  1KIL C;  4QMA A;  1YHQ P;  1USD A;  1PPJ G;  4HM2 A;  1IK7 A;  3SFD C;  3VMZ A;  4IFM A;  4EOT A;  4UB8 E;  4XA4 A;  4DJG A;  1KQL A;  1O7W A;  1Q2N A;  1DEE G;  3O8Z A;  1GD2 E;  1X22 A;  3BCC G;  1CZQ A;  4N78 E;  2HOD A;  1VQ6 P;  1KQS O;  4GOE A;  5L8R J;  5TIS H;  2GA1 A;  2ZVN B;  1LTB C;  3A0B E;  1SQX G;  1VM9 A;  1R5L A;  3P8M C;  4M3L A;  1FS0 E;  3CCU P;  1SFC D;  1SQP D;  1T8Z A;  1PL5 A;  1URQ A;  1LTA C;  3G3Z A;  2XV5 A;  1VQ8 P;  2WPS A;  2WSE H;  1KYO D;  1BE3 G;  1VQ4 P;  5APT A;  3QH9 A;  2FYU K;  1RE3 A;  3GOB A;  2YNY A;  1M7L A;  5EFW B;  2FY8 A;  1N7L A;  1USE A;  1SVF A;  5TIS E;  1SQV G;  5KLV G;  1AQ5 A;  5CJ0 A;  3G4S P;  3HUS C;  2R3S A;  4NPD A;  5AW3 B;  5GTH H;  3A0H E;  1X0T A;  2M0B A;  4RO0 A;  3CCE P;  4H0L B;  1LT9 B;  1KB9 H;  1RY3 A;  5AVW B;  1LTS C;  2K88 A;  1KQG B;  2JWD A;  5CCH A;  1K04 A;  4IOI H;  2R3C A;  3G9R A;  5K5G B;  3I56 P;  2KLV A;  1LWU A;  3H1H E;  1L0N J;  1N8R Q;  1LT1 A;  2ZVO B;  3EFF K;  1M1K Q;  1U7M A;  3L71 G;  3NTN A;  3MP7 B;  3OAK A;  1IFP A;  2WIT A;  3A0H H;  2YXR B;  4IFF A;  1VQO P;  1JY2 N;  3V2Q A;  4RJT A;  3RK2 D;  1ZR2 A;  3OA7 A;  4ZKU A;  1ZV8 A;  3L70 G;  1E79 H;  3TGU D;  5KJ7 A;  1IFD A;  2IZ1 A;  2B9B A;  1HJ0 A;  3TYY A;  3A2A A;  1PIX A;  1VDF A;  4IL6 X;  3U1C A;  2DW3 A;  2B87 B;  1P84 D;  3RK2 C;  1KB9 I;  4BWN A;  2I7F A;  2QJP B;  3FWN A;  3V2N A;  3GTE A;  1CW5 A;  4U3F G;  2HFE D;  2DE7 D;  2I1K A;  1AVO A;  2N1T D;  2DE6 D;  2PFX A;  1N7S C;  1SQV J;  1FE6 A;  2IBZ G;  2Z4E A;  3GTS A;  2P10 A;  1SQP K;  2A06 G;  1FZB A;  2W6B A;  4BRY B;  3L74 D;  1T6A A;  2KNC B;  1OXZ A;  4HJG H;  2W6A A;  5AW7 B;  2A06 E;  1OZH A;  3L71 J;  2AEJ A;  1RE4 C;  4GDO A;  4ASV A;  3S1K A;  3HRN A;  3RGU A;  1K9M Q;  3E1I A;  3RK2 B;  3E1R A;  1M1J C;  2FYN B;  3D6Y A;  2ZYD A;  3WU2 E;  4W80 A;  1YJ9 P;  1KFM A;  4GT1 A;  1NO4 A;  4JBZ A;  1L0N E;  1N7S D;  1NOH A;  4YPC A;  4PV1 B;  1L0L G;  2XZR A;  3MTU E;  3B5N D;  1S5L H;  1Y9B A;  2OYO A;  1X8Y A;  2HPC B;  4I7Z B;  3PJS K;  1EZV E;  1XTC C;  1NKN A;  3M91 A;  3OJA B;  3TF5 A;  1M1J B;  3C9I A;  1NYK A;  1EDI A;  1YTZ T;  3GF7 A;  2Q5U A;  2E75 C;  4I6M C;  2PP6 A;  2YVJ B;  3CME P;  1GDT A;  5AVX B;  2OGU A;  5HL4 A;  1DD3 A;  4N6J A;  1EZV D;  3V2R A;  3VMI D;  2KIK A;  1SQX J;  2KYV A;  3IN6 A;  3HE4 B;  4K35 A;  1VPC A;  3CI9 A;  5CXM A;  3JCU E;  4O9B A;  2P58 A;  1L4A C;  1LP1 B;  2A45 G;  2FFD C;  4QDF A;  4R4M A;  3VYI A;  3HUS B;  1H8A A;  1BE3 J;  4W7Y A;  4D6T D;  2B87 A;  3C0D A;  1N73 B;  1HGV A;  2HG5 D;  3AE9 C;  1GW3 A;  3L75 D;  1ZRT D;  4I1L A;  4NBF D;  5KLV J;  4ZNC A;  3SFE C;  1HWT C;  1FZG A;  2KS1 A;  1EDJ A;  3PP5 A;  3L37 A;  2RH0 A;  1JM0 A;  2H8P D;  4DOJ A;  1RFS A;  1VL2 A;  2O01 H;  1NTZ J;  1NDO A;  4OGQ D;  3Q5P A;  1M56 D;  1S5L X;  2K37 A;  4H13 B;  3A7O A;  3CLQ A;  1BDD A;  2J58 A;  3L35 A;  1EZV I;  2BAS A;  2J59 M;  3CCQ P;  1X9V A;  2RMZ A;  2KSE A;  3NFQ A;  2NUK A;  1IFJ A;  1FOS F;  1KMI Z;  1LT9 A;  4KT0 J;  3GB4 A;  1O7P A;  2E5Y A;  1HH0 A;  5B66 E;  3Q3D A;  2WSC J;  3AE4 C;  3AE3 C;  1NTM J;  1DH3 A;  3H1H D;  1YIT P;  3UIA A;  1JOC A;  3V2P A;  3KYQ A;  2E4P A;  1S9K E;  3GF3 A;  1CSB A;  2H43 A;  2W6J H;  1YIJ P;  1QVG O;  1EZV G;  3EFG A;  3BRT B;  2C0W A;  3BCC D;  3ZDM A;  2V7Q H;  1MFZ A;  2C9N Y;  1SQQ E;  2FXP A;  3LIE A;  4HKZ H;  1LWU C;  1HUC A;  1UII A;  2R5B A;  2QSI A;  1RF1 B;  3JCU H;  1U7J A;  4EI2 A;  3VMY A;  1NU1 E;  5AVV B;  1OW6 A;  2NRG A;  1URQ C;  2FFD A;  2W8Z A;  3KQG A;  2XU6 A;  4HM1 A;  3MUD A;  3H1H J;  3U59 A;  1NTK J;  3CXH I;  1EXI A;  2B89 A;  1N86 A;  2WSS H;  2WVR A;  1DIP A;  2HMO A;  3CWB E;  1VQP P;  2QIW A;  3AEC C;  1AFO A;  2HMJ A;  2FXM A;  1W2B O;  3F89 A;  2P67 A;  1YYC A;  3CMA P;  3CX5 H;  4RES B;  2FYU G;  5KLV K;  3LW5 H;  1JO5 A;  1HJB A;  3H1K D;  2XSO A;  1NU1 G;  4LLH A;  1HF9 A;  1SQV K;  4U3F E;  1GW4 A;  2HOD B;  5KAF H;  3N4X A;  1SQB D;  3M0A A;  5KJ7 D;  4EIJ A;  2FYU E;  1SQP J;  5KAI H;  3IFM A;  3VTP C;  4OGQ C;  3EN1 A;  5AEW A;  1PFI A;  2IBZ D;  1URQ D;  1L0L K;  1FZE A;  3L73 D;  3HE5 A;  1FU1 A;  4MN4 C;  3H1K E;  3IAO A;  1ZXG A;  2Q7C A;  2LXC B;  1RHZ B;  2WSE J;  1TU3 F;  4C46 A;  5KTB A;  1FOS E;  2MKV A;  4EYY Q;  4JPZ B;  1JUN A;  1IFI A;  1GU4 A;  4WVZ A;  5KAF E;  2A06 D;  3VMH D;  3H1I E;  3M9B A;  1O7N A;  2XSH A;  3AEE C;  4PV1 D;  4P1B H;  2CPS A;  3B8E B;  2OYH A;  1MZ9 A;  4U3F J;  5AW0 B;  3USS A;  2YKQ A;  3BCC J;  1VQ5 P;  2I8D A;  1NYH A;  1ZOY C;  1LNQ A;  1NH4 A;  1WRG A;  2ZT9 B;  4GOF A;  2XNX A;  2ZXX A;  3TNU A;  1QEX A;  2P2U A;  1DD4 A;  4YXW H;  2JP3 A;  4U7J A;  3BAS A;  5APU A;  2FXO A;  2E75 D;  4C7R A;  4DCK A;  1P84 E;  2K9J A;  3ITK A;  5AW2 B;  2OYI C;  3WMM 0;  2GBX A;  3A3Y B;  2R32 A;  4H44 D;  1NTK D;  1ZP0 C;  2NVE A;  3AEG C;  3GL0 A;  3L4F A;  3TGU E;  1SQV E;  2E74 C;  3V5B A;  2YKO A;  3DQY A;  3FXE A;  4Z1M H;  3H1I J;  3D71 A;  2Q9I A;  2Y9Z A;  3RK3 E;  1W5C E;  5KLI C;  1GU5 A;  1P84 I;  1BSN A;  1KB9 D;  5TJH A;  3AE2 C;  3VOP A;  1UUW A;  1S4X A;  2YFL A;  3W67 A;  1NTZ E;  3IR9 A;  3JC2 2;  1LT9 C;  5C39 A;  1FBM A;  2YO2 A;  3GMA A;  2NVG A;  1OWA A;  1L0N K;  4TT3 H;  1Q7Y Q;  5M1B A;  2NPS B;  2C9L Y;  3P8C D;  1RQU A;  2HLO A;  3L74 J;  1NU1 D;  2FYZ A;  1YJN P;  1RH5 B;  5E79 H;  1FZA A;  4QDC A;  2N1T C;  2KSJ A;  4Y28 J;  3SWY A;  2YXQ B;  1OW7 A;  1VF5 C;  1GL2 A;  1UIX A;  2ZFC A;  1W2E A;  3Q5R A;  1P84 H;  2LXB A;  5AVZ B;  2CPB A;  2BEZ F;  3V6I A;  3O6Q A;  1M90 Q;  3GL2 A;  3TK1 A;  2Y0D A;  1YJW P;  2GUS A;  5GTH E;  2D2C B;  1HTL C;  1T2K C;  1BE3 D;  1ULJ A;  2LR2 A;  3H1J J;  2ITA A;  3AE5 C;  1VQ7 P;  3H1I G;  1KB9 E;  2YFI A;  4NB9 D;  2WPV B;  4HM5 A;  1IFM A;  5AEU A;  1JMM A;  1OVU A;  1NTM K;  2NWF A;  3L74 E;  1H0T B;  1KIL D;  1J1D B;  2H89 C;  1J2J B;  4I2L C;  1RIE A;  5BVZ A;  2O01 N;  1O7M A;  4ZMD A;  2LKM A;  4AIV A;  3RBX A;  2Q3I A;  1NGM B;  3HD7 C;  5B5E E;  1L0L E;  1J1D C;  2YKP A;  4QDD A;  3KHU A;  1OX3 A;  2IYP A;  2QE7 H;  5CBO A;  1NU1 K;  1M1J A;  1GK6 A;  5H2F E;  4JYB A;  4JYC A;  1CI6 B;  1L4A A;  1J1E C;  3ABV C;  4HM3 A;  2OTK E;  3B5N A;  1VQK P;  1AQT A;  5B66 H;  5CCG C;  1OIP A;  1OMI A;  4GKG A;  4L73 A;  3CXH D;  1IFN A;  5APS A;  2Q1K A;  2QJK B;  1L2P A;  5DJT B;  3L74 G;  5KKZ C;  3AE1 C;  4YTP C;  3L75 J;  1H89 A;  2Q6Q A;  1KTM A;  3KDP B;  3R2P A;  4GOD A;  4DZO A;  4WWI A;  3H32 A;  4OH8 B;  2L5G B;  1JB0 J;  2KOG A;  3HTK B;  1OFC X;  3AE7 C;  2MJZ A;  4BRY A;  4W7Z A;  1YQ3 C;  2IZ0 A;  3CL3 D;  5AW5 B;  1KC8 Q;  1PGO A;  3VP8 A;  2JO1 A;  1SQQ D;  4N3Y B;  1SQQ G;  1N73 C;  2L91 A;  4H13 D;  1YBK A;  3H1H G;  2ZAE B;  1FDM A;  1O7H A;  4Y99 B;  3VMA A;  2QM7 A;  4DT0 A;  2OYI B;  2GBW A;  2QVA A;  3SWF A;  1HVV A;  5APQ A;  1RF0 A;  4PJ0 E;  3T97 B;  1BCC D;  5AVS B;  1EDL A;  3MGN A;  4WY4 C;  4QUP A;  1Q82 Q;  1FDO A;  3GHG A;  2V4H A;  2YIU C;  1OW8 A;  1LTJ B;  3R4Y A;  2JO6 A;  2BCC G;  3KXD A;  1KQF B;  5APY A;  2ZT9 C;  4TLF A;  1Q81 Q;  2D2C D;  4LGD E;  2SPZ A;  2WWW A;  3CWB D;  3FGA D;  3H1K J;  2OYH C;  3KZI E;  2R5D A;  2RKL A;  2O3J A;  3FOU A;  1KOR A;  1AVY A;  4AYC A;  2HYN A;  1NTZ G;  4KHX A;  1KIL B;  4LC1 A;  2NPS D;  2A45 I;  1UUV A;  2K9J B;  1JNM A;  3AZC A;  4I7Z C;  1L4A D;  3T97 A;  3L75 G;  2BMQ A;  2CK3 H;  3M0D A;  1IJD B;  4KJM A;  3AE6 C;  2PAJ A;  1Y8A A;  1GK4 A;  4EMJ B;  3BCC E;  2E76 C;  3CXH H;  1FZC A;  3KPE A;  2KZI A;  3L36 A;  1N2D C;  2AEM A;  2KB7 P;  1LTJ C;  2OYI A;  1T2K D;  2O1K A;  1N7S B;  4WY4 B;  2HML A;  4PD4 H;  3N0Q A;  1PP9 D;  2RN0 A;  3TSI A;  1AA0 A;  2E74 B;  3B5N B;  4NB8 D;  2ZYL A;  1G8J B;  3D6Z A;  2QA4 P;  2QJP C;  2J5U A;  2XR8 A;  2K3R A;  2BEQ D;  4QCK A;  1VQM P;  3VP9 A;  3LW5 J;  3CC4 P;  2M3E A;  2OAR A;  4WBA A;  1K05 A;  3VCA A;  4OGQ B;  4JF7 A;  1Q86 Q;  4JQ0 D;  2FKW B;  3M9Q A;  4IL6 H;  1NJI Q;  3KZI H;  2KZJ A;  3GG2 A;  1RF0 C;  4NPE A;  1KN7 A;  3S9O A;  1GTW A;  2E43 A;  1URQ B;  4NBA D;  1PGP A;  5GTI E;  2Y9Y A;  4B86 A;  3AEB C;  3H1K G;  1KD1 Q;  4ZKP A;  2YFJ A;  1G2C B;  3FX0 A;  4QDF B;  3LID A;  3H1I D;  3VCP A;  2IDB A;  4UB6 E;  4YXD C;  2PGD A;  3H25 A;  5AVY B;  5CJ4 A;  4U3F D;  3GHG B;  5AW1 B;  2JJL A;  2E74 D;  2VRS A;  2YMY A;  1L0L J;  1LTG C;  3GCE A;  5AW6 B;  1D7M A;  3MUD C;  1EQ7 A;  1EDK A;  5APW A;  1RE3 C;  1ZRT E;  3CWB G;  1Q90 C;  3W68 A;  1LTI C;  1LTJ A;  1IO4 A;  2M5A A;  1X79 B;  2N9Y B;  4WB4 A;  4ASW A;  3S4R A;  5E79 E;  2NZ2 A;  2AXC A;  2BMR A;  3TDK A;  1XTG B;  5KKZ B;  2A45 H;  1FJP A;  3VMG D;  3P7K A;  1ZLL A;  2QM8 A;  1Y47 A;  1LGH B;  3L70 D;  3GLM A;  5AVT B;  2CKF A;  3G71 P;  2XND H;  3CD6 P;  4HYT B;  1FZC B;  3RK3 D;  4H0L C;  2E42 A;  2YMK A;  2WPR A;  2NPS C;  3L70 E;  3N7N A;  1PGQ A;  1S9K D;  2BCC J;  3HTK A;  2QRX A;  1CI6 A;  1L4A B;  3M06 A;  3GZY A;  4H44 C;  4PD4 I;  5CMZ A;  1DX7 A;  3BVH A;  5KJ7 C;  5CCG D;  3RL0 g;  1BCC G;  5B5E H;  3B71 A;  1LP1 A;  1S2E A;  3HD7 A;  3FWL A;  1GL2 C;  3L71 E;  1U57 A;  3II6 A;  2IYO A;  2R44 A;  2W90 A;  2B88 A;  5AW8 B;  2WSF J;  1KYO I;  2IBZ I;  2AXT H;  1H88 A;  2IFM A;  5KAI E;  1G2C A;  2K9Y A;  4XE5 B;  5CCG A;  2XDJ A;  2HMK A;  3O6Q B;  1L0L D;  2YO3 A;  3A0B H;  3G6E P;  4QUR A;  2N1T B;  1IZN B;  1BGY D;  3TNU B;  2ZYA A;  1ZW0 A;  4PV1 C;  1BSH A;  5KLV E;  3L72 E;  1PPJ D;  2NVF A;  1KIL E;  1T3U A;  1PPJ E;  1WMK A;  3E7K A;  2NUM A;  4NBE D;  2FYN C;  3PTZ A;  3MIW A;  2QJY C;  2KI7 B;  3L73 G;  3VN0 A;  3P32 A;  1QL2 A;  3MHV A;  3C8V A;  1SQQ J;  1R5S A;  1QGK B;  2XKM A;  3AED C;  1SJG A;  1A02 F;  4AUW A;  3L75 E;  2GM4 A;  2OQQ A;  2WZ7 A;  4NBH D;  1SQX E;  2W83 C;  1BGY G;  1KZU B;  2JDI H;  2E76 D;  4AAY B;  3B5N C;  2JZA A;  4R4L A;  1SS1 A;  3WUT A;  3Q5S A;  3L73 E;  3M0D C;  1BCC J;  3RL0 C;  1M8O B;  1S1C X;  2IX7 C;  2M3B A;  1SLQ A;  3RL0 B;  1PGJ A;  1KIL A;  5KLI B;  3CC2 P;  1BCC E;  4XFJ A;  4AQR D;  1LJ2 A;  4NBC D;  3L72 G;  1AV1 A;  2Q3E A;  2WT7 B;  1QVF O;  2WPQ A;  4QUQ A;  2O01 J;  3OW2 O;  5APX A;  3EQ2 A;  2BCC E;  1SQQ K;  3HD7 D;  2G8Y A;  3CCS P;  1NHL A;  5BU8 B;  1QX8 A;  2N1T A;  1G8K B;  3A5T A;  4L76 A;  1ZN5 A;  2E75 B;  1OVR A;  1L0N G;  2ZT9 D;  1JY3 P;  5CCH C;  3H1L G;  2Z5H A;  1S3J A;  2JWA A;  2C0X A;  1SQB E;  1JY3 N;  2IFN A;  3I55 P;  1SQP E;  3WUU A;  1AJY A;  1N73 A;  2E4Q A;  1RF1 A;  1SQB J;  3GW6 A;  2QEX P;  1JY3 O;  3CXH E;  3L73 J;  2KXP B;  1NTM G;  2M8R A;  2QJY B;  1NTK E;  4C7N A;  2DE5 D;  2GUV A;  1BGY J;  1J1E B;  2IBZ E;  3F5H A;  2IPP A;  3CWB J;  1JTH A;  2V7Q J;  1MV8 A;  1MFT A;  1JMB A;  1S5L E;  1KV4 A;  3CCL P;  3SSU A;  3V4W A;  3IF4 A;  3M9H A;  4K3A A;  1O7G A;  3CX5 D;  1Z56 A;  1SQB K;  1LWU B;  1NKZ B;  3SWK A;  3B4S A;  1JM1 A;  3FXD A;  1IC2 A;  4Y99 C;  3H1L E;  1S72 P;  2W27 A;  3CCR P;  2PRR A;  1FC2 C;  1FZC C;  1G1I A;  2FBW C;  4WY4 A;  1ULI A;  1EG9 A;  1FAV A;  2WQY C;  4HM0 A;  1NTK G;  1NAF A;  5H2F H;  1NTM E;  3K5B A;  2D2C C;  1M57 D;  1NTM D;  3TGU J;  3MZW B;  2BMO A;  1PP9 J;  2UWJ E;  3U1A A;  2JKV A;  1E5W A;  2KLU A;  2WTY A;  1FJK A;  4WY4 D;  3GKE A;  3D70 A;  1SQB G;  1NWQ A;  4L74 A;  3HD7 B;  4H13 C;  1WQL A;  2JR8 A;  1SQV D;  3H1J D;  1EC5 A;  1RF1 C;  1HBW A;  4HKV A;  3H1J E;  3EQQ A;  1JCD A;  1L0N D;  4NBB D;  2FYU J;  2WSC H;  2KS1 B;  2Z5I A;  2OTJ P;  3RBZ A;  2ZYG A;  1GL2 B;  3P8C E;  1PP9 E;  3HUS A;  3CCM P;  4PD4 E;  1MUU A;  2POH A;  1SFC A;  4PD4 D;  5APV A;  4CPG A;  2QG4 A;  4HM7 A;  4BXL A;  1BE3 E;  3PH0 A;  2FFD B;  5DJU B;  1GMJ A;  3CPW O;  4NPF X;  3L70 J;  4PJ0 H;  2HPC A;  3H1J G;  2K1A A;  1VF5 B;  3AEA C;  3HE5 B;  2ZXE B;  4A7P A;  3CCV P;  1R8E A;  2N9B A;  1FZF A;  2FYU D;  2WT7 A;  2KP8 A;  1QLE D;  1VQN P;  2Y0C A;  5CCH D;  1N7S A;  4HJL A;  2HMM A;  2O1J A;  1GZL A;  3CC7 P;  4HM4 A;  1NTZ K;  1YI2 P;  1JY2 P;  2I1J A;  2NPS A;  4HH2 A;  3TGU G;  1NVO A;  1G1J A;  1PP9 G;  1RQV A;  2HMN A;  4HM6 A;  1SP4 A;  3PLN A;  3GZX A;  3AE8 C;  2E76 B;  2B24 A;  4L75 A;  3H32 B;  1RE4 A;  5CHX A;  2WMM A;  1JCC A;  3RL0 D;  4OWF A;  1K73 Q;  1GL2 D;  3L71 D;  3NXS A;  3WU2 H;  4HB1 A;  5GTI H;  3RK3 C;  2QPZ A;  2P7J A;  1PV3 A;  1JEK A;  4D6T J;  1YTZ I;  3WUV A;  1PZQ A;  4EDF A;  3MD0 A;  1MKM A;  1JY2 O;  4D6T E;  3Q1M A;  3HE4 A;  4C7N B;  2KUB A;  5AW4 B;  4H0L D;  3D89 A;  4P1C H;  3H6P A;  3GHG C;  1VF5 D;  2P1J A;  1ZME C;  3JSV C;  2G3A A;  2BCC D;  3BAT A;  4NBD D;  3RK3 B;  3Q2Y A;  3C1L A;  2KNC A;  1NTZ D;  1SFC C;  3H1L D;  1HGZ A;  2B1X A;  1FDI A;  2Q3W A;  4IL6 E;  3CX5 I;  4NBG D;  4GIF A;  1H0T A;  2Y0E A;  2HR3 A;  2ZJS E;  4UB8 H;  1T3J A; 
#chains in the Genus database with same CATH homology
 3ABV C;  1PPJ E;  4HM3 A;  1WMK A;  1RFS A;  2NUM A;  1VL2 A;  4H44 B;  4NBE D;  2FYN C;  1EXJ A;  2QJY C;  1YQ4 C;  1NDO A;  4OGQ D;  3Q5P A;  1Q90 D;  1S5L X;  1OMI A;  3C8V A;  4H13 B;  3CX5 E;  3AED C;  1SJG A;  4RKU J;  3L75 E;  2QJK C;  5KKZ C;  2XRX A;  2OQQ A;  3AE1 C;  2NUK A;  4NBH D;  1SQX E;  4YTP C;  1KMI Z;  2E76 D;  4AAY B;  4KT0 J;  3GB4 A;  1VCK A;  1O7P A;  1KTM A;  2JZA A;  4R4L A;  1FQT A;  3AEF C;  3Q5S A;  2H88 C;  3L73 E;  1JB0 J;  5BOK A;  3Q3D A;  1S1C X;  3AE7 C;  2WSC J;  3AE4 C;  1KYO E;  1YQ3 C;  3AE3 C;  1BCC E;  4XFJ A;  4NBC D;  2JO1 A;  3EWK A;  2E4P A;  4QUQ A;  3GF3 A;  2O01 J;  4H13 D;  2BCC E;  2G8Y A;  4HM8 A;  1O7H A;  1G8K B;  2GBW A;  2E75 B;  3T97 B;  2ZT9 D;  4QUP A;  1FDO A;  2FXP A;  2YIU C;  1SQQ E;  1OW8 A;  3R4Y A;  4HM2 A;  2JO6 A;  1IK7 A;  1SQB E;  3SFD C;  1SQP E;  1AJY A;  2QSI A;  1KQF B;  2ZT9 C;  2E4Q A;  1O7W A;  2D2C D;  1NU1 E;  1OW6 A;  3FGA D;  4HM1 A;  3FOU A;  3CXH E;  5L8R J;  1KOR A;  1EXI A;  1VM9 A;  1UUV A;  1DIP A;  1NTK E;  2HMO A;  3AZC A;  3CWB E;  4I7Z C;  1PL5 A;  2DE5 D;  2QIW A;  2IBZ E;  3AEC C;  2BMQ A;  2HMJ A;  2V7Q J;  3AE6 C;  3GOB A;  4EMJ B;  3BCC E;  2E76 C;  1O7G A;  2XSO A;  1HF9 A;  4U3F E;  2HML A;  3N0Q A;  1JM1 A;  2FYU E;  2E74 B;  4NB8 D;  4OGQ C;  3EN1 A;  5AEW A;  2ZYL A;  3H1L E;  1G8J B;  3D6Z A;  4H0L B;  2QJP C;  2J5U A;  3H1K E;  3IAO A;  1KQG B;  2FBW C;  1ULI A;  2XR8 A;  1K04 A;  2BEQ D;  1EG9 A;  2WQY C;  4QCK A;  3G9R A;  2WSE J;  3LW5 J;  4HM0 A;  1TU3 F;  3H1H E;  2MKV A;  1NTM E;  2D2C C;  2BMO A;  1K05 A;  3VMH D;  3VCA A;  4OGQ B;  3H1I E;  1O7N A;  2XSH A;  3AEE C;  4PV1 D;  4P1B H;  3GKE A;  3D70 A;  3S9O A;  4NBA D;  1NYH A;  1ZOY C;  4H13 C;  1WQL A;  3AEB C;  2ZT9 B;  2YFJ A;  4HKV A;  3EQQ A;  3H1J E;  4NBB D;  4QDF B;  1HJ0 A;  3VCP A;  1DD4 A;  2IDB A;  1PIX A;  4IL6 X;  4YXD C;  2JP3 A;  3H25 A;  4U7J A;  2E75 D;  1P84 E;  2I7F A;  1PP9 E;  2GBX A;  2E74 D;  4H44 D;  1ZP0 C;  4PD4 E;  2NVE A;  3GTE A;  3AEG C;  3GL0 A;  4HM7 A;  3GCE A;  3TGU E;  2DE7 D;  1BE3 E;  2E74 C;  1SQV E;  1GMJ A;  2DE6 D;  3DQY A;  4Z1M H;  3D71 A;  3RK3 E;  5KLI C;  1ZRT E;  1Q90 C;  3GTS A;  2P10 A;  1VF5 B;  3AE2 C;  3AEA C;  1UUW A;  2YFL A;  1R8E A;  1NTZ E;  2NZ2 A;  2BMR A;  2A06 E;  3GMA A;  2NVG A;  4GDO A;  3VMG D;  4HJL A;  2HMM A;  4HM4 A;  4TT3 H;  5M1B A;  3D6Y A;  1RQV A;  2HMN A;  4HM6 A;  3GZX A;  3AE8 C;  1RQU A;  2E76 B;  3GLM A;  1L0N E;  2CKF A;  2B24 A;  4PV1 B;  4QDC A;  4Y28 J;  1OW7 A;  1Y9B A;  1VF5 C;  4I7Z B;  4H0L C;  1UIX A;  1EZV E;  2YMK A;  3L70 E;  3Q5R A;  1NYK A;  3GF7 A;  2BEZ F;  2E75 C;  2YVJ B;  3O6Q A;  2QPZ A;  1PV3 A;  3GZY A;  3GL2 A;  4H44 C;  5HL4 A;  3RL0 g;  1DD3 A;  1MKM A;  3B71 A;  2D2C B;  3Q1M A;  1ULJ A;  3AE5 C;  4H0L D;  3D89 A;  3L71 E;  1KB9 E;  4P1C H;  2YFI A;  3VMI D;  1U57 A;  4NB9 D;  1VF5 D;  2WPV B;  4HM5 A;  1ZME C;  5AEU A;  2NWF A;  3L74 E;  2G3A A;  3IN6 A;  2WSF J;  2H89 C;  5CXM A;  1RIE A;  4NBD D;  1O7M A;  3Q2Y A;  4AIV A;  4QDF A;  2K9Y A;  4R4M A;  1NGM B;  2B1X A;  1FDI A;  2Q3W A;  1L0L E;  2HMK A;  3C0D A;  3AE9 C;  4QDD A;  4NBG D;  4NBF D;  4QUR A;  3SFE C;  4PV1 C;  5KLV E;  3L72 E;  2NVF A;  1KIL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...