4OGQD

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Cytochrome b6
total genus 36
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4ogqD02
5KLIC 2B1XA 1VM9A 2HMNA 5KLVE 5HL4A 3GL2A 3GZXA 3VMID 3CXHE 4NBFD 4HM1A 4HKVA 2JZAA 1NTME 2Q3WA 4HM7A 1G8KB 2E75C 4QDCA 4QURA 3L71E 3L73E 5BOKA 1P84E 1BE3E 1SQQE 4HM3A 2BMRA 3FOUA 1O7HA 4NBDD 1O7GA 4AAYB 4HM4A 3BCCE 2NUKA 4EMJB 2E76C 4H44C 2NVGA 2FYNC 3EN1A 1ZRTE 2QJPC 3EQQA 3DQYA 3GOBA 4H0LC 2XSOA 4PD4E 1O7NA 2ZT9C 1PPJE 3H1KE 3GCEA 3GKEA 3D89A 4HM0A 1BCCE 3GB4A 4H13D 4H0LD 1NDOA 2E74D 2YIUC 3C0DA 3GZYA 1EG9A 2YFJA 1O7PA 1L0NE 1UUVA 4PV1D 4HM2A 2YFIA 1UUWA 2D2CC 3L75E 1Q90C 4NBED 1SQVE 2QJYC 4HM5A 1G8JB 2GBWA 1FQTA 2HMLA 2HMMA 2YVJB 2D2CD 2E75D 3H1HE 3L72E 4PV1C 1NTKE 1VCKA 1ULIA 4P1CH 2QJKC 2E4QA 5KKZC 1WQLA 1NU1E 4H13C 3CX5E 2NVFA 2DE7D 4NBHD 1VF5C 5CXMA 4NBAD 2XRXA 4U3FE 2A06E 3GL0A 4NB9D 4OGQD 1SQXE 2NVEA 1JM1A 2E74C 2HMKA 4H44D 2E76D 3N0QA 4HM6A 4NBBD 1NTZE 4QUPA 3H1JE 3VCPA 3H1LE 2FYUE 2ZT9D 2BMOA 2DE5D 4HM8A 1KB9E 2XSHA 2B24A 4NB8D 4QCKA 3CWBE 3AZCA 1L0LE 3GTSA 3L74E 1NYKA 4P1BH 4I7ZC 1PP9E 4OGQC 2BCCE 3TGUE 2NUMA 4NBCD 2BMQA 2XR8A 3H1IE 1ULJA 2YFLA 1KYOE 4AIVA 1SJGA 1RFSA 5AEWA 1SQBE 4QUQA 2ZYLA 2JO6A 1EZVE 1O7MA 2IBZE 1VF5D 3GTEA 4NBGD 2HMOA 2YMKA 1RIEA 3VCAA 3VMHD 2QPZA 3L70E 1SQPE 4QDFB 4QDFA 4QDDA 3VMGD 2GBXA 2NWFA 4HJLA 1O7WA 2CKFA 2HMJA 2E4PA 2DE6D 5AEUA 2I7FA
chains in the Genus database with same CATH superfamily
5HL4A 1VQNP 1FDIA 2J59M 3L73J 1RHZB 2ITAA 5CCHD 2OARA 4BXLA 2JR8A 2CPSA 5AW6B 2B87B 2UWJE 4LLHA 2KIKA 1JTHA 2WT7A 3OA7A 3S9OA 3GKEA 1CI6B 3AE6C 4Y99C 3SWFA 1N7SC 1UUVA 5B5EE 3AE9C 3KXDA 2LR2A 1W5CE 2R3CA 3A0HE 1RQUA 1HTLC 5TISE 4P1CH 1MFZA 2QJKC 1OW6A 5APTA 1JEKA 3RK2D 1NU1E 2LXCB 2YXQB 1JY2O 1VPCA 4WY4D 4NBAD 5AVYB 4U3FE 4YTPC 4OGQD 2GM4A 2NVEA 3VP9A 1T3UA 3H1JE 4XA4A 3M9BA 2K9YA 5KAFE 1YJNP 3S1KA 1KN7A 3HTKB 3SWKA 4NB8D 4QCKA 1ZLLA 4H44B 1HBWA 3CMEP 3WMM0 1L0LD 2OTLP 5AEWA 2PAJA 1OW7A 2IBZE 1OXZA 2V4HA 3GTEA 2ZFCA 3L70J 2IFNA 2P10A 3V2QA 5BVZA 1SQPD 4TLFA 2WPRA 1RQVA 1FOSE 1ZV8A 5E79E 5BU5A 2ZYGA 1NTKJ 3CCVP 1LTBC 4PV1B 2L5GB 1M8OB 1AVOA 2ZXEB 1BDDA 3M0DC 1N8RQ 4QURA 3II6A 1SQXJ 1O7GA 2BEZF 3FGAD 3NMDA 4LGDE 3TYYA 1X0TA 1URQC 2QJPB 2E74D 2IDBA 1KQLA 4R4LA 1YTZT 2QM8A 3F89A 3V2NA 3WU2H 5APWA 3CX5E 2W6BA 4OWFA 1VQ4P 3HUSA 1FZAA 3GL0A 1DX7A 2N9YB 1KYOH 4ZMDA 1YTZI 5CJ4A 1S1CX 4NPEA 1PP9D 5APQA 1IJDB 1SFCB 3L74E 4WB4A 2J5UA 1DIPA 3CLQA 4HJGH 1SQBJ 2OQQA 1GMJA 2A45G 2WSEJ 4EOTA 3CXHI 1EXJA 3AE1C 1JMBA 1NKZB 4K35A 2HMOA 1SQPJ 1AQ5A 2QPZA 1LWUB 2C0WA 1SQPK 2GBXA 3MP7B 1M56D 2CKFA 4N3YB 2QJKB 3GL2A 3L75G 2OTJP 4HM1A 1G2CB 1DEEG 4XE5B 1JY3P 1LWUA 3ITKA 1OWAA 1JO5A 3GOBA 1BGYD 4GT1A 1PPJE 3H1HD 3P8CD 5KTBA 4HM0A 2JO1A 3R2PA 2FFDC 1T6AA 1G8JB 5GTHE 4W80A 2E75D 3L71G 1H0TB 1MUUA 2LXBA 3D70A 1L0LJ 3AE4C 3CC4P 4H13C 5E79H 2FYUG 4HH2A 2RMZA 1P84I 1N86A 3FX0A 1SQVD 1OX3A 2FXOA 1H8AA 3CX5H 3L73D 1GZLA 4P1BH 1Y8AA 3GF7A 1M1JC 3PHLA 1HJBA 1IFPA 3H32B 3TNUA 1R5LA 1ULJA 1SJGA 5AVZB 4QUQA 1LP1A 3H1ID 2AXTH 1ZN5A 2XZRA 1S2EA 1FC2C 4YXWH 3HUSC 3BRTB 3H1LJ 1BE3J 2IYOA 5TISH 3VCAA 3WUTA 3CCMP 3MTUE 2KS1A 3RBZA 3W68A 2I7FA 2Z4EA 3CCLP 1JUNA 1JCCA 4EDFA 3M91A 3U1CA 2JZAA 2BCCD 3AE2C 2FXPA 5KLIB 3FXEA 4D6TD 5DJUB 3A0BH 2HR3A 1Q90D 1DD3A 3VTPC 3CCEP 2N1TC 1EQ7A 2O01N 2H88C 2H8PD 4EMJB 2IPPA 5CCGC 2OYHA 3V6IA 1NTKD 5APSA 1W2EA 5K5GB 1SFCC 1EDIA 4L74A 1PPJG 2B88A 1SQQD 1L0NE 1J1EC 1URQB 3MIWA 2QJYC 4HM5A 2GBWA 3L75J 5GTIE 5AW4B 3L72D 1YYCA 3M9HA 1BGYE 2R5DA 2P67A 2Z5HA 1BCCJ 2DE7D 2HG5D 2GUVA 2W6JH 2NRGA 1JM1A 4GKGA 4HM6A 3KHUA 3VCPA 3KYQA 3E7KA 4HM8A 5AW7B 5AW5B 1IFJA 2YKOA 1ZR4A 2NPSD 3HUSB 1SQBE 1VL2A 3Q5RA 2M3BA 1L0NJ 2FFDB 1RIEA 2GA1A 1FU1A 2R3SA 4QDFB 2ZYDA 2Q3IA 3L70G 5KJ7A 3L74G 3M0AA 5KLIC 5AVSB 2HMNA 1BDCA 3V5BA 4D6TJ 3HRNA 5KAIE 3VMAA 2KSJA 2O1JA 3IFMA 2ZXXA 3EN1A 3EQQA 1ZRTE 1KILD 1SQQG 3H1LD 2A06D 2WVRA 3D6YA 3D89A 1S4XA 5KLVG 2QJYB 2R5BA 3AE7C 3I5CA 2D2CC 1KYOI 2QVAA 5AVQB 3TDKA 1ZR2A 3FXDA 4KJMA 1DEBA 1VCKA 2YNYA 2E4QA 4C46A 1JY2N 3MD0A 5M1BA 1FZCA 2NVFA 3V2RA 3GMAA 3RL0g 1EDLA 3L36A 4IFFA 1JCDA 5AW1B 3CWBD 1FZCB 1NOHA 4N78E 1NGMB 1WMKA 4ASVA 1FZFA 3JCUH 1RE3A 2WSCH 3QH9A 1NYHA 2HLOA 4WBAA 1S9KD 3VMHD 1P84H 3ABVC 1KFNA 3A3YB 1LTJC 4RJTA 2M0BA 4U3FJ 2XU6A 2YO2A 1M1JA 1JM0A 1NTME 2RN0A 3T97B 4N6JA 4C7RA 3FOUA 1FE6A 4KT0J 4BRYA 3RK3E 2YXRB 2KXPB 2XSOA 1RH5B 2N1TB 3HD7D 1VQKP 1CI6A 3H1KG 1Q7YQ 1LTJA 1LT1A 2XKMA 1Y9BA 2KI7B 1EZVI 1ZW0A 4PV1D 2SPZA 4IFMA 1LTTC 1BCCD 1USEA 5KLVD 2HYNA 3CXHD 1KILE 2CK3H 4RKUJ 4L73A 2IYPA 3L4FA 3SFDC 5AVTB 2R32A 2HODB 1JY3O 4MN4C 2XV5A 3CCQP 1JMMA 4NB9D 4LC1A 4D6TG 3L71D 1UIXA 1SQQJ 1RF1B 1Q81Q 4H44D 3N0QA 3AEBC 3U59A 1KB9E 3CWBJ 2K1AA 3HD7C 1L0ND 3TGUE 3A5TA 2BMQA 1OVRA 3R4YA 4AIVA 5GTHH 2JO6A 2KSEA 1NJIQ 2W8ZA 3KZIH 3OJAB 2KUBA 4ASWA 3O6QA 1SFCA 2E4PA 2YKPA 1N73C 1VF5B 2B9BA 2HFED 1LTAC 3RBXA 5L8RJ 5EFWB 1PP9G 1EZVG 2WMMA 2Q9IA 1IK9A 1RE3C 2NPSA 3RK2C 1KILA 1HGZA 1PGPA 3MUDC 3H1JG 3GB4A 1NDOA 5KAIH 3C8VA 3BVHA 1L0NK 4UB8H 4JYCA 1T2KD 3CCRP 2KB7P 3WUUA 2ZAEB 3CD6P 2W27A 3H1IG 3IF4A 4PD4D 2C9NY 1LTIC 4PD4I 1J1DB 2Z5IA 5AVUB 1VQ7P 2Q1KA 3LIDA 1NTZE 1L4AB 1X22A 2K88A 3H1LE 4JQ0D 2ZT9D 5KLVK 2DE5D 4H0LB 1KMIZ 1FJPA 1L0LE 2JP3A 2ZVNB 4I7ZC 1ZMEC 1D7MA 2BCCE 2NUMA 1N7SA 1HJ0A 2XR8A 2Q6QA 1A02J 1DD4A 4BWNA 1FZCC 4DCKA 2AEFA 1EZVE 1AVYA 1AJYA 1YITP 1N73B 4U3FD 1FJKA 2DW3A 3BRVB 3UIAA 2K9JA 2I1JA 1H0TA 2Q3EA 3G3ZA 2B1XA 2OYOA 5APVA 1KFMA 2WTYA 4H13B 1R5SA 3KZIE 1LTJB 1SFCD 1G2CA 1E5WA 3L73E 1P84E 2PP6A 2I8DA 4L75A 1VQMP 4HM4A 1L0NG 1OFCX 3HD7B 1IZNB 1FZEA 1M1JB 2WZ7A 4XFJA 1GDTA 4ZKUA 3PRJA 5AW3B 1RE4C 3T97A 1VQPP 2Y9ZA 3H1LG 3L75E 1HVVA 3SWYA 3BCCG 2YMYA 1M7LA 3C1LA 1KD1Q 1L2PA 4N78D 1L4AC 4NBHD 1VF5C 1URQA 2W90A 2HMKA 1FZBA 4NBBD 1XTCC 3VOPA 4I7ZB 2IX7C 4AQRD 1JTHB 4C7NB 3N4XA 2B89A 4HKZH 3AE5C 3GG2A 1YJ9P 1M1KQ 1LTGC 2O1KA 1KYOE 3D6ZA 2ZYLA 1RF1A 2JDIH 4PJ0H 1KQGB 5H2FE 5APUA 3KDPB 1X9VA 4UB8E 3CX5I 1X8YA 3LW5H 1GU5A 2P1JA 2KS1B 1PP9J 1ZOYC 1FOSF 3Q5SA 3IR9A 1VM9A 2QA4P 2OYIA 3W67A 4Y28J 2ZYAA 1J1DC 2M3EA 4NBFD 1NO4A 1NVOA 3TGUD 3PP5A 5BOKA 3L71E 3P32A 4AYCA 2KNCA 1DH3A 3O6QB 1FDOA 5APXA 3BCCE 1AFOA 1PGJA 2KLVA 1YIJP 2E76C 4OVNF 4OGQB 1O7NA 4GODA 3B5NC 3GCEA 1BCCE 2OGUA 1IFNA 3CI9A 4H0LD 1O7PA 4I6MC 2JWAA 4NBED 1OVUA 1ULIA 5APYA 5CJ0A 4M3LA 2O01J 1EXIA 3A2AA 5TJHA 2G8YA 1RY3A 2WSSH 3L71J 1LNQA 4QUPA 1NAYA 1KZUB 5B66E 4IFDK 1HUCA 3CC7P 1KILC 2KLUA 1K8AQ 1RE4A 1K05A 2V7QJ 4YPCA 1PP9E 2WT7B 1BE3G 3FWLA 1BE3D 3H1HG 4AUWA 3H1IE 3AEAC 1NTKK 1VQLP 3E1IA 5CBOA 1L4AA 3H6PA 3H1HJ 1JOCA 1JNMA 1MFTA 1SQPE 2D2CB 1HGVA 2BCCJ 2Y0CA 3A0HH 3TK1A 1S5LE 1NTZD 3TF5A 1S5LX 1VQ6P 3RL0C 1NTMJ 2R44A 4QDCA 1IFMA 2FYNB 3FWNA 2NZ2A 1GW4A 3B5NB 5CHXA 3L72J 2NUKA 3H1JD 1NTMG 2P2UA 1PV3A 2L91A 5B66H 2QM7A 2WWWA 2ZT9C 3P8MC 2KK7A 2FBWC 4EI2A 3MHVA 3Q5PA 1WT6A 2HPCB 2A45H 3KQGA 1UIIA 1OMIA 2HMMA 2E5TA 2G3AA 4JBZA 4GIFA 1QVFO 5KKZC 3HE5A 3WUVA 4WWIA 1T2KC 2WPQA 2A06E 3JSVC 4KHXA 2E76D 5GTIH 3GHGA 1J2JB 2RH0A 2K3RA 2WSCJ 2BMOA 2AEJA 3CWBE 3CCUP 4UB6H 2N1TD 3L73G 3CPWO 1GU4A 3TNUB 1HF9A 1ZP0C 1LTSC 1Y47A 1M90Q 5CBNA 1O7MA 1KORA 5KJ7C 1U57A 3O8ZA 2V7QH 1EDJA 1MKMA 3A0BE 4QDDA 1HH0A 3TGUJ 2IBZG 3B71A 1NU1J 1SLQA 2KYVA 1S72P 1IO4A 3CXHE 3EWKA 3PH0A 1AV1A 1SVFA 4GOFA 4HM3A 2BMRA 1OW8A 1RF1C 1VQOP 2WPSA 3HE4B 4HYTB 1AQTA 3H1JJ 3AE3C 1SQBK 1PL5A 4RO0A 2O3JA 3VMXA 3H32A 2H43A 5H2FH 4EIJA 1SP4A 3RK3B 3U1AA 2YFIA 1NTZJ 4YXDC 4IL6H 2AXCA 2IBZI 2IFMA 5AVXB 1NAFA 1NTZG 1NHLA 2WPVB 2QG4A 4WVZA 3CCJP 5AW8B 1KB9D 4DT0A 3D71A 1AA0A 2C9LY 2W6AA 1KTMA 2POHA 3LIEA 3G6EP 1KC8Q 3RK2B 1KILB 3CWBG 2E43A 2ZT9B 1QL1A 2YO3A 3AEGC 3P8CE 1U7JA 3M06A 3E1RA 1GL2A 1CSBA 3L70E 4TT3H 4I1LA 1CZQA 2WQYC 4I2LC 2O01H 3VN0A 1LT9B 3NFQA 1JY3N 5KKZB 2JJLA 1X79B 3VMID 2A45I 1VQ9P 3CMAP 1YQ4C 1SQQE 1YI2P 3VP8A 3S4RA 3RL0B 3G71P 1NTMD 2B87A 3GLMA 2OTKE 1K73Q 5AW2B 2FYNC 1S5LH 3H25A 4H0LC 3JC22 3RK3C 1SQVK 2YIUC 4L76A 1EG9A 4D6TE 1P84D 4QMAA 4JPZB 1FQTA 2FYZA 3H1HE 3P7KA 4IL6X 3L72E 1PFIA 2PRRA 3AEDC 1WQLA 3MGNA 5AW0B 1SQPG 5CXMA 3CX5D 2QEXP 2E74C 1URQD 3EQ2A 1H89A 1OVVA 3ZDMA 3M0DA 2FYUE 1U7MA 1SQBD 3PTZA 1PIXA 2XSHA 2B24A 3MUDA 2E42A 2K37A 2OYHB 1NU1D 1N7SB 3HD7A 1RFSA 1G1JA 3H1IJ 2BASA 3CXHH 2JEEA 3SFEC 1GTWA 3L35A 3HE4A 3PJSK 3L74D 1USDA 3B4SA 2ZJSE 2K9JB 3GZXA 3CL3D 3BCCD 2Q3WA 4HM7A 3VMYA 1SQQK 2Y0EA 2WSFH 1SQVG 4GOEA 4AAYB 3K5BA 3HTKA 5AW9B 4HB1A 4H44C 2A06G 2N1TA 4B86A 2QSIA 3BASA 2M5AB 5CMZA 3C0DA 3GZYA 1QVGO 1SQXG 1YQ3C 1GK6A 2H7HA 1A02F 4ZKPA 2VRSA 1YBKA 2FFDA 3VYIA 2HMLA 2Q5UA 4PV1C 1VQ5P 1Z56A 2M5AA 1FDMA 1M57D 1KB9H 2FKWB 4JYBA 3H1KJ 5BU8B 2E75B 2OYIB 3IAOA 3V2PA 1NTMK 2JWDA 1NU1G 1E79H 2AXTE 2KNCB 2FY8A 1GL2B 3A7OA 4WY4A 1PGQA 2PGDA 4CPGA 1FBMA 4C7NA 3TGUG 2E76B 2NPSC 4OGQC 5CCGA 1LT9A 1IK7A 3EFGA 2KOGA 2YFLA 2KZJA 4NPFX 1NTZK 3I56P 4NBGD 2JKVA 1OIPA 3CCSP 4QDFA 1Q82Q 5B5EH 1N7LA 3VMGD 4EYYQ 4HJLA 1O7WA 3AEEC 5KLVE 3F5HA 4HKVA 3V4WA 3G4SP 1LT9C 2W83C 2WSFJ 3QWOC 1QLED 1EC5A 4DZOA 5CCHA 4W7YA 4UB6E 3B5ND 3V4QA 4NPDA 3Q3DA 1BGYJ 1PPJD 1L4AD 2OYHC 1NH4A 3G9RA 3OAKA 1QGKB 1ZXGA 1UUWA 1L0LK 2E5YA 1Q90C 1VDFA 1GL2D 2YVJB 2D2CD 2FYUD 2WITA 2PFXA 3BCCJ 3NXSA 2FXMA 2OYIC 4R4MA 1N2DC 1T8ZA 1TU3F 3AEFC 1NU1K 1JY2P 2AEMA 2XNXA 1K9MQ 1GL2C 2HPCA 2IBZD 1QL2A 1MZ9A 3RL0D 2NPSB 1FZGA 5AVRB 2E74B 1SQVJ 3L74J 4BRYB 3USSA 1NTKG 2BCCG 1HWTC 3C9IA 3Q2YA 1SS1A 2IZ0A 1KV4A 3RGUA 1BSNA 4IL6E 1PGOA 1VF5D 2IZ1A 2YMKA 1XTGB 1Q86Q 1FAVA 1IC2A 3SSUA 1GK4A 1NKNA 4RESB 3VMZA 4PD4H 3WU2E 3HE5B 2XNDH 1SQBG 3L72G 1K04A 2E75C 3TSIA 1G8KB 1BE3E 1IFDA 3GF3A 1LJ2A 1Q2NA 3CC2P 3GHGB 1MV8A 2WSEH 3B5NA 1KB9I 2P7JA 4Y99B 4JF7A 5AVVB 2MKVA 2XDJA 1N7SD 2QIWA 1BCCG 1GD2E 1YJWP 2YFJA 2P58A 2RKLA 4HM2A 1RF0C 1SQVE 4WY4B 1BSHA 3H1KD 3L75D 1NTKE 3RK3D 1LGHB 2M8RA 1JB0J 2QRXA 3AE8C 2HODA 4OH8B 5C39A 2Q7CA 1WRGA 1SQXE 5CCGD 1LP1B 1KYOD 2Y9YA 2FYUK 1W2BO 1RF0A 1SQXK 4K3AA 3GW6A 2QE7H 3GTSA 1NYKA 4O9BA 1G1IA 4NBCD 5KLVJ 2GUSA 3Q1MA 2N9BA 2C0XA 1J1EB 1R8EA 5KAFH 3LW5J 3AECC 5AVWB 1NWQA 3B8EB 1EDKA 2BEQD 2NWFA 1KQFB 5AEUA 2DE6D 1H88A 1GW3A 2MJZA 3OW2O 3GHGC 4Z1MH 2KP8A 3N7NA 1O7HA 4IOIH 4NBDD 2FYUJ 4ZNCA 3BATA 1IFIA 2NVGA 2QJPC 3DQYA 4PD4E 1SQXD 3H1KE 4PJ0E 4H13D 3I55P 4W7ZA 4WY4C 1VQ8P 1S9KE 1S3JA 1QEXA 2YKQA 1ZRTD 4DOJA 3KPEA 3EFFK 3NTNA 3M9QA 2H89C 3L70D 2Y0DA 2XRXA 4U7JA 1EZVD 1BGYG 3JCUE 5DJTB 1YHQP 1KQSO 3AZCA 1FS0E 1CW5A 1QX8A 3L37A 1L0LG 2ZVOB 1T3JA 3PLNA 5CCHC 3MZWB 4U3FG 1LWUC 2YIUB 5KJ7D 3IN6A 4GDOA 4A7PA 4DJGA 2LKMA 1N73A 2I1KA 2CPBA 1OZHA 2J58A 2KZIA 2HMJA 1PZQA
chains in the Genus database with same CATH topology
3Q5SA 5KLIC 1VM9A 2HMNA 5HL4A 4Y28J 3GZXA 1FDIA 4NBFD 2Q3WA 4HM7A 5BOKA 3L71E 4AAYB 1FDOA 3BCCE 2E76C 4H44C 3EN1A 3EQQA 1ZRTE 4OGQB 1O7NA 3D6YA 3S9OA 3GCEA 3GKEA 3D89A 2QSIA 3AE6C 1BCCE 4H0LD 3C0DA 3GZYA 1O7PA 1YQ3C 1UUVA 3AE7C 3AE9C 2D2CC 4NBED 2HMLA 1RQUA 4PV1C 1VCKA 1ULIA 4P1CH 2QJKC 1OW6A 2E4QA 5M1BA 1NU1E 2O01J 2NVFA 1EXIA 2E75B 3IAOA 4NBAD 2G8YA 4U3FE 4YTPC 4OGQD 2NVEA 3GMAA 3RL0g 4QUPA 3H1JE 2K9YA 1K05A 2V7QJ 4QCKA 4NB8D 2E76B 4H44B 1PP9E 4OGQC 1NGMB 1IK7A 1WMKA 3H1IE 3AEAC 2YFLA 5AEWA 1OW7A 2IBZE 1NYHA 3GTEA 4NBGD 2P10A 3VMHD 1SQPE 2D2CB 1RQVA 4QDFA 3VMGD 4HJLA 1O7WA 3ABVC 4PV1B 3AEEC 5KLVE 1S5LX 4HKVA 1NTME 4QDCA 2WSFJ 4QURA 3T97B 3FOUA 1O7GA 2BEZF 2NZ2A 3FGAD 4KT0J 3RK3E 2NUKA 1PV3A 2XSOA 3Q3DA 2ZT9C 2FBWC 3Q5PA 2E74D 2IDBA 3G9RA 1Y9BA 4R4LA 4PV1D 1UUWA 1Q90C 1OMIA 2HMMA 2YVJB 2D2CD 2G3AA 1KILE 4RKUJ 4R4MA 5KKZC 1TU3F 3SFDC 3AEFC 3CX5E 2A06E 3GL0A 4NB9D 1UIXA 2E76D 4H44D 3N0QA 2WSCJ 2BMOA 3AEBC 1S1CX 2E74B 1KB9E 3CWBE 3L74E 3Q2YA 3TGUE 2J5UA 1DIPA 2BMQA 1HF9A 1ZP0C 2OQQA 3R4YA 4AIVA 1GMJA 2WSEJ 2JO6A 1O7MA 1KORA 3AE1C 1EXJA 1VF5D 1U57A 2HMOA 2YMKA 2QPZA 1MKMA 3O6QA 4QDDA 2GBXA 2CKFA 2E4PA 3B71A 1VF5B 3GL2A 3CXHE 3EWKA 4HM1A 5L8RJ 1G8KB 1K04A 2E75C 1BE3E 4HM3A 3GF3A 2BMRA 1OW8A 3AE3C 3GOBA 1PL5A 2MKVA 1PPJE 4HM0A 3GB4A 2JO1A 1NDOA 2QIWA 3C8VA 2YFJA 4HM2A 2YFIA 4YXDC 1SQVE 1G8JB 2E75D 1NTKE 3D70A 3AE4C 4H13C 2WPVB 1JB0J 3AE8C 3D71A 1SQXE 1NTZE 1KTMA 3H1LE 2ZT9D 2DE5D 4H0LB 1KMIZ 1L0LE 3GTSA 2JP3A 4P1BH 1NYKA 4I7ZC 1ZMEC 2BCCE 3GF7A 2NUMA 4NBCD 1HJ0A 2ZT9B 2XR8A 3Q1MA 1ULJA 1DD4A 3AEGC 1SJGA 4QUQA 1EZVE 1R8EA 1AJYA 3LW5J 3AECC 3VCAA 3L70E 4TT3H 2BEQD 2NWFA 1KQFB 5AEUA 2DE6D 2WQYC 2I7FA 2B1XA 3VMID 4H13B 2JZAA 3AE2C 1YQ4C 4Z1MH 2FXPA 3L73E 1P84E 1SQQE 1Q90D 1DD3A 1O7HA 4NBDD 2H88C 4HM4A 3GLMA 4EMJB 2NVGA 2FYNC 2QJPC 3DQYA 3H25A 4H0LC 4PD4E 3H1KE 4H13D 2YIUC 4XFJA 1EG9A 1L0NE 3L75E 2QJYC 4HM5A 2GBWA 1FQTA 3H1HE 4IL6X 3L72E 3AEDC 1WQLA 2H89C 2DE7D 4NBHD 1VF5C 5CXMA 2XRXA 4U7JA 1JM1A 2E74C 2HMKA 4HM6A 4NBBD 3VCPA 2FYUE 4I7ZB 4HM8A 1PIXA 2XSHA 2B24A 3AZCA 3AE5C 1KYOE 3D6ZA 1RFSA 1SQBE 2ZYLA 1VL2A 3Q5RA 1KQGB 3IN6A 4GDOA 3SFEC 1RIEA 4QDFB 1ZOYC 2HMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLI C;  2B1X A;  1VM9 A;  2HMN A;  5KLV E;  5HL4 A;  3GL2 A;  3GZX A;  3VMI D;  3CXH E;  4NBF D;  4HM1 A;  4HKV A;  2JZA A;  1NTM E;  2Q3W A;  4HM7 A;  1G8K B;  2E75 C;  4QDC A;  4QUR A;  3L71 E;  3L73 E;  5BOK A;  1P84 E;  1BE3 E;  1SQQ E;  4HM3 A;  2BMR A;  3FOU A;  1O7H A;  4NBD D;  1O7G A;  4AAY B;  4HM4 A;  3BCC E;  2NUK A;  4EMJ B;  2E76 C;  4H44 C;  2NVG A;  2FYN C;  3EN1 A;  1ZRT E;  2QJP C;  3EQQ A;  3DQY A;  3GOB A;  4H0L C;  2XSO A;  4PD4 E;  1O7N A;  2ZT9 C;  1PPJ E;  3H1K E;  3GCE A;  3GKE A;  3D89 A;  4HM0 A;  1BCC E;  3GB4 A;  4H13 D;  4H0L D;  1NDO A;  2E74 D;  2YIU C;  3C0D A;  3GZY A;  1EG9 A;  2YFJ A;  1O7P A;  1L0N E;  1UUV A;  4PV1 D;  4HM2 A;  2YFI A;  1UUW A;  2D2C C;  3L75 E;  1Q90 C;  4NBE D;  1SQV E;  2QJY C;  4HM5 A;  1G8J B;  2GBW A;  1FQT A;  2HML A;  2HMM A;  2YVJ B;  2D2C D;  2E75 D;  3H1H E;  3L72 E;  4PV1 C;  1NTK E;  1VCK A;  1ULI A;  4P1C H;  2QJK C;  2E4Q A;  5KKZ C;  1WQL A;  1NU1 E;  4H13 C;  3CX5 E;  2NVF A;  2DE7 D;  4NBH D;  1VF5 C;  5CXM A;  4NBA D;  2XRX A;  4U3F E;  2A06 E;  3GL0 A;  4NB9 D;  4OGQ D;  1SQX E;  2NVE A;  1JM1 A;  2E74 C;  2HMK A;  4H44 D;  2E76 D;  3N0Q A;  4HM6 A;  4NBB D;  1NTZ E;  4QUP A;  3H1J E;  3VCP A;  3H1L E;  2FYU E;  2ZT9 D;  2BMO A;  2DE5 D;  4HM8 A;  1KB9 E;  2XSH A;  2B24 A;  4NB8 D;  4QCK A;  3CWB E;  3AZC A;  1L0L E;  3GTS A;  3L74 E;  1NYK A;  4P1B H;  4I7Z C;  1PP9 E;  4OGQ C;  2BCC E;  3TGU E;  2NUM A;  4NBC D;  2BMQ A;  2XR8 A;  3H1I E;  1ULJ A;  2YFL A;  1KYO E;  4AIV A;  1SJG A;  1RFS A;  5AEW A;  1SQB E;  4QUQ A;  2ZYL A;  2JO6 A;  1EZV E;  1O7M A;  2IBZ E;  1VF5 D;  3GTE A;  4NBG D;  2HMO A;  2YMK A;  1RIE A;  3VCA A;  3VMH D;  2QPZ A;  3L70 E;  1SQP E;  4QDF B;  4QDF A;  4QDD A;  3VMG D;  2GBX A;  2NWF A;  4HJL A;  1O7W A;  2CKF A;  2HMJ A;  2E4P A;  2DE6 D;  5AEU A;  2I7F A; 
#chains in the Genus database with same CATH topology
 5HL4 A;  1VQN P;  1FDI A;  2J59 M;  3L73 J;  1RHZ B;  2ITA A;  5CCH D;  2OAR A;  4BXL A;  2JR8 A;  2CPS A;  5AW6 B;  2B87 B;  2UWJ E;  4LLH A;  2KIK A;  1JTH A;  2WT7 A;  3OA7 A;  3S9O A;  3GKE A;  1CI6 B;  3AE6 C;  4Y99 C;  3SWF A;  1N7S C;  1UUV A;  5B5E E;  3AE9 C;  3KXD A;  2LR2 A;  1W5C E;  2R3C A;  3A0H E;  1RQU A;  1HTL C;  5TIS E;  4P1C H;  1MFZ A;  2QJK C;  1OW6 A;  5APT A;  1JEK A;  3RK2 D;  1NU1 E;  2LXC B;  2YXQ B;  1JY2 O;  1VPC A;  4WY4 D;  4NBA D;  5AVY B;  4U3F E;  4YTP C;  4OGQ D;  2GM4 A;  2NVE A;  3VP9 A;  1T3U A;  3H1J E;  4XA4 A;  3M9B A;  2K9Y A;  5KAF E;  1YJN P;  3S1K A;  1KN7 A;  3HTK B;  3SWK A;  4NB8 D;  4QCK A;  1ZLL A;  4H44 B;  1HBW A;  3CME P;  3WMM 0;  1L0L D;  2OTL P;  5AEW A;  2PAJ A;  1OW7 A;  2IBZ E;  1OXZ A;  2V4H A;  3GTE A;  2ZFC A;  3L70 J;  2IFN A;  2P10 A;  3V2Q A;  5BVZ A;  1SQP D;  4TLF A;  2WPR A;  1RQV A;  1FOS E;  1ZV8 A;  5E79 E;  5BU5 A;  2ZYG A;  1NTK J;  3CCV P;  1LTB C;  4PV1 B;  2L5G B;  1M8O B;  1AVO A;  2ZXE B;  1BDD A;  3M0D C;  1N8R Q;  4QUR A;  3II6 A;  1SQX J;  1O7G A;  2BEZ F;  3FGA D;  3NMD A;  4LGD E;  3TYY A;  1X0T A;  1URQ C;  2QJP B;  2E74 D;  2IDB A;  1KQL A;  4R4L A;  1YTZ T;  2QM8 A;  3F89 A;  3V2N A;  3WU2 H;  5APW A;  3CX5 E;  2W6B A;  4OWF A;  1VQ4 P;  3HUS A;  1FZA A;  3GL0 A;  1DX7 A;  2N9Y B;  1KYO H;  4ZMD A;  1YTZ I;  5CJ4 A;  1S1C X;  4NPE A;  1PP9 D;  5APQ A;  1IJD B;  1SFC B;  3L74 E;  4WB4 A;  2J5U A;  1DIP A;  3CLQ A;  4HJG H;  1SQB J;  2OQQ A;  1GMJ A;  2A45 G;  2WSE J;  4EOT A;  3CXH I;  1EXJ A;  3AE1 C;  1JMB A;  1NKZ B;  4K35 A;  2HMO A;  1SQP J;  1AQ5 A;  2QPZ A;  1LWU B;  2C0W A;  1SQP K;  2GBX A;  3MP7 B;  1M56 D;  2CKF A;  4N3Y B;  2QJK B;  3GL2 A;  3L75 G;  2OTJ P;  4HM1 A;  1G2C B;  1DEE G;  4XE5 B;  1JY3 P;  1LWU A;  3ITK A;  1OWA A;  1JO5 A;  3GOB A;  1BGY D;  4GT1 A;  1PPJ E;  3H1H D;  3P8C D;  5KTB A;  4HM0 A;  2JO1 A;  3R2P A;  2FFD C;  1T6A A;  1G8J B;  5GTH E;  4W80 A;  2E75 D;  3L71 G;  1H0T B;  1MUU A;  2LXB A;  3D70 A;  1L0L J;  3AE4 C;  3CC4 P;  4H13 C;  5E79 H;  2FYU G;  4HH2 A;  2RMZ A;  1P84 I;  1N86 A;  3FX0 A;  1SQV D;  1OX3 A;  2FXO A;  1H8A A;  3CX5 H;  3L73 D;  1GZL A;  4P1B H;  1Y8A A;  3GF7 A;  1M1J C;  3PHL A;  1HJB A;  1IFP A;  3H32 B;  3TNU A;  1R5L A;  1ULJ A;  1SJG A;  5AVZ B;  4QUQ A;  1LP1 A;  3H1I D;  2AXT H;  1ZN5 A;  2XZR A;  1S2E A;  1FC2 C;  4YXW H;  3HUS C;  3BRT B;  3H1L J;  1BE3 J;  2IYO A;  5TIS H;  3VCA A;  3WUT A;  3CCM P;  3MTU E;  2KS1 A;  3RBZ A;  3W68 A;  2I7F A;  2Z4E A;  3CCL P;  1JUN A;  1JCC A;  4EDF A;  3M91 A;  3U1C A;  2JZA A;  2BCC D;  3AE2 C;  2FXP A;  5KLI B;  3FXE A;  4D6T D;  5DJU B;  3A0B H;  2HR3 A;  1Q90 D;  1DD3 A;  3VTP C;  3CCE P;  2N1T C;  1EQ7 A;  2O01 N;  2H88 C;  2H8P D;  4EMJ B;  2IPP A;  5CCG C;  2OYH A;  3V6I A;  1NTK D;  5APS A;  1W2E A;  5K5G B;  1SFC C;  1EDI A;  4L74 A;  1PPJ G;  2B88 A;  1SQQ D;  1L0N E;  1J1E C;  1URQ B;  3MIW A;  2QJY C;  4HM5 A;  2GBW A;  3L75 J;  5GTI E;  5AW4 B;  3L72 D;  1YYC A;  3M9H A;  1BGY E;  2R5D A;  2P67 A;  2Z5H A;  1BCC J;  2DE7 D;  2HG5 D;  2GUV A;  2W6J H;  2NRG A;  1JM1 A;  4GKG A;  4HM6 A;  3KHU A;  3VCP A;  3KYQ A;  3E7K A;  4HM8 A;  5AW7 B;  5AW5 B;  1IFJ A;  2YKO A;  1ZR4 A;  2NPS D;  3HUS B;  1SQB E;  1VL2 A;  3Q5R A;  2M3B A;  1L0N J;  2FFD B;  1RIE A;  2GA1 A;  1FU1 A;  2R3S A;  4QDF B;  2ZYD A;  2Q3I A;  3L70 G;  5KJ7 A;  3L74 G;  3M0A A;  5KLI C;  5AVS B;  2HMN A;  1BDC A;  3V5B A;  4D6T J;  3HRN A;  5KAI E;  3VMA A;  2KSJ A;  2O1J A;  3IFM A;  2ZXX A;  3EN1 A;  3EQQ A;  1ZRT E;  1KIL D;  1SQQ G;  3H1L D;  2A06 D;  2WVR A;  3D6Y A;  3D89 A;  1S4X A;  5KLV G;  2QJY B;  2R5B A;  3AE7 C;  3I5C A;  2D2C C;  1KYO I;  2QVA A;  5AVQ B;  3TDK A;  1ZR2 A;  3FXD A;  4KJM A;  1DEB A;  1VCK A;  2YNY A;  2E4Q A;  4C46 A;  1JY2 N;  3MD0 A;  5M1B A;  1FZC A;  2NVF A;  3V2R A;  3GMA A;  3RL0 g;  1EDL A;  3L36 A;  4IFF A;  1JCD A;  5AW1 B;  3CWB D;  1FZC B;  1NOH A;  4N78 E;  1NGM B;  1WMK A;  4ASV A;  1FZF A;  3JCU H;  1RE3 A;  2WSC H;  3QH9 A;  1NYH A;  2HLO A;  4WBA A;  1S9K D;  3VMH D;  1P84 H;  3ABV C;  1KFN A;  3A3Y B;  1LTJ C;  4RJT A;  2M0B A;  4U3F J;  2XU6 A;  2YO2 A;  1M1J A;  1JM0 A;  1NTM E;  2RN0 A;  3T97 B;  4N6J A;  4C7R A;  3FOU A;  1FE6 A;  4KT0 J;  4BRY A;  3RK3 E;  2YXR B;  2KXP B;  2XSO A;  1RH5 B;  2N1T B;  3HD7 D;  1VQK P;  1CI6 A;  3H1K G;  1Q7Y Q;  1LTJ A;  1LT1 A;  2XKM A;  1Y9B A;  2KI7 B;  1EZV I;  1ZW0 A;  4PV1 D;  2SPZ A;  4IFM A;  1LTT C;  1BCC D;  1USE A;  5KLV D;  2HYN A;  3CXH D;  1KIL E;  2CK3 H;  4RKU J;  4L73 A;  2IYP A;  3L4F A;  3SFD C;  5AVT B;  2R32 A;  2HOD B;  1JY3 O;  4MN4 C;  2XV5 A;  3CCQ P;  1JMM A;  4NB9 D;  4LC1 A;  4D6T G;  3L71 D;  1UIX A;  1SQQ J;  1RF1 B;  1Q81 Q;  4H44 D;  3N0Q A;  3AEB C;  3U59 A;  1KB9 E;  3CWB J;  2K1A A;  3HD7 C;  1L0N D;  3TGU E;  3A5T A;  2BMQ A;  1OVR A;  3R4Y A;  4AIV A;  5GTH H;  2JO6 A;  2KSE A;  1NJI Q;  2W8Z A;  3KZI H;  3OJA B;  2KUB A;  4ASW A;  3O6Q A;  1SFC A;  2E4P A;  2YKP A;  1N73 C;  1VF5 B;  2B9B A;  2HFE D;  1LTA C;  3RBX A;  5L8R J;  5EFW B;  1PP9 G;  1EZV G;  2WMM A;  2Q9I A;  1IK9 A;  1RE3 C;  2NPS A;  3RK2 C;  1KIL A;  1HGZ A;  1PGP A;  3MUD C;  3H1J G;  3GB4 A;  1NDO A;  5KAI H;  3C8V A;  3BVH A;  1L0N K;  4UB8 H;  4JYC A;  1T2K D;  3CCR P;  2KB7 P;  3WUU A;  2ZAE B;  3CD6 P;  2W27 A;  3H1I G;  3IF4 A;  4PD4 D;  2C9N Y;  1LTI C;  4PD4 I;  1J1D B;  2Z5I A;  5AVU B;  1VQ7 P;  2Q1K A;  3LID A;  1NTZ E;  1L4A B;  1X22 A;  2K88 A;  3H1L E;  4JQ0 D;  2ZT9 D;  5KLV K;  2DE5 D;  4H0L B;  1KMI Z;  1FJP A;  1L0L E;  2JP3 A;  2ZVN B;  4I7Z C;  1ZME C;  1D7M A;  2BCC E;  2NUM A;  1N7S A;  1HJ0 A;  2XR8 A;  2Q6Q A;  1A02 J;  1DD4 A;  4BWN A;  1FZC C;  4DCK A;  2AEF A;  1EZV E;  1AVY A;  1AJY A;  1YIT P;  1N73 B;  4U3F D;  1FJK A;  2DW3 A;  3BRV B;  3UIA A;  2K9J A;  2I1J A;  1H0T A;  2Q3E A;  3G3Z A;  2B1X A;  2OYO A;  5APV A;  1KFM A;  2WTY A;  4H13 B;  1R5S A;  3KZI E;  1LTJ B;  1SFC D;  1G2C A;  1E5W A;  3L73 E;  1P84 E;  2PP6 A;  2I8D A;  4L75 A;  1VQM P;  4HM4 A;  1L0N G;  1OFC X;  3HD7 B;  1IZN B;  1FZE A;  1M1J B;  2WZ7 A;  4XFJ A;  1GDT A;  4ZKU A;  3PRJ A;  5AW3 B;  1RE4 C;  3T97 A;  1VQP P;  2Y9Z A;  3H1L G;  3L75 E;  1HVV A;  3SWY A;  3BCC G;  2YMY A;  1M7L A;  3C1L A;  1KD1 Q;  1L2P A;  4N78 D;  1L4A C;  4NBH D;  1VF5 C;  1URQ A;  2W90 A;  2HMK A;  1FZB A;  4NBB D;  1XTC C;  3VOP A;  4I7Z B;  2IX7 C;  4AQR D;  1JTH B;  4C7N B;  3N4X A;  2B89 A;  4HKZ H;  3AE5 C;  3GG2 A;  1YJ9 P;  1M1K Q;  1LTG C;  2O1K A;  1KYO E;  3D6Z A;  2ZYL A;  1RF1 A;  2JDI H;  4PJ0 H;  1KQG B;  5H2F E;  5APU A;  3KDP B;  1X9V A;  4UB8 E;  3CX5 I;  1X8Y A;  3LW5 H;  1GU5 A;  2P1J A;  2KS1 B;  1PP9 J;  1ZOY C;  1FOS F;  3Q5S A;  3IR9 A;  1VM9 A;  2QA4 P;  2OYI A;  3W67 A;  4Y28 J;  2ZYA A;  1J1D C;  2M3E A;  4NBF D;  1NO4 A;  1NVO A;  3TGU D;  3PP5 A;  5BOK A;  3L71 E;  3P32 A;  4AYC A;  2KNC A;  1DH3 A;  3O6Q B;  1FDO A;  5APX A;  3BCC E;  1AFO A;  1PGJ A;  2KLV A;  1YIJ P;  2E76 C;  4OVN F;  4OGQ B;  1O7N A;  4GOD A;  3B5N C;  3GCE A;  1BCC E;  2OGU A;  1IFN A;  3CI9 A;  4H0L D;  1O7P A;  4I6M C;  2JWA A;  4NBE D;  1OVU A;  1ULI A;  5APY A;  5CJ0 A;  4M3L A;  2O01 J;  1EXI A;  3A2A A;  5TJH A;  2G8Y A;  1RY3 A;  2WSS H;  3L71 J;  1LNQ A;  4QUP A;  1NAY A;  1KZU B;  5B66 E;  4IFD K;  1HUC A;  3CC7 P;  1KIL C;  2KLU A;  1K8A Q;  1RE4 A;  1K05 A;  2V7Q J;  4YPC A;  1PP9 E;  2WT7 B;  1BE3 G;  3FWL A;  1BE3 D;  3H1H G;  4AUW A;  3H1I E;  3AEA C;  1NTK K;  1VQL P;  3E1I A;  5CBO A;  1L4A A;  3H6P A;  3H1H J;  1JOC A;  1JNM A;  1MFT A;  1SQP E;  2D2C B;  1HGV A;  2BCC J;  2Y0C A;  3A0H H;  3TK1 A;  1S5L E;  1NTZ D;  3TF5 A;  1S5L X;  1VQ6 P;  3RL0 C;  1NTM J;  2R44 A;  4QDC A;  1IFM A;  2FYN B;  3FWN A;  2NZ2 A;  1GW4 A;  3B5N B;  5CHX A;  3L72 J;  2NUK A;  3H1J D;  1NTM G;  2P2U A;  1PV3 A;  2L91 A;  5B66 H;  2QM7 A;  2WWW A;  2ZT9 C;  3P8M C;  2KK7 A;  2FBW C;  4EI2 A;  3MHV A;  3Q5P A;  1WT6 A;  2HPC B;  2A45 H;  3KQG A;  1UII A;  1OMI A;  2HMM A;  2E5T A;  2G3A A;  4JBZ A;  4GIF A;  1QVF O;  5KKZ C;  3HE5 A;  3WUV A;  4WWI A;  1T2K C;  2WPQ A;  2A06 E;  3JSV C;  4KHX A;  2E76 D;  5GTI H;  3GHG A;  1J2J B;  2RH0 A;  2K3R A;  2WSC J;  2BMO A;  2AEJ A;  3CWB E;  3CCU P;  4UB6 H;  2N1T D;  3L73 G;  3CPW O;  1GU4 A;  3TNU B;  1HF9 A;  1ZP0 C;  1LTS C;  1Y47 A;  1M90 Q;  5CBN A;  1O7M A;  1KOR A;  5KJ7 C;  1U57 A;  3O8Z A;  2V7Q H;  1EDJ A;  1MKM A;  3A0B E;  4QDD A;  1HH0 A;  3TGU J;  2IBZ G;  3B71 A;  1NU1 J;  1SLQ A;  2KYV A;  1S72 P;  1IO4 A;  3CXH E;  3EWK A;  3PH0 A;  1AV1 A;  1SVF A;  4GOF A;  4HM3 A;  2BMR A;  1OW8 A;  1RF1 C;  1VQO P;  2WPS A;  3HE4 B;  4HYT B;  1AQT A;  3H1J J;  3AE3 C;  1SQB K;  1PL5 A;  4RO0 A;  2O3J A;  3VMX A;  3H32 A;  2H43 A;  5H2F H;  4EIJ A;  1SP4 A;  3RK3 B;  3U1A A;  2YFI A;  1NTZ J;  4YXD C;  4IL6 H;  2AXC A;  2IBZ I;  2IFM A;  5AVX B;  1NAF A;  1NTZ G;  1NHL A;  2WPV B;  2QG4 A;  4WVZ A;  3CCJ P;  5AW8 B;  1KB9 D;  4DT0 A;  3D71 A;  1AA0 A;  2C9L Y;  2W6A A;  1KTM A;  2POH A;  3LIE A;  3G6E P;  1KC8 Q;  3RK2 B;  1KIL B;  3CWB G;  2E43 A;  2ZT9 B;  1QL1 A;  2YO3 A;  3AEG C;  3P8C E;  1U7J A;  3M06 A;  3E1R A;  1GL2 A;  1CSB A;  3L70 E;  4TT3 H;  4I1L A;  1CZQ A;  2WQY C;  4I2L C;  2O01 H;  3VN0 A;  1LT9 B;  3NFQ A;  1JY3 N;  5KKZ B;  2JJL A;  1X79 B;  3VMI D;  2A45 I;  1VQ9 P;  3CMA P;  1YQ4 C;  1SQQ E;  1YI2 P;  3VP8 A;  3S4R A;  3RL0 B;  3G71 P;  1NTM D;  2B87 A;  3GLM A;  2OTK E;  1K73 Q;  5AW2 B;  2FYN C;  1S5L H;  3H25 A;  4H0L C;  3JC2 2;  3RK3 C;  1SQV K;  2YIU C;  4L76 A;  1EG9 A;  4D6T E;  1P84 D;  4QMA A;  4JPZ B;  1FQT A;  2FYZ A;  3H1H E;  3P7K A;  4IL6 X;  3L72 E;  1PFI A;  2PRR A;  3AED C;  1WQL A;  3MGN A;  5AW0 B;  1SQP G;  5CXM A;  3CX5 D;  2QEX P;  2E74 C;  1URQ D;  3EQ2 A;  1H89 A;  1OVV A;  3ZDM A;  3M0D A;  2FYU E;  1U7M A;  1SQB D;  3PTZ A;  1PIX A;  2XSH A;  2B24 A;  3MUD A;  2E42 A;  2K37 A;  2OYH B;  1NU1 D;  1N7S B;  3HD7 A;  1RFS A;  1G1J A;  3H1I J;  2BAS A;  3CXH H;  2JEE A;  3SFE C;  1GTW A;  3L35 A;  3HE4 A;  3PJS K;  3L74 D;  1USD A;  3B4S A;  2ZJS E;  2K9J B;  3GZX A;  3CL3 D;  3BCC D;  2Q3W A;  4HM7 A;  3VMY A;  1SQQ K;  2Y0E A;  2WSF H;  1SQV G;  4GOE A;  4AAY B;  3K5B A;  3HTK A;  5AW9 B;  4HB1 A;  4H44 C;  2A06 G;  2N1T A;  4B86 A;  2QSI A;  3BAS A;  2M5A B;  5CMZ A;  3C0D A;  3GZY A;  1QVG O;  1SQX G;  1YQ3 C;  1GK6 A;  2H7H A;  1A02 F;  4ZKP A;  2VRS A;  1YBK A;  2FFD A;  3VYI A;  2HML A;  2Q5U A;  4PV1 C;  1VQ5 P;  1Z56 A;  2M5A A;  1FDM A;  1M57 D;  1KB9 H;  2FKW B;  4JYB A;  3H1K J;  5BU8 B;  2E75 B;  2OYI B;  3IAO A;  3V2P A;  1NTM K;  2JWD A;  1NU1 G;  1E79 H;  2AXT E;  2KNC B;  2FY8 A;  1GL2 B;  3A7O A;  4WY4 A;  1PGQ A;  2PGD A;  4CPG A;  1FBM A;  4C7N A;  3TGU G;  2E76 B;  2NPS C;  4OGQ C;  5CCG A;  1LT9 A;  1IK7 A;  3EFG A;  2KOG A;  2YFL A;  2KZJ A;  4NPF X;  1NTZ K;  3I56 P;  4NBG D;  2JKV A;  1OIP A;  3CCS P;  4QDF A;  1Q82 Q;  5B5E H;  1N7L A;  3VMG D;  4EYY Q;  4HJL A;  1O7W A;  3AEE C;  5KLV E;  3F5H A;  4HKV A;  3V4W A;  3G4S P;  1LT9 C;  2W83 C;  2WSF J;  3QWO C;  1QLE D;  1EC5 A;  4DZO A;  5CCH A;  4W7Y A;  4UB6 E;  3B5N D;  3V4Q A;  4NPD A;  3Q3D A;  1BGY J;  1PPJ D;  1L4A D;  2OYH C;  1NH4 A;  3G9R A;  3OAK A;  1QGK B;  1ZXG A;  1UUW A;  1L0L K;  2E5Y A;  1Q90 C;  1VDF A;  1GL2 D;  2YVJ B;  2D2C D;  2FYU D;  2WIT A;  2PFX A;  3BCC J;  3NXS A;  2FXM A;  2OYI C;  4R4M A;  1N2D C;  1T8Z A;  1TU3 F;  3AEF C;  1NU1 K;  1JY2 P;  2AEM A;  2XNX A;  1K9M Q;  1GL2 C;  2HPC A;  2IBZ D;  1QL2 A;  1MZ9 A;  3RL0 D;  2NPS B;  1FZG A;  5AVR B;  2E74 B;  1SQV J;  3L74 J;  4BRY B;  3USS A;  1NTK G;  2BCC G;  1HWT C;  3C9I A;  3Q2Y A;  1SS1 A;  2IZ0 A;  1KV4 A;  3RGU A;  1BSN A;  4IL6 E;  1PGO A;  1VF5 D;  2IZ1 A;  2YMK A;  1XTG B;  1Q86 Q;  1FAV A;  1IC2 A;  3SSU A;  1GK4 A;  1NKN A;  4RES B;  3VMZ A;  4PD4 H;  3WU2 E;  3HE5 B;  2XND H;  1SQB G;  3L72 G;  1K04 A;  2E75 C;  3TSI A;  1G8K B;  1BE3 E;  1IFD A;  3GF3 A;  1LJ2 A;  1Q2N A;  3CC2 P;  3GHG B;  1MV8 A;  2WSE H;  3B5N A;  1KB9 I;  2P7J A;  4Y99 B;  4JF7 A;  5AVV B;  2MKV A;  2XDJ A;  1N7S D;  2QIW A;  1BCC G;  1GD2 E;  1YJW P;  2YFJ A;  2P58 A;  2RKL A;  4HM2 A;  1RF0 C;  1SQV E;  4WY4 B;  1BSH A;  3H1K D;  3L75 D;  1NTK E;  3RK3 D;  1LGH B;  2M8R A;  1JB0 J;  2QRX A;  3AE8 C;  2HOD A;  4OH8 B;  5C39 A;  2Q7C A;  1WRG A;  1SQX E;  5CCG D;  1LP1 B;  1KYO D;  2Y9Y A;  2FYU K;  1W2B O;  1RF0 A;  1SQX K;  4K3A A;  3GW6 A;  2QE7 H;  3GTS A;  1NYK A;  4O9B A;  1G1I A;  4NBC D;  5KLV J;  2GUS A;  3Q1M A;  2N9B A;  2C0X A;  1J1E B;  1R8E A;  5KAF H;  3LW5 J;  3AEC C;  5AVW B;  1NWQ A;  3B8E B;  1EDK A;  2BEQ D;  2NWF A;  1KQF B;  5AEU A;  2DE6 D;  1H88 A;  1GW3 A;  2MJZ A;  3OW2 O;  3GHG C;  4Z1M H;  2KP8 A;  3N7N A;  1O7H A;  4IOI H;  4NBD D;  2FYU J;  4ZNC A;  3BAT A;  1IFI A;  2NVG A;  2QJP C;  3DQY A;  4PD4 E;  1SQX D;  3H1K E;  4PJ0 E;  4H13 D;  3I55 P;  4W7Z A;  4WY4 C;  1VQ8 P;  1S9K E;  1S3J A;  1QEX A;  2YKQ A;  1ZRT D;  4DOJ A;  3KPE A;  3EFF K;  3NTN A;  3M9Q A;  2H89 C;  3L70 D;  2Y0D A;  2XRX A;  4U7J A;  1EZV D;  1BGY G;  3JCU E;  5DJT B;  1YHQ P;  1KQS O;  3AZC A;  1FS0 E;  1CW5 A;  1QX8 A;  3L37 A;  1L0L G;  2ZVO B;  1T3J A;  3PLN A;  5CCH C;  3MZW B;  4U3F G;  1LWU C;  2YIU B;  5KJ7 D;  3IN6 A;  4GDO A;  4A7P A;  4DJG A;  2LKM A;  1N73 A;  2I1K A;  2CPB A;  1OZH A;  2J58 A;  2KZI A;  2HMJ A;  1PZQ A; 
#chains in the Genus database with same CATH homology
 3Q5S A;  5KLI C;  1VM9 A;  2HMN A;  5HL4 A;  4Y28 J;  3GZX A;  1FDI A;  4NBF D;  2Q3W A;  4HM7 A;  5BOK A;  3L71 E;  4AAY B;  1FDO A;  3BCC E;  2E76 C;  4H44 C;  3EN1 A;  3EQQ A;  1ZRT E;  4OGQ B;  1O7N A;  3D6Y A;  3S9O A;  3GCE A;  3GKE A;  3D89 A;  2QSI A;  3AE6 C;  1BCC E;  4H0L D;  3C0D A;  3GZY A;  1O7P A;  1YQ3 C;  1UUV A;  3AE7 C;  3AE9 C;  2D2C C;  4NBE D;  2HML A;  1RQU A;  4PV1 C;  1VCK A;  1ULI A;  4P1C H;  2QJK C;  1OW6 A;  2E4Q A;  5M1B A;  1NU1 E;  2O01 J;  2NVF A;  1EXI A;  2E75 B;  3IAO A;  4NBA D;  2G8Y A;  4U3F E;  4YTP C;  4OGQ D;  2NVE A;  3GMA A;  3RL0 g;  4QUP A;  3H1J E;  2K9Y A;  1K05 A;  2V7Q J;  4QCK A;  4NB8 D;  2E76 B;  4H44 B;  1PP9 E;  4OGQ C;  1NGM B;  1IK7 A;  1WMK A;  3H1I E;  3AEA C;  2YFL A;  5AEW A;  1OW7 A;  2IBZ E;  1NYH A;  3GTE A;  4NBG D;  2P10 A;  3VMH D;  1SQP E;  2D2C B;  1RQV A;  4QDF A;  3VMG D;  4HJL A;  1O7W A;  3ABV C;  4PV1 B;  3AEE C;  5KLV E;  1S5L X;  4HKV A;  1NTM E;  4QDC A;  2WSF J;  4QUR A;  3T97 B;  3FOU A;  1O7G A;  2BEZ F;  2NZ2 A;  3FGA D;  4KT0 J;  3RK3 E;  2NUK A;  1PV3 A;  2XSO A;  3Q3D A;  2ZT9 C;  2FBW C;  3Q5P A;  2E74 D;  2IDB A;  3G9R A;  1Y9B A;  4R4L A;  4PV1 D;  1UUW A;  1Q90 C;  1OMI A;  2HMM A;  2YVJ B;  2D2C D;  2G3A A;  1KIL E;  4RKU J;  4R4M A;  5KKZ C;  1TU3 F;  3SFD C;  3AEF C;  3CX5 E;  2A06 E;  3GL0 A;  4NB9 D;  1UIX A;  2E76 D;  4H44 D;  3N0Q A;  2WSC J;  2BMO A;  3AEB C;  1S1C X;  2E74 B;  1KB9 E;  3CWB E;  3L74 E;  3Q2Y A;  3TGU E;  2J5U A;  1DIP A;  2BMQ A;  1HF9 A;  1ZP0 C;  2OQQ A;  3R4Y A;  4AIV A;  1GMJ A;  2WSE J;  2JO6 A;  1O7M A;  1KOR A;  3AE1 C;  1EXJ A;  1VF5 D;  1U57 A;  2HMO A;  2YMK A;  2QPZ A;  1MKM A;  3O6Q A;  4QDD A;  2GBX A;  2CKF A;  2E4P A;  3B71 A;  1VF5 B;  3GL2 A;  3CXH E;  3EWK A;  4HM1 A;  5L8R J;  1G8K B;  1K04 A;  2E75 C;  1BE3 E;  4HM3 A;  3GF3 A;  2BMR A;  1OW8 A;  3AE3 C;  3GOB A;  1PL5 A;  2MKV A;  1PPJ E;  4HM0 A;  3GB4 A;  2JO1 A;  1NDO A;  2QIW A;  3C8V A;  2YFJ A;  4HM2 A;  2YFI A;  4YXD C;  1SQV E;  1G8J B;  2E75 D;  1NTK E;  3D70 A;  3AE4 C;  4H13 C;  2WPV B;  1JB0 J;  3AE8 C;  3D71 A;  1SQX E;  1NTZ E;  1KTM A;  3H1L E;  2ZT9 D;  2DE5 D;  4H0L B;  1KMI Z;  1L0L E;  3GTS A;  2JP3 A;  4P1B H;  1NYK A;  4I7Z C;  1ZME C;  2BCC E;  3GF7 A;  2NUM A;  4NBC D;  1HJ0 A;  2ZT9 B;  2XR8 A;  3Q1M A;  1ULJ A;  1DD4 A;  3AEG C;  1SJG A;  4QUQ A;  1EZV E;  1R8E A;  1AJY A;  3LW5 J;  3AEC C;  3VCA A;  3L70 E;  4TT3 H;  2BEQ D;  2NWF A;  1KQF B;  5AEU A;  2DE6 D;  2WQY C;  2I7F A;  2B1X A;  3VMI D;  4H13 B;  2JZA A;  3AE2 C;  1YQ4 C;  4Z1M H;  2FXP A;  3L73 E;  1P84 E;  1SQQ E;  1Q90 D;  1DD3 A;  1O7H A;  4NBD D;  2H88 C;  4HM4 A;  3GLM A;  4EMJ B;  2NVG A;  2FYN C;  2QJP C;  3DQY A;  3H25 A;  4H0L C;  4PD4 E;  3H1K E;  4H13 D;  2YIU C;  4XFJ A;  1EG9 A;  1L0N E;  3L75 E;  2QJY C;  4HM5 A;  2GBW A;  1FQT A;  3H1H E;  4IL6 X;  3L72 E;  3AED C;  1WQL A;  2H89 C;  2DE7 D;  4NBH D;  1VF5 C;  5CXM A;  2XRX A;  4U7J A;  1JM1 A;  2E74 C;  2HMK A;  4HM6 A;  4NBB D;  3VCP A;  2FYU E;  4I7Z B;  4HM8 A;  1PIX A;  2XSH A;  2B24 A;  3AZC A;  3AE5 C;  1KYO E;  3D6Z A;  1RFS A;  1SQB E;  2ZYL A;  1VL2 A;  3Q5R A;  1KQG B;  3IN6 A;  4GDO A;  3SFE C;  1RIE A;  4QDF B;  1ZOY C;  2HMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...