4OGQD

Internal lipid architecture of the hetero-oligomeric cytochrome b6f complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKDELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLTSWTETDFRTGEEPWWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 36
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4ogqD01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 4ogqD02
1BCCE 5BOKA 2NUKA 1EZVE 1BE3E 2DE5D 4NB9D 5HL4A 5KLVE 4QDDA 4NBGD 1JM1A 1KB9E 2YIUC 3CX5E 3H1HE 2GBWA 2BMRA 1NYKA 3CWBE 2HMMA 4I7ZC 1O7PA 4P1BH 2NVGA 1NTME 4HM6A 5KKZC 4HKVA 4PV1D 4HM7A 1VF5C 1SJGA 3GZXA 5AEUA 3GOBA 4AAYB 2JO6A 4NBED 4HM0A 2CKFA 5AEWA 2E4PA 3GKEA 2NVEA 4QDCA 2XSOA 2BCCE 3GZYA 4NBBD 3VCAA 1L0LE 2FYNC 1P84E 2E75C 3D89A 3GTSA 1ULIA 2XRXA 2E74D 4H13C 4QDFB 3L70E 3EQQA 2YFJA 1SQBE 3FOUA 4NBCD 1SQPE 5KLIC 4EMJB 2B24A 4HM2A 4OGQD 2YFLA 4H44D 4NBHD 4QURA 1O7NA 3L71E 2XSHA 2D2CD 1NTKE 2HMNA 2E76C 1NDOA 1O7GA 3AZCA 3H1IE 4NB8D 2FYUE 3L74E 2Q3WA 2ZT9D 4NBDD 4PD4E 4QCKA 1SQVE 1EG9A 1O7MA 3GB4A 2NUMA 1O7HA 2NVFA 4P1CH 1VM9A 3TGUE 4HJLA 1ZRTE 2BMOA 1UUWA 4HM3A 2JZAA 1L0NE 2QJKC 2NWFA 1PPJE 4PV1C 4HM8A 1SQXE 2IBZE 3BCCE 1RFSA 1UUVA 3CXHE 2QJPC 2YVJB 1G8JB 1G8KB 4HM4A 3C0DA 4H0LC 3VMID 1KYOE 3VMHD 3L75E 1VF5D 2HMLA 3N0QA 1VCKA 5CXMA 3H1LE 2E74C 1ULJA 2DE7D 3GTEA 1Q90C 2GBXA 3GL0A 4QUPA 3GL2A 1SQQE 4NBFD 2HMOA 4NBAD 2A06E 3L73E 2XR8A 2E75D 1RIEA 3H1JE 1O7WA 4QUQA 4OGQC 3GCEA 1NTZE 2QJYC 4H44C 1PP9E 4H13D 4HM1A 2D2CC 1WQLA 2BMQA 2ZYLA 3DQYA 4U3FE 2E4QA 2YFIA 2ZT9C 4QDFA 1FQTA 4AIVA 2I7FA 2YMKA 3VCPA 2HMKA 4HM5A 4H0LD 3VMGD 2E76D 2QPZA 2B1XA 3L72E 3H1KE 2HMJA 1NU1E 2DE6D 3EN1A
chains in the Genus database with same CATH superfamily
1E79H 3O8ZA 2OYHB 2Y9ZA 2CK3H 2VRSA 3MIWA 2FKWB 4GDOA 4W80A 5KKZC 3G4SP 4WVZA 1Q2NA 3KYQA 3KDPB 4TT3H 5DJUB 2KOGA 3G6EP 1YQ4C 3RK2B 1PPJD 1SQXD 5L8RJ 3M9HA 2YFJA 2HYNA 3FOUA 3SFDC 1GMJA 1EXJA 2C0XA 2HMNA 1KD1Q 1CZQA 1SQVE 3BATA 2WVRA 3L73D 1EZVG 1ZRTE 2K9JA 3WUUA 1HJBA 3RL0D 1LT1A 1LTBC 3CCEP 1G1IA 3BCCE 4R4MA 1XTCC 1NOHA 2KS1A 4B86A 2QG4A 1DEEG 1JY2O 1NKNA 4GIFA 2ZVNB 3Q3DA 3W68A 3G9RA 3F89A 5CHXA 4DCKA 1GK6A 4YPCA 1Q7YQ 4HJGH 5KAFH 3B71A 2NPSD 2JWAA 3Q5PA 2HMKA 1AA0A 4D6TJ 5CBNA 3RBZA 1PPJG 1KILB 2GBWA 1NAYA 1BCCJ 3CXHI 2P1JA 2KNCB 3G71P 2JO6A 1IFJA 3L4FA 1DIPA 1IFNA 4DT0A 1H0TB 5AW7B 3VMYA 3CPWO 1LT9C 1RHZB 1K8AQ 3L73G 3HUSA 5K5GB 1SQPE 3CC4P 4HM2A 2D2CD 3H1IE 2WT7A 2RKLA 2KXPB 2W83C 2W90A 1MV8A 3IF4A 1AQ5A 3H1JD 1NTZD 3L74J 2JJLA 1LT9A 2O01H 2QE7H 3HE4A 1SS1A 4HKZH 2K9YA 1U57A 5AVVB 2HLOA 1BGYD 3FXEA 1RF1C 1RF1B 4KT0J 4ASVA 3A0BH 5KLVD 1GZLA 3P32A 4QUPA 1VQ8P 2FFDA 3EFGA 3PJSK 5DJTB 4NBAD 3WUVA 3K5BA 4QUQA 2Q9IA 2BMQA 1URQA 2WPQA 2K1AA 2V4HA 1VQ6P 2MKVA 2B1XA 2YO2A 3RL0C 4HM5A 3N7NA 5BOKA 1W5CE 3RL0B 1OZHA 5AW4B 3RGUA 4C46A 4HYTB 1NU1J 4Y28J 3S9OA 3C1LA 3TDKA 2ZJSE 3CWBJ 3CMAP 1MKMA 5BVZA 1J2JB 1BCCG 5AVUB 1JMBA 2QVAA 1L0LE 1VQ4P 1KTMA 3FGAD 3T97B 5AW1B 2NPSC 2QA4P 2HG5D 2P58A 4EDFA 1BGYG 5AW5B 2Q3WA 1GL2C 3GB4A 3KQGA 1VM9A 2AEJA 3V6IA 2BMOA 2ZVOB 1PP9D 1KZUB 4WWIA 3ITKA 1L0NJ 1MFZA 2P7JA 1G8KB 3L74G 2W6AA 5AW2B 2LKMA 3CCSP 2Z4EA 3H1LE 3IAOA 3GL0A 4BWNA 1ZV8A 2JKVA 1S5LE 1GL2A 1OFCX 2V7QH 4XE5B 2D2CC 1KFMA 4UB6H 1WQLA 2D2CB 1KQFB 1GW4A 4QDFA 2YMKA 2WTYA 4YXDC 2E76D 2E5YA 1G2CB 1N73A 1EZVE 1PZQA 1OVUA 5GTHH 1MUUA 1VQPP 1HUCA 4I7ZC 2R3SA 2N1TA 1JCDA 4Z1MH 1Q86Q 4IL6H 2XV5A 2H88C 4YXWH 1JCCA 1YJNP 3SSUA 1VQOP 2CPBA 2B87A 3S4RA 1PP9G 1MFTA 3HTKA 2BEQD 5CJ0A 2KB7P 4BXLA 1AVOA 3KZIH 3L75D 4OGQD 2YFLA 1RQUA 2ZXXA 1CI6B 1JUNA 2IYOA 3V2QA 1J1EC 1LTIC 1J1EB 3PP5A 3A3YB 3D70A 1S9KD 3HRNA 4MN4C 2G3AA 5B66E 4DOJA 5H2FE 1OIPA 2QJKC 3HD7D 3LW5H 1T3UA 1PPJE 4U3FD 1SQXE 3TGUJ 2B89A 1IO4A 3PRJA 1VQ9P 2M8RA 3CCMP 3C0DA 4H0LC 4WY4A 1DD3A 3H1KD 3A0HH 1NTMD 3L73E 1UIXA 2P2UA 4OWFA 1USDA 3RL0g 1LWUC 4H13D 1N86A 3U1AA 4KHXA 1ZR4A 5EFWB 2RH0A 1RE4C 2XNDH 1FQTA 3VCPA 1H88A 1KC8Q 1Y8AA 2J5UA 4Y99B 2QPZA 3L70D 1JTHA 2YKOA 1SFCA 1PGOA 3RK2D 3L71D 3Q5RA 1SVFA 1BE3J 3E7KA 3TYYA 1K9MQ 2FYUD 3L75G 1JY3N 4NBED 1LWUA 2OGUA 1AJYA 1EXIA 2WSFH 1Q82Q 4ZMDA 1T2KD 4RO0A 1FZCB 5APUA 2WSEH 1K73Q 3RK3D 1EDIA 4U3FG 1R5SA 1YITP 2QJPB 3IR9A 3PH0A 4QURA 3HE5B 2E76C 2ZAEB 2E76B 4K3AA 4QCKA 3H1KG 3CCVP 1NTKJ 1EZVI 5B5EH 4NPDA 4RJTA 1NHLA 1NTMG 2K3RA 4I1LA 3NXSA 4OVNF 4HM4A 2OYIA 1VF5D 5CCHC 1BSHA 3RBXA 1WMKA 2WSEJ 3L70G 1NH4A 4GT1A 3H1JE 4OGQC 1NTZE 4OGQB 1KILD 4HM1A 1Z56A 4ZKPA 3L71G 4CPGA 3WMM0 5KAIH 2XU6A 2FYUG 3V4WA 1N7SA 1BGYE 1SQQK 3HD7C 1FDMA 1OXZA 5KLVE 5KAFE 3P7KA 2YNYA 1VPCA 5KLIB 4HM6A 3VP8A 1JY2N 3H1HJ 2E43A 2JO1A 2CKFA 1M1JC 2H7HA 2XSOA 1FZFA 2ITAA 1S5LX 1S2EA 1ULIA 2OYHC 4H13C 3VN0A 4H13B 3JCUE 2QSIA 4NBCD 1YQ3C 1QL2A 2WPRA 1S4XA 1SQBJ 2O1KA 3AZCA 1WRGA 2A45H 2ZXEB 1EDKA 1NU1K 3H32A 3RK2C 2IZ0A 1X79B 1M1JA 5C39A 2M5AB 4H44B 1NKZB 5CCGD 2OYHA 5APTA 3M0AA 3VMID 1M8OB 1T2KC 2FXOA 1BDDA 3RK3C 5E79H 3GL2A 3RK3B 1X22A 2KSEA 1LJ2A 1HBWA 1PP9E 1FOSE 1KB9H 5APSA 4YTPC 3CD6P 2IDBA 2I8DA 5AW3B 5APXA 1LTGC 4I6MC 1L0NK 2W8ZA 2XNXA 2Q3IA 3D71A 2PFXA 1PGPA 1A02J 5M1BA 3AE6C 4EI2A 4HM7A 1VF5C 1VF5B 3VTPC 1ZXGA 5AEUA 1L4AD 2WPSA 1CSBA 2E4PA 1EDJA 1JO5A 4GODA 5AVXB 2IBZD 1KILC 1KFNA 2BCCJ 2CPSA 3BRTB 4AQRD 3AEFC 1OVRA 1RE3C 1VQ5P 2OTKE 2ZT9D 1JB0J 3KPEA 1FJKA 2KZIA 1IC2A 1SQPK 5TISE 4D6TD 1W2BO 1YIJP 1NVOA 3L75E 1JM0A 1BCCD 3USSA 2DE7D 2KNCA 1KB9D 3GF7A 1S9KE 1EDLA 4N6JA 4NBFD 1H0TA 3S1KA 1QLED 2QJYC 1JEKA 2QJYB 1SQQJ 3BASA 4U3FE 1ZLLA 1YTZT 1W2EA 2HPCB 3VP9A 2KYVA 1G1JA 3D6YA 1PV3A 2WMMA 3H1KE 2HMJA 2RN0A 2DE6D 3EN1A 2WSCH 2IX7C 2NUKA 5CCGC 2IBZG 2R5DA 2FXPA 2YXRB 3L72J 1FC2C 2A45G 1NTME 1SJGA 1AQTA 3L74D 5AVWB 4XFJA 3M91A 5AEWA 1X8YA 3EFFK 3ZDMA 1N2DC 5GTHE 2IYPA 1GU4A 1IFPA 3GHGB 1VL2A 5BU5A 1NAFA 3NMDA 1RF1A 1NWQA 1A02F 3L70E 3W67A 4IL6E 1Y47A 5APQA 4D6TG 1O7NA 3L71E 3AE2C 3A7OA 1N7LA 4NB8D 2C9LY 2OTJP 2AXTE 2FYUE 1L0LK 1O7MA 1O7HA 1BSNA 3SWKA 1EC5A 3AE1C 3MZWB 2WSCJ 1SQVJ 5GTIH 5CBOA 2H8PD 3RK3E 1UUVA 1L4AC 2H43A 3GMAA 1L4AB 3BCCJ 1JNMA 1NU1D 3KXDA 5CXMA 2WITA 4UB8H 1LP1A 1RF0C 4IFMA 3CWBD 1LTTC 3FXDA 3VYIA 2E75D 2AEFA 2IFMA 3A0HE 4U7JA 4BRYA 2Q5UA 1NTKK 1GW3A 2ZT9C 1YHQP 4IOIH 2NRGA 2ZT9B 4JYCA 2R5BA 2GUSA 3VMGD 1M57D 5KTBA 2NPSA 4N78E 4EOTA 1R5LA 2A06G 2M3BA 4IFFA 3TF5A 2JDIH 2C9NY 2KSJA 2BEZF 2HMMA 1FZGA 1YI2P 4P1BH 2NVGA 1OW6A 1ZOYC 1KILE 3A2AA 3GOBA 4OH8B 1FE6A 5APWA 3MP7B 1FZAA 1HH0A 1L0ND 2N1TB 1OX3A 3I5CA 3WU2H 2LR2A 1FBMA 3GW6A 3CMEP 1SQPJ 2WWWA 2GM4A 3BVHA 1NU1G 2MJZA 1KYOH 3H1IJ 3CI9A 1N8RQ 3B5ND 1WT6A 3VOPA 2JZAA 2IFNA 3CWBG 1FS0E 5KJ7D 3MUDC 1L2PA 2Y0CA 3AE8C 2PP6A 5CMZA 2L91A 2HMLA 5B5EE 2B9BA 1SQXK 1SQBK 1FJPA 3EWKA 3AEAC 3CX5H 2YFIA 1VQ7P 4TLFA 1USEA 1GU5A 2WPVB 5AVYB 3D6ZA 1CI6A 4LLHA 2JEEA 2AEMA 4JF7A 1L0NG 5HL4A 1FDOA 2QIWA 1JM1A 2WQYC 5KAIE 2BMRA 2FXMA 1P84H 3U1CA 3LIEA 2FBWC 2K88A 1LTJC 1LTJB 1OW7A 1SFCB 3TGUD 4W7YA 4Y99C 4IFDK 2Z5HA 2FYNC 2E75C 1YBKA 2FYNB 5APYA 2E75B 2E74D 4PD4H 3MD0A 1FAVA 1L0LJ 2KUBA 1XTGB 1S5LH 1KYOD 4H44D 2HR3A 3AECC 2QM8A 4AUWA 1KQLA 1NYHA 2QEXP 1KMIZ 2NUMA 1FZCC 1RE4A 4JPZB 2Q6QA 2Q3EA 1OMIA 3MGNA 2IBZE 2QJPC 2YVJB 3NFQA 2JP3A 2OYOA 3M9QA 3NTNA 1BE3D 3GTEA 1S1CX 2GBXA 2M0BA 3CX5D 3H6PA 2W6JH 3OA7A 3H1LJ 1M1KQ 2OYIB 1RIEA 2Y0DA 3M0DC 2ZYAA 3TSIA 4C7NA 3V2RA 1K05A 4D6TE 3P8CD 1RQVA 3V2NA 5E79E 1P84D 1GDTA 5AW9B 3B5NC 3TGUG 3CCQP 3B5NB 3HE5A 1BCCE 4NBGD 5KJ7C 1NTZK 1KB9E 1IJDB 4AYCA 3C9IA 1NTKD 1IZNB 3TNUB 2K37A 3O6QB 1ZR2A 1KQGB 3QH9A 4PD4D 3B8EB 3CCJP 1TU3F 2HODB 1PGJA 3H25A 5KLVK 3D89A 1VQLP 3E1IA 2M3EA 5KLIC 2HFED 2P10A 5CCHA 2FYZA 4NBHD 2XSHA 3SWYA 1KQSO 3WUTA 3L74E 2KLUA 3L36A 2JR8A 1BE3G 2NWFA 2OARA 5AVQB 4K35A 2E42A 3HD7A 4L74A 3AEEC 1FZEA 1PFIA 2O01N 1G8JB 3UIAA 1SQXJ 1AFOA 1QGKB 3VMHD 1VCKA 3QWOC 1JOCA 2E74C 3II6A 2KIKA 2E74B 3H1HD 1RH5B 1YJ9P 2E5TA 4L76A 2XR8A 5CJ4A 1URQD 3GCEA 4H44C 3CC7P 5KKZB 2ZYLA 3Q5SA 3L73J 1NTKG 2J59M 3KHUA 2QRXA 2LXCB 2K9JB 3H1LG 3Q2YA 1SQVK 1KN7A 1QX8A 1VDFA 1NU1E 3M06A 4NB9D 1SQBD 3VMZA 4EIJA 2IPPA 1D7MA 2POHA 3CWBE 2KS1B 2IBZI 2J58A 1O7PA 2A45I 4HKVA 2QM7A 3CLQA 1QL1A 2Y0EA 3A0BE 1RY3A 2M5AA 1E5WA 3GLMA 4HM0A 3GKEA 1IFDA 3GZYA 3I55P 1M56D 2GA1A 3EQQA 3C8VA 3L35A 3B4SA 2Q7CA 1O7GA 3CXHH 1U7JA 4ZKUA 2Y9YA 4P1CH 3H1HG 4ZNCA 1KB9I 3N4XA 1L0NE 4KJMA 1J1DC 2Q1KA 3P8MC 1J1DB 4I2LC 4PJ0H 3LIDA 1UIIA 1QVFO 1BDCA 1GK4A 1GTWA 3HUSC 5GTIE 3HUSB 4O9BA 4W7ZA 1GL2D 3I56P 1M90Q 1SQXG 1SQBG 1LTAC 2JWDA 2WT7B 2YO3A 3DQYA 3JCUH 3H1JJ 1KILA 4UB8E 1NTZJ 4DJGA 2BCCD 2I7FA 3AE3C 4AIVA 3AE4C 1YJWP 1ZN5A 1LT9B 1KV4A 1NJIQ 5AVRB 1RE3A 3HE4B 1KORA 1BGYJ 2N1TD 3Q1MA 3EQ2A 3V4QA 5KLVJ 2YXQB 1FDIA 3AEDC 2FFDC 3A5TA 5TJHA 3GZXA 2FFDB 2NVEA 1S72P 2GUVA 1K04A 3VCAA 1URQC 2AXCA 3CL3D 1QEXA 1URQB 4UB6E 1Q90D 2KK7A 3PHLA 1NTMK 3CXHD 2H89C 1SLQA 3G3ZA 3OJAB 1AVYA 3SFEC 1U7MA 1NDOA 4NBDD 1IK7A 1SQQD 2I1KA 3WU2E 2A06D 1H8AA 3TGUE 3GHGC 2HPCA 2YMYA 4HJLA 1HVVA 1IFMA 3ABVC 4HM8A 1ZW0A 4WY4D 2YKPA 1NGMB 5CCGA 2FYUK 4RKUJ 1CW5A 1KYOE 5AW6B 3L72D 2BCCG 1ULJA 5BU8B 3KZIE 1O7WA 1Q81Q 2O01J 3GHGA 4NPFX 4LC1A 4EYYQ 1LP1B 1JY3P 1PP9J 2ZYGA 4WBAA 1SP4A 4H0LD 1SFCD 5AVTB 4BRYB 1BE3E 2WSSH 3H1JG 2DE5D 1NTZG 2YIUC 3CX5E 4WB4A 2YIUB 2LXBA 1JMMA 3AE7C 2R44A 3FWNA 2UWJE 1ZMEC 2W27A 3GG2A 2NPSB 1VQMP 5TISH 1IK9A 2KP8A 1FU1A 1EQ7A 2L5GB 4AAYB 1SQVD 1LNQA 3T97A 1ZRTD 4QDCA 3P8CE 3MTUE 1GL2B 1L4AA 4NBBD 1SQQG 3FWLA 5KLVG 1P84E 1IFIA 2O3JA 3BCCD 4QDFB 2G8YA 4ASWA 1RF0A 1Y9BA 1NTKE 1N73C 1N73B 4PD4E 1EG9A 3L72G 2ZFCA 1HWTC 2NVFA 3L37A 2N1TC 4HM3A 2XDJA 1H89A 1R8EA 4QMAA 1NO4A 4GOFA 4N3YB 2B87B 3V2PA 3GF3A 3HTKB 1Q90C 4A7PA 2PRRA 3L75J 3VMAA 2RMZA 3OAKA 4I7ZB 5APVA 2PAJA 1G2CA 1JY2P 4LGDE 2N9YB 1N7SD 3M9BA 2E4QA 2OQQA 1HTLC 1SQVG 4U3FJ 3JC22 2OTLP 1AV1A 2KZJA 3AE5C 2AXTH 1SQPD 5CCHD 5AW0B 3H1HE 3U59A 4WY4C 3H1KJ 4WY4B 3BCCG 2V7QJ 1OVVA 1OW8A 4PV1D 4DZOA 3H1ID 5AVSB 1FOSF 1KYOI 1NTMJ 1T8ZA 3MUDA 3AE9C 2W6BA 3V5BA 3FX0A 2I1JA 2QJKB 2C0WA 2XKMA 3SWFA 1DX7A 1SQBE 4GOEA 4EMJB 2KLVA 2B24A 1LTSC 3L70J 4C7RA 4H0LB 1LGHB 4JYBA 1JTHB 1SFCC 3L71J 3E1RA 2FYUJ 1UUWA 3CX5I 1LWUB 3JSVC 1GD2E 2ZYDA 2SPZA 2PGDA 1PL5A 1DEBA 2O1JA 4GKGA 3R4YA 1HF9A 1P84I 1LTJA 1DH3A 3F5HA 2Z5IA 1HJ0A 3LW5J 1SQPG 1PIXA 3CCLP 1T6AA 3IFMA 3PLNA 5AW8B 1HGZA 3H1IG 1L0LD 4L73A 4PD4I 4NPEA 2XZRA 3TK1A 4C7NB 4QDDA 4JBZA 2OYIC 1NYKA 4IL6X 4HH2A 1FZCA 2DW3A 1S3JA 2IZ1A 3R2PA 2B88A 2BCCE 4RESB 3GTSA 5AVZB 2XRXA 1VQNP 4R4LA 4HB1A 3OW2O 5B66H 1N7SC 2WZ7A 2NZ2A 1FZBA 1N7SB 1YTZI 2R32A 5H2FH 3IN6A 3H1LD 4N78D 3CCRP 3M0DA 2FY8A 2WSFJ 1ZP0C 1X9VA 2R3CA 3AEGC 3CCUP 1YYCA 1MZ9A 4PV1C 1X0TA 3B5NA 4PV1B 3BRVB 1VQKP 1RFSA 3CXHE 5KJ7A 2P67A 1QVGO 1M7LA 3N0QA 3TNUA 4XA4A 3O6QA 1EZVD 1L0LG 3HD7B 2YKQA 1JY3O 1SQQE 3MHVA 3PTZA 3CC2P 2HMOA 4JQ0D 2A06E 1DD4A 2KI7B 4PJ0E 4M3LA 3VMXA 2HODA 2N9BA 4L75A 1T3JA 2BASA 1PGQA 3H32B 1HGVA 1M1JB 1OWAA 3AEBC 3L72E
chains in the Genus database with same CATH topology
1KORA 3Q1MA 2BEZF 2HMMA 4GDOA 4P1BH 5KKZC 3Q5RA 2NVGA 1OW6A 1ZOYC 1FDIA 1KILE 3AEDC 3GZXA 3GOBA 4NBED 1AJYA 4TT3H 2NVEA 1EXIA 1K04A 1YQ4C 3VCAA 1Q90D 5L8RJ 2YFJA 3FOUA 2H89C 3SFDC 1GMJA 4QURA 1EXJA 2HMNA 3SFEC 2E76C 1NDOA 2E76B 4NBDD 1IK7A 4QCKA 1SQVE 3TGUE 4HJLA 1ZRTE 2JZAA 3ABVC 4HM8A 3BCCE 4R4MA 1NGMB 3AE8C 4HM4A 4RKUJ 1KYOE 1VF5D 2HMLA 1ULJA 1WMKA 3Q3DA 2WSEJ 3G9RA 3H1JE 3EWKA 1O7WA 4OGQC 1NTZE 4OGQB 4HM1A 2O01J 3AEAC 2YFIA 3B71A 3Q5PA 2HMKA 4H0LD 2WPVB 3D6ZA 1BE3E 2DE5D 5HL4A 1FDOA 2QIWA 5KLVE 2YIUC 1JM1A 3CX5E 2WQYC 2GBWA 2BMRA 3AE7C 1ZMEC 4HM6A 2FBWC 4AAYB 2JO6A 2JO1A 2CKFA 1DIPA 1OW7A 4QDCA 2XSOA 4NBBD 2FYNC 1P84E 2E75C 1S5LX 2E75B 1ULIA 2E74D 4H13C 4H13B 4QDFB 2QSIA 4NBCD 1YQ3C 2G8YA 1SQPE 1Y9BA 4HM2A 4H44D 2D2CD 3AECC 1NTKE 3AZCA 3H1IE 1NYHA 4PD4E 1KMIZ 1EG9A 2NUMA 2NVFA 4HM3A 4H44B 1OMIA 2IBZE 2K9YA 1R8EA 2QJPC 2YVJB 1U57A 2JP3A 3VMID 4KT0J 3GF3A 3GTEA 1S1CX 1Q90C 2GBXA 4QUPA 3GL2A 4NBAD 1RIEA 4QUQA 1PP9E 4I7ZB 2BMQA 2E4QA 1K05A 2OQQA 1RQVA 2MKVA 4YTPC 2IDBA 2B1XA 4HM5A 5BOKA 3AE5C 1BCCE 3D71A 4NBGD 1KB9E 3H1HE 4Y28J 2V7QJ 3S9OA 1OW8A 5M1BA 4PV1D 3AE6C 4HM7A 1VF5C 1VF5B 1KQGB 5AEUA 2E4PA 1MKMA 1TU3F 3AE9C 3H25A 1L0LE 3D89A 1KTMA 3FGAD 3T97B 1SQBE 4EMJB 5KLIC 2B24A 2P10A 3AEFC 4NBHD 2XSHA 4H0LB 3L74E 2Q3WA 2ZT9D 3GB4A 1JB0J 1VM9A 2BMOA 1UUWA 2NWFA 3AEEC 1G8JB 1G8KB 3VMHD 1PL5A 3L75E 1VCKA 3H1LE 3IAOA 2E74C 3R4YA 2DE7D 1HF9A 2E74B 3GL0A 3GF7A 4NBFD 2XR8A 1HJ0A 3LW5J 1PIXA 3GCEA 2QJYC 4H44C 2D2CC 1WQLA 2ZYLA 2D2CB 3Q5SA 4U3FE 1KQFB 4QDFA 2YMKA 3Q2YA 4YXDC 2E76D 3D6YA 1PV3A 3H1KE 2HMJA 1NU1E 2DE6D 3EN1A 2NUKA 1EZVE 4NB9D 4QDDA 1NYKA 3CWBE 2FXPA 4I7ZC 4IL6X 1O7PA 1NTME 4HKVA 4Z1MH 1SJGA 4XFJA 4HM0A 3GLMA 5AEWA 3GKEA 2H88C 2BCCE 3GZYA 1VL2A 3GTSA 2XRXA 4R4LA 2BEQD 3L70E 3EQQA 2NZ2A 3C8VA 4OGQD 2YFLA 1RQUA 3IN6A 1O7NA 3L71E 3AE2C 1O7GA 4NB8D 2FYUE 3D70A 2WSFJ 1O7MA 2G3AA 1ZP0C 1O7HA 4P1CH 3AE1C 3AEGC 2WSCJ 2QJKC 1L0NE 1PPJE 4PV1C 1SQXE 4PV1B 1RFSA 3RK3E 1UUVA 3CXHE 3GMAA 3C0DA 4H0LC 1DD3A 3N0QA 3O6QA 5CXMA 1SQQE 2HMOA 2A06E 1DD4A 3L73E 1UIXA 2E75D 3RL0g 4H13D 4U7JA 3DQYA 2ZT9C 2ZT9B 1FQTA 4AIVA 2I7FA 3AE3C 3AE4C 3VCPA 3VMGD 2J5UA 2QPZA 3AEBC 3L72E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC E;  5BOK A;  2NUK A;  1EZV E;  1BE3 E;  2DE5 D;  4NB9 D;  5HL4 A;  5KLV E;  4QDD A;  4NBG D;  1JM1 A;  1KB9 E;  2YIU C;  3CX5 E;  3H1H E;  2GBW A;  2BMR A;  1NYK A;  3CWB E;  2HMM A;  4I7Z C;  1O7P A;  4P1B H;  2NVG A;  1NTM E;  4HM6 A;  5KKZ C;  4HKV A;  4PV1 D;  4HM7 A;  1VF5 C;  1SJG A;  3GZX A;  5AEU A;  3GOB A;  4AAY B;  2JO6 A;  4NBE D;  4HM0 A;  2CKF A;  5AEW A;  2E4P A;  3GKE A;  2NVE A;  4QDC A;  2XSO A;  2BCC E;  3GZY A;  4NBB D;  3VCA A;  1L0L E;  2FYN C;  1P84 E;  2E75 C;  3D89 A;  3GTS A;  1ULI A;  2XRX A;  2E74 D;  4H13 C;  4QDF B;  3L70 E;  3EQQ A;  2YFJ A;  1SQB E;  3FOU A;  4NBC D;  1SQP E;  5KLI C;  4EMJ B;  2B24 A;  4HM2 A;  4OGQ D;  2YFL A;  4H44 D;  4NBH D;  4QUR A;  1O7N A;  3L71 E;  2XSH A;  2D2C D;  1NTK E;  2HMN A;  2E76 C;  1NDO A;  1O7G A;  3AZC A;  3H1I E;  4NB8 D;  2FYU E;  3L74 E;  2Q3W A;  2ZT9 D;  4NBD D;  4PD4 E;  4QCK A;  1SQV E;  1EG9 A;  1O7M A;  3GB4 A;  2NUM A;  1O7H A;  2NVF A;  4P1C H;  1VM9 A;  3TGU E;  4HJL A;  1ZRT E;  2BMO A;  1UUW A;  4HM3 A;  2JZA A;  1L0N E;  2QJK C;  2NWF A;  1PPJ E;  4PV1 C;  4HM8 A;  1SQX E;  2IBZ E;  3BCC E;  1RFS A;  1UUV A;  3CXH E;  2QJP C;  2YVJ B;  1G8J B;  1G8K B;  4HM4 A;  3C0D A;  4H0L C;  3VMI D;  1KYO E;  3VMH D;  3L75 E;  1VF5 D;  2HML A;  3N0Q A;  1VCK A;  5CXM A;  3H1L E;  2E74 C;  1ULJ A;  2DE7 D;  3GTE A;  1Q90 C;  2GBX A;  3GL0 A;  4QUP A;  3GL2 A;  1SQQ E;  4NBF D;  2HMO A;  4NBA D;  2A06 E;  3L73 E;  2XR8 A;  2E75 D;  1RIE A;  3H1J E;  1O7W A;  4QUQ A;  4OGQ C;  3GCE A;  1NTZ E;  2QJY C;  4H44 C;  1PP9 E;  4H13 D;  4HM1 A;  2D2C C;  1WQL A;  2BMQ A;  2ZYL A;  3DQY A;  4U3F E;  2E4Q A;  2YFI A;  2ZT9 C;  4QDF A;  1FQT A;  4AIV A;  2I7F A;  2YMK A;  3VCP A;  2HMK A;  4HM5 A;  4H0L D;  3VMG D;  2E76 D;  2QPZ A;  2B1X A;  3L72 E;  3H1K E;  2HMJ A;  1NU1 E;  2DE6 D;  3EN1 A; 
#chains in the Genus database with same CATH topology
 1E79 H;  3O8Z A;  2OYH B;  2Y9Z A;  2CK3 H;  2VRS A;  3MIW A;  2FKW B;  4GDO A;  4W80 A;  5KKZ C;  3G4S P;  4WVZ A;  1Q2N A;  3KYQ A;  3KDP B;  4TT3 H;  5DJU B;  2KOG A;  3G6E P;  1YQ4 C;  3RK2 B;  1PPJ D;  1SQX D;  5L8R J;  3M9H A;  2YFJ A;  2HYN A;  3FOU A;  3SFD C;  1GMJ A;  1EXJ A;  2C0X A;  2HMN A;  1KD1 Q;  1CZQ A;  1SQV E;  3BAT A;  2WVR A;  3L73 D;  1EZV G;  1ZRT E;  2K9J A;  3WUU A;  1HJB A;  3RL0 D;  1LT1 A;  1LTB C;  3CCE P;  1G1I A;  3BCC E;  4R4M A;  1XTC C;  1NOH A;  2KS1 A;  4B86 A;  2QG4 A;  1DEE G;  1JY2 O;  1NKN A;  4GIF A;  2ZVN B;  3Q3D A;  3W68 A;  3G9R A;  3F89 A;  5CHX A;  4DCK A;  1GK6 A;  4YPC A;  1Q7Y Q;  4HJG H;  5KAF H;  3B71 A;  2NPS D;  2JWA A;  3Q5P A;  2HMK A;  1AA0 A;  4D6T J;  5CBN A;  3RBZ A;  1PPJ G;  1KIL B;  2GBW A;  1NAY A;  1BCC J;  3CXH I;  2P1J A;  2KNC B;  3G71 P;  2JO6 A;  1IFJ A;  3L4F A;  1DIP A;  1IFN A;  4DT0 A;  1H0T B;  5AW7 B;  3VMY A;  3CPW O;  1LT9 C;  1RHZ B;  1K8A Q;  3L73 G;  3HUS A;  5K5G B;  1SQP E;  3CC4 P;  4HM2 A;  2D2C D;  3H1I E;  2WT7 A;  2RKL A;  2KXP B;  2W83 C;  2W90 A;  1MV8 A;  3IF4 A;  1AQ5 A;  3H1J D;  1NTZ D;  3L74 J;  2JJL A;  1LT9 A;  2O01 H;  2QE7 H;  3HE4 A;  1SS1 A;  4HKZ H;  2K9Y A;  1U57 A;  5AVV B;  2HLO A;  1BGY D;  3FXE A;  1RF1 C;  1RF1 B;  4KT0 J;  4ASV A;  3A0B H;  5KLV D;  1GZL A;  3P32 A;  4QUP A;  1VQ8 P;  2FFD A;  3EFG A;  3PJS K;  5DJT B;  4NBA D;  3WUV A;  3K5B A;  4QUQ A;  2Q9I A;  2BMQ A;  1URQ A;  2WPQ A;  2K1A A;  2V4H A;  1VQ6 P;  2MKV A;  2B1X A;  2YO2 A;  3RL0 C;  4HM5 A;  3N7N A;  5BOK A;  1W5C E;  3RL0 B;  1OZH A;  5AW4 B;  3RGU A;  4C46 A;  4HYT B;  1NU1 J;  4Y28 J;  3S9O A;  3C1L A;  3TDK A;  2ZJS E;  3CWB J;  3CMA P;  1MKM A;  5BVZ A;  1J2J B;  1BCC G;  5AVU B;  1JMB A;  2QVA A;  1L0L E;  1VQ4 P;  1KTM A;  3FGA D;  3T97 B;  5AW1 B;  2NPS C;  2QA4 P;  2HG5 D;  2P58 A;  4EDF A;  1BGY G;  5AW5 B;  2Q3W A;  1GL2 C;  3GB4 A;  3KQG A;  1VM9 A;  2AEJ A;  3V6I A;  2BMO A;  2ZVO B;  1PP9 D;  1KZU B;  4WWI A;  3ITK A;  1L0N J;  1MFZ A;  2P7J A;  1G8K B;  3L74 G;  2W6A A;  5AW2 B;  2LKM A;  3CCS P;  2Z4E A;  3H1L E;  3IAO A;  3GL0 A;  4BWN A;  1ZV8 A;  2JKV A;  1S5L E;  1GL2 A;  1OFC X;  2V7Q H;  4XE5 B;  2D2C C;  1KFM A;  4UB6 H;  1WQL A;  2D2C B;  1KQF B;  1GW4 A;  4QDF A;  2YMK A;  2WTY A;  4YXD C;  2E76 D;  2E5Y A;  1G2C B;  1N73 A;  1EZV E;  1PZQ A;  1OVU A;  5GTH H;  1MUU A;  1VQP P;  1HUC A;  4I7Z C;  2R3S A;  2N1T A;  1JCD A;  4Z1M H;  1Q86 Q;  4IL6 H;  2XV5 A;  2H88 C;  4YXW H;  1JCC A;  1YJN P;  3SSU A;  1VQO P;  2CPB A;  2B87 A;  3S4R A;  1PP9 G;  1MFT A;  3HTK A;  2BEQ D;  5CJ0 A;  2KB7 P;  4BXL A;  1AVO A;  3KZI H;  3L75 D;  4OGQ D;  2YFL A;  1RQU A;  2ZXX A;  1CI6 B;  1JUN A;  2IYO A;  3V2Q A;  1J1E C;  1LTI C;  1J1E B;  3PP5 A;  3A3Y B;  3D70 A;  1S9K D;  3HRN A;  4MN4 C;  2G3A A;  5B66 E;  4DOJ A;  5H2F E;  1OIP A;  2QJK C;  3HD7 D;  3LW5 H;  1T3U A;  1PPJ E;  4U3F D;  1SQX E;  3TGU J;  2B89 A;  1IO4 A;  3PRJ A;  1VQ9 P;  2M8R A;  3CCM P;  3C0D A;  4H0L C;  4WY4 A;  1DD3 A;  3H1K D;  3A0H H;  1NTM D;  3L73 E;  1UIX A;  2P2U A;  4OWF A;  1USD A;  3RL0 g;  1LWU C;  4H13 D;  1N86 A;  3U1A A;  4KHX A;  1ZR4 A;  5EFW B;  2RH0 A;  1RE4 C;  2XND H;  1FQT A;  3VCP A;  1H88 A;  1KC8 Q;  1Y8A A;  2J5U A;  4Y99 B;  2QPZ A;  3L70 D;  1JTH A;  2YKO A;  1SFC A;  1PGO A;  3RK2 D;  3L71 D;  3Q5R A;  1SVF A;  1BE3 J;  3E7K A;  3TYY A;  1K9M Q;  2FYU D;  3L75 G;  1JY3 N;  4NBE D;  1LWU A;  2OGU A;  1AJY A;  1EXI A;  2WSF H;  1Q82 Q;  4ZMD A;  1T2K D;  4RO0 A;  1FZC B;  5APU A;  2WSE H;  1K73 Q;  3RK3 D;  1EDI A;  4U3F G;  1R5S A;  1YIT P;  2QJP B;  3IR9 A;  3PH0 A;  4QUR A;  3HE5 B;  2E76 C;  2ZAE B;  2E76 B;  4K3A A;  4QCK A;  3H1K G;  3CCV P;  1NTK J;  1EZV I;  5B5E H;  4NPD A;  4RJT A;  1NHL A;  1NTM G;  2K3R A;  4I1L A;  3NXS A;  4OVN F;  4HM4 A;  2OYI A;  1VF5 D;  5CCH C;  1BSH A;  3RBX A;  1WMK A;  2WSE J;  3L70 G;  1NH4 A;  4GT1 A;  3H1J E;  4OGQ C;  1NTZ E;  4OGQ B;  1KIL D;  4HM1 A;  1Z56 A;  4ZKP A;  3L71 G;  4CPG A;  3WMM 0;  5KAI H;  2XU6 A;  2FYU G;  3V4W A;  1N7S A;  1BGY E;  1SQQ K;  3HD7 C;  1FDM A;  1OXZ A;  5KLV E;  5KAF E;  3P7K A;  2YNY A;  1VPC A;  5KLI B;  4HM6 A;  3VP8 A;  1JY2 N;  3H1H J;  2E43 A;  2JO1 A;  2CKF A;  1M1J C;  2H7H A;  2XSO A;  1FZF A;  2ITA A;  1S5L X;  1S2E A;  1ULI A;  2OYH C;  4H13 C;  3VN0 A;  4H13 B;  3JCU E;  2QSI A;  4NBC D;  1YQ3 C;  1QL2 A;  2WPR A;  1S4X A;  1SQB J;  2O1K A;  3AZC A;  1WRG A;  2A45 H;  2ZXE B;  1EDK A;  1NU1 K;  3H32 A;  3RK2 C;  2IZ0 A;  1X79 B;  1M1J A;  5C39 A;  2M5A B;  4H44 B;  1NKZ B;  5CCG D;  2OYH A;  5APT A;  3M0A A;  3VMI D;  1M8O B;  1T2K C;  2FXO A;  1BDD A;  3RK3 C;  5E79 H;  3GL2 A;  3RK3 B;  1X22 A;  2KSE A;  1LJ2 A;  1HBW A;  1PP9 E;  1FOS E;  1KB9 H;  5APS A;  4YTP C;  3CD6 P;  2IDB A;  2I8D A;  5AW3 B;  5APX A;  1LTG C;  4I6M C;  1L0N K;  2W8Z A;  2XNX A;  2Q3I A;  3D71 A;  2PFX A;  1PGP A;  1A02 J;  5M1B A;  3AE6 C;  4EI2 A;  4HM7 A;  1VF5 C;  1VF5 B;  3VTP C;  1ZXG A;  5AEU A;  1L4A D;  2WPS A;  1CSB A;  2E4P A;  1EDJ A;  1JO5 A;  4GOD A;  5AVX B;  2IBZ D;  1KIL C;  1KFN A;  2BCC J;  2CPS A;  3BRT B;  4AQR D;  3AEF C;  1OVR A;  1RE3 C;  1VQ5 P;  2OTK E;  2ZT9 D;  1JB0 J;  3KPE A;  1FJK A;  2KZI A;  1IC2 A;  1SQP K;  5TIS E;  4D6T D;  1W2B O;  1YIJ P;  1NVO A;  3L75 E;  1JM0 A;  1BCC D;  3USS A;  2DE7 D;  2KNC A;  1KB9 D;  3GF7 A;  1S9K E;  1EDL A;  4N6J A;  4NBF D;  1H0T A;  3S1K A;  1QLE D;  2QJY C;  1JEK A;  2QJY B;  1SQQ J;  3BAS A;  4U3F E;  1ZLL A;  1YTZ T;  1W2E A;  2HPC B;  3VP9 A;  2KYV A;  1G1J A;  3D6Y A;  1PV3 A;  2WMM A;  3H1K E;  2HMJ A;  2RN0 A;  2DE6 D;  3EN1 A;  2WSC H;  2IX7 C;  2NUK A;  5CCG C;  2IBZ G;  2R5D A;  2FXP A;  2YXR B;  3L72 J;  1FC2 C;  2A45 G;  1NTM E;  1SJG A;  1AQT A;  3L74 D;  5AVW B;  4XFJ A;  3M91 A;  5AEW A;  1X8Y A;  3EFF K;  3ZDM A;  1N2D C;  5GTH E;  2IYP A;  1GU4 A;  1IFP A;  3GHG B;  1VL2 A;  5BU5 A;  1NAF A;  3NMD A;  1RF1 A;  1NWQ A;  1A02 F;  3L70 E;  3W67 A;  4IL6 E;  1Y47 A;  5APQ A;  4D6T G;  1O7N A;  3L71 E;  3AE2 C;  3A7O A;  1N7L A;  4NB8 D;  2C9L Y;  2OTJ P;  2AXT E;  2FYU E;  1L0L K;  1O7M A;  1O7H A;  1BSN A;  3SWK A;  1EC5 A;  3AE1 C;  3MZW B;  2WSC J;  1SQV J;  5GTI H;  5CBO A;  2H8P D;  3RK3 E;  1UUV A;  1L4A C;  2H43 A;  3GMA A;  1L4A B;  3BCC J;  1JNM A;  1NU1 D;  3KXD A;  5CXM A;  2WIT A;  4UB8 H;  1LP1 A;  1RF0 C;  4IFM A;  3CWB D;  1LTT C;  3FXD A;  3VYI A;  2E75 D;  2AEF A;  2IFM A;  3A0H E;  4U7J A;  4BRY A;  2Q5U A;  1NTK K;  1GW3 A;  2ZT9 C;  1YHQ P;  4IOI H;  2NRG A;  2ZT9 B;  4JYC A;  2R5B A;  2GUS A;  3VMG D;  1M57 D;  5KTB A;  2NPS A;  4N78 E;  4EOT A;  1R5L A;  2A06 G;  2M3B A;  4IFF A;  3TF5 A;  2JDI H;  2C9N Y;  2KSJ A;  2BEZ F;  2HMM A;  1FZG A;  1YI2 P;  4P1B H;  2NVG A;  1OW6 A;  1ZOY C;  1KIL E;  3A2A A;  3GOB A;  4OH8 B;  1FE6 A;  5APW A;  3MP7 B;  1FZA A;  1HH0 A;  1L0N D;  2N1T B;  1OX3 A;  3I5C A;  3WU2 H;  2LR2 A;  1FBM A;  3GW6 A;  3CME P;  1SQP J;  2WWW A;  2GM4 A;  3BVH A;  1NU1 G;  2MJZ A;  1KYO H;  3H1I J;  3CI9 A;  1N8R Q;  3B5N D;  1WT6 A;  3VOP A;  2JZA A;  2IFN A;  3CWB G;  1FS0 E;  5KJ7 D;  3MUD C;  1L2P A;  2Y0C A;  3AE8 C;  2PP6 A;  5CMZ A;  2L91 A;  2HML A;  5B5E E;  2B9B A;  1SQX K;  1SQB K;  1FJP A;  3EWK A;  3AEA C;  3CX5 H;  2YFI A;  1VQ7 P;  4TLF A;  1USE A;  1GU5 A;  2WPV B;  5AVY B;  3D6Z A;  1CI6 A;  4LLH A;  2JEE A;  2AEM A;  4JF7 A;  1L0N G;  5HL4 A;  1FDO A;  2QIW A;  1JM1 A;  2WQY C;  5KAI E;  2BMR A;  2FXM A;  1P84 H;  3U1C A;  3LIE A;  2FBW C;  2K88 A;  1LTJ C;  1LTJ B;  1OW7 A;  1SFC B;  3TGU D;  4W7Y A;  4Y99 C;  4IFD K;  2Z5H A;  2FYN C;  2E75 C;  1YBK A;  2FYN B;  5APY A;  2E75 B;  2E74 D;  4PD4 H;  3MD0 A;  1FAV A;  1L0L J;  2KUB A;  1XTG B;  1S5L H;  1KYO D;  4H44 D;  2HR3 A;  3AEC C;  2QM8 A;  4AUW A;  1KQL A;  1NYH A;  2QEX P;  1KMI Z;  2NUM A;  1FZC C;  1RE4 A;  4JPZ B;  2Q6Q A;  2Q3E A;  1OMI A;  3MGN A;  2IBZ E;  2QJP C;  2YVJ B;  3NFQ A;  2JP3 A;  2OYO A;  3M9Q A;  3NTN A;  1BE3 D;  3GTE A;  1S1C X;  2GBX A;  2M0B A;  3CX5 D;  3H6P A;  2W6J H;  3OA7 A;  3H1L J;  1M1K Q;  2OYI B;  1RIE A;  2Y0D A;  3M0D C;  2ZYA A;  3TSI A;  4C7N A;  3V2R A;  1K05 A;  4D6T E;  3P8C D;  1RQV A;  3V2N A;  5E79 E;  1P84 D;  1GDT A;  5AW9 B;  3B5N C;  3TGU G;  3CCQ P;  3B5N B;  3HE5 A;  1BCC E;  4NBG D;  5KJ7 C;  1NTZ K;  1KB9 E;  1IJD B;  4AYC A;  3C9I A;  1NTK D;  1IZN B;  3TNU B;  2K37 A;  3O6Q B;  1ZR2 A;  1KQG B;  3QH9 A;  4PD4 D;  3B8E B;  3CCJ P;  1TU3 F;  2HOD B;  1PGJ A;  3H25 A;  5KLV K;  3D89 A;  1VQL P;  3E1I A;  2M3E A;  5KLI C;  2HFE D;  2P10 A;  5CCH A;  2FYZ A;  4NBH D;  2XSH A;  3SWY A;  1KQS O;  3WUT A;  3L74 E;  2KLU A;  3L36 A;  2JR8 A;  1BE3 G;  2NWF A;  2OAR A;  5AVQ B;  4K35 A;  2E42 A;  3HD7 A;  4L74 A;  3AEE C;  1FZE A;  1PFI A;  2O01 N;  1G8J B;  3UIA A;  1SQX J;  1AFO A;  1QGK B;  3VMH D;  1VCK A;  3QWO C;  1JOC A;  2E74 C;  3II6 A;  2KIK A;  2E74 B;  3H1H D;  1RH5 B;  1YJ9 P;  2E5T A;  4L76 A;  2XR8 A;  5CJ4 A;  1URQ D;  3GCE A;  4H44 C;  3CC7 P;  5KKZ B;  2ZYL A;  3Q5S A;  3L73 J;  1NTK G;  2J59 M;  3KHU A;  2QRX A;  2LXC B;  2K9J B;  3H1L G;  3Q2Y A;  1SQV K;  1KN7 A;  1QX8 A;  1VDF A;  1NU1 E;  3M06 A;  4NB9 D;  1SQB D;  3VMZ A;  4EIJ A;  2IPP A;  1D7M A;  2POH A;  3CWB E;  2KS1 B;  2IBZ I;  2J58 A;  1O7P A;  2A45 I;  4HKV A;  2QM7 A;  3CLQ A;  1QL1 A;  2Y0E A;  3A0B E;  1RY3 A;  2M5A A;  1E5W A;  3GLM A;  4HM0 A;  3GKE A;  1IFD A;  3GZY A;  3I55 P;  1M56 D;  2GA1 A;  3EQQ A;  3C8V A;  3L35 A;  3B4S A;  2Q7C A;  1O7G A;  3CXH H;  1U7J A;  4ZKU A;  2Y9Y A;  4P1C H;  3H1H G;  4ZNC A;  1KB9 I;  3N4X A;  1L0N E;  4KJM A;  1J1D C;  2Q1K A;  3P8M C;  1J1D B;  4I2L C;  4PJ0 H;  3LID A;  1UII A;  1QVF O;  1BDC A;  1GK4 A;  1GTW A;  3HUS C;  5GTI E;  3HUS B;  4O9B A;  4W7Z A;  1GL2 D;  3I56 P;  1M90 Q;  1SQX G;  1SQB G;  1LTA C;  2JWD A;  2WT7 B;  2YO3 A;  3DQY A;  3JCU H;  3H1J J;  1KIL A;  4UB8 E;  1NTZ J;  4DJG A;  2BCC D;  2I7F A;  3AE3 C;  4AIV A;  3AE4 C;  1YJW P;  1ZN5 A;  1LT9 B;  1KV4 A;  1NJI Q;  5AVR B;  1RE3 A;  3HE4 B;  1KOR A;  1BGY J;  2N1T D;  3Q1M A;  3EQ2 A;  3V4Q A;  5KLV J;  2YXQ B;  1FDI A;  3AED C;  2FFD C;  3A5T A;  5TJH A;  3GZX A;  2FFD B;  2NVE A;  1S72 P;  2GUV A;  1K04 A;  3VCA A;  1URQ C;  2AXC A;  3CL3 D;  1QEX A;  1URQ B;  4UB6 E;  1Q90 D;  2KK7 A;  3PHL A;  1NTM K;  3CXH D;  2H89 C;  1SLQ A;  3G3Z A;  3OJA B;  1AVY A;  3SFE C;  1U7M A;  1NDO A;  4NBD D;  1IK7 A;  1SQQ D;  2I1K A;  3WU2 E;  2A06 D;  1H8A A;  3TGU E;  3GHG C;  2HPC A;  2YMY A;  4HJL A;  1HVV A;  1IFM A;  3ABV C;  4HM8 A;  1ZW0 A;  4WY4 D;  2YKP A;  1NGM B;  5CCG A;  2FYU K;  4RKU J;  1CW5 A;  1KYO E;  5AW6 B;  3L72 D;  2BCC G;  1ULJ A;  5BU8 B;  3KZI E;  1O7W A;  1Q81 Q;  2O01 J;  3GHG A;  4NPF X;  4LC1 A;  4EYY Q;  1LP1 B;  1JY3 P;  1PP9 J;  2ZYG A;  4WBA A;  1SP4 A;  4H0L D;  1SFC D;  5AVT B;  4BRY B;  1BE3 E;  2WSS H;  3H1J G;  2DE5 D;  1NTZ G;  2YIU C;  3CX5 E;  4WB4 A;  2YIU B;  2LXB A;  1JMM A;  3AE7 C;  2R44 A;  3FWN A;  2UWJ E;  1ZME C;  2W27 A;  3GG2 A;  2NPS B;  1VQM P;  5TIS H;  1IK9 A;  2KP8 A;  1FU1 A;  1EQ7 A;  2L5G B;  4AAY B;  1SQV D;  1LNQ A;  3T97 A;  1ZRT D;  4QDC A;  3P8C E;  3MTU E;  1GL2 B;  1L4A A;  4NBB D;  1SQQ G;  3FWL A;  5KLV G;  1P84 E;  1IFI A;  2O3J A;  3BCC D;  4QDF B;  2G8Y A;  4ASW A;  1RF0 A;  1Y9B A;  1NTK E;  1N73 C;  1N73 B;  4PD4 E;  1EG9 A;  3L72 G;  2ZFC A;  1HWT C;  2NVF A;  3L37 A;  2N1T C;  4HM3 A;  2XDJ A;  1H89 A;  1R8E A;  4QMA A;  1NO4 A;  4GOF A;  4N3Y B;  2B87 B;  3V2P A;  3GF3 A;  3HTK B;  1Q90 C;  4A7P A;  2PRR A;  3L75 J;  3VMA A;  2RMZ A;  3OAK A;  4I7Z B;  5APV A;  2PAJ A;  1G2C A;  1JY2 P;  4LGD E;  2N9Y B;  1N7S D;  3M9B A;  2E4Q A;  2OQQ A;  1HTL C;  1SQV G;  4U3F J;  3JC2 2;  2OTL P;  1AV1 A;  2KZJ A;  3AE5 C;  2AXT H;  1SQP D;  5CCH D;  5AW0 B;  3H1H E;  3U59 A;  4WY4 C;  3H1K J;  4WY4 B;  3BCC G;  2V7Q J;  1OVV A;  1OW8 A;  4PV1 D;  4DZO A;  3H1I D;  5AVS B;  1FOS F;  1KYO I;  1NTM J;  1T8Z A;  3MUD A;  3AE9 C;  2W6B A;  3V5B A;  3FX0 A;  2I1J A;  2QJK B;  2C0W A;  2XKM A;  3SWF A;  1DX7 A;  1SQB E;  4GOE A;  4EMJ B;  2KLV A;  2B24 A;  1LTS C;  3L70 J;  4C7R A;  4H0L B;  1LGH B;  4JYB A;  1JTH B;  1SFC C;  3L71 J;  3E1R A;  2FYU J;  1UUW A;  3CX5 I;  1LWU B;  3JSV C;  1GD2 E;  2ZYD A;  2SPZ A;  2PGD A;  1PL5 A;  1DEB A;  2O1J A;  4GKG A;  3R4Y A;  1HF9 A;  1P84 I;  1LTJ A;  1DH3 A;  3F5H A;  2Z5I A;  1HJ0 A;  3LW5 J;  1SQP G;  1PIX A;  3CCL P;  1T6A A;  3IFM A;  3PLN A;  5AW8 B;  1HGZ A;  3H1I G;  1L0L D;  4L73 A;  4PD4 I;  4NPE A;  2XZR A;  3TK1 A;  4C7N B;  4QDD A;  4JBZ A;  2OYI C;  1NYK A;  4IL6 X;  4HH2 A;  1FZC A;  2DW3 A;  1S3J A;  2IZ1 A;  3R2P A;  2B88 A;  2BCC E;  4RES B;  3GTS A;  5AVZ B;  2XRX A;  1VQN P;  4R4L A;  4HB1 A;  3OW2 O;  5B66 H;  1N7S C;  2WZ7 A;  2NZ2 A;  1FZB A;  1N7S B;  1YTZ I;  2R32 A;  5H2F H;  3IN6 A;  3H1L D;  4N78 D;  3CCR P;  3M0D A;  2FY8 A;  2WSF J;  1ZP0 C;  1X9V A;  2R3C A;  3AEG C;  3CCU P;  1YYC A;  1MZ9 A;  4PV1 C;  1X0T A;  3B5N A;  4PV1 B;  3BRV B;  1VQK P;  1RFS A;  3CXH E;  5KJ7 A;  2P67 A;  1QVG O;  1M7L A;  3N0Q A;  3TNU A;  4XA4 A;  3O6Q A;  1EZV D;  1L0L G;  3HD7 B;  2YKQ A;  1JY3 O;  1SQQ E;  3MHV A;  3PTZ A;  3CC2 P;  2HMO A;  4JQ0 D;  2A06 E;  1DD4 A;  2KI7 B;  4PJ0 E;  4M3L A;  3VMX A;  2HOD A;  2N9B A;  4L75 A;  1T3J A;  2BAS A;  1PGQ A;  3H32 B;  1HGV A;  1M1J B;  1OWA A;  3AEB C;  3L72 E; 
#chains in the Genus database with same CATH homology
 1KOR A;  3Q1M A;  2BEZ F;  2HMM A;  4GDO A;  4P1B H;  5KKZ C;  3Q5R A;  2NVG A;  1OW6 A;  1ZOY C;  1FDI A;  1KIL E;  3AED C;  3GZX A;  3GOB A;  4NBE D;  1AJY A;  4TT3 H;  2NVE A;  1EXI A;  1K04 A;  1YQ4 C;  3VCA A;  1Q90 D;  5L8R J;  2YFJ A;  3FOU A;  2H89 C;  3SFD C;  1GMJ A;  4QUR A;  1EXJ A;  2HMN A;  3SFE C;  2E76 C;  1NDO A;  2E76 B;  4NBD D;  1IK7 A;  4QCK A;  1SQV E;  3TGU E;  4HJL A;  1ZRT E;  2JZA A;  3ABV C;  4HM8 A;  3BCC E;  4R4M A;  1NGM B;  3AE8 C;  4HM4 A;  4RKU J;  1KYO E;  1VF5 D;  2HML A;  1ULJ A;  1WMK A;  3Q3D A;  2WSE J;  3G9R A;  3H1J E;  3EWK A;  1O7W A;  4OGQ C;  1NTZ E;  4OGQ B;  4HM1 A;  2O01 J;  3AEA C;  2YFI A;  3B71 A;  3Q5P A;  2HMK A;  4H0L D;  2WPV B;  3D6Z A;  1BE3 E;  2DE5 D;  5HL4 A;  1FDO A;  2QIW A;  5KLV E;  2YIU C;  1JM1 A;  3CX5 E;  2WQY C;  2GBW A;  2BMR A;  3AE7 C;  1ZME C;  4HM6 A;  2FBW C;  4AAY B;  2JO6 A;  2JO1 A;  2CKF A;  1DIP A;  1OW7 A;  4QDC A;  2XSO A;  4NBB D;  2FYN C;  1P84 E;  2E75 C;  1S5L X;  2E75 B;  1ULI A;  2E74 D;  4H13 C;  4H13 B;  4QDF B;  2QSI A;  4NBC D;  1YQ3 C;  2G8Y A;  1SQP E;  1Y9B A;  4HM2 A;  4H44 D;  2D2C D;  3AEC C;  1NTK E;  3AZC A;  3H1I E;  1NYH A;  4PD4 E;  1KMI Z;  1EG9 A;  2NUM A;  2NVF A;  4HM3 A;  4H44 B;  1OMI A;  2IBZ E;  2K9Y A;  1R8E A;  2QJP C;  2YVJ B;  1U57 A;  2JP3 A;  3VMI D;  4KT0 J;  3GF3 A;  3GTE A;  1S1C X;  1Q90 C;  2GBX A;  4QUP A;  3GL2 A;  4NBA D;  1RIE A;  4QUQ A;  1PP9 E;  4I7Z B;  2BMQ A;  2E4Q A;  1K05 A;  2OQQ A;  1RQV A;  2MKV A;  4YTP C;  2IDB A;  2B1X A;  4HM5 A;  5BOK A;  3AE5 C;  1BCC E;  3D71 A;  4NBG D;  1KB9 E;  3H1H E;  4Y28 J;  2V7Q J;  3S9O A;  1OW8 A;  5M1B A;  4PV1 D;  3AE6 C;  4HM7 A;  1VF5 C;  1VF5 B;  1KQG B;  5AEU A;  2E4P A;  1MKM A;  1TU3 F;  3AE9 C;  3H25 A;  1L0L E;  3D89 A;  1KTM A;  3FGA D;  3T97 B;  1SQB E;  4EMJ B;  5KLI C;  2B24 A;  2P10 A;  3AEF C;  4NBH D;  2XSH A;  4H0L B;  3L74 E;  2Q3W A;  2ZT9 D;  3GB4 A;  1JB0 J;  1VM9 A;  2BMO A;  1UUW A;  2NWF A;  3AEE C;  1G8J B;  1G8K B;  3VMH D;  1PL5 A;  3L75 E;  1VCK A;  3H1L E;  3IAO A;  2E74 C;  3R4Y A;  2DE7 D;  1HF9 A;  2E74 B;  3GL0 A;  3GF7 A;  4NBF D;  2XR8 A;  1HJ0 A;  3LW5 J;  1PIX A;  3GCE A;  2QJY C;  4H44 C;  2D2C C;  1WQL A;  2ZYL A;  2D2C B;  3Q5S A;  4U3F E;  1KQF B;  4QDF A;  2YMK A;  3Q2Y A;  4YXD C;  2E76 D;  3D6Y A;  1PV3 A;  3H1K E;  2HMJ A;  1NU1 E;  2DE6 D;  3EN1 A;  2NUK A;  1EZV E;  4NB9 D;  4QDD A;  1NYK A;  3CWB E;  2FXP A;  4I7Z C;  4IL6 X;  1O7P A;  1NTM E;  4HKV A;  4Z1M H;  1SJG A;  4XFJ A;  4HM0 A;  3GLM A;  5AEW A;  3GKE A;  2H88 C;  2BCC E;  3GZY A;  1VL2 A;  3GTS A;  2XRX A;  4R4L A;  2BEQ D;  3L70 E;  3EQQ A;  2NZ2 A;  3C8V A;  4OGQ D;  2YFL A;  1RQU A;  3IN6 A;  1O7N A;  3L71 E;  3AE2 C;  1O7G A;  4NB8 D;  2FYU E;  3D70 A;  2WSF J;  1O7M A;  2G3A A;  1ZP0 C;  1O7H A;  4P1C H;  3AE1 C;  3AEG C;  2WSC J;  2QJK C;  1L0N E;  1PPJ E;  4PV1 C;  1SQX E;  4PV1 B;  1RFS A;  3RK3 E;  1UUV A;  3CXH E;  3GMA A;  3C0D A;  4H0L C;  1DD3 A;  3N0Q A;  3O6Q A;  5CXM A;  1SQQ E;  2HMO A;  2A06 E;  1DD4 A;  3L73 E;  1UIX A;  2E75 D;  3RL0 g;  4H13 D;  4U7J A;  3DQY A;  2ZT9 C;  2ZT9 B;  1FQT A;  4AIV A;  2I7F A;  3AE3 C;  3AE4 C;  3VCP A;  3VMG D;  2J5U A;  2QPZ A;  3AEB C;  3L72 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...