1Q90C

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
126
Chain Sequence
b'QAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAEGLVTFSTWTETDFRTGLEPWWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
total genus 22
structure length 126
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1q90C00
1O7WA 4H44D 2DE7D 3H1JE 2GBXA 2HMMA 1SQQE 4NBDD 4P1CH 2YIUC 1SJGA 3BCCE 1NTZE 2E76D 2HMOA 4QDDA 3L74E 4AAYB 2XSHA 4NBFD 4H13D 3DQYA 2ZYLA 3GL0A 4HM5A 1ZRTE 1O7GA 1RFSA 1SQXE 2HMLA 1G8JB 5AEUA 3C0DA 2HMJA 4HJLA 2BMRA 4HM3A 1JM1A 2FYNC 2DE6D 2YFIA 2XR8A 4QURA 5AEWA 1FQTA 2B1XA 2QJKC 3GKEA 2HMKA 1NTME 3L70E 4PD4E 3L72E 2NUMA 3GCEA 2I7FA 3VCPA 3VMID 1UUVA 2GBWA 1NU1E 4NBBD 4HM1A 1P84E 4HM8A 2NVEA 2BCCE 3D89A 1BCCE 4NBGD 3VCAA 2QPZA 1NTKE 4HM2A 4EMJB 2YVJB 2QJPC 4AIVA 1Q90C 3GL2A 1VM9A 5CXMA 2E75D 4QDFA 3GTEA 1EG9A 2BMOA 1VCKA 2JO6A 3CWBE 3L75E 2NVFA 4QUPA 5KLIC 1PPJE 3GZYA 3L71E 4HM6A 1BE3E 2CKFA 5KKZC 1WQLA 3CXHE 1VF5D 1L0NE 1SQBE 2IBZE 1L0LE 5KLVE 2Q3WA 2NUKA 1O7PA 4U3FE 1SQPE 3H1IE 2DE5D 4NB9D 2XRXA 4HM4A 3VMGD 2QJYC 4HM0A 3CX5E 2D2CD 4P1BH 3FOUA 4QUQA 1KYOE 3EQQA 4NBED 2ZT9D 3GTSA 1G8KB 3TGUE 2BMQA 2E4PA 3L73E 3GB4A 1NYKA 1EZVE 1O7MA 4QDFB 1KB9E 1RIEA 1SQVE 3H1HE 1UUWA 3H1KE 1O7NA 3EN1A 2B24A 2NVGA 3GOBA 1NDOA 4NB8D 4NBHD 2A06E 1PP9E 1O7HA 2NWFA 4HM7A 3VMHD 2YFJA 4HKVA 4NBAD 2E74D 3GZXA 4H0LD 2YFLA 5HL4A 3AZCA 4PV1D 4QCKA 1ULIA 1ULJA 2E4QA 3N0QA 3H1LE 4NBCD 2XSOA 2FYUE 5BOKA 2JZAA 4QDCA 4OGQD 2HMNA
chains in the Genus database with same CATH superfamily
1O7WA 4H44D 2DE7D 3H1JE 2GBXA 2HMMA 1SQQE 4NBDD 4P1CH 2YIUC 1SJGA 3BCCE 1NTZE 2E76D 2HMOA 4QDDA 3L74E 4AAYB 2XSHA 4NBFD 4H13D 3DQYA 2ZYLA 3GL0A 4HM5A 1ZRTE 1O7GA 1RFSA 1SQXE 2HMLA 1G8JB 5AEUA 3C0DA 2HMJA 4HJLA 2BMRA 4HM3A 1JM1A 2FYNC 2DE6D 2YFIA 2XR8A 4QURA 5AEWA 1FQTA 2B1XA 2QJKC 3GKEA 2HMKA 1NTME 3L70E 4PD4E 3L72E 2NUMA 3GCEA 2I7FA 3VCPA 3VMID 1UUVA 2GBWA 1NU1E 4NBBD 4HM1A 1P84E 4HM8A 2NVEA 2BCCE 3D89A 1BCCE 4NBGD 3VCAA 2QPZA 1NTKE 4HM2A 4EMJB 2YVJB 2QJPC 4AIVA 1Q90C 3GL2A 1VM9A 5CXMA 2E75D 4QDFA 3GTEA 1EG9A 2BMOA 1VCKA 2JO6A 3CWBE 3L75E 2NVFA 4QUPA 5KLIC 1PPJE 3GZYA 3L71E 4HM6A 1BE3E 2CKFA 5KKZC 1WQLA 3CXHE 1VF5D 1L0NE 1SQBE 2IBZE 1L0LE 5KLVE 2Q3WA 2NUKA 1O7PA 4U3FE 1SQPE 3H1IE 2DE5D 4NB9D 2XRXA 4HM4A 3VMGD 2QJYC 4HM0A 3CX5E 2D2CD 4P1BH 3FOUA 4QUQA 1KYOE 3EQQA 4NBED 2ZT9D 3GTSA 1G8KB 3TGUE 2BMQA 2E4PA 3L73E 3GB4A 1NYKA 1EZVE 1O7MA 4QDFB 1KB9E 1RIEA 1SQVE 3H1HE 1UUWA 3H1KE 1O7NA 3EN1A 2B24A 2NVGA 3GOBA 1NDOA 4NB8D 4NBHD 2A06E 1PP9E 1O7HA 2NWFA 4HM7A 3VMHD 2YFJA 4HKVA 4NBAD 2E74D 3GZXA 4H0LD 2YFLA 5HL4A 3AZCA 4PV1D 4QCKA 1ULIA 1ULJA 2E4QA 3N0QA 3H1LE 4NBCD 2XSOA 2FYUE 5BOKA 2JZAA 4QDCA 4OGQD 2HMNA
chains in the Genus database with same CATH topology
1O7WA 4H44D 2DE7D 3H1JE 2GBXA 2HMMA 1SQQE 4NBDD 4P1CH 2YIUC 1SJGA 3BCCE 1NTZE 2E76D 2HMOA 4QDDA 3L74E 4AAYB 2XSHA 4NBFD 4H13D 3DQYA 2ZYLA 3GL0A 4HM5A 1ZRTE 1O7GA 1RFSA 1SQXE 2HMLA 1G8JB 5AEUA 3C0DA 2HMJA 4HJLA 2BMRA 4HM3A 1JM1A 2FYNC 2DE6D 2YFIA 2XR8A 4QURA 5AEWA 1FQTA 2B1XA 2QJKC 3GKEA 2HMKA 1NTME 3L70E 4PD4E 3L72E 2NUMA 3GCEA 2I7FA 3VCPA 3VMID 1UUVA 2GBWA 1NU1E 4NBBD 4HM1A 1P84E 4HM8A 2NVEA 2BCCE 3D89A 1BCCE 4NBGD 3VCAA 2QPZA 1NTKE 4HM2A 4EMJB 2YVJB 2QJPC 4AIVA 1Q90C 3GL2A 1VM9A 5CXMA 2E75D 4QDFA 3GTEA 1EG9A 2BMOA 1VCKA 2JO6A 3CWBE 3L75E 2NVFA 4QUPA 5KLIC 1PPJE 3GZYA 3L71E 4HM6A 1BE3E 2CKFA 5KKZC 1WQLA 3CXHE 1VF5D 1L0NE 1SQBE 2IBZE 1L0LE 5KLVE 2Q3WA 2NUKA 1O7PA 4U3FE 1SQPE 3H1IE 2DE5D 4NB9D 2XRXA 4HM4A 3VMGD 2QJYC 4HM0A 3CX5E 2D2CD 4P1BH 3FOUA 4QUQA 1KYOE 3EQQA 4NBED 2ZT9D 3GTSA 1G8KB 3TGUE 2BMQA 2E4PA 3L73E 3GB4A 1NYKA 1EZVE 1O7MA 4QDFB 1KB9E 1RIEA 1SQVE 3H1HE 1UUWA 3H1KE 1O7NA 3EN1A 2B24A 2NVGA 3GOBA 1NDOA 4NB8D 4NBHD 2A06E 1PP9E 1O7HA 2NWFA 4HM7A 3VMHD 2YFJA 4HKVA 4NBAD 2E74D 3GZXA 4H0LD 2YFLA 5HL4A 3AZCA 4PV1D 4QCKA 1ULIA 1ULJA 2E4QA 3N0QA 3H1LE 4NBCD 2XSOA 2FYUE 5BOKA 2JZAA 4QDCA 4OGQD 2HMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7W A;  4H44 D;  2DE7 D;  3H1J E;  2GBX A;  2HMM A;  1SQQ E;  4NBD D;  4P1C H;  2YIU C;  1SJG A;  3BCC E;  1NTZ E;  2E76 D;  2HMO A;  4QDD A;  3L74 E;  4AAY B;  2XSH A;  4NBF D;  4H13 D;  3DQY A;  2ZYL A;  3GL0 A;  4HM5 A;  1ZRT E;  1O7G A;  1RFS A;  1SQX E;  2HML A;  1G8J B;  5AEU A;  3C0D A;  2HMJ A;  4HJL A;  2BMR A;  4HM3 A;  1JM1 A;  2FYN C;  2DE6 D;  2YFI A;  2XR8 A;  4QUR A;  5AEW A;  1FQT A;  2B1X A;  2QJK C;  3GKE A;  2HMK A;  1NTM E;  3L70 E;  4PD4 E;  3L72 E;  2NUM A;  3GCE A;  2I7F A;  3VCP A;  3VMI D;  1UUV A;  2GBW A;  1NU1 E;  4NBB D;  4HM1 A;  1P84 E;  4HM8 A;  2NVE A;  2BCC E;  3D89 A;  1BCC E;  4NBG D;  3VCA A;  2QPZ A;  1NTK E;  4HM2 A;  4EMJ B;  2YVJ B;  2QJP C;  4AIV A;  1Q90 C;  3GL2 A;  1VM9 A;  5CXM A;  2E75 D;  4QDF A;  3GTE A;  1EG9 A;  2BMO A;  1VCK A;  2JO6 A;  3CWB E;  3L75 E;  2NVF A;  4QUP A;  5KLI C;  1PPJ E;  3GZY A;  3L71 E;  4HM6 A;  1BE3 E;  2CKF A;  5KKZ C;  1WQL A;  3CXH E;  1VF5 D;  1L0N E;  1SQB E;  2IBZ E;  1L0L E;  5KLV E;  2Q3W A;  2NUK A;  1O7P A;  4U3F E;  1SQP E;  3H1I E;  2DE5 D;  4NB9 D;  2XRX A;  4HM4 A;  3VMG D;  2QJY C;  4HM0 A;  3CX5 E;  2D2C D;  4P1B H;  3FOU A;  4QUQ A;  1KYO E;  3EQQ A;  4NBE D;  2ZT9 D;  3GTS A;  1G8K B;  3TGU E;  2BMQ A;  2E4P A;  3L73 E;  3GB4 A;  1NYK A;  1EZV E;  1O7M A;  4QDF B;  1KB9 E;  1RIE A;  1SQV E;  3H1H E;  1UUW A;  3H1K E;  1O7N A;  3EN1 A;  2B24 A;  2NVG A;  3GOB A;  1NDO A;  4NB8 D;  4NBH D;  2A06 E;  1PP9 E;  1O7H A;  2NWF A;  4HM7 A;  3VMH D;  2YFJ A;  4HKV A;  4NBA D;  2E74 D;  3GZX A;  4H0L D;  2YFL A;  5HL4 A;  3AZC A;  4PV1 D;  4QCK A;  1ULI A;  1ULJ A;  2E4Q A;  3N0Q A;  3H1L E;  4NBC D;  2XSO A;  2FYU E;  5BOK A;  2JZA A;  4QDC A;  4OGQ D;  2HMN A; 
#chains in the Genus database with same CATH topology
 1O7W A;  4H44 D;  2DE7 D;  3H1J E;  2GBX A;  2HMM A;  1SQQ E;  4NBD D;  4P1C H;  2YIU C;  1SJG A;  3BCC E;  1NTZ E;  2E76 D;  2HMO A;  4QDD A;  3L74 E;  4AAY B;  2XSH A;  4NBF D;  4H13 D;  3DQY A;  2ZYL A;  3GL0 A;  4HM5 A;  1ZRT E;  1O7G A;  1RFS A;  1SQX E;  2HML A;  1G8J B;  5AEU A;  3C0D A;  2HMJ A;  4HJL A;  2BMR A;  4HM3 A;  1JM1 A;  2FYN C;  2DE6 D;  2YFI A;  2XR8 A;  4QUR A;  5AEW A;  1FQT A;  2B1X A;  2QJK C;  3GKE A;  2HMK A;  1NTM E;  3L70 E;  4PD4 E;  3L72 E;  2NUM A;  3GCE A;  2I7F A;  3VCP A;  3VMI D;  1UUV A;  2GBW A;  1NU1 E;  4NBB D;  4HM1 A;  1P84 E;  4HM8 A;  2NVE A;  2BCC E;  3D89 A;  1BCC E;  4NBG D;  3VCA A;  2QPZ A;  1NTK E;  4HM2 A;  4EMJ B;  2YVJ B;  2QJP C;  4AIV A;  1Q90 C;  3GL2 A;  1VM9 A;  5CXM A;  2E75 D;  4QDF A;  3GTE A;  1EG9 A;  2BMO A;  1VCK A;  2JO6 A;  3CWB E;  3L75 E;  2NVF A;  4QUP A;  5KLI C;  1PPJ E;  3GZY A;  3L71 E;  4HM6 A;  1BE3 E;  2CKF A;  5KKZ C;  1WQL A;  3CXH E;  1VF5 D;  1L0N E;  1SQB E;  2IBZ E;  1L0L E;  5KLV E;  2Q3W A;  2NUK A;  1O7P A;  4U3F E;  1SQP E;  3H1I E;  2DE5 D;  4NB9 D;  2XRX A;  4HM4 A;  3VMG D;  2QJY C;  4HM0 A;  3CX5 E;  2D2C D;  4P1B H;  3FOU A;  4QUQ A;  1KYO E;  3EQQ A;  4NBE D;  2ZT9 D;  3GTS A;  1G8K B;  3TGU E;  2BMQ A;  2E4P A;  3L73 E;  3GB4 A;  1NYK A;  1EZV E;  1O7M A;  4QDF B;  1KB9 E;  1RIE A;  1SQV E;  3H1H E;  1UUW A;  3H1K E;  1O7N A;  3EN1 A;  2B24 A;  2NVG A;  3GOB A;  1NDO A;  4NB8 D;  4NBH D;  2A06 E;  1PP9 E;  1O7H A;  2NWF A;  4HM7 A;  3VMH D;  2YFJ A;  4HKV A;  4NBA D;  2E74 D;  3GZX A;  4H0L D;  2YFL A;  5HL4 A;  3AZC A;  4PV1 D;  4QCK A;  1ULI A;  1ULJ A;  2E4Q A;  3N0Q A;  3H1L E;  4NBC D;  2XSO A;  2FYU E;  5BOK A;  2JZA A;  4QDC A;  4OGQ D;  2HMN A; 
#chains in the Genus database with same CATH homology
 1O7W A;  4H44 D;  2DE7 D;  3H1J E;  2GBX A;  2HMM A;  1SQQ E;  4NBD D;  4P1C H;  2YIU C;  1SJG A;  3BCC E;  1NTZ E;  2E76 D;  2HMO A;  4QDD A;  3L74 E;  4AAY B;  2XSH A;  4NBF D;  4H13 D;  3DQY A;  2ZYL A;  3GL0 A;  4HM5 A;  1ZRT E;  1O7G A;  1RFS A;  1SQX E;  2HML A;  1G8J B;  5AEU A;  3C0D A;  2HMJ A;  4HJL A;  2BMR A;  4HM3 A;  1JM1 A;  2FYN C;  2DE6 D;  2YFI A;  2XR8 A;  4QUR A;  5AEW A;  1FQT A;  2B1X A;  2QJK C;  3GKE A;  2HMK A;  1NTM E;  3L70 E;  4PD4 E;  3L72 E;  2NUM A;  3GCE A;  2I7F A;  3VCP A;  3VMI D;  1UUV A;  2GBW A;  1NU1 E;  4NBB D;  4HM1 A;  1P84 E;  4HM8 A;  2NVE A;  2BCC E;  3D89 A;  1BCC E;  4NBG D;  3VCA A;  2QPZ A;  1NTK E;  4HM2 A;  4EMJ B;  2YVJ B;  2QJP C;  4AIV A;  1Q90 C;  3GL2 A;  1VM9 A;  5CXM A;  2E75 D;  4QDF A;  3GTE A;  1EG9 A;  2BMO A;  1VCK A;  2JO6 A;  3CWB E;  3L75 E;  2NVF A;  4QUP A;  5KLI C;  1PPJ E;  3GZY A;  3L71 E;  4HM6 A;  1BE3 E;  2CKF A;  5KKZ C;  1WQL A;  3CXH E;  1VF5 D;  1L0N E;  1SQB E;  2IBZ E;  1L0L E;  5KLV E;  2Q3W A;  2NUK A;  1O7P A;  4U3F E;  1SQP E;  3H1I E;  2DE5 D;  4NB9 D;  2XRX A;  4HM4 A;  3VMG D;  2QJY C;  4HM0 A;  3CX5 E;  2D2C D;  4P1B H;  3FOU A;  4QUQ A;  1KYO E;  3EQQ A;  4NBE D;  2ZT9 D;  3GTS A;  1G8K B;  3TGU E;  2BMQ A;  2E4P A;  3L73 E;  3GB4 A;  1NYK A;  1EZV E;  1O7M A;  4QDF B;  1KB9 E;  1RIE A;  1SQV E;  3H1H E;  1UUW A;  3H1K E;  1O7N A;  3EN1 A;  2B24 A;  2NVG A;  3GOB A;  1NDO A;  4NB8 D;  4NBH D;  2A06 E;  1PP9 E;  1O7H A;  2NWF A;  4HM7 A;  3VMH D;  2YFJ A;  4HKV A;  4NBA D;  2E74 D;  3GZX A;  4H0L D;  2YFL A;  5HL4 A;  3AZC A;  4PV1 D;  4QCK A;  1ULI A;  1ULJ A;  2E4Q A;  3N0Q A;  3H1L E;  4NBC D;  2XSO A;  2FYU E;  5BOK A;  2JZA A;  4QDC A;  4OGQ D;  2HMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...