1Q90C

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
126
Chain Sequence
QAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAEGLVTFSTWTETDFRTGLEPWWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
molecule keywords Apocytochrome f
total genus 22
structure length 126
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1q90C00
4AIVA 2FYNC 2NWFA 2A06E 2BMQA 1SJGA 2YIUC 2DE6D 1NDOA 4QDCA 2YFLA 3VMGD 4H13D 1SQPE 4U3FE 2I7FA 2HMMA 3L74E 5KLVE 3GL0A 3GL2A 3H1IE 5KKZC 2ZT9D 2NVFA 3GTEA 1BCCE 1VF5D 2YFJA 5BOKA 2E76D 1RIEA 1SQVE 2B24A 3DQYA 4QCKA 2NUMA 3GZXA 3BCCE 4PD4E 2HMOA 4HM6A 1SQBE 4OGQD 1Q90C 2YFIA 3VCPA 2E75D 1PPJE 2XSHA 2NVGA 1JM1A 3H1LE 2E4QA 2CKFA 2HMKA 2YVJB 1NU1E 1SQXE 3L71E 2JO6A 3GOBA 5CXMA 2XRXA 3GTSA 3EN1A 4QURA 4NB9D 1O7GA 2QJKC 3L70E 5HL4A 5AEUA 5KLIC 4NBDD 3GCEA 3L75E 4HM2A 2B1XA 2E74D 1UUWA 4QUPA 3CWBE 3EQQA 4HM7A 2GBXA 4NB8D 2XSOA 1G8KB 2HMLA 3L73E 2IBZE 3FOUA 4H0LD 4NBAD 2GBWA 1O7WA 4NBED 2QJPC 1ULJA 2D2CD 2JZAA 3H1KE 4NBBD 1O7NA 3GB4A 4QUQA 4HM3A 2DE7D 2HMNA 2ZYLA 4NBCD 1KB9E 2E4PA 4NBFD 1O7PA 1VM9A 3C0DA 4HM1A 2NUKA 1O7MA 3GZYA 1UUVA 1WQLA 1VCKA 1ZRTE 1RFSA 1FQTA 1ULIA 1EG9A 1NTKE 4AAYB 2QJYC 3D89A 3TGUE 1EZVE 3AZCA 2BMRA 4H44D 4HJLA 4NBGD 1O7HA 2Q3WA 3CX5E 4QDFA 1P84E 1NTZE 1NYKA 4P1CH 1PP9E 4PV1D 2QPZA 4QDFB 2DE5D 2BCCE 4QDDA 1L0NE 3VMID 1G8JB 2XR8A 5AEWA 3CXHE 4HM0A 1L0LE 4EMJB 3VMHD 3GKEA 2BMOA 4HKVA 1SQQE 3L72E 2NVEA 4HM4A 1NTME 4HM8A 4NBHD 4HM5A 1BE3E 4P1BH 3H1HE 1KYOE 3H1JE 2FYUE 3VCAA 3N0QA 2HMJA
chains in the Genus database with same CATH superfamily
4AIVA 2FYNC 2NWFA 2A06E 2BMQA 1SJGA 2YIUC 2DE6D 1NDOA 4QDCA 2YFLA 3VMGD 4H13D 1SQPE 4U3FE 2I7FA 2HMMA 3L74E 5KLVE 3GL0A 3GL2A 3H1IE 5KKZC 2ZT9D 2NVFA 3GTEA 1BCCE 1VF5D 2YFJA 5BOKA 2E76D 1RIEA 1SQVE 2B24A 3DQYA 4QCKA 2NUMA 3GZXA 3BCCE 4PD4E 2HMOA 4HM6A 1SQBE 4OGQD 1Q90C 2YFIA 3VCPA 2E75D 1PPJE 2XSHA 2NVGA 1JM1A 3H1LE 2E4QA 2CKFA 2HMKA 2YVJB 1NU1E 1SQXE 3L71E 2JO6A 3GOBA 5CXMA 2XRXA 3GTSA 3EN1A 4QURA 4NB9D 1O7GA 2QJKC 3L70E 5HL4A 5AEUA 5KLIC 4NBDD 3GCEA 3L75E 4HM2A 2B1XA 2E74D 1UUWA 4QUPA 3CWBE 3EQQA 4HM7A 2GBXA 4NB8D 2XSOA 1G8KB 2HMLA 3L73E 2IBZE 3FOUA 4H0LD 4NBAD 2GBWA 1O7WA 4NBED 2QJPC 1ULJA 2D2CD 2JZAA 3H1KE 4NBBD 1O7NA 3GB4A 4QUQA 4HM3A 2DE7D 2HMNA 2ZYLA 4NBCD 1KB9E 2E4PA 4NBFD 1O7PA 1VM9A 3C0DA 4HM1A 2NUKA 1O7MA 3GZYA 1UUVA 1WQLA 1VCKA 1ZRTE 1RFSA 1FQTA 1ULIA 1EG9A 1NTKE 4AAYB 2QJYC 3D89A 3TGUE 1EZVE 3AZCA 2BMRA 4H44D 4HJLA 4NBGD 1O7HA 2Q3WA 3CX5E 4QDFA 1P84E 1NTZE 1NYKA 4P1CH 1PP9E 4PV1D 2QPZA 4QDFB 2DE5D 2BCCE 4QDDA 1L0NE 3VMID 1G8JB 2XR8A 5AEWA 3CXHE 4HM0A 1L0LE 4EMJB 3VMHD 3GKEA 2BMOA 4HKVA 1SQQE 3L72E 2NVEA 4HM4A 1NTME 4HM8A 4NBHD 4HM5A 1BE3E 4P1BH 3H1HE 1KYOE 3H1JE 2FYUE 3VCAA 3N0QA 2HMJA
chains in the Genus database with same CATH topology
4AIVA 2FYNC 2NWFA 2A06E 2BMQA 1SJGA 2YIUC 2DE6D 1NDOA 4QDCA 2YFLA 3VMGD 4H13D 1SQPE 4U3FE 2I7FA 2HMMA 3L74E 5KLVE 3GL0A 3GL2A 3H1IE 5KKZC 2ZT9D 2NVFA 3GTEA 1BCCE 1VF5D 2YFJA 5BOKA 2E76D 1RIEA 1SQVE 2B24A 3DQYA 4QCKA 2NUMA 3GZXA 3BCCE 4PD4E 2HMOA 4HM6A 1SQBE 4OGQD 1Q90C 2YFIA 3VCPA 2E75D 1PPJE 2XSHA 2NVGA 1JM1A 3H1LE 2E4QA 2CKFA 2HMKA 2YVJB 1NU1E 1SQXE 3L71E 2JO6A 3GOBA 5CXMA 2XRXA 3GTSA 3EN1A 4QURA 4NB9D 1O7GA 2QJKC 3L70E 5HL4A 5AEUA 5KLIC 4NBDD 3GCEA 3L75E 4HM2A 2B1XA 2E74D 1UUWA 4QUPA 3CWBE 3EQQA 4HM7A 2GBXA 4NB8D 2XSOA 1G8KB 2HMLA 3L73E 2IBZE 3FOUA 4H0LD 4NBAD 2GBWA 1O7WA 4NBED 2QJPC 1ULJA 2D2CD 2JZAA 3H1KE 4NBBD 1O7NA 3GB4A 4QUQA 4HM3A 2DE7D 2HMNA 2ZYLA 4NBCD 1KB9E 2E4PA 4NBFD 1O7PA 1VM9A 3C0DA 4HM1A 2NUKA 1O7MA 3GZYA 1UUVA 1WQLA 1VCKA 1ZRTE 1RFSA 1FQTA 1ULIA 1EG9A 1NTKE 4AAYB 2QJYC 3D89A 3TGUE 1EZVE 3AZCA 2BMRA 4H44D 4HJLA 4NBGD 1O7HA 2Q3WA 3CX5E 4QDFA 1P84E 1NTZE 1NYKA 4P1CH 1PP9E 4PV1D 2QPZA 4QDFB 2DE5D 2BCCE 4QDDA 1L0NE 3VMID 1G8JB 2XR8A 5AEWA 3CXHE 4HM0A 1L0LE 4EMJB 3VMHD 3GKEA 2BMOA 4HKVA 1SQQE 3L72E 2NVEA 4HM4A 1NTME 4HM8A 4NBHD 4HM5A 1BE3E 4P1BH 3H1HE 1KYOE 3H1JE 2FYUE 3VCAA 3N0QA 2HMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AIV A;  2FYN C;  2NWF A;  2A06 E;  2BMQ A;  1SJG A;  2YIU C;  2DE6 D;  1NDO A;  4QDC A;  2YFL A;  3VMG D;  4H13 D;  1SQP E;  4U3F E;  2I7F A;  2HMM A;  3L74 E;  5KLV E;  3GL0 A;  3GL2 A;  3H1I E;  5KKZ C;  2ZT9 D;  2NVF A;  3GTE A;  1BCC E;  1VF5 D;  2YFJ A;  5BOK A;  2E76 D;  1RIE A;  1SQV E;  2B24 A;  3DQY A;  4QCK A;  2NUM A;  3GZX A;  3BCC E;  4PD4 E;  2HMO A;  4HM6 A;  1SQB E;  4OGQ D;  1Q90 C;  2YFI A;  3VCP A;  2E75 D;  1PPJ E;  2XSH A;  2NVG A;  1JM1 A;  3H1L E;  2E4Q A;  2CKF A;  2HMK A;  2YVJ B;  1NU1 E;  1SQX E;  3L71 E;  2JO6 A;  3GOB A;  5CXM A;  2XRX A;  3GTS A;  3EN1 A;  4QUR A;  4NB9 D;  1O7G A;  2QJK C;  3L70 E;  5HL4 A;  5AEU A;  5KLI C;  4NBD D;  3GCE A;  3L75 E;  4HM2 A;  2B1X A;  2E74 D;  1UUW A;  4QUP A;  3CWB E;  3EQQ A;  4HM7 A;  2GBX A;  4NB8 D;  2XSO A;  1G8K B;  2HML A;  3L73 E;  2IBZ E;  3FOU A;  4H0L D;  4NBA D;  2GBW A;  1O7W A;  4NBE D;  2QJP C;  1ULJ A;  2D2C D;  2JZA A;  3H1K E;  4NBB D;  1O7N A;  3GB4 A;  4QUQ A;  4HM3 A;  2DE7 D;  2HMN A;  2ZYL A;  4NBC D;  1KB9 E;  2E4P A;  4NBF D;  1O7P A;  1VM9 A;  3C0D A;  4HM1 A;  2NUK A;  1O7M A;  3GZY A;  1UUV A;  1WQL A;  1VCK A;  1ZRT E;  1RFS A;  1FQT A;  1ULI A;  1EG9 A;  1NTK E;  4AAY B;  2QJY C;  3D89 A;  3TGU E;  1EZV E;  3AZC A;  2BMR A;  4H44 D;  4HJL A;  4NBG D;  1O7H A;  2Q3W A;  3CX5 E;  4QDF A;  1P84 E;  1NTZ E;  1NYK A;  4P1C H;  1PP9 E;  4PV1 D;  2QPZ A;  4QDF B;  2DE5 D;  2BCC E;  4QDD A;  1L0N E;  3VMI D;  1G8J B;  2XR8 A;  5AEW A;  3CXH E;  4HM0 A;  1L0L E;  4EMJ B;  3VMH D;  3GKE A;  2BMO A;  4HKV A;  1SQQ E;  3L72 E;  2NVE A;  4HM4 A;  1NTM E;  4HM8 A;  4NBH D;  4HM5 A;  1BE3 E;  4P1B H;  3H1H E;  1KYO E;  3H1J E;  2FYU E;  3VCA A;  3N0Q A;  2HMJ A; 
#chains in the Genus database with same CATH topology
 4AIV A;  2FYN C;  2NWF A;  2A06 E;  2BMQ A;  1SJG A;  2YIU C;  2DE6 D;  1NDO A;  4QDC A;  2YFL A;  3VMG D;  4H13 D;  1SQP E;  4U3F E;  2I7F A;  2HMM A;  3L74 E;  5KLV E;  3GL0 A;  3GL2 A;  3H1I E;  5KKZ C;  2ZT9 D;  2NVF A;  3GTE A;  1BCC E;  1VF5 D;  2YFJ A;  5BOK A;  2E76 D;  1RIE A;  1SQV E;  2B24 A;  3DQY A;  4QCK A;  2NUM A;  3GZX A;  3BCC E;  4PD4 E;  2HMO A;  4HM6 A;  1SQB E;  4OGQ D;  1Q90 C;  2YFI A;  3VCP A;  2E75 D;  1PPJ E;  2XSH A;  2NVG A;  1JM1 A;  3H1L E;  2E4Q A;  2CKF A;  2HMK A;  2YVJ B;  1NU1 E;  1SQX E;  3L71 E;  2JO6 A;  3GOB A;  5CXM A;  2XRX A;  3GTS A;  3EN1 A;  4QUR A;  4NB9 D;  1O7G A;  2QJK C;  3L70 E;  5HL4 A;  5AEU A;  5KLI C;  4NBD D;  3GCE A;  3L75 E;  4HM2 A;  2B1X A;  2E74 D;  1UUW A;  4QUP A;  3CWB E;  3EQQ A;  4HM7 A;  2GBX A;  4NB8 D;  2XSO A;  1G8K B;  2HML A;  3L73 E;  2IBZ E;  3FOU A;  4H0L D;  4NBA D;  2GBW A;  1O7W A;  4NBE D;  2QJP C;  1ULJ A;  2D2C D;  2JZA A;  3H1K E;  4NBB D;  1O7N A;  3GB4 A;  4QUQ A;  4HM3 A;  2DE7 D;  2HMN A;  2ZYL A;  4NBC D;  1KB9 E;  2E4P A;  4NBF D;  1O7P A;  1VM9 A;  3C0D A;  4HM1 A;  2NUK A;  1O7M A;  3GZY A;  1UUV A;  1WQL A;  1VCK A;  1ZRT E;  1RFS A;  1FQT A;  1ULI A;  1EG9 A;  1NTK E;  4AAY B;  2QJY C;  3D89 A;  3TGU E;  1EZV E;  3AZC A;  2BMR A;  4H44 D;  4HJL A;  4NBG D;  1O7H A;  2Q3W A;  3CX5 E;  4QDF A;  1P84 E;  1NTZ E;  1NYK A;  4P1C H;  1PP9 E;  4PV1 D;  2QPZ A;  4QDF B;  2DE5 D;  2BCC E;  4QDD A;  1L0N E;  3VMI D;  1G8J B;  2XR8 A;  5AEW A;  3CXH E;  4HM0 A;  1L0L E;  4EMJ B;  3VMH D;  3GKE A;  2BMO A;  4HKV A;  1SQQ E;  3L72 E;  2NVE A;  4HM4 A;  1NTM E;  4HM8 A;  4NBH D;  4HM5 A;  1BE3 E;  4P1B H;  3H1H E;  1KYO E;  3H1J E;  2FYU E;  3VCA A;  3N0Q A;  2HMJ A; 
#chains in the Genus database with same CATH homology
 4AIV A;  2FYN C;  2NWF A;  2A06 E;  2BMQ A;  1SJG A;  2YIU C;  2DE6 D;  1NDO A;  4QDC A;  2YFL A;  3VMG D;  4H13 D;  1SQP E;  4U3F E;  2I7F A;  2HMM A;  3L74 E;  5KLV E;  3GL0 A;  3GL2 A;  3H1I E;  5KKZ C;  2ZT9 D;  2NVF A;  3GTE A;  1BCC E;  1VF5 D;  2YFJ A;  5BOK A;  2E76 D;  1RIE A;  1SQV E;  2B24 A;  3DQY A;  4QCK A;  2NUM A;  3GZX A;  3BCC E;  4PD4 E;  2HMO A;  4HM6 A;  1SQB E;  4OGQ D;  1Q90 C;  2YFI A;  3VCP A;  2E75 D;  1PPJ E;  2XSH A;  2NVG A;  1JM1 A;  3H1L E;  2E4Q A;  2CKF A;  2HMK A;  2YVJ B;  1NU1 E;  1SQX E;  3L71 E;  2JO6 A;  3GOB A;  5CXM A;  2XRX A;  3GTS A;  3EN1 A;  4QUR A;  4NB9 D;  1O7G A;  2QJK C;  3L70 E;  5HL4 A;  5AEU A;  5KLI C;  4NBD D;  3GCE A;  3L75 E;  4HM2 A;  2B1X A;  2E74 D;  1UUW A;  4QUP A;  3CWB E;  3EQQ A;  4HM7 A;  2GBX A;  4NB8 D;  2XSO A;  1G8K B;  2HML A;  3L73 E;  2IBZ E;  3FOU A;  4H0L D;  4NBA D;  2GBW A;  1O7W A;  4NBE D;  2QJP C;  1ULJ A;  2D2C D;  2JZA A;  3H1K E;  4NBB D;  1O7N A;  3GB4 A;  4QUQ A;  4HM3 A;  2DE7 D;  2HMN A;  2ZYL A;  4NBC D;  1KB9 E;  2E4P A;  4NBF D;  1O7P A;  1VM9 A;  3C0D A;  4HM1 A;  2NUK A;  1O7M A;  3GZY A;  1UUV A;  1WQL A;  1VCK A;  1ZRT E;  1RFS A;  1FQT A;  1ULI A;  1EG9 A;  1NTK E;  4AAY B;  2QJY C;  3D89 A;  3TGU E;  1EZV E;  3AZC A;  2BMR A;  4H44 D;  4HJL A;  4NBG D;  1O7H A;  2Q3W A;  3CX5 E;  4QDF A;  1P84 E;  1NTZ E;  1NYK A;  4P1C H;  1PP9 E;  4PV1 D;  2QPZ A;  4QDF B;  2DE5 D;  2BCC E;  4QDD A;  1L0N E;  3VMI D;  1G8J B;  2XR8 A;  5AEW A;  3CXH E;  4HM0 A;  1L0L E;  4EMJ B;  3VMH D;  3GKE A;  2BMO A;  4HKV A;  1SQQ E;  3L72 E;  2NVE A;  4HM4 A;  1NTM E;  4HM8 A;  4NBH D;  4HM5 A;  1BE3 E;  4P1B H;  3H1H E;  1KYO E;  3H1J E;  2FYU E;  3VCA A;  3N0Q A;  2HMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...