1Q90C

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
126
Chain Sequence
QAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAEGLVTFSTWTETDFRTGLEPWWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 22
structure length 126
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1q90C00
4NBAD 4H13D 2HMNA 3GZXA 1ZRTE 2HMMA 3CX5E 4OGQD 1WQLA 2D2CD 3AZCA 2BCCE 3VCPA 4NB8D 2BMRA 2NVGA 2DE5D 4QCKA 2FYNC 4HM3A 1RIEA 3D89A 4AAYB 2BMQA 4P1BH 4HM2A 3GTSA 3CWBE 1G8KB 1VF5D 2E75D 4NBDD 1O7WA 3L72E 4NBBD 4H44D 3VCAA 2NUKA 2E76D 1KB9E 4PV1D 3FOUA 1NU1E 4HKVA 2QPZA 3EQQA 4NBCD 1SQPE 2XSOA 3C0DA 2CKFA 5KLVE 4NBFD 5CXMA 5KKZC 4HM7A 2JO6A 1Q90C 3GL2A 4HM8A 2HMJA 3H1KE 5HL4A 4PD4E 1NDOA 3GKEA 4QDDA 2GBWA 1NTKE 4NBGD 3H1LE 3L73E 1O7PA 5KLIC 2I7FA 1SQVE 2YVJB 3H1IE 3GZYA 2YFLA 3L74E 3CXHE 4HM1A 4QUPA 1G8JB 2A06E 1PPJE 1SQQE 2NVFA 3DQYA 1P84E 2XRXA 2XR8A 4HJLA 5AEWA 3GTEA 1ULIA 2DE7D 1JM1A 4NBHD 3L71E 2E4PA 2IBZE 1EZVE 2DE6D 2HMLA 3GL0A 4HM5A 2HMKA 1VM9A 1SQXE 4AIVA 5AEUA 2B1XA 2QJPC 3GB4A 1SQBE 1RFSA 4P1CH 2YFJA 3BCCE 1NYKA 4EMJB 3H1HE 4H0LD 1NTME 1O7GA 3H1JE 1L0NE 2QJKC 2YIUC 4NBED 1L0LE 4HM4A 1VCKA 1BCCE 1EG9A 1O7NA 2ZT9D 3VMGD 3TGUE 1KYOE 2ZYLA 1ULJA 1FQTA 2XSHA 4QDFB 1O7HA 4U3FE 1O7MA 2NVEA 3N0QA 2GBXA 2QJYC 2E4QA 3L75E 2NWFA 1BE3E 3L70E 5BOKA 2YFIA 2HMOA 2FYUE 1PP9E 2JZAA 2BMOA 2B24A 3GCEA 3GOBA 1UUVA 1SJGA 1UUWA 1NTZE 4HM0A 3VMHD 3VMID 4NB9D 4QDCA 2Q3WA 4QUQA 4QDFA 4HM6A 3EN1A 2E74D 4QURA 2NUMA
chains in the Genus database with same CATH superfamily
4NBAD 4H13D 2HMNA 3GZXA 1ZRTE 2HMMA 3CX5E 4OGQD 1WQLA 2D2CD 3AZCA 2BCCE 3VCPA 4NB8D 2BMRA 2NVGA 2DE5D 4QCKA 2FYNC 4HM3A 1RIEA 3D89A 4AAYB 2BMQA 4P1BH 4HM2A 3GTSA 3CWBE 1G8KB 1VF5D 2E75D 4NBDD 1O7WA 3L72E 4NBBD 4H44D 3VCAA 2NUKA 2E76D 1KB9E 4PV1D 3FOUA 1NU1E 4HKVA 2QPZA 3EQQA 4NBCD 1SQPE 2XSOA 3C0DA 2CKFA 5KLVE 4NBFD 5CXMA 5KKZC 4HM7A 2JO6A 1Q90C 3GL2A 4HM8A 2HMJA 3H1KE 5HL4A 4PD4E 1NDOA 3GKEA 4QDDA 2GBWA 1NTKE 4NBGD 3H1LE 3L73E 1O7PA 5KLIC 2I7FA 1SQVE 2YVJB 3H1IE 3GZYA 2YFLA 3L74E 3CXHE 4HM1A 4QUPA 1G8JB 2A06E 1PPJE 1SQQE 2NVFA 3DQYA 1P84E 2XRXA 2XR8A 4HJLA 5AEWA 3GTEA 1ULIA 2DE7D 1JM1A 4NBHD 3L71E 2E4PA 2IBZE 1EZVE 2DE6D 2HMLA 3GL0A 4HM5A 2HMKA 1VM9A 1SQXE 4AIVA 5AEUA 2B1XA 2QJPC 3GB4A 1SQBE 1RFSA 4P1CH 2YFJA 3BCCE 1NYKA 4EMJB 3H1HE 4H0LD 1NTME 1O7GA 3H1JE 1L0NE 2QJKC 2YIUC 4NBED 1L0LE 4HM4A 1VCKA 1BCCE 1EG9A 1O7NA 2ZT9D 3VMGD 3TGUE 1KYOE 2ZYLA 1ULJA 1FQTA 2XSHA 4QDFB 1O7HA 4U3FE 1O7MA 2NVEA 3N0QA 2GBXA 2QJYC 2E4QA 3L75E 2NWFA 1BE3E 3L70E 5BOKA 2YFIA 2HMOA 2FYUE 1PP9E 2JZAA 2BMOA 2B24A 3GCEA 3GOBA 1UUVA 1SJGA 1UUWA 1NTZE 4HM0A 3VMHD 3VMID 4NB9D 4QDCA 2Q3WA 4QUQA 4QDFA 4HM6A 3EN1A 2E74D 4QURA 2NUMA
chains in the Genus database with same CATH topology
4NBAD 4H13D 2HMNA 3GZXA 1ZRTE 2HMMA 3CX5E 4OGQD 1WQLA 2D2CD 3AZCA 2BCCE 3VCPA 4NB8D 2BMRA 2NVGA 2DE5D 4QCKA 2FYNC 4HM3A 1RIEA 3D89A 4AAYB 2BMQA 4P1BH 4HM2A 3GTSA 3CWBE 1G8KB 1VF5D 2E75D 4NBDD 1O7WA 3L72E 4NBBD 4H44D 3VCAA 2NUKA 2E76D 1KB9E 4PV1D 3FOUA 1NU1E 4HKVA 2QPZA 3EQQA 4NBCD 1SQPE 2XSOA 3C0DA 2CKFA 5KLVE 4NBFD 5CXMA 5KKZC 4HM7A 2JO6A 1Q90C 3GL2A 4HM8A 2HMJA 3H1KE 5HL4A 4PD4E 1NDOA 3GKEA 4QDDA 2GBWA 1NTKE 4NBGD 3H1LE 3L73E 1O7PA 5KLIC 2I7FA 1SQVE 2YVJB 3H1IE 3GZYA 2YFLA 3L74E 3CXHE 4HM1A 4QUPA 1G8JB 2A06E 1PPJE 1SQQE 2NVFA 3DQYA 1P84E 2XRXA 2XR8A 4HJLA 5AEWA 3GTEA 1ULIA 2DE7D 1JM1A 4NBHD 3L71E 2E4PA 2IBZE 1EZVE 2DE6D 2HMLA 3GL0A 4HM5A 2HMKA 1VM9A 1SQXE 4AIVA 5AEUA 2B1XA 2QJPC 3GB4A 1SQBE 1RFSA 4P1CH 2YFJA 3BCCE 1NYKA 4EMJB 3H1HE 4H0LD 1NTME 1O7GA 3H1JE 1L0NE 2QJKC 2YIUC 4NBED 1L0LE 4HM4A 1VCKA 1BCCE 1EG9A 1O7NA 2ZT9D 3VMGD 3TGUE 1KYOE 2ZYLA 1ULJA 1FQTA 2XSHA 4QDFB 1O7HA 4U3FE 1O7MA 2NVEA 3N0QA 2GBXA 2QJYC 2E4QA 3L75E 2NWFA 1BE3E 3L70E 5BOKA 2YFIA 2HMOA 2FYUE 1PP9E 2JZAA 2BMOA 2B24A 3GCEA 3GOBA 1UUVA 1SJGA 1UUWA 1NTZE 4HM0A 3VMHD 3VMID 4NB9D 4QDCA 2Q3WA 4QUQA 4QDFA 4HM6A 3EN1A 2E74D 4QURA 2NUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBA D;  4H13 D;  2HMN A;  3GZX A;  1ZRT E;  2HMM A;  3CX5 E;  4OGQ D;  1WQL A;  2D2C D;  3AZC A;  2BCC E;  3VCP A;  4NB8 D;  2BMR A;  2NVG A;  2DE5 D;  4QCK A;  2FYN C;  4HM3 A;  1RIE A;  3D89 A;  4AAY B;  2BMQ A;  4P1B H;  4HM2 A;  3GTS A;  3CWB E;  1G8K B;  1VF5 D;  2E75 D;  4NBD D;  1O7W A;  3L72 E;  4NBB D;  4H44 D;  3VCA A;  2NUK A;  2E76 D;  1KB9 E;  4PV1 D;  3FOU A;  1NU1 E;  4HKV A;  2QPZ A;  3EQQ A;  4NBC D;  1SQP E;  2XSO A;  3C0D A;  2CKF A;  5KLV E;  4NBF D;  5CXM A;  5KKZ C;  4HM7 A;  2JO6 A;  1Q90 C;  3GL2 A;  4HM8 A;  2HMJ A;  3H1K E;  5HL4 A;  4PD4 E;  1NDO A;  3GKE A;  4QDD A;  2GBW A;  1NTK E;  4NBG D;  3H1L E;  3L73 E;  1O7P A;  5KLI C;  2I7F A;  1SQV E;  2YVJ B;  3H1I E;  3GZY A;  2YFL A;  3L74 E;  3CXH E;  4HM1 A;  4QUP A;  1G8J B;  2A06 E;  1PPJ E;  1SQQ E;  2NVF A;  3DQY A;  1P84 E;  2XRX A;  2XR8 A;  4HJL A;  5AEW A;  3GTE A;  1ULI A;  2DE7 D;  1JM1 A;  4NBH D;  3L71 E;  2E4P A;  2IBZ E;  1EZV E;  2DE6 D;  2HML A;  3GL0 A;  4HM5 A;  2HMK A;  1VM9 A;  1SQX E;  4AIV A;  5AEU A;  2B1X A;  2QJP C;  3GB4 A;  1SQB E;  1RFS A;  4P1C H;  2YFJ A;  3BCC E;  1NYK A;  4EMJ B;  3H1H E;  4H0L D;  1NTM E;  1O7G A;  3H1J E;  1L0N E;  2QJK C;  2YIU C;  4NBE D;  1L0L E;  4HM4 A;  1VCK A;  1BCC E;  1EG9 A;  1O7N A;  2ZT9 D;  3VMG D;  3TGU E;  1KYO E;  2ZYL A;  1ULJ A;  1FQT A;  2XSH A;  4QDF B;  1O7H A;  4U3F E;  1O7M A;  2NVE A;  3N0Q A;  2GBX A;  2QJY C;  2E4Q A;  3L75 E;  2NWF A;  1BE3 E;  3L70 E;  5BOK A;  2YFI A;  2HMO A;  2FYU E;  1PP9 E;  2JZA A;  2BMO A;  2B24 A;  3GCE A;  3GOB A;  1UUV A;  1SJG A;  1UUW A;  1NTZ E;  4HM0 A;  3VMH D;  3VMI D;  4NB9 D;  4QDC A;  2Q3W A;  4QUQ A;  4QDF A;  4HM6 A;  3EN1 A;  2E74 D;  4QUR A;  2NUM A; 
#chains in the Genus database with same CATH topology
 4NBA D;  4H13 D;  2HMN A;  3GZX A;  1ZRT E;  2HMM A;  3CX5 E;  4OGQ D;  1WQL A;  2D2C D;  3AZC A;  2BCC E;  3VCP A;  4NB8 D;  2BMR A;  2NVG A;  2DE5 D;  4QCK A;  2FYN C;  4HM3 A;  1RIE A;  3D89 A;  4AAY B;  2BMQ A;  4P1B H;  4HM2 A;  3GTS A;  3CWB E;  1G8K B;  1VF5 D;  2E75 D;  4NBD D;  1O7W A;  3L72 E;  4NBB D;  4H44 D;  3VCA A;  2NUK A;  2E76 D;  1KB9 E;  4PV1 D;  3FOU A;  1NU1 E;  4HKV A;  2QPZ A;  3EQQ A;  4NBC D;  1SQP E;  2XSO A;  3C0D A;  2CKF A;  5KLV E;  4NBF D;  5CXM A;  5KKZ C;  4HM7 A;  2JO6 A;  1Q90 C;  3GL2 A;  4HM8 A;  2HMJ A;  3H1K E;  5HL4 A;  4PD4 E;  1NDO A;  3GKE A;  4QDD A;  2GBW A;  1NTK E;  4NBG D;  3H1L E;  3L73 E;  1O7P A;  5KLI C;  2I7F A;  1SQV E;  2YVJ B;  3H1I E;  3GZY A;  2YFL A;  3L74 E;  3CXH E;  4HM1 A;  4QUP A;  1G8J B;  2A06 E;  1PPJ E;  1SQQ E;  2NVF A;  3DQY A;  1P84 E;  2XRX A;  2XR8 A;  4HJL A;  5AEW A;  3GTE A;  1ULI A;  2DE7 D;  1JM1 A;  4NBH D;  3L71 E;  2E4P A;  2IBZ E;  1EZV E;  2DE6 D;  2HML A;  3GL0 A;  4HM5 A;  2HMK A;  1VM9 A;  1SQX E;  4AIV A;  5AEU A;  2B1X A;  2QJP C;  3GB4 A;  1SQB E;  1RFS A;  4P1C H;  2YFJ A;  3BCC E;  1NYK A;  4EMJ B;  3H1H E;  4H0L D;  1NTM E;  1O7G A;  3H1J E;  1L0N E;  2QJK C;  2YIU C;  4NBE D;  1L0L E;  4HM4 A;  1VCK A;  1BCC E;  1EG9 A;  1O7N A;  2ZT9 D;  3VMG D;  3TGU E;  1KYO E;  2ZYL A;  1ULJ A;  1FQT A;  2XSH A;  4QDF B;  1O7H A;  4U3F E;  1O7M A;  2NVE A;  3N0Q A;  2GBX A;  2QJY C;  2E4Q A;  3L75 E;  2NWF A;  1BE3 E;  3L70 E;  5BOK A;  2YFI A;  2HMO A;  2FYU E;  1PP9 E;  2JZA A;  2BMO A;  2B24 A;  3GCE A;  3GOB A;  1UUV A;  1SJG A;  1UUW A;  1NTZ E;  4HM0 A;  3VMH D;  3VMI D;  4NB9 D;  4QDC A;  2Q3W A;  4QUQ A;  4QDF A;  4HM6 A;  3EN1 A;  2E74 D;  4QUR A;  2NUM A; 
#chains in the Genus database with same CATH homology
 4NBA D;  4H13 D;  2HMN A;  3GZX A;  1ZRT E;  2HMM A;  3CX5 E;  4OGQ D;  1WQL A;  2D2C D;  3AZC A;  2BCC E;  3VCP A;  4NB8 D;  2BMR A;  2NVG A;  2DE5 D;  4QCK A;  2FYN C;  4HM3 A;  1RIE A;  3D89 A;  4AAY B;  2BMQ A;  4P1B H;  4HM2 A;  3GTS A;  3CWB E;  1G8K B;  1VF5 D;  2E75 D;  4NBD D;  1O7W A;  3L72 E;  4NBB D;  4H44 D;  3VCA A;  2NUK A;  2E76 D;  1KB9 E;  4PV1 D;  3FOU A;  1NU1 E;  4HKV A;  2QPZ A;  3EQQ A;  4NBC D;  1SQP E;  2XSO A;  3C0D A;  2CKF A;  5KLV E;  4NBF D;  5CXM A;  5KKZ C;  4HM7 A;  2JO6 A;  1Q90 C;  3GL2 A;  4HM8 A;  2HMJ A;  3H1K E;  5HL4 A;  4PD4 E;  1NDO A;  3GKE A;  4QDD A;  2GBW A;  1NTK E;  4NBG D;  3H1L E;  3L73 E;  1O7P A;  5KLI C;  2I7F A;  1SQV E;  2YVJ B;  3H1I E;  3GZY A;  2YFL A;  3L74 E;  3CXH E;  4HM1 A;  4QUP A;  1G8J B;  2A06 E;  1PPJ E;  1SQQ E;  2NVF A;  3DQY A;  1P84 E;  2XRX A;  2XR8 A;  4HJL A;  5AEW A;  3GTE A;  1ULI A;  2DE7 D;  1JM1 A;  4NBH D;  3L71 E;  2E4P A;  2IBZ E;  1EZV E;  2DE6 D;  2HML A;  3GL0 A;  4HM5 A;  2HMK A;  1VM9 A;  1SQX E;  4AIV A;  5AEU A;  2B1X A;  2QJP C;  3GB4 A;  1SQB E;  1RFS A;  4P1C H;  2YFJ A;  3BCC E;  1NYK A;  4EMJ B;  3H1H E;  4H0L D;  1NTM E;  1O7G A;  3H1J E;  1L0N E;  2QJK C;  2YIU C;  4NBE D;  1L0L E;  4HM4 A;  1VCK A;  1BCC E;  1EG9 A;  1O7N A;  2ZT9 D;  3VMG D;  3TGU E;  1KYO E;  2ZYL A;  1ULJ A;  1FQT A;  2XSH A;  4QDF B;  1O7H A;  4U3F E;  1O7M A;  2NVE A;  3N0Q A;  2GBX A;  2QJY C;  2E4Q A;  3L75 E;  2NWF A;  1BE3 E;  3L70 E;  5BOK A;  2YFI A;  2HMO A;  2FYU E;  1PP9 E;  2JZA A;  2BMO A;  2B24 A;  3GCE A;  3GOB A;  1UUV A;  1SJG A;  1UUW A;  1NTZ E;  4HM0 A;  3VMH D;  3VMI D;  4NB9 D;  4QDC A;  2Q3W A;  4QUQ A;  4QDF A;  4HM6 A;  3EN1 A;  2E74 D;  4QUR A;  2NUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...