1Q90C

Structure of the cytochrome b6f (plastohydroquinone : plastocyanin oxidoreductase) from chlamydomonas reinhardtii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
127
structure length
126
Chain Sequence
QAAKDALGNDIKAGEWLKTHLAGDRSLSQGLKGDPTYLIVTADSTIEKYGLNAVCTHLGCVVPWVAAENKFKCPCHGSQYNAEGKVVRGPAPLSLALAHCDVAEGLVTFSTWTETDFRTGLEPWWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apocytochrome f
publication title An Atypical Haem in the Cytochrome B6F Complex
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Photosynthesis
total genus 22
structure length 126
sequence length 127
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2003-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1q90C00
4QUPA 2HMKA 3H1KE 3L71E 2DE5D 2JZAA 1O7PA 1ULJA 2YVJB 2XR8A 4H44D 4HM7A 4HM1A 4EMJB 1BE3E 3H1IE 4AIVA 1SQBE 4OGQD 3GZXA 2E4QA 2HMMA 1O7GA 2E4PA 3L75E 2NVEA 2BCCE 1KB9E 2B24A 2IBZE 4NB8D 5AEUA 1NYKA 2Q3WA 4NBGD 4QDDA 1VM9A 3DQYA 2NUMA 5KLIC 1NU1E 4HM0A 5BOKA 1VCKA 1JM1A 4PV1D 1NDOA 1G8KB 3GTSA 4HKVA 1EZVE 1L0NE 3AZCA 1RIEA 4P1CH 1SQXE 4HM8A 3VCAA 2CKFA 1NTZE 2YIUC 4HM2A 3VMGD 2XSHA 4HM3A 2HMJA 2BMRA 3H1LE 2DE7D 4P1BH 3H1JE 2DE6D 3EN1A 4AAYB 4H0LD 3TGUE 2B1XA 2I7FA 1PP9E 2A06E 1UUWA 2XSOA 3VMHD 3GL0A 3GTEA 1UUVA 5AEWA 1PPJE 2NVGA 2ZYLA 2D2CD 3EQQA 3GKEA 1O7WA 5KLVE 4QCKA 4QUQA 4NB9D 1O7NA 1VF5D 2YFLA 4HM4A 4HM5A 1O7MA 1SQPE 4QURA 4HJLA 2NUKA 1WQLA 1SJGA 2QJYC 3CXHE 1BCCE 1FQTA 4NBAD 2E74D 2QJPC 2E75D 3L74E 1EG9A 4NBDD 1KYOE 2YFIA 2HMLA 4NBFD 3GOBA 3BCCE 4NBCD 1L0LE 5CXMA 3GB4A 1SQQE 4NBHD 1NTKE 5KKZC 1RFSA 2YFJA 3GCEA 1ZRTE 3GL2A 2E76D 4QDCA 1P84E 4PD4E 2HMOA 2BMQA 1ULIA 4QDFA 3FOUA 4NBBD 3VCPA 4U3FE 2NWFA 3D89A 3VMID 1O7HA 1G8JB 2GBWA 3N0QA 1Q90C 3C0DA 2FYNC 3GZYA 2JO6A 2QPZA 2BMOA 1NTME 4H13D 1SQVE 2NVFA 2GBXA 2QJKC 4HM6A 3L73E 3L72E 4QDFB 4NBED 2ZT9D 5HL4A 3CWBE 3L70E 3H1HE 3CX5E 2XRXA 2HMNA 2FYUE
chains in the Genus database with same CATH superfamily
4QUPA 2HMKA 3H1KE 3L71E 2DE5D 2JZAA 1O7PA 1ULJA 2YVJB 2XR8A 4H44D 4HM7A 4HM1A 4EMJB 1BE3E 3H1IE 4AIVA 1SQBE 4OGQD 3GZXA 2E4QA 2HMMA 1O7GA 2E4PA 3L75E 2NVEA 2BCCE 1KB9E 2B24A 2IBZE 4NB8D 5AEUA 1NYKA 2Q3WA 4NBGD 4QDDA 1VM9A 3DQYA 2NUMA 5KLIC 1NU1E 4HM0A 5BOKA 1VCKA 1JM1A 4PV1D 1NDOA 1G8KB 3GTSA 4HKVA 1EZVE 1L0NE 3AZCA 1RIEA 4P1CH 1SQXE 4HM8A 3VCAA 2CKFA 1NTZE 2YIUC 4HM2A 3VMGD 2XSHA 4HM3A 2HMJA 2BMRA 3H1LE 2DE7D 4P1BH 3H1JE 2DE6D 3EN1A 4AAYB 4H0LD 3TGUE 2B1XA 2I7FA 1PP9E 2A06E 1UUWA 2XSOA 3VMHD 3GL0A 3GTEA 1UUVA 5AEWA 1PPJE 2NVGA 2ZYLA 2D2CD 3EQQA 3GKEA 1O7WA 5KLVE 4QCKA 4QUQA 4NB9D 1O7NA 1VF5D 2YFLA 4HM4A 4HM5A 1O7MA 1SQPE 4QURA 4HJLA 2NUKA 1WQLA 1SJGA 2QJYC 3CXHE 1BCCE 1FQTA 4NBAD 2E74D 2QJPC 2E75D 3L74E 1EG9A 4NBDD 1KYOE 2YFIA 2HMLA 4NBFD 3GOBA 3BCCE 4NBCD 1L0LE 5CXMA 3GB4A 1SQQE 4NBHD 1NTKE 5KKZC 1RFSA 2YFJA 3GCEA 1ZRTE 3GL2A 2E76D 4QDCA 1P84E 4PD4E 2HMOA 2BMQA 1ULIA 4QDFA 3FOUA 4NBBD 3VCPA 4U3FE 2NWFA 3D89A 3VMID 1O7HA 1G8JB 2GBWA 3N0QA 1Q90C 3C0DA 2FYNC 3GZYA 2JO6A 2QPZA 2BMOA 1NTME 4H13D 1SQVE 2NVFA 2GBXA 2QJKC 4HM6A 3L73E 3L72E 4QDFB 4NBED 2ZT9D 5HL4A 3CWBE 3L70E 3H1HE 3CX5E 2XRXA 2HMNA 2FYUE
chains in the Genus database with same CATH topology
4QUPA 2HMKA 3H1KE 3L71E 2DE5D 2JZAA 1O7PA 1ULJA 2YVJB 2XR8A 4H44D 4HM7A 4HM1A 4EMJB 1BE3E 3H1IE 4AIVA 1SQBE 4OGQD 3GZXA 2E4QA 2HMMA 1O7GA 2E4PA 3L75E 2NVEA 2BCCE 1KB9E 2B24A 2IBZE 4NB8D 5AEUA 1NYKA 2Q3WA 4NBGD 4QDDA 1VM9A 3DQYA 2NUMA 5KLIC 1NU1E 4HM0A 5BOKA 1VCKA 1JM1A 4PV1D 1NDOA 1G8KB 3GTSA 4HKVA 1EZVE 1L0NE 3AZCA 1RIEA 4P1CH 1SQXE 4HM8A 3VCAA 2CKFA 1NTZE 2YIUC 4HM2A 3VMGD 2XSHA 4HM3A 2HMJA 2BMRA 3H1LE 2DE7D 4P1BH 3H1JE 2DE6D 3EN1A 4AAYB 4H0LD 3TGUE 2B1XA 2I7FA 1PP9E 2A06E 1UUWA 2XSOA 3VMHD 3GL0A 3GTEA 1UUVA 5AEWA 1PPJE 2NVGA 2ZYLA 2D2CD 3EQQA 3GKEA 1O7WA 5KLVE 4QCKA 4QUQA 4NB9D 1O7NA 1VF5D 2YFLA 4HM4A 4HM5A 1O7MA 1SQPE 4QURA 4HJLA 2NUKA 1WQLA 1SJGA 2QJYC 3CXHE 1BCCE 1FQTA 4NBAD 2E74D 2QJPC 2E75D 3L74E 1EG9A 4NBDD 1KYOE 2YFIA 2HMLA 4NBFD 3GOBA 3BCCE 4NBCD 1L0LE 5CXMA 3GB4A 1SQQE 4NBHD 1NTKE 5KKZC 1RFSA 2YFJA 3GCEA 1ZRTE 3GL2A 2E76D 4QDCA 1P84E 4PD4E 2HMOA 2BMQA 1ULIA 4QDFA 3FOUA 4NBBD 3VCPA 4U3FE 2NWFA 3D89A 3VMID 1O7HA 1G8JB 2GBWA 3N0QA 1Q90C 3C0DA 2FYNC 3GZYA 2JO6A 2QPZA 2BMOA 1NTME 4H13D 1SQVE 2NVFA 2GBXA 2QJKC 4HM6A 3L73E 3L72E 4QDFB 4NBED 2ZT9D 5HL4A 3CWBE 3L70E 3H1HE 3CX5E 2XRXA 2HMNA 2FYUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QUP A;  2HMK A;  3H1K E;  3L71 E;  2DE5 D;  2JZA A;  1O7P A;  1ULJ A;  2YVJ B;  2XR8 A;  4H44 D;  4HM7 A;  4HM1 A;  4EMJ B;  1BE3 E;  3H1I E;  4AIV A;  1SQB E;  4OGQ D;  3GZX A;  2E4Q A;  2HMM A;  1O7G A;  2E4P A;  3L75 E;  2NVE A;  2BCC E;  1KB9 E;  2B24 A;  2IBZ E;  4NB8 D;  5AEU A;  1NYK A;  2Q3W A;  4NBG D;  4QDD A;  1VM9 A;  3DQY A;  2NUM A;  5KLI C;  1NU1 E;  4HM0 A;  5BOK A;  1VCK A;  1JM1 A;  4PV1 D;  1NDO A;  1G8K B;  3GTS A;  4HKV A;  1EZV E;  1L0N E;  3AZC A;  1RIE A;  4P1C H;  1SQX E;  4HM8 A;  3VCA A;  2CKF A;  1NTZ E;  2YIU C;  4HM2 A;  3VMG D;  2XSH A;  4HM3 A;  2HMJ A;  2BMR A;  3H1L E;  2DE7 D;  4P1B H;  3H1J E;  2DE6 D;  3EN1 A;  4AAY B;  4H0L D;  3TGU E;  2B1X A;  2I7F A;  1PP9 E;  2A06 E;  1UUW A;  2XSO A;  3VMH D;  3GL0 A;  3GTE A;  1UUV A;  5AEW A;  1PPJ E;  2NVG A;  2ZYL A;  2D2C D;  3EQQ A;  3GKE A;  1O7W A;  5KLV E;  4QCK A;  4QUQ A;  4NB9 D;  1O7N A;  1VF5 D;  2YFL A;  4HM4 A;  4HM5 A;  1O7M A;  1SQP E;  4QUR A;  4HJL A;  2NUK A;  1WQL A;  1SJG A;  2QJY C;  3CXH E;  1BCC E;  1FQT A;  4NBA D;  2E74 D;  2QJP C;  2E75 D;  3L74 E;  1EG9 A;  4NBD D;  1KYO E;  2YFI A;  2HML A;  4NBF D;  3GOB A;  3BCC E;  4NBC D;  1L0L E;  5CXM A;  3GB4 A;  1SQQ E;  4NBH D;  1NTK E;  5KKZ C;  1RFS A;  2YFJ A;  3GCE A;  1ZRT E;  3GL2 A;  2E76 D;  4QDC A;  1P84 E;  4PD4 E;  2HMO A;  2BMQ A;  1ULI A;  4QDF A;  3FOU A;  4NBB D;  3VCP A;  4U3F E;  2NWF A;  3D89 A;  3VMI D;  1O7H A;  1G8J B;  2GBW A;  3N0Q A;  1Q90 C;  3C0D A;  2FYN C;  3GZY A;  2JO6 A;  2QPZ A;  2BMO A;  1NTM E;  4H13 D;  1SQV E;  2NVF A;  2GBX A;  2QJK C;  4HM6 A;  3L73 E;  3L72 E;  4QDF B;  4NBE D;  2ZT9 D;  5HL4 A;  3CWB E;  3L70 E;  3H1H E;  3CX5 E;  2XRX A;  2HMN A;  2FYU E; 
#chains in the Genus database with same CATH topology
 4QUP A;  2HMK A;  3H1K E;  3L71 E;  2DE5 D;  2JZA A;  1O7P A;  1ULJ A;  2YVJ B;  2XR8 A;  4H44 D;  4HM7 A;  4HM1 A;  4EMJ B;  1BE3 E;  3H1I E;  4AIV A;  1SQB E;  4OGQ D;  3GZX A;  2E4Q A;  2HMM A;  1O7G A;  2E4P A;  3L75 E;  2NVE A;  2BCC E;  1KB9 E;  2B24 A;  2IBZ E;  4NB8 D;  5AEU A;  1NYK A;  2Q3W A;  4NBG D;  4QDD A;  1VM9 A;  3DQY A;  2NUM A;  5KLI C;  1NU1 E;  4HM0 A;  5BOK A;  1VCK A;  1JM1 A;  4PV1 D;  1NDO A;  1G8K B;  3GTS A;  4HKV A;  1EZV E;  1L0N E;  3AZC A;  1RIE A;  4P1C H;  1SQX E;  4HM8 A;  3VCA A;  2CKF A;  1NTZ E;  2YIU C;  4HM2 A;  3VMG D;  2XSH A;  4HM3 A;  2HMJ A;  2BMR A;  3H1L E;  2DE7 D;  4P1B H;  3H1J E;  2DE6 D;  3EN1 A;  4AAY B;  4H0L D;  3TGU E;  2B1X A;  2I7F A;  1PP9 E;  2A06 E;  1UUW A;  2XSO A;  3VMH D;  3GL0 A;  3GTE A;  1UUV A;  5AEW A;  1PPJ E;  2NVG A;  2ZYL A;  2D2C D;  3EQQ A;  3GKE A;  1O7W A;  5KLV E;  4QCK A;  4QUQ A;  4NB9 D;  1O7N A;  1VF5 D;  2YFL A;  4HM4 A;  4HM5 A;  1O7M A;  1SQP E;  4QUR A;  4HJL A;  2NUK A;  1WQL A;  1SJG A;  2QJY C;  3CXH E;  1BCC E;  1FQT A;  4NBA D;  2E74 D;  2QJP C;  2E75 D;  3L74 E;  1EG9 A;  4NBD D;  1KYO E;  2YFI A;  2HML A;  4NBF D;  3GOB A;  3BCC E;  4NBC D;  1L0L E;  5CXM A;  3GB4 A;  1SQQ E;  4NBH D;  1NTK E;  5KKZ C;  1RFS A;  2YFJ A;  3GCE A;  1ZRT E;  3GL2 A;  2E76 D;  4QDC A;  1P84 E;  4PD4 E;  2HMO A;  2BMQ A;  1ULI A;  4QDF A;  3FOU A;  4NBB D;  3VCP A;  4U3F E;  2NWF A;  3D89 A;  3VMI D;  1O7H A;  1G8J B;  2GBW A;  3N0Q A;  1Q90 C;  3C0D A;  2FYN C;  3GZY A;  2JO6 A;  2QPZ A;  2BMO A;  1NTM E;  4H13 D;  1SQV E;  2NVF A;  2GBX A;  2QJK C;  4HM6 A;  3L73 E;  3L72 E;  4QDF B;  4NBE D;  2ZT9 D;  5HL4 A;  3CWB E;  3L70 E;  3H1H E;  3CX5 E;  2XRX A;  2HMN A;  2FYU E; 
#chains in the Genus database with same CATH homology
 4QUP A;  2HMK A;  3H1K E;  3L71 E;  2DE5 D;  2JZA A;  1O7P A;  1ULJ A;  2YVJ B;  2XR8 A;  4H44 D;  4HM7 A;  4HM1 A;  4EMJ B;  1BE3 E;  3H1I E;  4AIV A;  1SQB E;  4OGQ D;  3GZX A;  2E4Q A;  2HMM A;  1O7G A;  2E4P A;  3L75 E;  2NVE A;  2BCC E;  1KB9 E;  2B24 A;  2IBZ E;  4NB8 D;  5AEU A;  1NYK A;  2Q3W A;  4NBG D;  4QDD A;  1VM9 A;  3DQY A;  2NUM A;  5KLI C;  1NU1 E;  4HM0 A;  5BOK A;  1VCK A;  1JM1 A;  4PV1 D;  1NDO A;  1G8K B;  3GTS A;  4HKV A;  1EZV E;  1L0N E;  3AZC A;  1RIE A;  4P1C H;  1SQX E;  4HM8 A;  3VCA A;  2CKF A;  1NTZ E;  2YIU C;  4HM2 A;  3VMG D;  2XSH A;  4HM3 A;  2HMJ A;  2BMR A;  3H1L E;  2DE7 D;  4P1B H;  3H1J E;  2DE6 D;  3EN1 A;  4AAY B;  4H0L D;  3TGU E;  2B1X A;  2I7F A;  1PP9 E;  2A06 E;  1UUW A;  2XSO A;  3VMH D;  3GL0 A;  3GTE A;  1UUV A;  5AEW A;  1PPJ E;  2NVG A;  2ZYL A;  2D2C D;  3EQQ A;  3GKE A;  1O7W A;  5KLV E;  4QCK A;  4QUQ A;  4NB9 D;  1O7N A;  1VF5 D;  2YFL A;  4HM4 A;  4HM5 A;  1O7M A;  1SQP E;  4QUR A;  4HJL A;  2NUK A;  1WQL A;  1SJG A;  2QJY C;  3CXH E;  1BCC E;  1FQT A;  4NBA D;  2E74 D;  2QJP C;  2E75 D;  3L74 E;  1EG9 A;  4NBD D;  1KYO E;  2YFI A;  2HML A;  4NBF D;  3GOB A;  3BCC E;  4NBC D;  1L0L E;  5CXM A;  3GB4 A;  1SQQ E;  4NBH D;  1NTK E;  5KKZ C;  1RFS A;  2YFJ A;  3GCE A;  1ZRT E;  3GL2 A;  2E76 D;  4QDC A;  1P84 E;  4PD4 E;  2HMO A;  2BMQ A;  1ULI A;  4QDF A;  3FOU A;  4NBB D;  3VCP A;  4U3F E;  2NWF A;  3D89 A;  3VMI D;  1O7H A;  1G8J B;  2GBW A;  3N0Q A;  1Q90 C;  3C0D A;  2FYN C;  3GZY A;  2JO6 A;  2QPZ A;  2BMO A;  1NTM E;  4H13 D;  1SQV E;  2NVF A;  2GBX A;  2QJK C;  4HM6 A;  3L73 E;  3L72 E;  4QDF B;  4NBE D;  2ZT9 D;  5HL4 A;  3CWB E;  3L70 E;  3H1H E;  3CX5 E;  2XRX A;  2HMN A;  2FYU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...