2E75D

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 20
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e75D02
2XR8A 2E4PA 3EN1A 4H44C 4NBAD 4QUQA 1O7GA 1NU1E 2D2CD 4PV1D 2DE5D 2HMMA 1ULIA 1G8KB 3VMID 2E76D 3GTSA 1O7MA 1O7HA 2YFJA 4HM4A 3L70E 2NUKA 4I7ZC 1O7PA 3GL0A 5KLVE 4QDCA 3VCAA 2BCCE 2QJPC 2HMLA 5AEWA 1P84E 2E75D 4NB9D 3TGUE 2YVJB 1NTKE 1L0LE 4P1CH 2HMNA 1VF5C 1ULJA 2NVFA 3GL2A 4H0LD 4HJLA 3VCPA 3GKEA 2HMKA 2B24A 2E74C 1BCCE 3GZXA 4U3FE 2HMOA 4AAYB 2XRXA 4H13C 3GTEA 2NVEA 3AZCA 4HM1A 1KB9E 4NBHD 3BCCE 2E75C 5AEUA 4OGQC 1UUVA 3C0DA 2JZAA 3DQYA 4PD4E 2ZT9D 3CXHE 4HM2A 4QDFB 4H0LC 1NDOA 4NBBD 2CKFA 4HM6A 2XSOA 2E74D 3VMGD 2FYNC 3H1HE 3D89A 3GOBA 1L0NE 1NTZE 1VM9A 1Q90C 1SQXE 2NWFA 1NYKA 2BMRA 3H1LE 4OGQD 2YFIA 2IBZE 3GZYA 4NBED 1PPJE 4HM5A 1UUWA 1SQQE 2QJYC 3GB4A 4HM8A 2ZYLA 2DE7D 1RFSA 2GBWA 4P1BH 4H44D 2D2CC 4PV1C 1SQVE 1VCKA 3FOUA 3VMHD 2NVGA 1ZRTE 2QJKC 4QDDA 1SQPE 3EQQA 4HM7A 3L75E 4HM3A 5BOKA 2NUMA 2YFLA 1KYOE 1EG9A 4QURA 5HL4A 1PP9E 2B1XA 2JO6A 4EMJB 2Q3WA 1WQLA 3L74E 4NB8D 1VF5D 4HKVA 4NBGD 3CX5E 2XSHA 3H1KE 1SJGA 1JM1A 2HMJA 4H13D 4HM0A 4NBDD 5KLIC 2QPZA 1O7NA 2E4QA 4QCKA 4QDFA 2ZT9C 2GBXA 1SQBE 2DE6D 4NBFD 3L71E 2YMKA 2BMOA 2BMQA 3N0QA 3H1JE 4QUPA 1BE3E 2FYUE 3GCEA 4NBCD 1NTME 1G8JB 2YIUC 5CXMA 2E76C 2A06E 3CWBE 1EZVE 3H1IE 2I7FA 1O7WA 4AIVA 3L72E 3L73E 1FQTA 5KKZC 1RIEA
chains in the Genus database with same CATH superfamily
2N9BA 3TGUD 1SFCD 1G8KB 3VMID 4UB8E 5KLIB 2DW3A 4IFDK 3N7NA 3GLMA 3VCAA 3CLQA 4HJLA 1IFNA 3GHGA 2WPQA 1W2EA 2SPZA 1XTCC 1NJIQ 3FX0A 3NXSA 4GKGA 3CXHI 1ZR4A 5APQA 1S3JA 2FYNC 1M1JC 3L75D 1Q90C 1NU1K 1T8ZA 2R5BA 1JTHB 1QX8A 1AQ5A 2ZYLA 2Q3EA 3L70J 4ZNCA 3FWNA 2NRGA 2WITA 3P8CE 4WY4B 3VMHD 3F89A 3H1HJ 2YO2A 3CCUP 3C1LA 1L0NK 4LC1A 2E75B 2WSCH 2E42A 2GUVA 4D6TJ 4B86A 2M8RA 1AJYA 3MIWA 1AA0A 4H13D 1JM0A 1N7LA 3AEBC 1KILB 1YYCA 2XKMA 1L0LG 1S72P 5TJHA 4BXLA 3MZWB 1EXIA 1RF1B 5L8RJ 5APUA 1CZQA 3H1JD 4U3FJ 1KB9D 4OVNF 4W80A 2PAJA 3D71A 1LTJA 3CI9A 3TF5A 4PJ0H 4XFJA 5E79E 3CCRP 2FXOA 1RY3A 2BCCE 1X22A 4RJTA 1OW6A 3MTUE 3T97B 1NTZJ 1BCCE 4AQRD 3TDKA 3WU2H 4R4MA 1VPCA 3O6QB 1X9VA 1Q90D 3AE2C 2JZAA 1IK9A 1NKNA 2WSEJ 2E74D 2E43A 4R4LA 3AE4C 1VL2A 3MGNA 3W68A 1S1CX 2MJZA 1EC5A 4IOIH 2O01N 3H1KG 3L70G 2FFDB 5APYA 3A5TA 1NGMB 2N1TA 1PP9G 2O01H 3P8MC 1YIJP 3V5BA 3PH0A 1S4XA 2E76B 2K9JB 2JKVA 3CWBJ 4W7ZA 2WSSH 2IYOA 2ZT9B 4TT3H 1LTJC 1JCCA 1JY2P 3L70D 1U7JA 2KIKA 2JDIH 1FOSE 1PGPA 3W67A 1O7NA 2FBWC 1PP9D 2PFXA 1OW8A 5AW2B 1SQBE 2JO1A 3L71E 1SQVD 2ZYDA 3Q1MA 1HTLC 2CPSA 1ZN5A 3H1IE 3AE5C 2XR8A 3VMZA 3SSUA 1MZ9A 1S2EA 4JYCA 5EFWB 2OYIB 1LWUA 3H6PA 2FXMA 1G2CB 2KLUA 4HB1A 1NAFA 3KXDA 1LT9A 1SLQA 3V2PA 1ULJA 5AVTB 2E74C 3GZXA 4AAYB 3HE4A 2Q9IA 2P2UA 2Y0CA 2R44A 2L5GB 3CMEP 2FKWB 1LNQA 1MV8A 3JSVC 3AE3C 4QDFB 5KLVK 3BRTB 2OYHB 3HUSB 1GDTA 1CI6B 2M5AB 2QM8A 3KPEA 4HM5A 2GBWA 1URQC 3L74G 2OTKE 3TK1A 1GTWA 2E74B 1SVFA 2YFLA 4JYBA 4PD4I 4EYYQ 2W8ZA 3GHGB 3L35A 4NBGD 2XSHA 1L4AC 3PP5A 3Q3DA 4NPEA 4HM0A 2ZXXA 4I7ZB 3WMM0 4OH8B 1KD1Q 1S5LX 1DEEG 3SWFA 1NTZG 2BMOA 2G8YA 2FYUE 1ZP0C 1TU3F 3CCEP 2WVRA 2A06E 1VQ8P 1HGZA 5AVSB 3JCUH 1T6AA 4EIJA 5M1BA 4L74A 1NTZD 1P84E 1L0LE 3TYYA 2K1AA 4IL6H 4H0LD 1SFCA 3L73G 3M0DC 4L76A 2JWAA 1FZBA 2YKPA 3S9OA 2XRXA 2B88A 1KB9E 3V6IA 4YXWH 1BSHA 3S1KA 5B66H 5KAFH 1UUVA 2QJYB 1SS1A 4HM2A 2P1JA 3OW2O 1J1EC 3VP9A 2XSOA 1HJBA 2IFNA 1FDIA 3HE5A 1KV4A 1K04A 3KZIH 1SQQJ 3L73D 1FZCB 1LTJB 5CCHD 5AVUB 1PV3A 3B71A 3AEAC 1N7SD 1RF0C 3PTZA 1QLED 2Q7CA 1NTKD 3VMAA 4BWNA 1NTMG 2D2CB 4HKVA 1VQ7P 3UIAA 1GW4A 1DD4A 1NH4A 1KQFB 2ZT9C 2BCCD 1N73A 2C9LY 3BRVB 1VQMP 1VQLP 1NTMD 3TSIA 3CCLP 2KP8A 4N78D 2FYZA 2KUBA 4OWFA 2FXPA 1G1JA 1HF9A 2D2CD 3L75J 1QEXA 2BCCG 2B9BA 1EDIA 4Z1MH 5AEWA 2BASA 3RK2C 3TGUE 4NB9D 3TNUB 2R5DA 3GL2A 2HMOA 3G9RA 3OAKA 3AE8C 2E75C 2E5TA 4ZKPA 2A45I 4HM6A 1NTKK 1E5WA 4EOTA 3D89A 1U7MA 4C7NA 1FS0E 2A45H 1VQNP 3CMAP 5KLVD 1E79H 1FU1A 2KNCB 1JMBA 3GF7A 4Y99C 1OMIA 3G6EP 1L0NG 3L75E 4IFFA 1A02F 3GG2A 5KJ7C 1WT6A 1GL2B 1P84D 4WB4A 2QIWA 4IFMA 5KLVG 3CX5E 2P7JA 1ZMEC 3A0HE 1JY2O 2QPZA 2RMZA 2KB7P 3L73J 4I1LA 2J58A 4UB8H 1L0ND 1VF5B 1RH5B 1CI6A 3CX5D 1QL2A 4QUPA 3V2QA 3G71P 1WMKA 1AVYA 2C9NY 3A0BE 1PP9J 1BE3J 5AVZB 3R4YA 1K9MQ 2MKVA 3M9BA 2R32A 3L73E 1SQXK 2PP6A 2HODB 3H1ID 5KKZC 1PGJA 4IL6X 1O7HA 4HM4A 3V2NA 3V2RA 3H32B 1KILD 2O01J 2E75D 1VF5C 2N9YB 2B87A 3BASA 3L72G 1NHLA 4H13C 2NPSB 4KHXA 3H1IG 5AW8B 1OX3A 5APTA 4ZMDA 1IFDA 4W7YA 4PD4E 4JPZB 1NTZE 1BDCA 1HH0A 2N1TD 1JY3O 1NU1D 5CMZA 5AW7B 1OZHA 5H2FE 3H1LG 1BDDA 1S5LH 3L72D 1K73Q 1N8RQ 1XTGB 3AEEC 5KJ7D 1VCKA 2WZ7A 3BVHA 3FGAD 3PRJA 2XDJA 3CC7P 2B1XA 1HUCA 1SQXJ 1JNMA 1SFCB 3H1KE 3L71G 5AVVB 2YO3A 1BCCD 1LGHB 2LXBA 4D6TG 1J2JB 1N2DC 1BE3E 1VQ9P 3L71D 2BEZF 2OYHC 3CD6P 1BCCG 5AVRB 3CCQP 4NPDA 1N73C 4NBAD 1T2KD 2HMMA 3M9HA 2JP3A 1O7MA 3U1CA 2Z4EA 3EQ2A 2VRSA 2HYNA 2ZYAA 2HMLA 1JUNA 2JEEA 1VQOP 1ZXGA 1YHQP 5KAFE 2E5YA 1EZVD 2GA1A 4NBHD 1W5CE 3E7KA 4AYCA 1KYOH 2WPSA 3BCCG 3B8EB 1JY3P 1Y47A 1NAYA 4JQ0D 3GW6A 1KORA 3ABVC 1RF1A 1IFIA 4NBED 1SQPK 2I1JA 1N86A 1KYOI 2KXPB 3AE7C 3V4QA 3USSA 1KB9H 1MFZA 2FYNB 2WSFH 5AVWB 1SQVE 4JBZA 1ZRTE 3MUDA 1L0LJ 1N7SB 1SQPE 1LTIC 1P84H 1K05A 3RL0D 1UIXA 4NB8D 2I8DA 2OTLP 1BE3D 1ZR2A 4RESB 5APVA 3O6QA 5AW0B 3VN0A 2W6BA 3G3ZA 3L72J 1EDKA 1L0LK 1FDOA 4XA4A 3H25A 4NBCD 3AE6C 3A0HH 1BE3G 5CXMA 1OVVA 3L72E 2FFDA 1NU1E 3TGUG 4HJGH 1L4AB 5H2FH 4I7ZC 3GL0A 1EQ7A 5CCGA 2IX7C 4IL6E 2HMNA 1GL2A 4U3FE 1RE3A 1PIXA 3A3YB 2ZVNB 2B89A 4HYTB 1NTKJ 3RK3C 3EFGA 1W2BO 1PPJD 1SQXE 1NYKA 3GZYA 2J5UA 1S9KD 1Q81Q 3HD7C 4DJGA 1SQQG 3B5NA 3FOUA 1WRGA 2OYIA 1IO4A 3GF3A 5K5GB 1FZGA 3HTKA 3EWKA 1SQPG 3CPWO 1G2CA 3MD0A 1YQ4C 2Q3WA 3RK3B 1ZOYC 2FYUG 5CHXA 3SFEC 2NPSA 3MP7B 1YJNP 1SQQD 5KLIC 2QVAA 1L0LD 4QDFA 1KQGB 5E79H 2ZFCA 2DE6D 3FWLA 3HUSA 3OJAB 3CWBD 2ZVOB 1KC8Q 4L75A 4PD4D 1NTME 3H1JG 5AW3B 2KK7A 2KYVA 2E4PA 1URQD 1FC2C 5CCHC 1PFIA 3AEDC 4PV1D 4HKZH 1Z56A 2Y0EA 3JCUE 5AW4B 2R3SA 5AVYB 1O7PA 4OGQB 1KYOD 2Q1KA 2OYIC 1LWUC 1H0TB 1LTSC 3LW5J 3BCCE 2XZRA 1HJ0A 1D7MA 1NDOA 1K8AQ 3H1HE 3HD7D 2CPBA 3L74J 3H1LE 4EI2A 2BMRA 5GTHE 2LR2A 1KN7A 4M3LA 1UUWA 2Q6QA 2PGDA 2DE7D 3KZIE 2LKMA 1NTMK 3WU2E 1OWAA 5AVQB 3GHGC 2NVGA 2OQQA 1M1KQ 5APXA 3EQQA 1LTGC 5CBOA 2K88A 3H1HD 3M0AA 1S5LE 3K5BA 1YJWP 1M1JB 4NBDD 4NPFX 1RF0A 2ZJSE 4UB6H 3H1HG 4N6JA 1JMMA 2RN0A 1G1IA 2QEXP 2BMQA 1SQVG 5APWA 3E1IA 1M8OB 1KFMA 1EZVE 1IFMA 3H1JJ 4U3FD 1AVOA 1HGVA 1FZCA 1LT9C 4H44C 4C7RA 1OIPA 3Q5RA 5TISE 2E76D 1H89A 4EDFA 1X8YA 5KLVE 1GK6A 3A0BH 1H88A 5GTIE 1NTZK 1J1EB 3VCPA 1RQVA 1GMJA 3AZCA 4DT0A 1JY3N 5AEUA 3M91A 1KQLA 2W6AA 5KLVJ 1QL1A 3VMGD 3VOPA 3I56P 1YQ3C 3U1AA 1L0NE 3L75G 1URQA 1LT1A 4OGQD 1BCCJ 1JCDA 2QJYC 3GB4A 2Y0DA 2GUSA 2D2CC 3CCJP 1CW5A 4O9BA 1KTMA 3LW5H 3KQGA 2J59M 2Y9ZA 2FY8A 4AUWA 3OA7A 1EG9A 3HD7B 2O3JA 3TNUA 1VF5D 2HMJA 2IZ0A 3CCVP 3D6ZA 2QA4P 2AXTH 3RBZA 3EFFK 2I1KA 2Q3IA 3KYQA 2N1TC 3C9IA 2H89C 1G8JB 2YIUC 2E76C 2V4HA 3GMAA 2Z5IA 3RK3E 2QM7A 1FQTA 3B5NB 1OVRA 3GTSA 3H1LJ 4GOFA 1LP1B 2IDBA 2ZXEB 1VQ4P 2IBZG 1HBWA 3BCCJ 5CCHA 2NVFA 1PGOA 4OGQC 3IR9A 1ZW0A 2WQYC 3DQYA 2KI7B 1GW3A 2HPCB 3V4WA 2FYUJ 3ITKA 4Y99B 3GOBA 2WPVB 3AECC 3A7OA 2IBZD 2GM4A 2K37A 1SQQE 1YJ9P 1AFOA 4H0LB 3H1KD 2AEJA 4LGDE 2HODA 1FJPA 1RE4C 4BRYB 4QDDA 1KILC 1FBMA 1KZUB 3H32A 4EMJB 1ZRTD 1NTKG 1YITP 2JR8A 2Y9YA 1KILE 1H0TA 3CX5I 4DZOA 2QRXA 1M56D 2E4QA 2IFMA 4WWIA 1SP4A 3SWKA 3VMXA 4CPGA 1LJ2A 3M06A 5BU8B 4KT0J 1H8AA 2YMKA 4KJMA 1SQQK 3H1JE 3GCEA 5CCGD 2XV5A 3E1RA 2QJPB 1Q2NA 1M57D 2AXCA 3Q2YA 2P10A 1O7GA 4WY4A 1BSNA 2DE5D 2H7HA 3WUVA 4QDCA 1SQVJ 3FXEA 1NTKE 2HFED 5CBNA 4I6MC 4HM1A 2K9YA 3VMYA 3B5ND 4I2LC 1AQTA 1P84I 1IFJA 2YNYA 1JO5A 2M0BA 3VP8A 3RL0B 2NPSC 3IAOA 2CK3H 5BVZA 5B66E 1IK7A 2YKOA 1KB9I 2YXQB 1GL2D 5AW6B 2AEFA 2IZ1A 4YTPC 3RBXA 3L74D 1T2KC 1VQ6P 1SFCC 5C39A 3SFDC 3NTNA 1IFPA 3CC4P 1NU1J 1R8EA 2M3BA 3CC2P 1WQLA 3H1IJ 4TLFA 2KLVA 2WWWA 2OGUA 1QGKB 2IBZI 2YIUB 5CCGC 2BCCJ 3P7KA 1USEA 4YPCA 3IN6A 4NBFD 4K3AA 2WPRA 4L73A 5AW9B 1VDFA 1M90Q 5KAIE 1X0TA 5KTBA 1ZV8A 4AIVA 3G4SP 4NBBD 4MN4C 1OFCX 2W27A 4QUQA 2N1TB 1ULIA 2RH0A 2YFJA 2XNDH 1N7SA 3Q5SA 2KS1B 2M3EA 3HD7A 1EDLA 3PHLA 3B5NC 5DJTB 5AW1B 1SQXG 2H88C 3GTEA 2NVEA 1EDJA 3L36A 2NPSD 4ASVA 3B4SA 3L4FA 4UB6E 4H0LC 2CKFA 3WUUA 1J1DB 1GL2C 3FXDA 3M0DA 3AE9C 1VM9A 1RE3C 3VTPC 3R2PA 2YFIA 1FZAA 1NU1G 3U59A 4GIFA 3BATA 1LTTC 1IC2A 1ZLLA 1SQXD 3I5CA 1NOHA 1PGQA 3RL0g 1JOCA 1RFSA 3MHVA 1SQBJ 2OTJP 1NWQA 1EZVI 1USDA 2FYUK 1LWUB 4WVZA 1L4AA 2QE7H 2KZIA 3IFMA 2NUMA 1LP1A 2W6JH 4DCKA 5HL4A 2AEMA 1LT9B 2R3CA 3L37A 3CXHD 4QMAA 5AW5B 4H44B 1HWTC 3MUDC 5GTHH 1FZFA 1N7SC 2IPPA 2YKQA 3AEGC 1L0NJ 2GBXA 4YXDC 2OYOA 1SQPJ 2M5AA 3NMDA 3Q5PA 1SQVK 1OXZA 1M7LA 4DOJA 2WMMA 2C0WA 1PL5A 2A06G 2OARA 1NYHA 3EN1A 1GU5A 3II6A 4GT1A 4BRYA 3A2AA 1IZNB 3L70E 3HTKB 1GK4A 2QJPC 3D6YA 5CJ4A 1S9KE 2HG5D 4Y28J 4P1CH 2HMKA 2QJKB 1RF1C 1NTMJ 2A06D 3IF4A 3WUTA 3P8CD 4N3YB 3RGUA 1YTZT 1LTBC 3BCCD 2ZAEB 2V7QJ 3KHUA 4GDOA 1L2PA 1Y9BA 4HM8A 3NFQA 2AXTE 2WT7A 1VQ5P 1HVVA 5AVXB 1DX7A 4PV1C 2QJKC 4HH2A 2YXRB 2NZ2A 4HM7A 1GZLA 4PJ0E 3CL3D 2P67A 4QURA 5BU5A 2JO6A 5B5EH 1FZCC 2Q5UA 1KMIZ 3F5HA 1RQUA 1SQBD 4A7PA 1U57A 2WSFJ 1AV1A 1DD3A 3AE1C 1VQKP 2KOGA 4XE5B 3HE5B 2W90A 2A45G 2W83C 1JTHA 2K3RA 1BGYD 3CX5H 1NKZB 1UIIA 2RKLA 1FZEA 2I7FA 1SQBG 1LTAC 3RK2B 2QG4A 3S4RA 4D6TE 5TISH 2C0XA 3PLNA 1MUUA 1FAVA 2NUKA 2JJLA 3VYIA 2H43A 1YI2P 2YVJB 1RHZB 3SWYA 2XNXA 2YMYA 1BGYG 2WSCJ 3LIEA 3RK3D 3GKEA 2B24A 1L4AD 1M1JA 1SQBK 4N78E 1KFNA 1KILA 1R5LA 5APSA 2JWDA 2HR3A 4K35A 1EXJA 1GD2E 3CXHE 4GOEA 1GU4A 3C8VA 2IYPA 1N73B 1PPJG 2IBZE 3H1LD 1KQSO 1NO4A 2V7QH 5KJ7A 1Q7YQ 3CCMP 2ZYGA 4P1BH 4LLHA 1DH3A 2O1KA 3QH9A 4H44D 2O1JA 1FOSF 2HLOA 2P58A 3HRNA 2KS1A 5BOKA 1KYOE 1SQPD 1YBKA 1PP9E 1BGYE 2BEQD 3RK2D 3L74E 3ZDMA 2FYUD 3HUSC 4WY4C 3T97A 4ASWA 4U7JA 2XU6A 1JY2N 1PZQA 4D6TD 3TGUJ 3PJSK 5KKZB 3CWBG 4C7NB 1URQB 3N4XA 2Z5HA 3CWBE 2POHA 3LIDA 2KNCA 1RIEA 1YTZI 2UWJE 1OVUA 2K9JA 3QWOC 1CSBA 1IJDB 1FJKA 3KDPB 1T3JA 1BGYJ 3L71J 3CXHH 4RO0A 1EZVG 2WTYA 1OW7A 1Q86Q 3C0DA 4WBAA 1DEBA 3M9QA 2ZT9D 2H8PD 3D70A 1R5SA 4ZKUA 2FFDC 1T3UA 2NWFA 4H13B 1VQPP 3JC22 3H1KJ 1PPJE 1Q82Q 1NVOA 2KSEA 1Y8AA 2ITAA 2PRRA 1DIPA 4RKUJ 4WY4D 1X79B 1A02J 4HM3A 4GODA 2KZJA 3O8ZA 2KSJA 2B87B 4PV1B 3I55P 3CCSP 1RE4A 1SJGA 3RL0C 3AEFC 3HE4B 1JM1A 5GTIH 1FE6A 1JB0J 1JEKA 3P32A 1MFTA 5CJ0A 2HPCA 4QCKA 2LXCB 4PD4H 5DJUB 2OYHA 1FDMA 1QVFO 5B5EE 2G3AA 4JF7A 3N0QA 2QSIA 4C46A 1QVGO 1MKMA 2L91A 5KAIH 2WT7B 1O7WA 1J1DC 4U3FG 2WSEH
chains in the Genus database with same CATH topology
2E4PA 1HF9A 4QUQA 2D2CD 3AEDC 4PV1D 1ULIA 1G8KB 3VMID 2YFJA 3Q5SA 1O7PA 4Z1MH 4OGQB 3GLMA 3VCAA 5AEWA 3TGUE 4NB9D 3GL2A 4HJLA 2H88C 2HMOA 3G9RA 3GTEA 2NVEA 3AE8C 3LW5J 3BCCE 2E75C 1HJ0A 4H0LC 1NDOA 2CKFA 4HM6A 2FYNC 3H1HE 3D89A 3AE9C 1VM9A 1Q90C 3H1LE 2BMRA 2YFIA 1UUWA 3RL0g 2ZYLA 2DE7D 1RFSA 3GF7A 1OMIA 3VMHD 2NVGA 2OQQA 3EQQA 3L75E 2E75B 2NUMA 5HL4A 4H44B 2QIWA 1AJYA 3CX5E 4H13D 1ZMEC 4NBDD 2QPZA 3AEBC 3AEGC 2GBXA 1VF5B 1EXIA 4YXDC 2BMQA 5L8RJ 3Q5PA 4QUPA 1WMKA 3R4YA 1EZVE 3D71A 2MKVA 3L73E 1PL5A 5KKZC 1NYHA 3EN1A 4H44C 3Q5RA 4XFJA 2E76D 4IL6X 1O7HA 4HM4A 3L70E 5KLVE 2BCCE 2QJPC 3D6YA 2O01J 2E75D 4Y28J 1OW6A 4P1CH 1VF5C 3T97B 3VCPA 1RQVA 2HMKA 1GMJA 1BCCE 4R4MA 4H13C 3AZCA 1Q90D 3AE2C 5AEUA 2JZAA 4PD4E 2WSEJ 2E74D 3VMGD 2V7QJ 1YQ3C 4GDOA 1L0NE 1NTZE 4R4LA 4OGQD 3AE4C 1VL2A 1S1CX 1Y9BA 2QJYC 3GB4A 4HM8A 3AEEC 2D2CC 4PV1C 1NGMB 1VCKA 2QJKC 1KTMA 3FGAD 2NZ2A 4HM7A 2E76B 4QURA 1EG9A 2B1XA 2JO6A 2ZT9B 4TT3H 1VF5D 1KMIZ 3H1KE 2HMJA 1RQUA 3D6ZA 1O7NA 2FBWC 1OW8A 1U57A 2WSFJ 1SQBE 1DD3A 3AE1C 2JO1A 3L71E 1BE3E 2H89C 3Q1MA 1G8JB 2YIUC 2E76C 2BEZF 3H1IE 2I7FA 3GMAA 3AE5C 3RK3E 1FQTA 2XR8A 4NBAD 2HMMA 3GTSA 2JP3A 1O7MA 2NUKA 2HMLA 2IDBA 2YVJB 1ULJA 2NVFA 2WSCJ 3GKEA 2B24A 2E74C 3GZXA 4AAYB 4NBHD 4OGQC 1EXJA 2WQYC 3DQYA 4QDFB 3AE3C 3CXHE 3C8VA 3GOBA 2WPVB 1KORA 3ABVC 3AECC 2IBZE 4NBED 4HM5A 1SQQE 3AE7C 4H0LB 2GBWA 4P1BH 4H44D 1SQVE 1ZRTE 2E74B 4QDDA 1SQPE 1K05A 5BOKA 2YFLA 1KYOE 1PP9E 1UIXA 2BEQD 4EMJB 3L74E 4NB8D 4NBGD 1KILE 2XSHA 4HM0A 3Q3DA 3O6QA 4U7JA 4I7ZB 2E4QA 1S5LX 1FDOA 4KT0J 2YMKA 3H25A 2BMOA 2G8YA 3H1JE 2FYUE 3AE6C 3GCEA 4NBCD 1ZP0C 1TU3F 5CXMA 2A06E 3CWBE 3L72E 1RIEA 3Q2YA 2P10A 5M1BA 1NU1E 1O7GA 2DE5D 4I7ZC 3GL0A 4QDCA 1P84E 1NTKE 1L0LE 2HMNA 4H0LD 4U3FE 3S9OA 2XRXA 4HM1A 2K9YA 1KB9E 1OW7A 1PIXA 1UUVA 3C0DA 2ZT9D 4HM2A 2XSOA 3D70A 2NWFA 1SQXE 1NYKA 4H13B 3IAOA 1FDIA 3GZYA 1K04A 1IK7A 2J5UA 1PPJE 4YTPC 3FOUA 1PV3A 3B71A 1DIPA 3GF3A 4RKUJ 3SFDC 3AEAC 4HM3A 3EWKA 1R8EA 1YQ4C 2Q3WA 1WQLA 1ZOYC 2D2CB 4PV1B 4HKVA 3SFEC 1SJGA 1JM1A 3AEFC 5KLIC 1JB0J 1DD4A 1KQFB 4QCKA 4QDFA 2ZT9C 1KQGB 3IN6A 2DE6D 4NBFD 2G3AA 3N0QA 2QSIA 1NTME 1MKMA 1O7WA 4AIVA 4NBBD 2FXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XR8 A;  2E4P A;  3EN1 A;  4H44 C;  4NBA D;  4QUQ A;  1O7G A;  1NU1 E;  2D2C D;  4PV1 D;  2DE5 D;  2HMM A;  1ULI A;  1G8K B;  3VMI D;  2E76 D;  3GTS A;  1O7M A;  1O7H A;  2YFJ A;  4HM4 A;  3L70 E;  2NUK A;  4I7Z C;  1O7P A;  3GL0 A;  5KLV E;  4QDC A;  3VCA A;  2BCC E;  2QJP C;  2HML A;  5AEW A;  1P84 E;  2E75 D;  4NB9 D;  3TGU E;  2YVJ B;  1NTK E;  1L0L E;  4P1C H;  2HMN A;  1VF5 C;  1ULJ A;  2NVF A;  3GL2 A;  4H0L D;  4HJL A;  3VCP A;  3GKE A;  2HMK A;  2B24 A;  2E74 C;  1BCC E;  3GZX A;  4U3F E;  2HMO A;  4AAY B;  2XRX A;  4H13 C;  3GTE A;  2NVE A;  3AZC A;  4HM1 A;  1KB9 E;  4NBH D;  3BCC E;  2E75 C;  5AEU A;  4OGQ C;  1UUV A;  3C0D A;  2JZA A;  3DQY A;  4PD4 E;  2ZT9 D;  3CXH E;  4HM2 A;  4QDF B;  4H0L C;  1NDO A;  4NBB D;  2CKF A;  4HM6 A;  2XSO A;  2E74 D;  3VMG D;  2FYN C;  3H1H E;  3D89 A;  3GOB A;  1L0N E;  1NTZ E;  1VM9 A;  1Q90 C;  1SQX E;  2NWF A;  1NYK A;  2BMR A;  3H1L E;  4OGQ D;  2YFI A;  2IBZ E;  3GZY A;  4NBE D;  1PPJ E;  4HM5 A;  1UUW A;  1SQQ E;  2QJY C;  3GB4 A;  4HM8 A;  2ZYL A;  2DE7 D;  1RFS A;  2GBW A;  4P1B H;  4H44 D;  2D2C C;  4PV1 C;  1SQV E;  1VCK A;  3FOU A;  3VMH D;  2NVG A;  1ZRT E;  2QJK C;  4QDD A;  1SQP E;  3EQQ A;  4HM7 A;  3L75 E;  4HM3 A;  5BOK A;  2NUM A;  2YFL A;  1KYO E;  1EG9 A;  4QUR A;  5HL4 A;  1PP9 E;  2B1X A;  2JO6 A;  4EMJ B;  2Q3W A;  1WQL A;  3L74 E;  4NB8 D;  1VF5 D;  4HKV A;  4NBG D;  3CX5 E;  2XSH A;  3H1K E;  1SJG A;  1JM1 A;  2HMJ A;  4H13 D;  4HM0 A;  4NBD D;  5KLI C;  2QPZ A;  1O7N A;  2E4Q A;  4QCK A;  4QDF A;  2ZT9 C;  2GBX A;  1SQB E;  2DE6 D;  4NBF D;  3L71 E;  2YMK A;  2BMO A;  2BMQ A;  3N0Q A;  3H1J E;  4QUP A;  1BE3 E;  2FYU E;  3GCE A;  4NBC D;  1NTM E;  1G8J B;  2YIU C;  5CXM A;  2E76 C;  2A06 E;  3CWB E;  1EZV E;  3H1I E;  2I7F A;  1O7W A;  4AIV A;  3L72 E;  3L73 E;  1FQT A;  5KKZ C;  1RIE A; 
#chains in the Genus database with same CATH topology
 2N9B A;  3TGU D;  1SFC D;  1G8K B;  3VMI D;  4UB8 E;  5KLI B;  2DW3 A;  4IFD K;  3N7N A;  3GLM A;  3VCA A;  3CLQ A;  4HJL A;  1IFN A;  3GHG A;  2WPQ A;  1W2E A;  2SPZ A;  1XTC C;  1NJI Q;  3FX0 A;  3NXS A;  4GKG A;  3CXH I;  1ZR4 A;  5APQ A;  1S3J A;  2FYN C;  1M1J C;  3L75 D;  1Q90 C;  1NU1 K;  1T8Z A;  2R5B A;  1JTH B;  1QX8 A;  1AQ5 A;  2ZYL A;  2Q3E A;  3L70 J;  4ZNC A;  3FWN A;  2NRG A;  2WIT A;  3P8C E;  4WY4 B;  3VMH D;  3F89 A;  3H1H J;  2YO2 A;  3CCU P;  3C1L A;  1L0N K;  4LC1 A;  2E75 B;  2WSC H;  2E42 A;  2GUV A;  4D6T J;  4B86 A;  2M8R A;  1AJY A;  3MIW A;  1AA0 A;  4H13 D;  1JM0 A;  1N7L A;  3AEB C;  1KIL B;  1YYC A;  2XKM A;  1L0L G;  1S72 P;  5TJH A;  4BXL A;  3MZW B;  1EXI A;  1RF1 B;  5L8R J;  5APU A;  1CZQ A;  3H1J D;  4U3F J;  1KB9 D;  4OVN F;  4W80 A;  2PAJ A;  3D71 A;  1LTJ A;  3CI9 A;  3TF5 A;  4PJ0 H;  4XFJ A;  5E79 E;  3CCR P;  2FXO A;  1RY3 A;  2BCC E;  1X22 A;  4RJT A;  1OW6 A;  3MTU E;  3T97 B;  1NTZ J;  1BCC E;  4AQR D;  3TDK A;  3WU2 H;  4R4M A;  1VPC A;  3O6Q B;  1X9V A;  1Q90 D;  3AE2 C;  2JZA A;  1IK9 A;  1NKN A;  2WSE J;  2E74 D;  2E43 A;  4R4L A;  3AE4 C;  1VL2 A;  3MGN A;  3W68 A;  1S1C X;  2MJZ A;  1EC5 A;  4IOI H;  2O01 N;  3H1K G;  3L70 G;  2FFD B;  5APY A;  3A5T A;  1NGM B;  2N1T A;  1PP9 G;  2O01 H;  3P8M C;  1YIJ P;  3V5B A;  3PH0 A;  1S4X A;  2E76 B;  2K9J B;  2JKV A;  3CWB J;  4W7Z A;  2WSS H;  2IYO A;  2ZT9 B;  4TT3 H;  1LTJ C;  1JCC A;  1JY2 P;  3L70 D;  1U7J A;  2KIK A;  2JDI H;  1FOS E;  1PGP A;  3W67 A;  1O7N A;  2FBW C;  1PP9 D;  2PFX A;  1OW8 A;  5AW2 B;  1SQB E;  2JO1 A;  3L71 E;  1SQV D;  2ZYD A;  3Q1M A;  1HTL C;  2CPS A;  1ZN5 A;  3H1I E;  3AE5 C;  2XR8 A;  3VMZ A;  3SSU A;  1MZ9 A;  1S2E A;  4JYC A;  5EFW B;  2OYI B;  1LWU A;  3H6P A;  2FXM A;  1G2C B;  2KLU A;  4HB1 A;  1NAF A;  3KXD A;  1LT9 A;  1SLQ A;  3V2P A;  1ULJ A;  5AVT B;  2E74 C;  3GZX A;  4AAY B;  3HE4 A;  2Q9I A;  2P2U A;  2Y0C A;  2R44 A;  2L5G B;  3CME P;  2FKW B;  1LNQ A;  1MV8 A;  3JSV C;  3AE3 C;  4QDF B;  5KLV K;  3BRT B;  2OYH B;  3HUS B;  1GDT A;  1CI6 B;  2M5A B;  2QM8 A;  3KPE A;  4HM5 A;  2GBW A;  1URQ C;  3L74 G;  2OTK E;  3TK1 A;  1GTW A;  2E74 B;  1SVF A;  2YFL A;  4JYB A;  4PD4 I;  4EYY Q;  2W8Z A;  3GHG B;  3L35 A;  4NBG D;  2XSH A;  1L4A C;  3PP5 A;  3Q3D A;  4NPE A;  4HM0 A;  2ZXX A;  4I7Z B;  3WMM 0;  4OH8 B;  1KD1 Q;  1S5L X;  1DEE G;  3SWF A;  1NTZ G;  2BMO A;  2G8Y A;  2FYU E;  1ZP0 C;  1TU3 F;  3CCE P;  2WVR A;  2A06 E;  1VQ8 P;  1HGZ A;  5AVS B;  3JCU H;  1T6A A;  4EIJ A;  5M1B A;  4L74 A;  1NTZ D;  1P84 E;  1L0L E;  3TYY A;  2K1A A;  4IL6 H;  4H0L D;  1SFC A;  3L73 G;  3M0D C;  4L76 A;  2JWA A;  1FZB A;  2YKP A;  3S9O A;  2XRX A;  2B88 A;  1KB9 E;  3V6I A;  4YXW H;  1BSH A;  3S1K A;  5B66 H;  5KAF H;  1UUV A;  2QJY B;  1SS1 A;  4HM2 A;  2P1J A;  3OW2 O;  1J1E C;  3VP9 A;  2XSO A;  1HJB A;  2IFN A;  1FDI A;  3HE5 A;  1KV4 A;  1K04 A;  3KZI H;  1SQQ J;  3L73 D;  1FZC B;  1LTJ B;  5CCH D;  5AVU B;  1PV3 A;  3B71 A;  3AEA C;  1N7S D;  1RF0 C;  3PTZ A;  1QLE D;  2Q7C A;  1NTK D;  3VMA A;  4BWN A;  1NTM G;  2D2C B;  4HKV A;  1VQ7 P;  3UIA A;  1GW4 A;  1DD4 A;  1NH4 A;  1KQF B;  2ZT9 C;  2BCC D;  1N73 A;  2C9L Y;  3BRV B;  1VQM P;  1VQL P;  1NTM D;  3TSI A;  3CCL P;  2KP8 A;  4N78 D;  2FYZ A;  2KUB A;  4OWF A;  2FXP A;  1G1J A;  1HF9 A;  2D2C D;  3L75 J;  1QEX A;  2BCC G;  2B9B A;  1EDI A;  4Z1M H;  5AEW A;  2BAS A;  3RK2 C;  3TGU E;  4NB9 D;  3TNU B;  2R5D A;  3GL2 A;  2HMO A;  3G9R A;  3OAK A;  3AE8 C;  2E75 C;  2E5T A;  4ZKP A;  2A45 I;  4HM6 A;  1NTK K;  1E5W A;  4EOT A;  3D89 A;  1U7M A;  4C7N A;  1FS0 E;  2A45 H;  1VQN P;  3CMA P;  5KLV D;  1E79 H;  1FU1 A;  2KNC B;  1JMB A;  3GF7 A;  4Y99 C;  1OMI A;  3G6E P;  1L0N G;  3L75 E;  4IFF A;  1A02 F;  3GG2 A;  5KJ7 C;  1WT6 A;  1GL2 B;  1P84 D;  4WB4 A;  2QIW A;  4IFM A;  5KLV G;  3CX5 E;  2P7J A;  1ZME C;  3A0H E;  1JY2 O;  2QPZ A;  2RMZ A;  2KB7 P;  3L73 J;  4I1L A;  2J58 A;  4UB8 H;  1L0N D;  1VF5 B;  1RH5 B;  1CI6 A;  3CX5 D;  1QL2 A;  4QUP A;  3V2Q A;  3G71 P;  1WMK A;  1AVY A;  2C9N Y;  3A0B E;  1PP9 J;  1BE3 J;  5AVZ B;  3R4Y A;  1K9M Q;  2MKV A;  3M9B A;  2R32 A;  3L73 E;  1SQX K;  2PP6 A;  2HOD B;  3H1I D;  5KKZ C;  1PGJ A;  4IL6 X;  1O7H A;  4HM4 A;  3V2N A;  3V2R A;  3H32 B;  1KIL D;  2O01 J;  2E75 D;  1VF5 C;  2N9Y B;  2B87 A;  3BAS A;  3L72 G;  1NHL A;  4H13 C;  2NPS B;  4KHX A;  3H1I G;  5AW8 B;  1OX3 A;  5APT A;  4ZMD A;  1IFD A;  4W7Y A;  4PD4 E;  4JPZ B;  1NTZ E;  1BDC A;  1HH0 A;  2N1T D;  1JY3 O;  1NU1 D;  5CMZ A;  5AW7 B;  1OZH A;  5H2F E;  3H1L G;  1BDD A;  1S5L H;  3L72 D;  1K73 Q;  1N8R Q;  1XTG B;  3AEE C;  5KJ7 D;  1VCK A;  2WZ7 A;  3BVH A;  3FGA D;  3PRJ A;  2XDJ A;  3CC7 P;  2B1X A;  1HUC A;  1SQX J;  1JNM A;  1SFC B;  3H1K E;  3L71 G;  5AVV B;  2YO3 A;  1BCC D;  1LGH B;  2LXB A;  4D6T G;  1J2J B;  1N2D C;  1BE3 E;  1VQ9 P;  3L71 D;  2BEZ F;  2OYH C;  3CD6 P;  1BCC G;  5AVR B;  3CCQ P;  4NPD A;  1N73 C;  4NBA D;  1T2K D;  2HMM A;  3M9H A;  2JP3 A;  1O7M A;  3U1C A;  2Z4E A;  3EQ2 A;  2VRS A;  2HYN A;  2ZYA A;  2HML A;  1JUN A;  2JEE A;  1VQO P;  1ZXG A;  1YHQ P;  5KAF E;  2E5Y A;  1EZV D;  2GA1 A;  4NBH D;  1W5C E;  3E7K A;  4AYC A;  1KYO H;  2WPS A;  3BCC G;  3B8E B;  1JY3 P;  1Y47 A;  1NAY A;  4JQ0 D;  3GW6 A;  1KOR A;  3ABV C;  1RF1 A;  1IFI A;  4NBE D;  1SQP K;  2I1J A;  1N86 A;  1KYO I;  2KXP B;  3AE7 C;  3V4Q A;  3USS A;  1KB9 H;  1MFZ A;  2FYN B;  2WSF H;  5AVW B;  1SQV E;  4JBZ A;  1ZRT E;  3MUD A;  1L0L J;  1N7S B;  1SQP E;  1LTI C;  1P84 H;  1K05 A;  3RL0 D;  1UIX A;  4NB8 D;  2I8D A;  2OTL P;  1BE3 D;  1ZR2 A;  4RES B;  5APV A;  3O6Q A;  5AW0 B;  3VN0 A;  2W6B A;  3G3Z A;  3L72 J;  1EDK A;  1L0L K;  1FDO A;  4XA4 A;  3H25 A;  4NBC D;  3AE6 C;  3A0H H;  1BE3 G;  5CXM A;  1OVV A;  3L72 E;  2FFD A;  1NU1 E;  3TGU G;  4HJG H;  1L4A B;  5H2F H;  4I7Z C;  3GL0 A;  1EQ7 A;  5CCG A;  2IX7 C;  4IL6 E;  2HMN A;  1GL2 A;  4U3F E;  1RE3 A;  1PIX A;  3A3Y B;  2ZVN B;  2B89 A;  4HYT B;  1NTK J;  3RK3 C;  3EFG A;  1W2B O;  1PPJ D;  1SQX E;  1NYK A;  3GZY A;  2J5U A;  1S9K D;  1Q81 Q;  3HD7 C;  4DJG A;  1SQQ G;  3B5N A;  3FOU A;  1WRG A;  2OYI A;  1IO4 A;  3GF3 A;  5K5G B;  1FZG A;  3HTK A;  3EWK A;  1SQP G;  3CPW O;  1G2C A;  3MD0 A;  1YQ4 C;  2Q3W A;  3RK3 B;  1ZOY C;  2FYU G;  5CHX A;  3SFE C;  2NPS A;  3MP7 B;  1YJN P;  1SQQ D;  5KLI C;  2QVA A;  1L0L D;  4QDF A;  1KQG B;  5E79 H;  2ZFC A;  2DE6 D;  3FWL A;  3HUS A;  3OJA B;  3CWB D;  2ZVO B;  1KC8 Q;  4L75 A;  4PD4 D;  1NTM E;  3H1J G;  5AW3 B;  2KK7 A;  2KYV A;  2E4P A;  1URQ D;  1FC2 C;  5CCH C;  1PFI A;  3AED C;  4PV1 D;  4HKZ H;  1Z56 A;  2Y0E A;  3JCU E;  5AW4 B;  2R3S A;  5AVY B;  1O7P A;  4OGQ B;  1KYO D;  2Q1K A;  2OYI C;  1LWU C;  1H0T B;  1LTS C;  3LW5 J;  3BCC E;  2XZR A;  1HJ0 A;  1D7M A;  1NDO A;  1K8A Q;  3H1H E;  3HD7 D;  2CPB A;  3L74 J;  3H1L E;  4EI2 A;  2BMR A;  5GTH E;  2LR2 A;  1KN7 A;  4M3L A;  1UUW A;  2Q6Q A;  2PGD A;  2DE7 D;  3KZI E;  2LKM A;  1NTM K;  3WU2 E;  1OWA A;  5AVQ B;  3GHG C;  2NVG A;  2OQQ A;  1M1K Q;  5APX A;  3EQQ A;  1LTG C;  5CBO A;  2K88 A;  3H1H D;  3M0A A;  1S5L E;  3K5B A;  1YJW P;  1M1J B;  4NBD D;  4NPF X;  1RF0 A;  2ZJS E;  4UB6 H;  3H1H G;  4N6J A;  1JMM A;  2RN0 A;  1G1I A;  2QEX P;  2BMQ A;  1SQV G;  5APW A;  3E1I A;  1M8O B;  1KFM A;  1EZV E;  1IFM A;  3H1J J;  4U3F D;  1AVO A;  1HGV A;  1FZC A;  1LT9 C;  4H44 C;  4C7R A;  1OIP A;  3Q5R A;  5TIS E;  2E76 D;  1H89 A;  4EDF A;  1X8Y A;  5KLV E;  1GK6 A;  3A0B H;  1H88 A;  5GTI E;  1NTZ K;  1J1E B;  3VCP A;  1RQV A;  1GMJ A;  3AZC A;  4DT0 A;  1JY3 N;  5AEU A;  3M91 A;  1KQL A;  2W6A A;  5KLV J;  1QL1 A;  3VMG D;  3VOP A;  3I56 P;  1YQ3 C;  3U1A A;  1L0N E;  3L75 G;  1URQ A;  1LT1 A;  4OGQ D;  1BCC J;  1JCD A;  2QJY C;  3GB4 A;  2Y0D A;  2GUS A;  2D2C C;  3CCJ P;  1CW5 A;  4O9B A;  1KTM A;  3LW5 H;  3KQG A;  2J59 M;  2Y9Z A;  2FY8 A;  4AUW A;  3OA7 A;  1EG9 A;  3HD7 B;  2O3J A;  3TNU A;  1VF5 D;  2HMJ A;  2IZ0 A;  3CCV P;  3D6Z A;  2QA4 P;  2AXT H;  3RBZ A;  3EFF K;  2I1K A;  2Q3I A;  3KYQ A;  2N1T C;  3C9I A;  2H89 C;  1G8J B;  2YIU C;  2E76 C;  2V4H A;  3GMA A;  2Z5I A;  3RK3 E;  2QM7 A;  1FQT A;  3B5N B;  1OVR A;  3GTS A;  3H1L J;  4GOF A;  1LP1 B;  2IDB A;  2ZXE B;  1VQ4 P;  2IBZ G;  1HBW A;  3BCC J;  5CCH A;  2NVF A;  1PGO A;  4OGQ C;  3IR9 A;  1ZW0 A;  2WQY C;  3DQY A;  2KI7 B;  1GW3 A;  2HPC B;  3V4W A;  2FYU J;  3ITK A;  4Y99 B;  3GOB A;  2WPV B;  3AEC C;  3A7O A;  2IBZ D;  2GM4 A;  2K37 A;  1SQQ E;  1YJ9 P;  1AFO A;  4H0L B;  3H1K D;  2AEJ A;  4LGD E;  2HOD A;  1FJP A;  1RE4 C;  4BRY B;  4QDD A;  1KIL C;  1FBM A;  1KZU B;  3H32 A;  4EMJ B;  1ZRT D;  1NTK G;  1YIT P;  2JR8 A;  2Y9Y A;  1KIL E;  1H0T A;  3CX5 I;  4DZO A;  2QRX A;  1M56 D;  2E4Q A;  2IFM A;  4WWI A;  1SP4 A;  3SWK A;  3VMX A;  4CPG A;  1LJ2 A;  3M06 A;  5BU8 B;  4KT0 J;  1H8A A;  2YMK A;  4KJM A;  1SQQ K;  3H1J E;  3GCE A;  5CCG D;  2XV5 A;  3E1R A;  2QJP B;  1Q2N A;  1M57 D;  2AXC A;  3Q2Y A;  2P10 A;  1O7G A;  4WY4 A;  1BSN A;  2DE5 D;  2H7H A;  3WUV A;  4QDC A;  1SQV J;  3FXE A;  1NTK E;  2HFE D;  5CBN A;  4I6M C;  4HM1 A;  2K9Y A;  3VMY A;  3B5N D;  4I2L C;  1AQT A;  1P84 I;  1IFJ A;  2YNY A;  1JO5 A;  2M0B A;  3VP8 A;  3RL0 B;  2NPS C;  3IAO A;  2CK3 H;  5BVZ A;  5B66 E;  1IK7 A;  2YKO A;  1KB9 I;  2YXQ B;  1GL2 D;  5AW6 B;  2AEF A;  2IZ1 A;  4YTP C;  3RBX A;  3L74 D;  1T2K C;  1VQ6 P;  1SFC C;  5C39 A;  3SFD C;  3NTN A;  1IFP A;  3CC4 P;  1NU1 J;  1R8E A;  2M3B A;  3CC2 P;  1WQL A;  3H1I J;  4TLF A;  2KLV A;  2WWW A;  2OGU A;  1QGK B;  2IBZ I;  2YIU B;  5CCG C;  2BCC J;  3P7K A;  1USE A;  4YPC A;  3IN6 A;  4NBF D;  4K3A A;  2WPR A;  4L73 A;  5AW9 B;  1VDF A;  1M90 Q;  5KAI E;  1X0T A;  5KTB A;  1ZV8 A;  4AIV A;  3G4S P;  4NBB D;  4MN4 C;  1OFC X;  2W27 A;  4QUQ A;  2N1T B;  1ULI A;  2RH0 A;  2YFJ A;  2XND H;  1N7S A;  3Q5S A;  2KS1 B;  2M3E A;  3HD7 A;  1EDL A;  3PHL A;  3B5N C;  5DJT B;  5AW1 B;  1SQX G;  2H88 C;  3GTE A;  2NVE A;  1EDJ A;  3L36 A;  2NPS D;  4ASV A;  3B4S A;  3L4F A;  4UB6 E;  4H0L C;  2CKF A;  3WUU A;  1J1D B;  1GL2 C;  3FXD A;  3M0D A;  3AE9 C;  1VM9 A;  1RE3 C;  3VTP C;  3R2P A;  2YFI A;  1FZA A;  1NU1 G;  3U59 A;  4GIF A;  3BAT A;  1LTT C;  1IC2 A;  1ZLL A;  1SQX D;  3I5C A;  1NOH A;  1PGQ A;  3RL0 g;  1JOC A;  1RFS A;  3MHV A;  1SQB J;  2OTJ P;  1NWQ A;  1EZV I;  1USD A;  2FYU K;  1LWU B;  4WVZ A;  1L4A A;  2QE7 H;  2KZI A;  3IFM A;  2NUM A;  1LP1 A;  2W6J H;  4DCK A;  5HL4 A;  2AEM A;  1LT9 B;  2R3C A;  3L37 A;  3CXH D;  4QMA A;  5AW5 B;  4H44 B;  1HWT C;  3MUD C;  5GTH H;  1FZF A;  1N7S C;  2IPP A;  2YKQ A;  3AEG C;  1L0N J;  2GBX A;  4YXD C;  2OYO A;  1SQP J;  2M5A A;  3NMD A;  3Q5P A;  1SQV K;  1OXZ A;  1M7L A;  4DOJ A;  2WMM A;  2C0W A;  1PL5 A;  2A06 G;  2OAR A;  1NYH A;  3EN1 A;  1GU5 A;  3II6 A;  4GT1 A;  4BRY A;  3A2A A;  1IZN B;  3L70 E;  3HTK B;  1GK4 A;  2QJP C;  3D6Y A;  5CJ4 A;  1S9K E;  2HG5 D;  4Y28 J;  4P1C H;  2HMK A;  2QJK B;  1RF1 C;  1NTM J;  2A06 D;  3IF4 A;  3WUT A;  3P8C D;  4N3Y B;  3RGU A;  1YTZ T;  1LTB C;  3BCC D;  2ZAE B;  2V7Q J;  3KHU A;  4GDO A;  1L2P A;  1Y9B A;  4HM8 A;  3NFQ A;  2AXT E;  2WT7 A;  1VQ5 P;  1HVV A;  5AVX B;  1DX7 A;  4PV1 C;  2QJK C;  4HH2 A;  2YXR B;  2NZ2 A;  4HM7 A;  1GZL A;  4PJ0 E;  3CL3 D;  2P67 A;  4QUR A;  5BU5 A;  2JO6 A;  5B5E H;  1FZC C;  2Q5U A;  1KMI Z;  3F5H A;  1RQU A;  1SQB D;  4A7P A;  1U57 A;  2WSF J;  1AV1 A;  1DD3 A;  3AE1 C;  1VQK P;  2KOG A;  4XE5 B;  3HE5 B;  2W90 A;  2A45 G;  2W83 C;  1JTH A;  2K3R A;  1BGY D;  3CX5 H;  1NKZ B;  1UII A;  2RKL A;  1FZE A;  2I7F A;  1SQB G;  1LTA C;  3RK2 B;  2QG4 A;  3S4R A;  4D6T E;  5TIS H;  2C0X A;  3PLN A;  1MUU A;  1FAV A;  2NUK A;  2JJL A;  3VYI A;  2H43 A;  1YI2 P;  2YVJ B;  1RHZ B;  3SWY A;  2XNX A;  2YMY A;  1BGY G;  2WSC J;  3LIE A;  3RK3 D;  3GKE A;  2B24 A;  1L4A D;  1M1J A;  1SQB K;  4N78 E;  1KFN A;  1KIL A;  1R5L A;  5APS A;  2JWD A;  2HR3 A;  4K35 A;  1EXJ A;  1GD2 E;  3CXH E;  4GOE A;  1GU4 A;  3C8V A;  2IYP A;  1N73 B;  1PPJ G;  2IBZ E;  3H1L D;  1KQS O;  1NO4 A;  2V7Q H;  5KJ7 A;  1Q7Y Q;  3CCM P;  2ZYG A;  4P1B H;  4LLH A;  1DH3 A;  2O1K A;  3QH9 A;  4H44 D;  2O1J A;  1FOS F;  2HLO A;  2P58 A;  3HRN A;  2KS1 A;  5BOK A;  1KYO E;  1SQP D;  1YBK A;  1PP9 E;  1BGY E;  2BEQ D;  3RK2 D;  3L74 E;  3ZDM A;  2FYU D;  3HUS C;  4WY4 C;  3T97 A;  4ASW A;  4U7J A;  2XU6 A;  1JY2 N;  1PZQ A;  4D6T D;  3TGU J;  3PJS K;  5KKZ B;  3CWB G;  4C7N B;  1URQ B;  3N4X A;  2Z5H A;  3CWB E;  2POH A;  3LID A;  2KNC A;  1RIE A;  1YTZ I;  2UWJ E;  1OVU A;  2K9J A;  3QWO C;  1CSB A;  1IJD B;  1FJK A;  3KDP B;  1T3J A;  1BGY J;  3L71 J;  3CXH H;  4RO0 A;  1EZV G;  2WTY A;  1OW7 A;  1Q86 Q;  3C0D A;  4WBA A;  1DEB A;  3M9Q A;  2ZT9 D;  2H8P D;  3D70 A;  1R5S A;  4ZKU A;  2FFD C;  1T3U A;  2NWF A;  4H13 B;  1VQP P;  3JC2 2;  3H1K J;  1PPJ E;  1Q82 Q;  1NVO A;  2KSE A;  1Y8A A;  2ITA A;  2PRR A;  1DIP A;  4RKU J;  4WY4 D;  1X79 B;  1A02 J;  4HM3 A;  4GOD A;  2KZJ A;  3O8Z A;  2KSJ A;  2B87 B;  4PV1 B;  3I55 P;  3CCS P;  1RE4 A;  1SJG A;  3RL0 C;  3AEF C;  3HE4 B;  1JM1 A;  5GTI H;  1FE6 A;  1JB0 J;  1JEK A;  3P32 A;  1MFT A;  5CJ0 A;  2HPC A;  4QCK A;  2LXC B;  4PD4 H;  5DJU B;  2OYH A;  1FDM A;  1QVF O;  5B5E E;  2G3A A;  4JF7 A;  3N0Q A;  2QSI A;  4C46 A;  1QVG O;  1MKM A;  2L91 A;  5KAI H;  2WT7 B;  1O7W A;  1J1D C;  4U3F G;  2WSE H; 
#chains in the Genus database with same CATH homology
 2E4P A;  1HF9 A;  4QUQ A;  2D2C D;  3AED C;  4PV1 D;  1ULI A;  1G8K B;  3VMI D;  2YFJ A;  3Q5S A;  1O7P A;  4Z1M H;  4OGQ B;  3GLM A;  3VCA A;  5AEW A;  3TGU E;  4NB9 D;  3GL2 A;  4HJL A;  2H88 C;  2HMO A;  3G9R A;  3GTE A;  2NVE A;  3AE8 C;  3LW5 J;  3BCC E;  2E75 C;  1HJ0 A;  4H0L C;  1NDO A;  2CKF A;  4HM6 A;  2FYN C;  3H1H E;  3D89 A;  3AE9 C;  1VM9 A;  1Q90 C;  3H1L E;  2BMR A;  2YFI A;  1UUW A;  3RL0 g;  2ZYL A;  2DE7 D;  1RFS A;  3GF7 A;  1OMI A;  3VMH D;  2NVG A;  2OQQ A;  3EQQ A;  3L75 E;  2E75 B;  2NUM A;  5HL4 A;  4H44 B;  2QIW A;  1AJY A;  3CX5 E;  4H13 D;  1ZME C;  4NBD D;  2QPZ A;  3AEB C;  3AEG C;  2GBX A;  1VF5 B;  1EXI A;  4YXD C;  2BMQ A;  5L8R J;  3Q5P A;  4QUP A;  1WMK A;  3R4Y A;  1EZV E;  3D71 A;  2MKV A;  3L73 E;  1PL5 A;  5KKZ C;  1NYH A;  3EN1 A;  4H44 C;  3Q5R A;  4XFJ A;  2E76 D;  4IL6 X;  1O7H A;  4HM4 A;  3L70 E;  5KLV E;  2BCC E;  2QJP C;  3D6Y A;  2O01 J;  2E75 D;  4Y28 J;  1OW6 A;  4P1C H;  1VF5 C;  3T97 B;  3VCP A;  1RQV A;  2HMK A;  1GMJ A;  1BCC E;  4R4M A;  4H13 C;  3AZC A;  1Q90 D;  3AE2 C;  5AEU A;  2JZA A;  4PD4 E;  2WSE J;  2E74 D;  3VMG D;  2V7Q J;  1YQ3 C;  4GDO A;  1L0N E;  1NTZ E;  4R4L A;  4OGQ D;  3AE4 C;  1VL2 A;  1S1C X;  1Y9B A;  2QJY C;  3GB4 A;  4HM8 A;  3AEE C;  2D2C C;  4PV1 C;  1NGM B;  1VCK A;  2QJK C;  1KTM A;  3FGA D;  2NZ2 A;  4HM7 A;  2E76 B;  4QUR A;  1EG9 A;  2B1X A;  2JO6 A;  2ZT9 B;  4TT3 H;  1VF5 D;  1KMI Z;  3H1K E;  2HMJ A;  1RQU A;  3D6Z A;  1O7N A;  2FBW C;  1OW8 A;  1U57 A;  2WSF J;  1SQB E;  1DD3 A;  3AE1 C;  2JO1 A;  3L71 E;  1BE3 E;  2H89 C;  3Q1M A;  1G8J B;  2YIU C;  2E76 C;  2BEZ F;  3H1I E;  2I7F A;  3GMA A;  3AE5 C;  3RK3 E;  1FQT A;  2XR8 A;  4NBA D;  2HMM A;  3GTS A;  2JP3 A;  1O7M A;  2NUK A;  2HML A;  2IDB A;  2YVJ B;  1ULJ A;  2NVF A;  2WSC J;  3GKE A;  2B24 A;  2E74 C;  3GZX A;  4AAY B;  4NBH D;  4OGQ C;  1EXJ A;  2WQY C;  3DQY A;  4QDF B;  3AE3 C;  3CXH E;  3C8V A;  3GOB A;  2WPV B;  1KOR A;  3ABV C;  3AEC C;  2IBZ E;  4NBE D;  4HM5 A;  1SQQ E;  3AE7 C;  4H0L B;  2GBW A;  4P1B H;  4H44 D;  1SQV E;  1ZRT E;  2E74 B;  4QDD A;  1SQP E;  1K05 A;  5BOK A;  2YFL A;  1KYO E;  1PP9 E;  1UIX A;  2BEQ D;  4EMJ B;  3L74 E;  4NB8 D;  4NBG D;  1KIL E;  2XSH A;  4HM0 A;  3Q3D A;  3O6Q A;  4U7J A;  4I7Z B;  2E4Q A;  1S5L X;  1FDO A;  4KT0 J;  2YMK A;  3H25 A;  2BMO A;  2G8Y A;  3H1J E;  2FYU E;  3AE6 C;  3GCE A;  4NBC D;  1ZP0 C;  1TU3 F;  5CXM A;  2A06 E;  3CWB E;  3L72 E;  1RIE A;  3Q2Y A;  2P10 A;  5M1B A;  1NU1 E;  1O7G A;  2DE5 D;  4I7Z C;  3GL0 A;  4QDC A;  1P84 E;  1NTK E;  1L0L E;  2HMN A;  4H0L D;  4U3F E;  3S9O A;  2XRX A;  4HM1 A;  2K9Y A;  1KB9 E;  1OW7 A;  1PIX A;  1UUV A;  3C0D A;  2ZT9 D;  4HM2 A;  2XSO A;  3D70 A;  2NWF A;  1SQX E;  1NYK A;  4H13 B;  3IAO A;  1FDI A;  3GZY A;  1K04 A;  1IK7 A;  2J5U A;  1PPJ E;  4YTP C;  3FOU A;  1PV3 A;  3B71 A;  1DIP A;  3GF3 A;  4RKU J;  3SFD C;  3AEA C;  4HM3 A;  3EWK A;  1R8E A;  1YQ4 C;  2Q3W A;  1WQL A;  1ZOY C;  2D2C B;  4PV1 B;  4HKV A;  3SFE C;  1SJG A;  1JM1 A;  3AEF C;  5KLI C;  1JB0 J;  1DD4 A;  1KQF B;  4QCK A;  4QDF A;  2ZT9 C;  1KQG B;  3IN6 A;  2DE6 D;  4NBF D;  2G3A A;  3N0Q A;  2QSI A;  1NTM E;  1MKM A;  1O7W A;  4AIV A;  4NBB D;  2FXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...