2E75D

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
total genus 20
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e75D02
3AZCA 1G8KB 2YIUC 1ULIA 1NTKE 3GCEA 4NBHD 4HM1A 1VF5C 2HMMA 4HM0A 4AIVA 4EMJB 5KLVE 2NVGA 4PD4E 3VMID 1FQTA 2NUMA 4HM3A 1KB9E 2NVFA 1SQBE 4HM5A 4NBFD 2E4PA 4H13C 4H0LD 1O7WA 1NU1E 3L71E 2ZT9D 5HL4A 4HM7A 1PP9E 1SQXE 4QDCA 2NUKA 2GBWA 3L70E 2ZYLA 2B1XA 1VF5D 5AEWA 4HJLA 2XSHA 4QDDA 1ULJA 2IBZE 3GKEA 4QDFB 2QJYC 1SQVE 4NB9D 1NTZE 2BCCE 2XRXA 2YVJB 4H13D 1RFSA 4OGQC 1L0LE 2JO6A 4P1BH 2YFIA 5KKZC 1ZRTE 1KYOE 1NDOA 2E4QA 2HMLA 3DQYA 1O7NA 2GBXA 3CX5E 5BOKA 4QUQA 2D2CC 3EN1A 3L74E 4NB8D 3VCAA 1RIEA 3GZYA 1NTME 1O7MA 4AAYB 3TGUE 1EZVE 2QJPC 3CXHE 3H1HE 1BE3E 2DE5D 3GOBA 3L75E 2E75C 3BCCE 2HMJA 2BMOA 3H1KE 4QURA 4NBGD 2Q3WA 2A06E 1SJGA 4OGQD 1UUWA 1Q90C 3H1IE 3L73E 1O7GA 2FYNC 2YFJA 5AEUA 2CKFA 5CXMA 3L72E 1JM1A 4HKVA 2D2CD 4HM6A 2JZAA 1SQPE 4U3FE 1G8JB 3D89A 4QUPA 2YMKA 3VMHD 4PV1C 2DE6D 3H1LE 4HM4A 3GB4A 1PPJE 2FYUE 2QJKC 2E75D 4NBDD 3GL2A 1SQQE 1VM9A 4QDFA 4NBCD 1O7PA 2DE7D 2E74C 2NVEA 1EG9A 2HMOA 3EQQA 2B24A 2NWFA 2E76C 3GTSA 3H1JE 2BMQA 4NBBD 1O7HA 4NBAD 4PV1D 3C0DA 4P1CH 1L0NE 4H44C 2I7FA 3N0QA 2QPZA 2XR8A 2XSOA 2YFLA 1UUVA 2E74D 2HMKA 1P84E 4NBED 3FOUA 4QCKA 3GTEA 1WQLA 1BCCE 3CWBE 3VMGD 2HMNA 3GL0A 3VCPA 1VCKA 2E76D 2BMRA 4H0LC 4HM8A 2ZT9C 5KLIC 3GZXA 4H44D 4I7ZC 4HM2A 1NYKA
chains in the Genus database with same CATH superfamily
2O3JA 2A06D 1QL2A 5KLVK 4U3FD 3E7KA 2KK7A 2IBZE 1T2KC 5KJ7C 4ZKUA 1LT1A 1LT9A 1YI2P 1N7SA 3B5NC 5CCHD 2P2UA 2W27A 2XKMA 1L4AD 2PP6A 1BE3G 4JF7A 1P84D 1PGPA 1JY2P 1AJYA 1X8YA 2IDBA 4OGQD 2OYIC 1Q90C 2YFJA 4N78E 2WITA 4HM6A 3TSIA 4K3AA 1AVYA 2KXPB 4HM4A 4RESB 2RKLA 2ZYAA 1VQ4P 2E5YA 2OYHC 2QJKC 1PZQA 1FC2C 1GDTA 2KOGA 2WSCJ 2AXTH 1EQ7A 3H25A 2H89C 1IFDA 4I1LA 5BU8B 3KDPB 1ZP0C 4BRYA 4GOFA 4C7NA 2I1KA 1Q82Q 4IL6E 1LP1B 1L0NK 3CCVP 1SFCB 1MV8A 2E75B 5E79H 1YBKA 3CX5H 2ZT9C 3GZXA 4H44D 5KAFH 1EZVD 1NTZG 5CBOA 3CXHD 1LTTC 4ASVA 5CCGC 1T6AA 2KI7B 3AE6C 2ZFCA 2IYPA 1KQFB 4LGDE 2I1JA 2N1TC 1FJKA 2KNCB 1KB9E 2HYNA 3L72D 5K5GB 4H13C 4H0LD 3LIDA 1NU1E 2FYZA 3V2NA 3N4XA 1SQXG 2NPSB 1N7LA 1T3JA 1HUCA 1VL2A 1SQVG 3AE3C 3ITKA 1SFCA 1FS0E 1M1JB 3H1JD 3L71J 2SPZA 2Z4EA 1NTMG 1EDLA 5AVSB 1LTBC 1EXJA 2KSEA 1S4XA 3AEAC 1URQD 2FYNC 2KSJA 3CX5I 4Y28J 3P7KA 3VMZA 1YTZI 1OMIA 1EC5A 5APWA 3CWBG 4NBDD 5KLVD 1YIJP 1SQBD 2Z5IA 1YQ3C 1M1JA 2HMOA 2BCCJ 3GTSA 2XU6A 1L2PA 1O7HA 4P1CH 2E43A 1U7MA 4EOTA 1TU3F 4RO0A 2GUVA 4L74A 3G9RA 2Y0DA 3H1HJ 4A7PA 3HE5A 4DT0A 1KILD 5AVTB 3TYYA 4GIFA 5BVZA 4IFDK 4PV1B 1NTKK 1LTJA 4HM5A 1G1JA 1JTHB 1SQQJ 3L71E 3CC2P 3GG2A 4HM7A 4D6TJ 2N1TA 5AEWA 3VP8A 3RGUA 2XRXA 1SQPG 1YJWP 2MJZA 1OW8A 1PPJG 4W7YA 1N2DC 2GBXA 1L0ND 5AW1B 2WSSH 3M0DC 4L75A 1MZ9A 1WMKA 3EFFK 2G3AA 1BCCD 3L73E 3MD0A 3SWFA 3M06A 2Q6QA 4DOJA 3LW5H 2JO1A 1GTWA 2AXCA 2FXPA 2FYUE 4WY4C 5AVVB 2R5DA 3GHGC 2P7JA 4PD4H 2W90A 2HODB 3FWLA 5M1BA 2B24A 2WSCH 5H2FH 2P67A 2C9NY 3A0BH 2Y0EA 3CCQP 2E5TA 3L74J 2FBWC 2QJPB 3V4WA 1Q86Q 1RF1A 2CPBA 2A45G 1BE3J 3CX5D 2QRXA 2W8ZA 3CC7P 1DIPA 3L75D 3A5TA 1RE3C 4AIVA 4EMJB 3H1LJ 1FQTA 3GLMA 1JY3P 3EFGA 5L8RJ 4O9BA 2HODA 1OZHA 3PHLA 2NPSD 1T2KD 3RL0D 1FZFA 3H1IG 3L70E 4PD4I 3PLNA 4NB9D 1LTSC 1JY2O 1SP4A 3R2PA 2KS1B 3RL0g 3H32B 3L36A 3AE2C 4AAYB 3GMAA 2DE5D 1PPJD 4WBAA 1SJGA 2K9JA 1VQPP 3JC22 5CXMA 3LIEA 1FZBA 2XNDH 3M0AA 5GTHH 1SQXJ 4IFMA 3Q3DA 1IZNB 1KFMA 1L4AB 1E79H 2WPQA 2QJYB 3VOPA 2IFMA 5APYA 1SQVJ 2UWJE 2KB7P 3HRNA 2BMQA 4NBBD 1L0LJ 3I5CA 3P8CE 1R8EA 2I7FA 3H32A 1BDDA 2IPPA 3MHVA 1N73A 1J1EC 2QIWA 1BSHA 1U57A 1NTMJ 2R3CA 1S1CX 1KYOH 1BGYG 4HM8A 2QM8A 3RK3E 5AVXB 2JKVA 4I7ZC 5CMZA 3AZCA 3CCMP 4YXWH 3GCEA 4NBHD 1NKZB 3VTPC 4HM0A 1L4AA 3VMID 2WMMA 2E4PA 3CWBJ 1HWTC 1JY3N 1RE3A 5B5EH 2A06G 1FDIA 4H44B 3NTNA 1R5SA 3KHUA 4KT0J 1NTZE 4U3FG 3CCSP 2W83C 3H1ID 2OGUA 4P1BH 4EI2A 2AEFA 3JCUE 4PJ0H 3RK3C 3WU2H 4H0LB 2ZYGA 3VCAA 2Q3EA 4IL6X 3HUSB 2POHA 4AQRD 3M9HA 2BMOA 1LT9C 1KYOI 1QGKB 1N7SC 4YPCA 3Q5SA 1OW6A 3W68A 3M91A 1VQOP 1DD4A 1KN7A 1DD3A 3MTUE 4NPDA 1M8OB 3HD7D 4PD4D 1SQQK 1URQB 4XFJA 1YITP 3O8ZA 3TNUA 1JOCA 1K05A 3IN6A 4HKZH 2YXQB 2AXTE 2QPZA 2FKWB 2P10A 3CWBE 1USEA 2M3BA 1J1DC 1GK4A 2E76D 2ZAEB 1AVOA 1FE6A 1YHQP 1KTMA 1GW3A 4OH8B 2O01J 2J5UA 3U1CA 1OX3A 1KV4A 2OTLP 1ZR4A 3RBZA 4LLHA 1EZVG 5AVQB 1H0TA 1IK7A 2K37A 1NJIQ 1KILB 1IK9A 5AW3B 4QDDA 1KORA 3VP9A 3TGUD 3L72G 3PJSK 4BXLA 1ZRTE 5DJTB 1RE4A 1FZAA 3KZIH 3DQYA 1WT6A 1K04A 3C1LA 1WRGA 3C8VA 3AEEC 4Z1MH 1SFCC 3GOBA 2E75C 4EYYQ 2HMJA 4C7RA 3FX0A 2B88A 3H1JG 5AEUA 3ZDMA 2FXMA 1FJPA 2ZXEB 3BATA 1SQPE 3FXDA 1VPCA 3VMHD 1QLED 1PPJE 1NU1J 1KILA 1Y9BA 1MKMA 1QL1A 5B66E 5APTA 4AUWA 2QEXP 2DE7D 2FFDB 1AA0A 3D70A 5KKZB 3WUTA 1NVOA 2BEZF 5KLVG 3A3YB 2R5BA 1YTZT 1SQBG 2W6JH 1RHZB 3A7OA 1UUVA 2BCCD 2PRRA 1S2EA 1M1JC 2WVRA 3VN0A 4GODA 1KYOD 1HGZA 3VCPA 1JY3O 2O01N 4HH2A 3H1KD 1VF5C 1BSNA 2HLOA 4ZKPA 1HJ0A 1LWUB 4HM3A 4TT3H 2FFDA 2B89A 3BCCG 3BASA 1JM0A 1SQQD 1GZLA 1LTJC 1SQXK 4D6TD 2K88A 3AE9C 1X0TA 1SQVK 1KQSO 3AE4C 1VQNP 2YXRB 5KTBA 1L0LK 3Q2YA 2PGDA 3Q5PA 3RL0B 3BVHA 2ZVNB 4NBGD 1LWUA 2Z5HA 1NTMK 3H1IE 1L0NG 1LP1A 2R32A 4HKVA 2D2CD 1H8AA 2YMKA 4PV1C 1AQTA 2DE6D 1BCCG 2WZ7A 4HB1A 2P1JA 1S5LE 3GL2A 1VM9A 3EQ2A 1O7PA 1GL2D 1IC2A 1HH0A 3EQQA 2Q3IA 2KNCA 3AE5C 4UB6E 2NPSA 1ZLLA 1FOSF 2KZJA 4TLFA 1CI6B 5GTIE 5H2FE 3D6ZA 2PFXA 2Y9YA 3L74D 3FGAD 3L73J 2WPVB 2XNXA 4HM2A 2N9YB 4XA4A 2IZ0A 4HM1A 1RF1C 4RJTA 1OVVA 1ZXGA 2Y9ZA 1SLQA 3CC4P 2FYUJ 1IJDB 1RY3A 2KZIA 2BASA 2O01H 3L75G 3H1LD 1IFIA 4QDCA 3HE4B 4DZOA 2WPRA 1BGYE 2JDIH 3BCCD 1CI6A 4EIJA 2OTJP 1PL5A 1HVVA 1FZCB 3QH9A 2IBZI 3QWOC 3GZYA 3TGUE 2QJPC 4IL6H 3CCRP 2A06E 3GW6A 1PIXA 3RK2D 2M5AB 1W2BO 2JZAA 4U3FE 3Q1MA 1UIXA 2CPSA 1RF0A 1JNMA 3CCEP 3L70J 1S9KD 1KB9H 2RH0A 1EG9A 1HBWA 1NAYA 5AW2B 5TISE 1K73Q 1FZCA 2RMZA 1IFNA 1PGQA 1JTHA 1XTGB 3G6EP 1LNQA 2E74D 1A02F 1P84E 1L0LD 2GM4A 3W67A 1JB0J 1PP9G 4UB8E 3HD7B 2M5AA 1U7JA 4LC1A 3B8EB 4I6MC 2B87B 1N73C 2C0XA 1G8KB 1ULIA 2G8YA 3Q5RA 1RQUA 2HMMA 2W6BA 1H89A 3PRJA 5HL4A 2YKQA 1VQLP 1NU1K 2E76B 1L4AC 4QDFB 1KB9I 2QJYC 3KYQA 2LXCB 1N86A 4OGQC 2NZ2A 1DEEG 1SQBJ 3A0HE 2BEQD 2WQYC 2MKVA 4QUQA 4YTPC 3EN1A 1HGVA 2B87A 2KUBA 3O6QB 1O7MA 1EZVE 3CXHE 5KJ7D 2W6AA 1HTLC 3GF7A 3WU2E 2CKFA 4Y99B 3B5ND 3L72E 3P32A 3D89A 3V4QA 4QDFA 2V7QJ 1Q90D 2WPSA 1Q81Q 1J2JB 1OVUA 2R3SA 1MFTA 2AEMA 2HFED 1NTZJ 2N9BA 3H1JE 4H44C 3O6QA 3S4RA 1UIIA 1CSBA 2XZRA 1YJ9P 3E1IA 1EDJA 1NTKD 2C0WA 5EFWB 1GMJA 2QE7H 1PGJA 2LR2A 4H0LC 3UIAA 1FOSE 1QX8A 3MGNA 3HUSC 3AEDC 1NH4A 1NYKA 1PP9D 5DJUB 3E1RA 3G3ZA 2KS1A 3VMXA 4I2LC 3V2RA 1DEBA 5KLVE 4N78D 2QVAA 1QVGO 2OYOA 1SQBE 2ZT9D 3CCUP 3I55P 3IR9A 2JR8A 4WB4A 2NUKA 3CMAP 5CCGD 4NPEA 4RKUJ 1OW7A 2N1TD 4NPFX 5KAIE 3L4FA 5CCHA 1URQC 4H13D 2IZ1A 2JO6A 5AW0B 3USSA 1R5LA 2HMLA 3G4SP 2IYOA 3MIWA 1KILE 5AVUB 3TGUG 4YXDC 3II6A 3BCCE 2Q3WA 3OW2O 3OA7A 1RE4C 1JEKA 5CBNA 5APUA 2QM7A 1FBMA 1M1KQ 2M0BA 2YNYA 1KB9D 2FYUK 1LJ2A 4WVZA 1NGMB 2E42A 2O1JA 3M9QA 2GUSA 1NAFA 1KILC 1L0NE 5CHXA 3N0QA 2D2CB 1FZEA 1H88A 1QVFO 1JMBA 2Q7CA 3F89A 3L35A 3CCLP 1BCCE 1K8AQ 1PFIA 1GL2B 3IF4A 2ZJSE 4W7ZA 5AVYB 3CPWO 2BCCG 5C39A 1FAVA 3NFQA 1SQPJ 1W2EA 2NVGA 3CD6P 3HUSA 2KIKA 4JBZA 3H1HG 1JCCA 3H1KG 3CLQA 1EXIA 2GBWA 1S5LX 1ZW0A 1NHLA 3EWKA 4MN4C 2FFDC 1Q2NA 1VQ9P 3T97B 2YFIA 5KKZC 1OIPA 2I8DA 5E79E 1DX7A 3CX5E 1GL2A 1SQQG 5APXA 3OJAB 1IO4A 5KAFE 1URQA 4D6TG 1FDMA 1QEXA 1E5WA 3L75E 2YIUB 1O7GA 1VQ8P 3AE8C 2Q9IA 1LGHB 3MUDA 1LWUC 1LT9B 5AW9B 2LXBA 2NVEA 3L71D 2K3RA 1MUUA 2V7QH 1FU1A 1NO4A 4WY4D 3RK2B 5APSA 3SWKA 2C9LY 4GOEA 1D7MA 1S3JA 3M9BA 3D71A 4B86A 1SQBK 3GL0A 3JCUH 2O1KA 1PV3A 3H1IJ 1Z56A 1IFMA 2JP3A 2NPSC 3RL0C 3BRVB 2JWDA 1NTKE 3AECC 3K5BA 1X22A 3VMYA 2YKPA 2WSFJ 3L73D 2L5GB 3L74G 4NBFD 1J1DB 4BRYB 1O7WA 2E74B 4C7NB 1OVRA 1CW5A 1PP9E 4ZNCA 1W5CE 2FYUD 3LW5J 2ZYLA 1KZUB 2B1XA 5APQA 2L91A 1EDIA 3H1HD 1JO5A 1VQ7P 3H1LG 5AVRB 1NTZK 1NDOA 2E4QA 2XV5A 3TF5A 3N7NA 3GF3A 5KLIB 4ZMDA 3R4YA 2KP8A 1M90Q 3KPEA 4R4LA 1UUWA 2QG4A 2HPCB 4BWNA 1JUNA 3GB4A 3H6PA 1IFPA 4JPZB 4M3LA 5TJHA 1T3UA 1BGYJ 2KLUA 1X79B 2K9YA 2NWFA 1LTAC 3L70D 1G2CB 2K1AA 2GA1A 3B5NB 1RF0C 2HMKA 2FXOA 2B9BA 3TGUJ 1FZCC 2OYIB 4KJMA 2HPCA 2JJLA 1RQVA 1Q7YQ 1L0LG 1AQ5A 4U3FJ 3AEFC 2OYHB 2QJKB 3U59A 3S1KA 4PD4E 4IOIH 2NVFA 3SFEC 5KJ7A 3CCJP 2WTYA 1G2CA 3B5NA 1VF5B 3KQGA 3A0BE 1JY2N 1ULJA 3GKEA 5B66H 4QMAA 1BE3D 3HE5B 2YVJB 1RFSA 2OTKE 1KQLA 3RBXA 2OYIA 2YMYA 3P8CD 2AEJA 2ZT9B 1LTJB 3WUVA 3VYIA 3SSUA 2OYHA 3HD7C 4L76A 1VQKP 3SFDC 3RK3D 2N1TB 4H13B 3B4SA 1YYCA 2R44A 1XTCC 1SQPK 3MP7B 2DW3A 3L37A 1VDFA 3G71P 1N7SD 1GU4A 3H1KJ 2JWAA 2IFNA 1CZQA 4HJGH 2E76C 2A45H 4NBAD 3TK1A 1GD2E 2WSEJ 4OWFA 1NTZD 4GDOA 1DH3A 3HE4A 5CCGA 1BDCA 1NWQA 1RH5B 2VRSA 2FYNB 1VCKA 3CL3D 2IBZG 3V2QA 4JQ0D 3IAOA 3AEGC 1VQMP 1NTKG 1SQXD 5GTHE 3L72J 2HG5D 2NRGA 4Y99C 1SQVD 5CJ0A 2Y0CA 3PH0A 4XE5B 2WSFH 1K9MQ 1T8ZA 3A2AA 3WUUA 4EDFA 1RF1B 1S5LH 1NTMD 3H1JJ 3IFMA 2BCCE 3CI9A 3ABVC 1SVFA 2HR3A 5AVZB 2A45I 1KYOE 1JCDA 1KMIZ 4HYTB 1O7NA 4NB8D 2ZYDA 4UB6H 5AW8B 3H1HE 5CCHC 5CJ4A 3H1KE 3CWBD 1KC8Q 1M57D 5AW6B 2P58A 5GTIH 3HTKB 4U7JA 5KLVJ 3WMM0 1FDOA 4N3YB 3HD7A 4QUPA 2IX7C 5B5EE 1SFCD 2E75D 1SQQE 1LTGC 2M3EA 3P8MC 4D6TE 3FXEA 3AEBC 2V4HA 4W80A 2YO3A 4PJ0E 3U1AA 2RN0A 2WT7B 2K9JB 1NU1G 1SS1A 1N8RQ 3FOUA 3S9OA 1ZRTD 2ITAA 3NMDA 4AYCA 3HTKA 3BCCJ 5AW4B 1KFNA 1EDKA 1X9VA 4CPGA 1FZGA 3D6YA 2H43A 3F5HA 3FWNA 1ZOYC 4WY4B 2IBZD 4ASWA 3GHGB 2NUMA 2KLVA 3C9IA 1SQPD 1YJNP 1N73B 2WT7A 1LTIC 1VF5D 4HJLA 2XSHA 1ZN5A 3M0DA 2KYVA 1L0NJ 4L73A 3NXSA 5TISH 3TDKA 1VQ5P 5BOKA 2D2CC 3L74E 1BCCJ 2OQQA 1BE3E 1A02J 5BU5A 1P84H 4WY4A 3B71A 2J59M 4OGQB 4UB8H 1M7LA 3GHGA 2YO2A 1GL2C 1MFZA 1G8JB 4JYCA 2CK3H 3H1LE 4C46A 5AW5B 4NBCD 1Y8AA 3CMEP 1NYHA 3KZIE 3MUDC 1AFOA 4PV1D 3C0DA 5APVA 2J58A 3PP5A 4OVNF 2XR8A 2YFLA 3PTZA 3L71G 4JYBA 4NBED 2ZVOB 2ZXXA 1S72P 1WQLA 1Y47A 3GTEA 3MZWB 2WSEH 2HMNA 3L75J 3A0HH 1AV1A 1ZMEC 1NU1D 3OAKA 5AVWB 2QA4P 3KXDA 2H8PD 1P84I 2YIUC 3CXHH 1OWAA 2XDJA 2Q1KA 3TNUB 3AE1C 2FY8A 1S9KE 4WWIA 2H7HA 1GU5A 2OARA 3V5BA 1SQXE 1IFJA 3L73G 2WWWA 4N6JA 1SQVE 1YQ4C 1J1EB 1KQGB 1L0LE 1GW4A 2FYUG 1VQ6P 3RK2C 1OFCX 2QSIA 1ZV8A 3V2PA 3JSVC 1RIEA 1NTME 4IFFA 4I7ZB 3BRTB 4QURA 4K35A 3I56P 1H0TB 1KD1Q 1NTKJ 1JM1A 4DJGA 1EZVI 3CXHI 1GK6A 1HJBA 2M8RA 2H88C 3AE7C 1PP9J 1NKNA 1G1IA 2JEEA 2E74C 1ZR2A 1OXZA 2YKOA 3VMAA 3V6IA 3RK3B 2PAJA 1BGYD 4DCKA 2XSOA 2LKMA 1M56D 5KAIH 1HF9A 4QCKA 1NOHA 1PGOA 3VMGD 5AW7B 3L70G 4KHXA 1N7SB 4GKGA 1JMMA 2BMRA 3SWYA 5KLIC 4GT1A 3T97A 4R4MA 2Q5UA 1USDA
chains in the Genus database with same CATH topology
3AZCA 1G8KB 1ULIA 2G8YA 3GCEA 4NBHD 3Q5RA 1RQUA 2HMMA 4HM0A 3AEFC 4PD4E 3VMID 2NVFA 2E4PA 3SFEC 5HL4A 2E76B 1VF5B 1ULJA 1FDIA 2IBZE 4H44B 3GKEA 4QDFB 2QJYC 4KT0J 1NTZE 2YVJB 1RFSA 4OGQC 2NZ2A 4P1BH 2BEQD 2WQYC 2MKVA 4QUQA 4YTPC 3EN1A 4H0LB 3VCAA 2ZT9B 4IL6X 1O7MA 1EZVE 3CXHE 1AJYA 2BMOA 2IDBA 3GF7A 4OGQD 1Q90C 2YFJA 3Q5SA 3SFDC 2CKFA 1OW6A 3L72E 4HM6A 4H13B 3D89A 1DD4A 4HM4A 2QJKC 1DD3A 2WSCJ 4QDFA 2V7QJ 1Q90D 3H25A 2H89C 4XFJA 2E76C 3H1JE 1ZP0C 3IN6A 1K05A 4NBAD 4H44C 2WSEJ 3O6QA 2QPZA 4GDOA 2P10A 1GMJA 2E75B 3CWBE 1VCKA 2E76D 4H0LC 2ZT9C 3IAOA 3GZXA 4H44D 3AEDC 3AEGC 1NYKA 1KTMA 3AE6C 2O01J 2J5UA 1KQFB 5KLVE 1KB9E 1SQBE 4H13C 4H0LD 1NU1E 2ZT9D 1IK7A 2NUKA 4QDDA 1KORA 1VL2A 4RKUJ 1OW7A 3AE3C 2BCCE 4H13D 3ABVC 2JO6A 1ZRTE 1KYOE 2HMLA 3DQYA 1KMIZ 1O7NA 1K04A 1KILE 4NB8D 3C8VA 3AEEC 4YXDC 4Z1MH 1EXJA 3H1HE 3GOBA 2E75C 3BCCE 2HMJA 3H1KE 3AEAC 2Q3WA 2FYNC 5AEUA 4Y28J 4U7JA 1FDOA 1SQPE 4QUPA 1OMIA 3VMHD 1PPJE 1Y9BA 4NBDD 2E75D 1MKMA 1SQQE 2DE7D 1NGMB 1YQ3C 3AEBC 2HMOA 3D70A 3GTSA 1O7HA 2BEZF 4P1CH 1L0NE 3N0QA 2D2CB 1TU3F 1UUVA 3FOUA 3S9OA 1BCCE 3G9RA 3VCPA 3D6YA 1VF5C 4PV1B 1ZOYC 1HJ0A 2NVGA 4HM3A 2NUMA 4HM5A 4TT3H 3L71E 4HM7A 1EXIA 2GBWA 1S5LX 1VF5D 5AEWA 4HJLA 2XSHA 3EWKA 2XRXA 3T97B 1OW8A 3AE9C 2YFIA 5KKZC 3AE4C 2GBXA 3CX5E 5BOKA 2D2CC 3L74E 3Q2YA 1WMKA 3Q5PA 2OQQA 1BE3E 2G3AA 3L75E 4NBGD 3B71A 4OGQB 3H1IE 3L73E 1O7GA 3AE8C 4HKVA 2D2CD 2JO1A 1G8JB 2FXPA 2YMKA 4PV1C 2DE6D 3H1LE 2FYUE 3GL2A 1VM9A 4NBCD 1O7PA 2NVEA 3EQQA 1NYHA 5M1BA 2B24A 3AE5C 4PV1D 3C0DA 2XR8A 2YFLA 2FBWC 4NBED 3GTEA 3D71A 1WQLA 2HMNA 3GL0A 3D6ZA 1ZMEC 3FGAD 1PV3A 2WPVB 1DIPA 2JP3A 4HM2A 2YIUC 1NTKE 3AECC 4HM1A 2WSFJ 4AIVA 4EMJB 3AE1C 1FQTA 4NBFD 3GLMA 1O7WA 2E74B 5L8RJ 1PP9E 1SQXE 4QDCA 3LW5J 3L70E 2ZYLA 2B1XA 1SQVE 4NB9D 1YQ4C 1KQGB 1RQVA 1L0LE 1PL5A 1NDOA 2E4QA 3RL0g 2QSIA 3GF3A 1RIEA 3GZYA 1NTME 3AE2C 4I7ZB 4AAYB 3TGUE 3GMAA 3R4YA 2QJPC 2DE5D 4QURA 2A06E 4R4LA 1SJGA 1UUWA 1PIXA 5CXMA 1JM1A 2JZAA 4U3FE 3Q1MA 3GB4A 2H88C 1UIXA 3AE7C 3Q3DA 2E74C 1EG9A 2K9YA 2NWFA 2BMQA 4NBBD 1R8EA 2I7FA 2XSOA 2QIWA 2E74D 2HMKA 1P84E 1HF9A 4QCKA 1U57A 1JB0J 3VMGD 1S1CX 2BMRA 4HM8A 3RK3E 5KLIC 4I7ZC 4R4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AZC A;  1G8K B;  2YIU C;  1ULI A;  1NTK E;  3GCE A;  4NBH D;  4HM1 A;  1VF5 C;  2HMM A;  4HM0 A;  4AIV A;  4EMJ B;  5KLV E;  2NVG A;  4PD4 E;  3VMI D;  1FQT A;  2NUM A;  4HM3 A;  1KB9 E;  2NVF A;  1SQB E;  4HM5 A;  4NBF D;  2E4P A;  4H13 C;  4H0L D;  1O7W A;  1NU1 E;  3L71 E;  2ZT9 D;  5HL4 A;  4HM7 A;  1PP9 E;  1SQX E;  4QDC A;  2NUK A;  2GBW A;  3L70 E;  2ZYL A;  2B1X A;  1VF5 D;  5AEW A;  4HJL A;  2XSH A;  4QDD A;  1ULJ A;  2IBZ E;  3GKE A;  4QDF B;  2QJY C;  1SQV E;  4NB9 D;  1NTZ E;  2BCC E;  2XRX A;  2YVJ B;  4H13 D;  1RFS A;  4OGQ C;  1L0L E;  2JO6 A;  4P1B H;  2YFI A;  5KKZ C;  1ZRT E;  1KYO E;  1NDO A;  2E4Q A;  2HML A;  3DQY A;  1O7N A;  2GBX A;  3CX5 E;  5BOK A;  4QUQ A;  2D2C C;  3EN1 A;  3L74 E;  4NB8 D;  3VCA A;  1RIE A;  3GZY A;  1NTM E;  1O7M A;  4AAY B;  3TGU E;  1EZV E;  2QJP C;  3CXH E;  3H1H E;  1BE3 E;  2DE5 D;  3GOB A;  3L75 E;  2E75 C;  3BCC E;  2HMJ A;  2BMO A;  3H1K E;  4QUR A;  4NBG D;  2Q3W A;  2A06 E;  1SJG A;  4OGQ D;  1UUW A;  1Q90 C;  3H1I E;  3L73 E;  1O7G A;  2FYN C;  2YFJ A;  5AEU A;  2CKF A;  5CXM A;  3L72 E;  1JM1 A;  4HKV A;  2D2C D;  4HM6 A;  2JZA A;  1SQP E;  4U3F E;  1G8J B;  3D89 A;  4QUP A;  2YMK A;  3VMH D;  4PV1 C;  2DE6 D;  3H1L E;  4HM4 A;  3GB4 A;  1PPJ E;  2FYU E;  2QJK C;  2E75 D;  4NBD D;  3GL2 A;  1SQQ E;  1VM9 A;  4QDF A;  4NBC D;  1O7P A;  2DE7 D;  2E74 C;  2NVE A;  1EG9 A;  2HMO A;  3EQQ A;  2B24 A;  2NWF A;  2E76 C;  3GTS A;  3H1J E;  2BMQ A;  4NBB D;  1O7H A;  4NBA D;  4PV1 D;  3C0D A;  4P1C H;  1L0N E;  4H44 C;  2I7F A;  3N0Q A;  2QPZ A;  2XR8 A;  2XSO A;  2YFL A;  1UUV A;  2E74 D;  2HMK A;  1P84 E;  4NBE D;  3FOU A;  4QCK A;  3GTE A;  1WQL A;  1BCC E;  3CWB E;  3VMG D;  2HMN A;  3GL0 A;  3VCP A;  1VCK A;  2E76 D;  2BMR A;  4H0L C;  4HM8 A;  2ZT9 C;  5KLI C;  3GZX A;  4H44 D;  4I7Z C;  4HM2 A;  1NYK A; 
#chains in the Genus database with same CATH topology
 2O3J A;  2A06 D;  1QL2 A;  5KLV K;  4U3F D;  3E7K A;  2KK7 A;  2IBZ E;  1T2K C;  5KJ7 C;  4ZKU A;  1LT1 A;  1LT9 A;  1YI2 P;  1N7S A;  3B5N C;  5CCH D;  2P2U A;  2W27 A;  2XKM A;  1L4A D;  2PP6 A;  1BE3 G;  4JF7 A;  1P84 D;  1PGP A;  1JY2 P;  1AJY A;  1X8Y A;  2IDB A;  4OGQ D;  2OYI C;  1Q90 C;  2YFJ A;  4N78 E;  2WIT A;  4HM6 A;  3TSI A;  4K3A A;  1AVY A;  2KXP B;  4HM4 A;  4RES B;  2RKL A;  2ZYA A;  1VQ4 P;  2E5Y A;  2OYH C;  2QJK C;  1PZQ A;  1FC2 C;  1GDT A;  2KOG A;  2WSC J;  2AXT H;  1EQ7 A;  3H25 A;  2H89 C;  1IFD A;  4I1L A;  5BU8 B;  3KDP B;  1ZP0 C;  4BRY A;  4GOF A;  4C7N A;  2I1K A;  1Q82 Q;  4IL6 E;  1LP1 B;  1L0N K;  3CCV P;  1SFC B;  1MV8 A;  2E75 B;  5E79 H;  1YBK A;  3CX5 H;  2ZT9 C;  3GZX A;  4H44 D;  5KAF H;  1EZV D;  1NTZ G;  5CBO A;  3CXH D;  1LTT C;  4ASV A;  5CCG C;  1T6A A;  2KI7 B;  3AE6 C;  2ZFC A;  2IYP A;  1KQF B;  4LGD E;  2I1J A;  2N1T C;  1FJK A;  2KNC B;  1KB9 E;  2HYN A;  3L72 D;  5K5G B;  4H13 C;  4H0L D;  3LID A;  1NU1 E;  2FYZ A;  3V2N A;  3N4X A;  1SQX G;  2NPS B;  1N7L A;  1T3J A;  1HUC A;  1VL2 A;  1SQV G;  3AE3 C;  3ITK A;  1SFC A;  1FS0 E;  1M1J B;  3H1J D;  3L71 J;  2SPZ A;  2Z4E A;  1NTM G;  1EDL A;  5AVS B;  1LTB C;  1EXJ A;  2KSE A;  1S4X A;  3AEA C;  1URQ D;  2FYN C;  2KSJ A;  3CX5 I;  4Y28 J;  3P7K A;  3VMZ A;  1YTZ I;  1OMI A;  1EC5 A;  5APW A;  3CWB G;  4NBD D;  5KLV D;  1YIJ P;  1SQB D;  2Z5I A;  1YQ3 C;  1M1J A;  2HMO A;  2BCC J;  3GTS A;  2XU6 A;  1L2P A;  1O7H A;  4P1C H;  2E43 A;  1U7M A;  4EOT A;  1TU3 F;  4RO0 A;  2GUV A;  4L74 A;  3G9R A;  2Y0D A;  3H1H J;  4A7P A;  3HE5 A;  4DT0 A;  1KIL D;  5AVT B;  3TYY A;  4GIF A;  5BVZ A;  4IFD K;  4PV1 B;  1NTK K;  1LTJ A;  4HM5 A;  1G1J A;  1JTH B;  1SQQ J;  3L71 E;  3CC2 P;  3GG2 A;  4HM7 A;  4D6T J;  2N1T A;  5AEW A;  3VP8 A;  3RGU A;  2XRX A;  1SQP G;  1YJW P;  2MJZ A;  1OW8 A;  1PPJ G;  4W7Y A;  1N2D C;  2GBX A;  1L0N D;  5AW1 B;  2WSS H;  3M0D C;  4L75 A;  1MZ9 A;  1WMK A;  3EFF K;  2G3A A;  1BCC D;  3L73 E;  3MD0 A;  3SWF A;  3M06 A;  2Q6Q A;  4DOJ A;  3LW5 H;  2JO1 A;  1GTW A;  2AXC A;  2FXP A;  2FYU E;  4WY4 C;  5AVV B;  2R5D A;  3GHG C;  2P7J A;  4PD4 H;  2W90 A;  2HOD B;  3FWL A;  5M1B A;  2B24 A;  2WSC H;  5H2F H;  2P67 A;  2C9N Y;  3A0B H;  2Y0E A;  3CCQ P;  2E5T A;  3L74 J;  2FBW C;  2QJP B;  3V4W A;  1Q86 Q;  1RF1 A;  2CPB A;  2A45 G;  1BE3 J;  3CX5 D;  2QRX A;  2W8Z A;  3CC7 P;  1DIP A;  3L75 D;  3A5T A;  1RE3 C;  4AIV A;  4EMJ B;  3H1L J;  1FQT A;  3GLM A;  1JY3 P;  3EFG A;  5L8R J;  4O9B A;  2HOD A;  1OZH A;  3PHL A;  2NPS D;  1T2K D;  3RL0 D;  1FZF A;  3H1I G;  3L70 E;  4PD4 I;  3PLN A;  4NB9 D;  1LTS C;  1JY2 O;  1SP4 A;  3R2P A;  2KS1 B;  3RL0 g;  3H32 B;  3L36 A;  3AE2 C;  4AAY B;  3GMA A;  2DE5 D;  1PPJ D;  4WBA A;  1SJG A;  2K9J A;  1VQP P;  3JC2 2;  5CXM A;  3LIE A;  1FZB A;  2XND H;  3M0A A;  5GTH H;  1SQX J;  4IFM A;  3Q3D A;  1IZN B;  1KFM A;  1L4A B;  1E79 H;  2WPQ A;  2QJY B;  3VOP A;  2IFM A;  5APY A;  1SQV J;  2UWJ E;  2KB7 P;  3HRN A;  2BMQ A;  4NBB D;  1L0L J;  3I5C A;  3P8C E;  1R8E A;  2I7F A;  3H32 A;  1BDD A;  2IPP A;  3MHV A;  1N73 A;  1J1E C;  2QIW A;  1BSH A;  1U57 A;  1NTM J;  2R3C A;  1S1C X;  1KYO H;  1BGY G;  4HM8 A;  2QM8 A;  3RK3 E;  5AVX B;  2JKV A;  4I7Z C;  5CMZ A;  3AZC A;  3CCM P;  4YXW H;  3GCE A;  4NBH D;  1NKZ B;  3VTP C;  4HM0 A;  1L4A A;  3VMI D;  2WMM A;  2E4P A;  3CWB J;  1HWT C;  1JY3 N;  1RE3 A;  5B5E H;  2A06 G;  1FDI A;  4H44 B;  3NTN A;  1R5S A;  3KHU A;  4KT0 J;  1NTZ E;  4U3F G;  3CCS P;  2W83 C;  3H1I D;  2OGU A;  4P1B H;  4EI2 A;  2AEF A;  3JCU E;  4PJ0 H;  3RK3 C;  3WU2 H;  4H0L B;  2ZYG A;  3VCA A;  2Q3E A;  4IL6 X;  3HUS B;  2POH A;  4AQR D;  3M9H A;  2BMO A;  1LT9 C;  1KYO I;  1QGK B;  1N7S C;  4YPC A;  3Q5S A;  1OW6 A;  3W68 A;  3M91 A;  1VQO P;  1DD4 A;  1KN7 A;  1DD3 A;  3MTU E;  4NPD A;  1M8O B;  3HD7 D;  4PD4 D;  1SQQ K;  1URQ B;  4XFJ A;  1YIT P;  3O8Z A;  3TNU A;  1JOC A;  1K05 A;  3IN6 A;  4HKZ H;  2YXQ B;  2AXT E;  2QPZ A;  2FKW B;  2P10 A;  3CWB E;  1USE A;  2M3B A;  1J1D C;  1GK4 A;  2E76 D;  2ZAE B;  1AVO A;  1FE6 A;  1YHQ P;  1KTM A;  1GW3 A;  4OH8 B;  2O01 J;  2J5U A;  3U1C A;  1OX3 A;  1KV4 A;  2OTL P;  1ZR4 A;  3RBZ A;  4LLH A;  1EZV G;  5AVQ B;  1H0T A;  1IK7 A;  2K37 A;  1NJI Q;  1KIL B;  1IK9 A;  5AW3 B;  4QDD A;  1KOR A;  3VP9 A;  3TGU D;  3L72 G;  3PJS K;  4BXL A;  1ZRT E;  5DJT B;  1RE4 A;  1FZA A;  3KZI H;  3DQY A;  1WT6 A;  1K04 A;  3C1L A;  1WRG A;  3C8V A;  3AEE C;  4Z1M H;  1SFC C;  3GOB A;  2E75 C;  4EYY Q;  2HMJ A;  4C7R A;  3FX0 A;  2B88 A;  3H1J G;  5AEU A;  3ZDM A;  2FXM A;  1FJP A;  2ZXE B;  3BAT A;  1SQP E;  3FXD A;  1VPC A;  3VMH D;  1QLE D;  1PPJ E;  1NU1 J;  1KIL A;  1Y9B A;  1MKM A;  1QL1 A;  5B66 E;  5APT A;  4AUW A;  2QEX P;  2DE7 D;  2FFD B;  1AA0 A;  3D70 A;  5KKZ B;  3WUT A;  1NVO A;  2BEZ F;  5KLV G;  3A3Y B;  2R5B A;  1YTZ T;  1SQB G;  2W6J H;  1RHZ B;  3A7O A;  1UUV A;  2BCC D;  2PRR A;  1S2E A;  1M1J C;  2WVR A;  3VN0 A;  4GOD A;  1KYO D;  1HGZ A;  3VCP A;  1JY3 O;  2O01 N;  4HH2 A;  3H1K D;  1VF5 C;  1BSN A;  2HLO A;  4ZKP A;  1HJ0 A;  1LWU B;  4HM3 A;  4TT3 H;  2FFD A;  2B89 A;  3BCC G;  3BAS A;  1JM0 A;  1SQQ D;  1GZL A;  1LTJ C;  1SQX K;  4D6T D;  2K88 A;  3AE9 C;  1X0T A;  1SQV K;  1KQS O;  3AE4 C;  1VQN P;  2YXR B;  5KTB A;  1L0L K;  3Q2Y A;  2PGD A;  3Q5P A;  3RL0 B;  3BVH A;  2ZVN B;  4NBG D;  1LWU A;  2Z5H A;  1NTM K;  3H1I E;  1L0N G;  1LP1 A;  2R32 A;  4HKV A;  2D2C D;  1H8A A;  2YMK A;  4PV1 C;  1AQT A;  2DE6 D;  1BCC G;  2WZ7 A;  4HB1 A;  2P1J A;  1S5L E;  3GL2 A;  1VM9 A;  3EQ2 A;  1O7P A;  1GL2 D;  1IC2 A;  1HH0 A;  3EQQ A;  2Q3I A;  2KNC A;  3AE5 C;  4UB6 E;  2NPS A;  1ZLL A;  1FOS F;  2KZJ A;  4TLF A;  1CI6 B;  5GTI E;  5H2F E;  3D6Z A;  2PFX A;  2Y9Y A;  3L74 D;  3FGA D;  3L73 J;  2WPV B;  2XNX A;  4HM2 A;  2N9Y B;  4XA4 A;  2IZ0 A;  4HM1 A;  1RF1 C;  4RJT A;  1OVV A;  1ZXG A;  2Y9Z A;  1SLQ A;  3CC4 P;  2FYU J;  1IJD B;  1RY3 A;  2KZI A;  2BAS A;  2O01 H;  3L75 G;  3H1L D;  1IFI A;  4QDC A;  3HE4 B;  4DZO A;  2WPR A;  1BGY E;  2JDI H;  3BCC D;  1CI6 A;  4EIJ A;  2OTJ P;  1PL5 A;  1HVV A;  1FZC B;  3QH9 A;  2IBZ I;  3QWO C;  3GZY A;  3TGU E;  2QJP C;  4IL6 H;  3CCR P;  2A06 E;  3GW6 A;  1PIX A;  3RK2 D;  2M5A B;  1W2B O;  2JZA A;  4U3F E;  3Q1M A;  1UIX A;  2CPS A;  1RF0 A;  1JNM A;  3CCE P;  3L70 J;  1S9K D;  1KB9 H;  2RH0 A;  1EG9 A;  1HBW A;  1NAY A;  5AW2 B;  5TIS E;  1K73 Q;  1FZC A;  2RMZ A;  1IFN A;  1PGQ A;  1JTH A;  1XTG B;  3G6E P;  1LNQ A;  2E74 D;  1A02 F;  1P84 E;  1L0L D;  2GM4 A;  3W67 A;  1JB0 J;  1PP9 G;  4UB8 E;  3HD7 B;  2M5A A;  1U7J A;  4LC1 A;  3B8E B;  4I6M C;  2B87 B;  1N73 C;  2C0X A;  1G8K B;  1ULI A;  2G8Y A;  3Q5R A;  1RQU A;  2HMM A;  2W6B A;  1H89 A;  3PRJ A;  5HL4 A;  2YKQ A;  1VQL P;  1NU1 K;  2E76 B;  1L4A C;  4QDF B;  1KB9 I;  2QJY C;  3KYQ A;  2LXC B;  1N86 A;  4OGQ C;  2NZ2 A;  1DEE G;  1SQB J;  3A0H E;  2BEQ D;  2WQY C;  2MKV A;  4QUQ A;  4YTP C;  3EN1 A;  1HGV A;  2B87 A;  2KUB A;  3O6Q B;  1O7M A;  1EZV E;  3CXH E;  5KJ7 D;  2W6A A;  1HTL C;  3GF7 A;  3WU2 E;  2CKF A;  4Y99 B;  3B5N D;  3L72 E;  3P32 A;  3D89 A;  3V4Q A;  4QDF A;  2V7Q J;  1Q90 D;  2WPS A;  1Q81 Q;  1J2J B;  1OVU A;  2R3S A;  1MFT A;  2AEM A;  2HFE D;  1NTZ J;  2N9B A;  3H1J E;  4H44 C;  3O6Q A;  3S4R A;  1UII A;  1CSB A;  2XZR A;  1YJ9 P;  3E1I A;  1EDJ A;  1NTK D;  2C0W A;  5EFW B;  1GMJ A;  2QE7 H;  1PGJ A;  2LR2 A;  4H0L C;  3UIA A;  1FOS E;  1QX8 A;  3MGN A;  3HUS C;  3AED C;  1NH4 A;  1NYK A;  1PP9 D;  5DJU B;  3E1R A;  3G3Z A;  2KS1 A;  3VMX A;  4I2L C;  3V2R A;  1DEB A;  5KLV E;  4N78 D;  2QVA A;  1QVG O;  2OYO A;  1SQB E;  2ZT9 D;  3CCU P;  3I55 P;  3IR9 A;  2JR8 A;  4WB4 A;  2NUK A;  3CMA P;  5CCG D;  4NPE A;  4RKU J;  1OW7 A;  2N1T D;  4NPF X;  5KAI E;  3L4F A;  5CCH A;  1URQ C;  4H13 D;  2IZ1 A;  2JO6 A;  5AW0 B;  3USS A;  1R5L A;  2HML A;  3G4S P;  2IYO A;  3MIW A;  1KIL E;  5AVU B;  3TGU G;  4YXD C;  3II6 A;  3BCC E;  2Q3W A;  3OW2 O;  3OA7 A;  1RE4 C;  1JEK A;  5CBN A;  5APU A;  2QM7 A;  1FBM A;  1M1K Q;  2M0B A;  2YNY A;  1KB9 D;  2FYU K;  1LJ2 A;  4WVZ A;  1NGM B;  2E42 A;  2O1J A;  3M9Q A;  2GUS A;  1NAF A;  1KIL C;  1L0N E;  5CHX A;  3N0Q A;  2D2C B;  1FZE A;  1H88 A;  1QVF O;  1JMB A;  2Q7C A;  3F89 A;  3L35 A;  3CCL P;  1BCC E;  1K8A Q;  1PFI A;  1GL2 B;  3IF4 A;  2ZJS E;  4W7Z A;  5AVY B;  3CPW O;  2BCC G;  5C39 A;  1FAV A;  3NFQ A;  1SQP J;  1W2E A;  2NVG A;  3CD6 P;  3HUS A;  2KIK A;  4JBZ A;  3H1H G;  1JCC A;  3H1K G;  3CLQ A;  1EXI A;  2GBW A;  1S5L X;  1ZW0 A;  1NHL A;  3EWK A;  4MN4 C;  2FFD C;  1Q2N A;  1VQ9 P;  3T97 B;  2YFI A;  5KKZ C;  1OIP A;  2I8D A;  5E79 E;  1DX7 A;  3CX5 E;  1GL2 A;  1SQQ G;  5APX A;  3OJA B;  1IO4 A;  5KAF E;  1URQ A;  4D6T G;  1FDM A;  1QEX A;  1E5W A;  3L75 E;  2YIU B;  1O7G A;  1VQ8 P;  3AE8 C;  2Q9I A;  1LGH B;  3MUD A;  1LWU C;  1LT9 B;  5AW9 B;  2LXB A;  2NVE A;  3L71 D;  2K3R A;  1MUU A;  2V7Q H;  1FU1 A;  1NO4 A;  4WY4 D;  3RK2 B;  5APS A;  3SWK A;  2C9L Y;  4GOE A;  1D7M A;  1S3J A;  3M9B A;  3D71 A;  4B86 A;  1SQB K;  3GL0 A;  3JCU H;  2O1K A;  1PV3 A;  3H1I J;  1Z56 A;  1IFM A;  2JP3 A;  2NPS C;  3RL0 C;  3BRV B;  2JWD A;  1NTK E;  3AEC C;  3K5B A;  1X22 A;  3VMY A;  2YKP A;  2WSF J;  3L73 D;  2L5G B;  3L74 G;  4NBF D;  1J1D B;  4BRY B;  1O7W A;  2E74 B;  4C7N B;  1OVR A;  1CW5 A;  1PP9 E;  4ZNC A;  1W5C E;  2FYU D;  3LW5 J;  2ZYL A;  1KZU B;  2B1X A;  5APQ A;  2L91 A;  1EDI A;  3H1H D;  1JO5 A;  1VQ7 P;  3H1L G;  5AVR B;  1NTZ K;  1NDO A;  2E4Q A;  2XV5 A;  3TF5 A;  3N7N A;  3GF3 A;  5KLI B;  4ZMD A;  3R4Y A;  2KP8 A;  1M90 Q;  3KPE A;  4R4L A;  1UUW A;  2QG4 A;  2HPC B;  4BWN A;  1JUN A;  3GB4 A;  3H6P A;  1IFP A;  4JPZ B;  4M3L A;  5TJH A;  1T3U A;  1BGY J;  2KLU A;  1X79 B;  2K9Y A;  2NWF A;  1LTA C;  3L70 D;  1G2C B;  2K1A A;  2GA1 A;  3B5N B;  1RF0 C;  2HMK A;  2FXO A;  2B9B A;  3TGU J;  1FZC C;  2OYI B;  4KJM A;  2HPC A;  2JJL A;  1RQV A;  1Q7Y Q;  1L0L G;  1AQ5 A;  4U3F J;  3AEF C;  2OYH B;  2QJK B;  3U59 A;  3S1K A;  4PD4 E;  4IOI H;  2NVF A;  3SFE C;  5KJ7 A;  3CCJ P;  2WTY A;  1G2C A;  3B5N A;  1VF5 B;  3KQG A;  3A0B E;  1JY2 N;  1ULJ A;  3GKE A;  5B66 H;  4QMA A;  1BE3 D;  3HE5 B;  2YVJ B;  1RFS A;  2OTK E;  1KQL A;  3RBX A;  2OYI A;  2YMY A;  3P8C D;  2AEJ A;  2ZT9 B;  1LTJ B;  3WUV A;  3VYI A;  3SSU A;  2OYH A;  3HD7 C;  4L76 A;  1VQK P;  3SFD C;  3RK3 D;  2N1T B;  4H13 B;  3B4S A;  1YYC A;  2R44 A;  1XTC C;  1SQP K;  3MP7 B;  2DW3 A;  3L37 A;  1VDF A;  3G71 P;  1N7S D;  1GU4 A;  3H1K J;  2JWA A;  2IFN A;  1CZQ A;  4HJG H;  2E76 C;  2A45 H;  4NBA D;  3TK1 A;  1GD2 E;  2WSE J;  4OWF A;  1NTZ D;  4GDO A;  1DH3 A;  3HE4 A;  5CCG A;  1BDC A;  1NWQ A;  1RH5 B;  2VRS A;  2FYN B;  1VCK A;  3CL3 D;  2IBZ G;  3V2Q A;  4JQ0 D;  3IAO A;  3AEG C;  1VQM P;  1NTK G;  1SQX D;  5GTH E;  3L72 J;  2HG5 D;  2NRG A;  4Y99 C;  1SQV D;  5CJ0 A;  2Y0C A;  3PH0 A;  4XE5 B;  2WSF H;  1K9M Q;  1T8Z A;  3A2A A;  3WUU A;  4EDF A;  1RF1 B;  1S5L H;  1NTM D;  3H1J J;  3IFM A;  2BCC E;  3CI9 A;  3ABV C;  1SVF A;  2HR3 A;  5AVZ B;  2A45 I;  1KYO E;  1JCD A;  1KMI Z;  4HYT B;  1O7N A;  4NB8 D;  2ZYD A;  4UB6 H;  5AW8 B;  3H1H E;  5CCH C;  5CJ4 A;  3H1K E;  3CWB D;  1KC8 Q;  1M57 D;  5AW6 B;  2P58 A;  5GTI H;  3HTK B;  4U7J A;  5KLV J;  3WMM 0;  1FDO A;  4N3Y B;  3HD7 A;  4QUP A;  2IX7 C;  5B5E E;  1SFC D;  2E75 D;  1SQQ E;  1LTG C;  2M3E A;  3P8M C;  4D6T E;  3FXE A;  3AEB C;  2V4H A;  4W80 A;  2YO3 A;  4PJ0 E;  3U1A A;  2RN0 A;  2WT7 B;  2K9J B;  1NU1 G;  1SS1 A;  1N8R Q;  3FOU A;  3S9O A;  1ZRT D;  2ITA A;  3NMD A;  4AYC A;  3HTK A;  3BCC J;  5AW4 B;  1KFN A;  1EDK A;  1X9V A;  4CPG A;  1FZG A;  3D6Y A;  2H43 A;  3F5H A;  3FWN A;  1ZOY C;  4WY4 B;  2IBZ D;  4ASW A;  3GHG B;  2NUM A;  2KLV A;  3C9I A;  1SQP D;  1YJN P;  1N73 B;  2WT7 A;  1LTI C;  1VF5 D;  4HJL A;  2XSH A;  1ZN5 A;  3M0D A;  2KYV A;  1L0N J;  4L73 A;  3NXS A;  5TIS H;  3TDK A;  1VQ5 P;  5BOK A;  2D2C C;  3L74 E;  1BCC J;  2OQQ A;  1BE3 E;  1A02 J;  5BU5 A;  1P84 H;  4WY4 A;  3B71 A;  2J59 M;  4OGQ B;  4UB8 H;  1M7L A;  3GHG A;  2YO2 A;  1GL2 C;  1MFZ A;  1G8J B;  4JYC A;  2CK3 H;  3H1L E;  4C46 A;  5AW5 B;  4NBC D;  1Y8A A;  3CME P;  1NYH A;  3KZI E;  3MUD C;  1AFO A;  4PV1 D;  3C0D A;  5APV A;  2J58 A;  3PP5 A;  4OVN F;  2XR8 A;  2YFL A;  3PTZ A;  3L71 G;  4JYB A;  4NBE D;  2ZVO B;  2ZXX A;  1S72 P;  1WQL A;  1Y47 A;  3GTE A;  3MZW B;  2WSE H;  2HMN A;  3L75 J;  3A0H H;  1AV1 A;  1ZME C;  1NU1 D;  3OAK A;  5AVW B;  2QA4 P;  3KXD A;  2H8P D;  1P84 I;  2YIU C;  3CXH H;  1OWA A;  2XDJ A;  2Q1K A;  3TNU B;  3AE1 C;  2FY8 A;  1S9K E;  4WWI A;  2H7H A;  1GU5 A;  2OAR A;  3V5B A;  1SQX E;  1IFJ A;  3L73 G;  2WWW A;  4N6J A;  1SQV E;  1YQ4 C;  1J1E B;  1KQG B;  1L0L E;  1GW4 A;  2FYU G;  1VQ6 P;  3RK2 C;  1OFC X;  2QSI A;  1ZV8 A;  3V2P A;  3JSV C;  1RIE A;  1NTM E;  4IFF A;  4I7Z B;  3BRT B;  4QUR A;  4K35 A;  3I56 P;  1H0T B;  1KD1 Q;  1NTK J;  1JM1 A;  4DJG A;  1EZV I;  3CXH I;  1GK6 A;  1HJB A;  2M8R A;  2H88 C;  3AE7 C;  1PP9 J;  1NKN A;  1G1I A;  2JEE A;  2E74 C;  1ZR2 A;  1OXZ A;  2YKO A;  3VMA A;  3V6I A;  3RK3 B;  2PAJ A;  1BGY D;  4DCK A;  2XSO A;  2LKM A;  1M56 D;  5KAI H;  1HF9 A;  4QCK A;  1NOH A;  1PGO A;  3VMG D;  5AW7 B;  3L70 G;  4KHX A;  1N7S B;  4GKG A;  1JMM A;  2BMR A;  3SWY A;  5KLI C;  4GT1 A;  3T97 A;  4R4M A;  2Q5U A;  1USD A; 
#chains in the Genus database with same CATH homology
 3AZC A;  1G8K B;  1ULI A;  2G8Y A;  3GCE A;  4NBH D;  3Q5R A;  1RQU A;  2HMM A;  4HM0 A;  3AEF C;  4PD4 E;  3VMI D;  2NVF A;  2E4P A;  3SFE C;  5HL4 A;  2E76 B;  1VF5 B;  1ULJ A;  1FDI A;  2IBZ E;  4H44 B;  3GKE A;  4QDF B;  2QJY C;  4KT0 J;  1NTZ E;  2YVJ B;  1RFS A;  4OGQ C;  2NZ2 A;  4P1B H;  2BEQ D;  2WQY C;  2MKV A;  4QUQ A;  4YTP C;  3EN1 A;  4H0L B;  3VCA A;  2ZT9 B;  4IL6 X;  1O7M A;  1EZV E;  3CXH E;  1AJY A;  2BMO A;  2IDB A;  3GF7 A;  4OGQ D;  1Q90 C;  2YFJ A;  3Q5S A;  3SFD C;  2CKF A;  1OW6 A;  3L72 E;  4HM6 A;  4H13 B;  3D89 A;  1DD4 A;  4HM4 A;  2QJK C;  1DD3 A;  2WSC J;  4QDF A;  2V7Q J;  1Q90 D;  3H25 A;  2H89 C;  4XFJ A;  2E76 C;  3H1J E;  1ZP0 C;  3IN6 A;  1K05 A;  4NBA D;  4H44 C;  2WSE J;  3O6Q A;  2QPZ A;  4GDO A;  2P10 A;  1GMJ A;  2E75 B;  3CWB E;  1VCK A;  2E76 D;  4H0L C;  2ZT9 C;  3IAO A;  3GZX A;  4H44 D;  3AED C;  3AEG C;  1NYK A;  1KTM A;  3AE6 C;  2O01 J;  2J5U A;  1KQF B;  5KLV E;  1KB9 E;  1SQB E;  4H13 C;  4H0L D;  1NU1 E;  2ZT9 D;  1IK7 A;  2NUK A;  4QDD A;  1KOR A;  1VL2 A;  4RKU J;  1OW7 A;  3AE3 C;  2BCC E;  4H13 D;  3ABV C;  2JO6 A;  1ZRT E;  1KYO E;  2HML A;  3DQY A;  1KMI Z;  1O7N A;  1K04 A;  1KIL E;  4NB8 D;  3C8V A;  3AEE C;  4YXD C;  4Z1M H;  1EXJ A;  3H1H E;  3GOB A;  2E75 C;  3BCC E;  2HMJ A;  3H1K E;  3AEA C;  2Q3W A;  2FYN C;  5AEU A;  4Y28 J;  4U7J A;  1FDO A;  1SQP E;  4QUP A;  1OMI A;  3VMH D;  1PPJ E;  1Y9B A;  4NBD D;  2E75 D;  1MKM A;  1SQQ E;  2DE7 D;  1NGM B;  1YQ3 C;  3AEB C;  2HMO A;  3D70 A;  3GTS A;  1O7H A;  2BEZ F;  4P1C H;  1L0N E;  3N0Q A;  2D2C B;  1TU3 F;  1UUV A;  3FOU A;  3S9O A;  1BCC E;  3G9R A;  3VCP A;  3D6Y A;  1VF5 C;  4PV1 B;  1ZOY C;  1HJ0 A;  2NVG A;  4HM3 A;  2NUM A;  4HM5 A;  4TT3 H;  3L71 E;  4HM7 A;  1EXI A;  2GBW A;  1S5L X;  1VF5 D;  5AEW A;  4HJL A;  2XSH A;  3EWK A;  2XRX A;  3T97 B;  1OW8 A;  3AE9 C;  2YFI A;  5KKZ C;  3AE4 C;  2GBX A;  3CX5 E;  5BOK A;  2D2C C;  3L74 E;  3Q2Y A;  1WMK A;  3Q5P A;  2OQQ A;  1BE3 E;  2G3A A;  3L75 E;  4NBG D;  3B71 A;  4OGQ B;  3H1I E;  3L73 E;  1O7G A;  3AE8 C;  4HKV A;  2D2C D;  2JO1 A;  1G8J B;  2FXP A;  2YMK A;  4PV1 C;  2DE6 D;  3H1L E;  2FYU E;  3GL2 A;  1VM9 A;  4NBC D;  1O7P A;  2NVE A;  3EQQ A;  1NYH A;  5M1B A;  2B24 A;  3AE5 C;  4PV1 D;  3C0D A;  2XR8 A;  2YFL A;  2FBW C;  4NBE D;  3GTE A;  3D71 A;  1WQL A;  2HMN A;  3GL0 A;  3D6Z A;  1ZME C;  3FGA D;  1PV3 A;  2WPV B;  1DIP A;  2JP3 A;  4HM2 A;  2YIU C;  1NTK E;  3AEC C;  4HM1 A;  2WSF J;  4AIV A;  4EMJ B;  3AE1 C;  1FQT A;  4NBF D;  3GLM A;  1O7W A;  2E74 B;  5L8R J;  1PP9 E;  1SQX E;  4QDC A;  3LW5 J;  3L70 E;  2ZYL A;  2B1X A;  1SQV E;  4NB9 D;  1YQ4 C;  1KQG B;  1RQV A;  1L0L E;  1PL5 A;  1NDO A;  2E4Q A;  3RL0 g;  2QSI A;  3GF3 A;  1RIE A;  3GZY A;  1NTM E;  3AE2 C;  4I7Z B;  4AAY B;  3TGU E;  3GMA A;  3R4Y A;  2QJP C;  2DE5 D;  4QUR A;  2A06 E;  4R4L A;  1SJG A;  1UUW A;  1PIX A;  5CXM A;  1JM1 A;  2JZA A;  4U3F E;  3Q1M A;  3GB4 A;  2H88 C;  1UIX A;  3AE7 C;  3Q3D A;  2E74 C;  1EG9 A;  2K9Y A;  2NWF A;  2BMQ A;  4NBB D;  1R8E A;  2I7F A;  2XSO A;  2QIW A;  2E74 D;  2HMK A;  1P84 E;  1HF9 A;  4QCK A;  1U57 A;  1JB0 J;  3VMG D;  1S1C X;  2BMR A;  4HM8 A;  3RK3 E;  5KLI C;  4I7Z C;  4R4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...