2E75D

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
166
Chain Sequence
b'DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e75D02
1EZVE 4QDFA 1KYOE 1ULIA 2GBWA 4NB9D 3VMGD 1O7HA 2E76D 4H13D 3CWBE 2BMQA 2DE5D 2QJKC 4HM8A 1SQBE 2D2CD 1EG9A 2BMOA 1G8JB 4HKVA 2YMKA 1NTKE 3GL2A 4QDFB 4H44D 1SQPE 2JZAA 4NB8D 1PP9E 3L70E 2QJPC 1SQQE 2DE6D 2YFLA 3H1HE 1BCCE 2JO6A 1VCKA 2YFJA 2FYNC 2HMKA 2HMNA 1VM9A 4PV1D 1WQLA 2XR8A 5CXMA 2DE7D 5KLIC 3CXHE 3DQYA 4H13C 2E4QA 2Q3WA 4HM4A 1SJGA 2B24A 2D2CC 4NBFD 1P84E 1PPJE 4I7ZC 4H44C 1O7PA 3GZYA 1NTZE 2NWFA 2E75D 1O7GA 3GKEA 3TGUE 4PV1C 4QDDA 5HL4A 1SQVE 2XRXA 2E4PA 2I7FA 3BCCE 3VCAA 2ZYLA 5AEWA 4QURA 3VMHD 3L74E 1UUVA 2NUMA 4AAYB 4U3FE 4HM0A 4HM3A 2YIUC 3FOUA 5BOKA 2CKFA 4HM2A 2E75C 1SQXE 3GOBA 3H1KE 4HM1A 4PD4E 1ULJA 1G8KB 2BMRA 3L72E 2XSHA 4QCKA 1NU1E 1NTME 1UUWA 4HM7A 4OGQC 2HMJA 3GTEA 2HMLA 4NBHD 3L73E 1KB9E 3GTSA 3C0DA 2HMOA 4NBBD 3GB4A 4HJLA 4P1BH 2FYUE 1O7NA 5KLVE 2HMMA 1BE3E 2GBXA 1NYKA 3EQQA 4OGQD 2IBZE 2QJYC 4AIVA 4EMJB 2BCCE 3VMID 4P1CH 1L0LE 4H0LD 2NVFA 3GL0A 3CX5E 5KKZC 2YFIA 1JM1A 2XSOA 2ZT9D 2E74D 1VF5D 3GCEA 2QPZA 1RIEA 3H1LE 1O7MA 2YVJB 4NBGD 3GZXA 4QDCA 4QUQA 3H1IE 4NBDD 4HM6A 1RFSA 1FQTA 3N0QA 3L71E 1L0NE 2NVEA 4HM5A 2NUKA 1Q90C 3AZCA 2A06E 1ZRTE 3VCPA 4NBED 2B1XA 2NVGA 4NBCD 4H0LC 1O7WA 3L75E 4NBAD 1NDOA 2E76C 3H1JE 3EN1A 4QUPA 3D89A 2ZT9C 2E74C 1VF5C 5AEUA
chains in the Genus database with same CATH superfamily
1BGYG 1O7HA 1BE3D 4N6JA 2IBZD 1AV1A 4ZMDA 1HJBA 2QG4A 3C1LA 2KUBA 2AEMA 3F5HA 3SWKA 3B4SA 3RL0D 2OARA 3AE7C 3HTKB 2QRXA 2QJKB 2OYIA 2GUSA 4U3FG 2JKVA 1FDMA 5CJ4A 1KILA 3P8MC 3H1KG 2IYPA 4O9BA 2IBZI 1OZHA 1J1DC 2B88A 3L75J 4N3YB 1A02J 3BRVB 2ZYGA 4L76A 1UIIA 2HODB 1BCCJ 2FFDC 3D6YA 3AEDC 1IFPA 3JCUE 4OWFA 3LW5J 1QVFO 5AVXB 5APUA 1QGKB 4Z1MH 1YQ3C 3AEAC 5TJHA 3V2QA 3H1JG 2KI7B 1NTZJ 1SQVD 2QIWA 2ZYAA 1S9KE 3BCCJ 3KXDA 3CD6P 4L75A 2LXBA 3L74G 2AXTE 3EFFK 1GL2B 3AZCA 1Y9BA 1O7WA 2QM7A 2Z4EA 5TISE 1K73Q 1L0LK 2FYUD 2QJKC 1PZQA 2OTLP 3CMAP 1K04A 5APSA 2RMZA 3L73G 4R4MA 4UB6H 1FJKA 2ZVOB 3FXDA 1L0LJ 3RL0g 1M90Q 1CW5A 3Q5SA 3SSUA 4JBZA 1YITP 4YTPC 1OMIA 1T8ZA 2FFDA 1MFZA 1HH0A 3JC22 3L71G 1L0NG 5AEWA 2B9BA 2P58A 3IN6A 2QM8A 3MIWA 3VMZA 2J5UA 4I1LA 5BOKA 1QLED 3VMAA 3L36A 2JJLA 3CCEP 1RY3A 4M3LA 2E75B 1SFCB 1X0TA 3KZIE 1PGQA 1VQ4P 3SWFA 3PHLA 3HUSB 1EC5A 3A3YB 1FU1A 2IFNA 3H1HD 1GL2C 2ZT9D 2E74D 2H89C 1PL5A 3AEEC 1RE3C 4U3FJ 5KTBA 3B5ND 1T6AA 2O1KA 3KHUA 4PD4D 1JY3N 1Q90C 3M0AA 3H1KJ 1AVOA 1M8OB 1YQ4C 1PFIA 2N9YB 3S9OA 3L37A 1EZVE 2GBWA 3VMGD 2E76D 4H13D 2WITA 2KK7A 3JCUH 3RK3C 2JZAA 3MUDC 2KSJA 4PD4I 2KP8A 2HMKA 3KYQA 3ITKA 1KYOH 3H1ID 3VP8A 1EDJA 5AVTB 3AE3C 1G1JA 1JEKA 4JYBA 1PGOA 1ZV8A 3AEBC 3VMXA 2AXTH 3H1JJ 3H32B 4I7ZB 1PGJA 1LTBC 1U7JA 3I56P 2I8DA 3SFDC 1S4XA 2E75C 2B89A 3HE5A 1SFCC 1KQGB 5AW0B 5BU5A 1NU1E 1OFCX 3HUSC 1T3UA 1HF9A 1SQQG 3C0DA 1JTHA 3U59A 1VQ7P 3FWNA 2YKOA 3HRNA 2IDBA 2WSFH 4OGQB 1X22A 1EZVG 1LTJA 2H8PD 2HFED 5CCGC 4EI2A 2YO3A 4D6TD 1VQNP 1YI2P 2P67A 3VTPC 3V2NA 4ZKUA 3L72D 2YNYA 2G8YA 2B87B 1USEA 1KB9D 2FXPA 4QDFA 5C39A 2POHA 3GMAA 1M1JA 3KQGA 5CBNA 1QL2A 2SPZA 4H0LB 2YXRB 2BMOA 1JOCA 1Q2NA 4YXDC 1FZCA 1N73A 2IBZG 1PIXA 4PV1D 2XR8A 3AECC 1GDTA 1H0TB 1T3JA 1FDIA 4I7ZC 3IAOA 4IFDK 1NU1G 1USDA 3KPEA 2LR2A 2KSEA 4AQRD 1ZR4A 2I7FA 3VCAA 1IFMA 4H44B 4LGDE 1SQBD 3WUTA 1FDOA 1WMKA 1LTIC 2P7JA 2NPSB 3M0DA 3GOBA 1URQA 1VQ5P 4A7PA 4QMAA 3A2AA 3HD7D 4OGQC 4WY4D 3T97A 2WPSA 4BRYA 4HJLA 1ZW0A 4ASWA 2WSFJ 1LTTC 2KXPB 4LC1A 4KT0J 3CCRP 1GU5A 1JM1A 2XSOA 1RIEA 1FJPA 1SQVG 3G6EP 2FKWB 4H0LC 4NBAD 1NTMD 2K9JB 2C0WA 1OVVA 2KS1B 3GLMA 5KLVD 2P1JA 1JY2P 3V6IA 3IR9A 3CXHI 1J1EB 5AVQB 2DE6D 1KORA 2FYUG 3H1HE 2H7HA 3H1LD 2I1KA 4HKZH 2E4QA 1LT9A 1FOSE 1K8AQ 4GODA 5KJ7C 3BVHA 1ZRTD 4H44C 1O7PA 1KQLA 1O7GA 3V4QA 5B5EE 3VMHD 2WT7A 3CWBD 4N78D 1VQOP 1UUVA 2OYHB 2J59M 3P7KA 1AQ5A 3V2PA 1SQPD 4DOJA 3WU2H 3VYIA 5DJTB 3RK2C 1PP9D 5M1BA 4EYYQ 1QVGO 1BGYE 2JR8A 1ULJA 1D7MA 3L4FA 5AW5B 1NTKK 1LP1B 5AW6B 1N7SC 5L8RJ 4I6MC 2R3CA 3AE8C 1H8AA 4W7YA 4HH2A 3TGUD 2BCCE 2O3JA 1RHZB 4P1CH 3L70D 1X79B 1HVVA 5KAFH 1L4AB 3HD7A 2QPZA 1JCDA 4IFMA 1RF0C 3OAKA 4WY4A 1JO5A 1IC2A 4QDCA 1G2CB 3H1HG 3VCPA 2AEFA 1GTWA 1J1EC 1NU1J 1KQFB 2AXCA 3O6QA 2KB7P 1SQXK 1UIXA 1EXJA 1FZAA 1OWAA 3CX5D 2YFLA 2YMYA 1SQXJ 4D6TE 3N4XA 5BU8B 3D71A 3DQYA 2Q3WA 2CPBA 2XDJA 1PV3A 1T2KC 1PPJE 3W68A 4ZNCA 1XTCC 5CCHC 1M7LA 3IF4A 2Z5HA 3CCJP 4QDDA 2ZYLA 3CX5I 2P2UA 1N7SA 3L74E 1NTKD 4HM3A 3MZWB 1IFIA 2BCCG 3FOUA 2OGUA 4C7NA 2N1TA 1YHQP 3P32A 3HE4A 2XSHA 3AE5C 4NBHD 2Z5IA 3L73E 3W67A 3GTSA 2K88A 4NBBD 1EDIA 1L4AC 1RH5B 1Q82Q 1S72P 1N2DC 1DEBA 2O01N 5AW4B 4TLFA 2OTKE 3B71A 3A5TA 5B5EH 1FOSF 2M0BA 1NTZK 4NBGD 3GZXA 4W7ZA 3TDKA 2LKMA 1W2BO 4HM6A 3P8CD 3L71E 3CLQA 1L0NE 1OW7A 2QA4P 4NPFX 3Q1MA 4D6TG 3WUVA 2IZ1A 2HPCB 1KC8Q 5KAIH 1PGPA 1WT6A 1KYOE 4C7RA 1PPJG 2YO2A 3L72G 2ZXEB 2OTJP 3G3ZA 5H2FE 1HGVA 5CCHA 2WPVB 3CCLP 1CSBA 2Q7CA 2ITAA 3ABVC 1GU4A 4IL6X 2WSEH 3CXHE 3TNUA 2W27A 1SJGA 2FXOA 3UIAA 4EOTA 1JUNA 2A06D 3FWLA 2HYNA 1N8RQ 3L75D 2FYNB 2CPSA 1H88A 2L5GB 3CCVP 3CC4P 1K05A 1DD4A 4I2LC 3CCMP 4WVZA 3CC2P 3H25A 3FGAD 1BCCD 3CPWO 2KZIA 1G8KB 3KDPB 1SQBG 3GTEA 2HMJA 2YIUB 1JY2O 3GB4A 1VL2A 2ZVNB 2E42A 2HMMA 1KILE 1NTZD 1YJNP 2WZ7A 1CI6B 1Q90D 3BCCD 1X9VA 2ZJSE 4N78E 3NMDA 3BASA 2GA1A 1Z56A 1FE6A 3AE9C 3B5NB 3RK3D 1BGYJ 2E43A 4GDOA 4WWIA 2W6JH 2A45I 1LTGC 2W6AA 2N9BA 2RN0A 2BMQA 4EIJA 1N86A 1NTMG 4HM8A 1IZNB 1RQUA 2E76B 4H13B 3HTKA 1OX3A 1VF5B 1L0LD 3L70E 2BCCJ 2PP6A 1SQQE 5KLVG 2FYNC 3U1CA 5CXMA 1GW4A 3CI9A 3EWKA 1DIPA 1OVUA 2QJPB 1YYCA 3GZYA 2E75D 1SFCD 3TK1A 5HL4A 2HODA 1FZEA 2D2CB 2NUMA 1FC2C 4JQ0D 3AE6C 2YIUC 2XKMA 2PFXA 3M91A 4LLHA 5H2FH 3GHGB 3CWBG 2K1AA 3V4WA 4MN4C 4NPEA 1FS0E 1URQD 1SQPG 2HMLA 2WMMA 5K5GB 3A0HE 3CXHH 1BE3E 2IBZE 3Q5RA 1YIJP 2WQYC 2Y9YA 4EMJB 1U57A 2C9NY 5APXA 3B5NC 3CCQP 1IK7A 1NKNA 3S4RA 3L74J 4U3FD 1GL2A 3VOPA 1RE4C 1N7LA 1WRGA 4QUQA 3L70G 3H1KD 2Q5UA 1RE3A 1LNQA 2JWDA 4NBCD 1OW8A 2BASA 2E76C 3AE1C 2KNCB 5GTHE 1VF5C 1KZUB 1NAYA 2R5BA 1NJIQ 3L73J 1RF1B 2UWJE 2QJPC 1L0NK 2YFJA 3MUDA 1Y47A 4PV1B 1IFNA 2D2CC 2C9LY 3WU2E 3LIEA 3L71J 1L0NJ 4WBAA 2HLOA 2CK3H 2M3EA 3H1JD 3MD0A 3PRJA 1HJ0A 2W8ZA 1JM0A 1SQVE 1VQ9P 1BE3G 4KJMA 3PLNA 2M5AB 3H6PA 1KMIZ 4WB4A 4HM2A 1Q86Q 1DH3A 1KB9I 3E1IA 4HM1A 1SFCA 2JP3A 1NOHA 2M3BA 5KAFE 4DJGA 3O8ZA 1IFDA 3V5BA 1JMBA 2HR3A 5AVSB 3HUSA 2FYUE 3NFQA 4RESB 1VDFA 4AYCA 4PJ0H 1VQ6P 4H0LD 2QEXP 3E7KA 2J58A 3GW6A 5APVA 2IPPA 2HG5D 3II6A 5CCGA 1LWUB 5APQA 3A7OA 1RFSA 3PH0A 2LXCB 2NVGA 4DT0A 1SP4A 5AVYB 1RF1C 2R3SA 2MKVA 1MUUA 2DE5D 1S5LX 5GTIH 3D6ZA 1GD2E 4H44D 1LGHB 2L91A 3A0HH 2Q6QA 1S9KD 3CMEP 2FBWC 1IFJA 4AUWA 4GIFA 2Y9ZA 1BSNA 4RO0A 4DZOA 4HM4A 2OYIB 1EQ7A 3H32A 3RK2D 4OH8B 1Y8AA 3A0BE 1KILB 2KZJA 1YTZT 2E4PA 1OXZA 1SQQK 2A06G 5GTHH 3CCSP 3GG2A 3L75G 1N7SD 4EDFA 5CBOA 3VP9A 1NWQA 4PD4E 3Q5PA 1SQQJ 2N1TD 3ZDMA 5AW2B 2E5YA 1UUWA 5AW7B 3I5CA 2NPSC 1DX7A 1BCCG 4GT1A 1BDCA 3R2PA 2QSIA 2G3AA 1Q7YQ 3AE4C 1FZFA 1LWUC 2OQQA 4BWNA 1LT1A 5KAIE 2B87A 5AVUB 3BCCG 3H1IE 4NBDD 1P84D 2A45G 2NVEA 2JWAA 3GF7A 3OW2O 2FXMA 3B8EB 1MKMA 1CZQA 4JYCA 1BE3J 1VQ8P 2BEQD 1NU1K 1H0TA 2KLUA 3AEGC 3GL2A 1AVYA 1VPCA 5CCHD 2OYIC 1P84I 1VCKA 1E79H 3CC7P 1ZR2A 3VN0A 1J1DB 1KILC 4NPDA 1ZN5A 1R5SA 1L0LG 2JDIH 1GW3A 1L2PA 5KJ7A 1A02F 3USSA 3QWOC 4XFJA 3GKEA 3AEFC 1EZVD 2PAJA 1M57D 2Q1KA 2NPSA 2FFDB 3CCUP 5CMZA 3RL0B 1KTMA 3R4YA 4GOFA 3L72E 2OYHC 4QCKA 4TT3H 4YPCA 2A45H 2Y0DA 3H1IG 1EZVI 1KB9E 1SQVK 1EDLA 4DCKA 1FZGA 1HBWA 2IYOA 2YXQB 3GF3A 1HUCA 1JY2N 1SQVJ 1TU3F 3A0BH 2V4HA 2K9JA 1RF0A 2V7QH 1MZ9A 2FY8A 4HM5A 2KS1A 1FBMA 2FYUK 4IL6E 1NU1D 1NAFA 4PD4H 5CHXA 1YBKA 2FYUJ 1VQMP 1SQBE 1G8JB 4HKVA 1IK9A 2YMKA 2Y0EA 1BSHA 4KHXA 3L35A 4U7JA 4UB8H 1SQXD 1JY3P 1ZLLA 4L73A 1OVRA 3G9RA 1J2JB 3FX0A 2M8RA 1AA0A 2OYHA 2KIKA 3RL0C 4GKGA 1EXIA 2QVAA 3SFEC 5B66E 2CKFA 4IFFA 1LP1A 1KV4A 3PP5A 4K3AA 5DJUB 1NTME 3HE5B 3EQ2A 4K35A 1QX8A 5KLVE 5BVZA 4AIVA 1OIPA 2H88C 1L4AA 2WVRA 1JTHB 2WPRA 3NTNA 1G2CA 3H1HJ 3H1LE 2V7QJ 3E1RA 1ZMEC 2KLVA 1HTLC 1GL2D 1LTJB 2Q9IA 5AVZB 1SS1A 5KKZB 1ZRTE 5APYA 2WPQA 1K9MQ 1KD1Q 4HB1A 3RK3B 3D89A 4ZKPA 2ZYDA 2Y0CA 1ULIA 4CPGA 3CWBE 1JNMA 2ZXXA 3Q3DA 1KB9H 3M9BA 4QDFB 1Q81Q 1SQPE 2E74B 2ZT9B 1PP9E 4Y28J 5E79H 1M1JB 2XU6A 4JPZB 3I55P 5APWA 2YKQA 2RKLA 1FZCB 2PGDA 1N73B 1P84E 3H1IJ 1VQLP 1GMJA 1HGZA 3IFMA 5KLIB 1GK4A 3TGUE 3MTUE 4IL6H 2WSEJ 3RGUA 3EFGA 4GOEA 1NHLA 2QE7H 2BMRA 1NVOA 1NO4A 4PJ0E 1S2EA 3H1LG 4XE5B 4HM7A 1URQB 1GK6A 2K9YA 3V2RA 4P1BH 3PTZA 1QEXA 3FXEA 2I1JA 1NGMB 2GBXA 1NYKA 4OVNF 3T97B 2Q3IA 4BRYB 1ZXGA 1VQPP 1LTJC 1NH4A 1XTGB 2NVFA 2IX7C 3CX5E 5KKZC 2XV5A 1VF5D 3GCEA 1KFMA 1PP9G 5GTIE 4D6TJ 5CJ0A 1BGYD 3WMM0 2HPCA 3N0QA 5CCGD 5B66H 2B1XA 4NBED 2OYOA 3L72J 4QUPA 3M06A 2ZT9C 2E74C 1M1JC 3S1KA 3G4SP 2WSSH 2BCCD 2D2CD 1EG9A 1NTKE 2DW3A 1FZCC 3TGUG 4NB8D 1N73C 3AE2C 3PJSK 4RJTA 1LJ2A 3OJAB 1DEEG 5TISH 4IOIH 4JF7A 1WQLA 5KLIC 4B86A 4H13C 5EFWB 1YJ9P 2B24A 1QL1A 2WTYA 4R4LA 1LT9B 1SQBK 3RBZA 3G71P 4QURA 3F89A 2GUVA 3M0DC 1R8EA 4HM0A 1AFOA 1SQBJ 1URQC 2WT7B 1YTZI 3P8CE 1SQXE 2JEEA 1IJDB 3RBXA 1CI6A 3M9QA 1JB0J 1PPJD 1O7NA 3GHGC 1LTAC 3BRTB 4OGQD 2K3RA 2KYVA 2RH0A 3VMYA 1P84H 3N7NA 1M1KQ 3L74D 1JY3O 3GL0A 3QH9A 1IO4A 3B5NA 1S5LE 2ZAEB 1NTMK 1NTKG 2YVJB 3M9HA 3KZIH 3MP7B 1RE4A 1MFTA 3HD7B 2BEZF 4W80A 4WY4B 3TF5A 2A06E 1W2EA 2MJZA 5KLVK 2XZRA 3L75E 3K5BA 2NZ2A 3EN1A 3L73D 5AEUA 1NTMJ 1FAVA 4Y99B 3TYYA 4L74A 3C9IA 5KLVJ 3U1AA 2JO1A 2E5TA 3SWYA 3O6QB 1S1CX 1BCCE 2JO6A 1EDKA 1VM9A 1LT9C 1M56D 3Q2YA 2O01H 3CX5H 1H89A 3H1LJ 3L71D 3JSVC 1L0ND 1SQXG 2R44A 3C8VA 1NTZE 2NWFA 2FYZA 3RK2B 5KJ7D 1X8YA 1SQPK 2XNXA 1KYOD 4PV1C 3BCCE 1E5WA 1W5CE 3WUUA 1S3JA 3GHGA 2NPSD 3CWBJ 1AQTA 1N7SB 1NKZB 2P10A 2XNDH 1SQPJ 5AVWB 3OA7A 1PP9J 2W83C 1HWTC 1SVFA 1VQKP 3RK3E 3CXHD 3CL3D 2KOGA 4C7NB 1SLQA 2N1TB 4ASVA 1ZOYC 1KYOI 3HE4B 3D70A 2NRGA 3EQQA 1OW6A 4BXLA 5AW1B 1L0LE 3HD7C 3TGUJ 2K37A 1KN7A 2C0XA 4WY4C 2O1JA 3L70J 2QJYB 1NYHA 2KNCA 3BATA 4Y99C 4RKUJ 2GM4A 5APTA 3TSIA 1U7MA 4UB8E 1JMMA 1RQVA 2WSCH 1RF1A 1YJWP 2W90A 4NB9D 1BDDA 1KILD 1NTZG 3MGNA 5AVRB 1G1IA 1JCCA 2WWWA 2H43A 4C46A 2HMNA 2O01J 2DE7D 2YKPA 4HJGH 1KFNA 1LTSC 5AW8B 2R5DA 4NBFD 1S5LH 2IFMA 3TNUB 2M5AA 1AJYA 1T2KD 2XRXA 5AVVB 4AAYB 4YXWH 4HYTB 4U3FE 2N1TC 1FZBA 2Q3EA 3LIDA 1SQQD 1NTKJ 2VRSA 2ZFCA 3H1KE 5AW3B 2HMOA 4UB6E 2AEJA 2W6BA 2QJYC 3LW5H 1DD3A 5AW9B 3VMID 1MV8A 2PRRA 1KQSO 1R5LA 1L4AD 2R32A 1LWUA 4XA4A 2YFIA 1GZLA 1O7MA 1ZP0C 3NXSA 3MHVA 1FQTA 2NUKA 5E79E 2WSCJ 2IZ0A 1NDOA 3H1JE
chains in the Genus database with same CATH topology
3GLMA 1ULIA 1O7HA 3CWBE 3Q3DA 4QDFB 2ZT9B 2E74B 1SQPE 1PP9E 4Y28J 2QJPC 2DE6D 1KORA 3H1HE 2YFJA 3AE7C 2E4QA 4PV1B 2D2CC 1P84E 1GMJA 4H44C 1O7PA 1HJ0A 1O7GA 3TGUE 1SQVE 2WSEJ 3VMHD 1UUVA 1KMIZ 4HM2A 5M1BA 4HM1A 1ULJA 2BMRA 2JP3A 3D6YA 4HM7A 3AEDC 2K9YA 4P1BH 3LW5J 5L8RJ 2FYUE 1NGMB 2GBXA 1NYKA 3AE8C 1YQ3C 4Z1MH 3AEAC 3T97B 2BCCE 4P1CH 2QIWA 4H0LD 2NVFA 3CX5E 5KKZC 1VF5D 3GCEA 2QPZA 4QDCA 1RFSA 3N0QA 3AZCA 3VCPA 1Y9BA 4NBED 2B1XA 2NVGA 1O7WA 4QUPA 2ZT9C 2E74C 1KQFB 2MKVA 3O6QA 1UIXA 2QJKC 2DE5D 1S5LX 3D6ZA 2D2CD 1EG9A 1NTKE 1EXJA 4H44D 4NB8D 1K04A 4R4MA 3AE2C 2YFLA 2FBWC 3RL0g 1WQLA 3Q5SA 5KLIC 3D71A 3DQYA 4H13C 2Q3WA 4HM4A 2B24A 1PV3A 4YTPC 1PPJE 1OMIA 4R4LA 4QDDA 2E4PA 2ZYLA 5AEWA 4QURA 3L74E 3IN6A 1R8EA 4HM0A 4HM3A 2J5UA 3FOUA 5BOKA 1SQXE 4PD4E 3Q5PA 2XSHA 1UUWA 3AE5C 4NBHD 3L73E 3GTSA 2E75B 1JB0J 4NBBD 2QSIA 2G3AA 1O7NA 4OGQD 3AE4C 2OQQA 3GL0A 3B71A 2ZT9D 2E74D 2H89C 1PL5A 3AEEC 2YVJB 4NBGD 3GZXA 3H1IE 4NBDD 4HM6A 3L71E 1L0NE 2NVEA 2BEZF 1Q90C 1OW7A 2A06E 3L75E 3Q1MA 2NZ2A 1YQ4C 3EN1A 3S9OA 3GF7A 5AEUA 1EZVE 1KYOE 2GBWA 3VMGD 2E76D 4H13D 1MKMA 2BEQD 2WPVB 2JO1A 3GL2A 3AEGC 2JZAA 3ABVC 1S1CX 1BCCE 2JO6A 1VCKA 4IL6X 2HMKA 1VM9A 3CXHE 3Q2YA 3AE3C 1SJGA 3C8VA 1NTZE 3AEBC 2NWFA 4XFJA 3GKEA 3AEFC 4PV1C 3BCCE 1K05A 1DD4A 4I7ZB 3SFDC 3H25A 2E75C 2P10A 3FGAD 1KQGB 1KTMA 3R4YA 1G8KB 3L72E 3RK3E 4QCKA 4TT3H 1NU1E 3GTEA 2HMJA 1ZOYC 1HF9A 1KB9E 3D70A 3C0DA 3GB4A 1VL2A 2HMMA 1KILE 3EQQA 1OW6A 2IDBA 3GF3A 4OGQB 1Q90D 1L0LE 1TU3F 1NYHA 3AE9C 4RKUJ 4HM5A 2G8YA 4GDOA 1RQVA 2FXPA 4QDFA 4NB9D 3GMAA 2BMQA 4H0LB 4HM8A 1RQUA 2E76B 4H13B 1SQBE 1G8JB 4HKVA 2BMOA 2YMKA 1VF5B 3L70E 4U7JA 4YXDC 1SQQE 2FYNC 2HMNA 2O01J 1PIXA 4PV1D 2XR8A 3AECC 5CXMA 2DE7D 3EWKA 1FDIA 1DIPA 3G9RA 4NBFD 4I7ZC 3IAOA 3GZYA 2E75D 1AJYA 5HL4A 2XRXA 2I7FA 3VCAA 2D2CB 4H44B 1EXIA 2NUMA 4AAYB 3SFEC 1FDOA 4U3FE 1WMKA 3AE6C 2YIUC 2CKFA 3H1KE 3GOBA 1NTME 4OGQC 2HMLA 2HMOA 4HJLA 5KLVE 1BE3E 2WSFJ 2IBZE 3Q5RA 2QJYC 4AIVA 2WQYC 2H88C 4EMJB 1DD3A 3VMID 1U57A 4KT0J 1IK7A 2YFIA 1JM1A 2XSOA 1RIEA 3H1LE 1O7MA 2V7QJ 1ZP0C 1ZMEC 4QUQA 1FQTA 2NUKA 1ZRTE 4NBCD 4H0LC 1OW8A 4NBAD 2WSCJ 1NDOA 2E76C 3AE1C 3H1JE 3D89A 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV E;  4QDF A;  1KYO E;  1ULI A;  2GBW A;  4NB9 D;  3VMG D;  1O7H A;  2E76 D;  4H13 D;  3CWB E;  2BMQ A;  2DE5 D;  2QJK C;  4HM8 A;  1SQB E;  2D2C D;  1EG9 A;  2BMO A;  1G8J B;  4HKV A;  2YMK A;  1NTK E;  3GL2 A;  4QDF B;  4H44 D;  1SQP E;  2JZA A;  4NB8 D;  1PP9 E;  3L70 E;  2QJP C;  1SQQ E;  2DE6 D;  2YFL A;  3H1H E;  1BCC E;  2JO6 A;  1VCK A;  2YFJ A;  2FYN C;  2HMK A;  2HMN A;  1VM9 A;  4PV1 D;  1WQL A;  2XR8 A;  5CXM A;  2DE7 D;  5KLI C;  3CXH E;  3DQY A;  4H13 C;  2E4Q A;  2Q3W A;  4HM4 A;  1SJG A;  2B24 A;  2D2C C;  4NBF D;  1P84 E;  1PPJ E;  4I7Z C;  4H44 C;  1O7P A;  3GZY A;  1NTZ E;  2NWF A;  2E75 D;  1O7G A;  3GKE A;  3TGU E;  4PV1 C;  4QDD A;  5HL4 A;  1SQV E;  2XRX A;  2E4P A;  2I7F A;  3BCC E;  3VCA A;  2ZYL A;  5AEW A;  4QUR A;  3VMH D;  3L74 E;  1UUV A;  2NUM A;  4AAY B;  4U3F E;  4HM0 A;  4HM3 A;  2YIU C;  3FOU A;  5BOK A;  2CKF A;  4HM2 A;  2E75 C;  1SQX E;  3GOB A;  3H1K E;  4HM1 A;  4PD4 E;  1ULJ A;  1G8K B;  2BMR A;  3L72 E;  2XSH A;  4QCK A;  1NU1 E;  1NTM E;  1UUW A;  4HM7 A;  4OGQ C;  2HMJ A;  3GTE A;  2HML A;  4NBH D;  3L73 E;  1KB9 E;  3GTS A;  3C0D A;  2HMO A;  4NBB D;  3GB4 A;  4HJL A;  4P1B H;  2FYU E;  1O7N A;  5KLV E;  2HMM A;  1BE3 E;  2GBX A;  1NYK A;  3EQQ A;  4OGQ D;  2IBZ E;  2QJY C;  4AIV A;  4EMJ B;  2BCC E;  3VMI D;  4P1C H;  1L0L E;  4H0L D;  2NVF A;  3GL0 A;  3CX5 E;  5KKZ C;  2YFI A;  1JM1 A;  2XSO A;  2ZT9 D;  2E74 D;  1VF5 D;  3GCE A;  2QPZ A;  1RIE A;  3H1L E;  1O7M A;  2YVJ B;  4NBG D;  3GZX A;  4QDC A;  4QUQ A;  3H1I E;  4NBD D;  4HM6 A;  1RFS A;  1FQT A;  3N0Q A;  3L71 E;  1L0N E;  2NVE A;  4HM5 A;  2NUK A;  1Q90 C;  3AZC A;  2A06 E;  1ZRT E;  3VCP A;  4NBE D;  2B1X A;  2NVG A;  4NBC D;  4H0L C;  1O7W A;  3L75 E;  4NBA D;  1NDO A;  2E76 C;  3H1J E;  3EN1 A;  4QUP A;  3D89 A;  2ZT9 C;  2E74 C;  1VF5 C;  5AEU A; 
#chains in the Genus database with same CATH topology
 1BGY G;  1O7H A;  1BE3 D;  4N6J A;  2IBZ D;  1AV1 A;  4ZMD A;  1HJB A;  2QG4 A;  3C1L A;  2KUB A;  2AEM A;  3F5H A;  3SWK A;  3B4S A;  3RL0 D;  2OAR A;  3AE7 C;  3HTK B;  2QRX A;  2QJK B;  2OYI A;  2GUS A;  4U3F G;  2JKV A;  1FDM A;  5CJ4 A;  1KIL A;  3P8M C;  3H1K G;  2IYP A;  4O9B A;  2IBZ I;  1OZH A;  1J1D C;  2B88 A;  3L75 J;  4N3Y B;  1A02 J;  3BRV B;  2ZYG A;  4L76 A;  1UII A;  2HOD B;  1BCC J;  2FFD C;  3D6Y A;  3AED C;  1IFP A;  3JCU E;  4OWF A;  3LW5 J;  1QVF O;  5AVX B;  5APU A;  1QGK B;  4Z1M H;  1YQ3 C;  3AEA C;  5TJH A;  3V2Q A;  3H1J G;  2KI7 B;  1NTZ J;  1SQV D;  2QIW A;  2ZYA A;  1S9K E;  3BCC J;  3KXD A;  3CD6 P;  4L75 A;  2LXB A;  3L74 G;  2AXT E;  3EFF K;  1GL2 B;  3AZC A;  1Y9B A;  1O7W A;  2QM7 A;  2Z4E A;  5TIS E;  1K73 Q;  1L0L K;  2FYU D;  2QJK C;  1PZQ A;  2OTL P;  3CMA P;  1K04 A;  5APS A;  2RMZ A;  3L73 G;  4R4M A;  4UB6 H;  1FJK A;  2ZVO B;  3FXD A;  1L0L J;  3RL0 g;  1M90 Q;  1CW5 A;  3Q5S A;  3SSU A;  4JBZ A;  1YIT P;  4YTP C;  1OMI A;  1T8Z A;  2FFD A;  1MFZ A;  1HH0 A;  3JC2 2;  3L71 G;  1L0N G;  5AEW A;  2B9B A;  2P58 A;  3IN6 A;  2QM8 A;  3MIW A;  3VMZ A;  2J5U A;  4I1L A;  5BOK A;  1QLE D;  3VMA A;  3L36 A;  2JJL A;  3CCE P;  1RY3 A;  4M3L A;  2E75 B;  1SFC B;  1X0T A;  3KZI E;  1PGQ A;  1VQ4 P;  3SWF A;  3PHL A;  3HUS B;  1EC5 A;  3A3Y B;  1FU1 A;  2IFN A;  3H1H D;  1GL2 C;  2ZT9 D;  2E74 D;  2H89 C;  1PL5 A;  3AEE C;  1RE3 C;  4U3F J;  5KTB A;  3B5N D;  1T6A A;  2O1K A;  3KHU A;  4PD4 D;  1JY3 N;  1Q90 C;  3M0A A;  3H1K J;  1AVO A;  1M8O B;  1YQ4 C;  1PFI A;  2N9Y B;  3S9O A;  3L37 A;  1EZV E;  2GBW A;  3VMG D;  2E76 D;  4H13 D;  2WIT A;  2KK7 A;  3JCU H;  3RK3 C;  2JZA A;  3MUD C;  2KSJ A;  4PD4 I;  2KP8 A;  2HMK A;  3KYQ A;  3ITK A;  1KYO H;  3H1I D;  3VP8 A;  1EDJ A;  5AVT B;  3AE3 C;  1G1J A;  1JEK A;  4JYB A;  1PGO A;  1ZV8 A;  3AEB C;  3VMX A;  2AXT H;  3H1J J;  3H32 B;  4I7Z B;  1PGJ A;  1LTB C;  1U7J A;  3I56 P;  2I8D A;  3SFD C;  1S4X A;  2E75 C;  2B89 A;  3HE5 A;  1SFC C;  1KQG B;  5AW0 B;  5BU5 A;  1NU1 E;  1OFC X;  3HUS C;  1T3U A;  1HF9 A;  1SQQ G;  3C0D A;  1JTH A;  3U59 A;  1VQ7 P;  3FWN A;  2YKO A;  3HRN A;  2IDB A;  2WSF H;  4OGQ B;  1X22 A;  1EZV G;  1LTJ A;  2H8P D;  2HFE D;  5CCG C;  4EI2 A;  2YO3 A;  4D6T D;  1VQN P;  1YI2 P;  2P67 A;  3VTP C;  3V2N A;  4ZKU A;  3L72 D;  2YNY A;  2G8Y A;  2B87 B;  1USE A;  1KB9 D;  2FXP A;  4QDF A;  5C39 A;  2POH A;  3GMA A;  1M1J A;  3KQG A;  5CBN A;  1QL2 A;  2SPZ A;  4H0L B;  2YXR B;  2BMO A;  1JOC A;  1Q2N A;  4YXD C;  1FZC A;  1N73 A;  2IBZ G;  1PIX A;  4PV1 D;  2XR8 A;  3AEC C;  1GDT A;  1H0T B;  1T3J A;  1FDI A;  4I7Z C;  3IAO A;  4IFD K;  1NU1 G;  1USD A;  3KPE A;  2LR2 A;  2KSE A;  4AQR D;  1ZR4 A;  2I7F A;  3VCA A;  1IFM A;  4H44 B;  4LGD E;  1SQB D;  3WUT A;  1FDO A;  1WMK A;  1LTI C;  2P7J A;  2NPS B;  3M0D A;  3GOB A;  1URQ A;  1VQ5 P;  4A7P A;  4QMA A;  3A2A A;  3HD7 D;  4OGQ C;  4WY4 D;  3T97 A;  2WPS A;  4BRY A;  4HJL A;  1ZW0 A;  4ASW A;  2WSF J;  1LTT C;  2KXP B;  4LC1 A;  4KT0 J;  3CCR P;  1GU5 A;  1JM1 A;  2XSO A;  1RIE A;  1FJP A;  1SQV G;  3G6E P;  2FKW B;  4H0L C;  4NBA D;  1NTM D;  2K9J B;  2C0W A;  1OVV A;  2KS1 B;  3GLM A;  5KLV D;  2P1J A;  1JY2 P;  3V6I A;  3IR9 A;  3CXH I;  1J1E B;  5AVQ B;  2DE6 D;  1KOR A;  2FYU G;  3H1H E;  2H7H A;  3H1L D;  2I1K A;  4HKZ H;  2E4Q A;  1LT9 A;  1FOS E;  1K8A Q;  4GOD A;  5KJ7 C;  3BVH A;  1ZRT D;  4H44 C;  1O7P A;  1KQL A;  1O7G A;  3V4Q A;  5B5E E;  3VMH D;  2WT7 A;  3CWB D;  4N78 D;  1VQO P;  1UUV A;  2OYH B;  2J59 M;  3P7K A;  1AQ5 A;  3V2P A;  1SQP D;  4DOJ A;  3WU2 H;  3VYI A;  5DJT B;  3RK2 C;  1PP9 D;  5M1B A;  4EYY Q;  1QVG O;  1BGY E;  2JR8 A;  1ULJ A;  1D7M A;  3L4F A;  5AW5 B;  1NTK K;  1LP1 B;  5AW6 B;  1N7S C;  5L8R J;  4I6M C;  2R3C A;  3AE8 C;  1H8A A;  4W7Y A;  4HH2 A;  3TGU D;  2BCC E;  2O3J A;  1RHZ B;  4P1C H;  3L70 D;  1X79 B;  1HVV A;  5KAF H;  1L4A B;  3HD7 A;  2QPZ A;  1JCD A;  4IFM A;  1RF0 C;  3OAK A;  4WY4 A;  1JO5 A;  1IC2 A;  4QDC A;  1G2C B;  3H1H G;  3VCP A;  2AEF A;  1GTW A;  1J1E C;  1NU1 J;  1KQF B;  2AXC A;  3O6Q A;  2KB7 P;  1SQX K;  1UIX A;  1EXJ A;  1FZA A;  1OWA A;  3CX5 D;  2YFL A;  2YMY A;  1SQX J;  4D6T E;  3N4X A;  5BU8 B;  3D71 A;  3DQY A;  2Q3W A;  2CPB A;  2XDJ A;  1PV3 A;  1T2K C;  1PPJ E;  3W68 A;  4ZNC A;  1XTC C;  5CCH C;  1M7L A;  3IF4 A;  2Z5H A;  3CCJ P;  4QDD A;  2ZYL A;  3CX5 I;  2P2U A;  1N7S A;  3L74 E;  1NTK D;  4HM3 A;  3MZW B;  1IFI A;  2BCC G;  3FOU A;  2OGU A;  4C7N A;  2N1T A;  1YHQ P;  3P32 A;  3HE4 A;  2XSH A;  3AE5 C;  4NBH D;  2Z5I A;  3L73 E;  3W67 A;  3GTS A;  2K88 A;  4NBB D;  1EDI A;  1L4A C;  1RH5 B;  1Q82 Q;  1S72 P;  1N2D C;  1DEB A;  2O01 N;  5AW4 B;  4TLF A;  2OTK E;  3B71 A;  3A5T A;  5B5E H;  1FOS F;  2M0B A;  1NTZ K;  4NBG D;  3GZX A;  4W7Z A;  3TDK A;  2LKM A;  1W2B O;  4HM6 A;  3P8C D;  3L71 E;  3CLQ A;  1L0N E;  1OW7 A;  2QA4 P;  4NPF X;  3Q1M A;  4D6T G;  3WUV A;  2IZ1 A;  2HPC B;  1KC8 Q;  5KAI H;  1PGP A;  1WT6 A;  1KYO E;  4C7R A;  1PPJ G;  2YO2 A;  3L72 G;  2ZXE B;  2OTJ P;  3G3Z A;  5H2F E;  1HGV A;  5CCH A;  2WPV B;  3CCL P;  1CSB A;  2Q7C A;  2ITA A;  3ABV C;  1GU4 A;  4IL6 X;  2WSE H;  3CXH E;  3TNU A;  2W27 A;  1SJG A;  2FXO A;  3UIA A;  4EOT A;  1JUN A;  2A06 D;  3FWL A;  2HYN A;  1N8R Q;  3L75 D;  2FYN B;  2CPS A;  1H88 A;  2L5G B;  3CCV P;  3CC4 P;  1K05 A;  1DD4 A;  4I2L C;  3CCM P;  4WVZ A;  3CC2 P;  3H25 A;  3FGA D;  1BCC D;  3CPW O;  2KZI A;  1G8K B;  3KDP B;  1SQB G;  3GTE A;  2HMJ A;  2YIU B;  1JY2 O;  3GB4 A;  1VL2 A;  2ZVN B;  2E42 A;  2HMM A;  1KIL E;  1NTZ D;  1YJN P;  2WZ7 A;  1CI6 B;  1Q90 D;  3BCC D;  1X9V A;  2ZJS E;  4N78 E;  3NMD A;  3BAS A;  2GA1 A;  1Z56 A;  1FE6 A;  3AE9 C;  3B5N B;  3RK3 D;  1BGY J;  2E43 A;  4GDO A;  4WWI A;  2W6J H;  2A45 I;  1LTG C;  2W6A A;  2N9B A;  2RN0 A;  2BMQ A;  4EIJ A;  1N86 A;  1NTM G;  4HM8 A;  1IZN B;  1RQU A;  2E76 B;  4H13 B;  3HTK A;  1OX3 A;  1VF5 B;  1L0L D;  3L70 E;  2BCC J;  2PP6 A;  1SQQ E;  5KLV G;  2FYN C;  3U1C A;  5CXM A;  1GW4 A;  3CI9 A;  3EWK A;  1DIP A;  1OVU A;  2QJP B;  1YYC A;  3GZY A;  2E75 D;  1SFC D;  3TK1 A;  5HL4 A;  2HOD A;  1FZE A;  2D2C B;  2NUM A;  1FC2 C;  4JQ0 D;  3AE6 C;  2YIU C;  2XKM A;  2PFX A;  3M91 A;  4LLH A;  5H2F H;  3GHG B;  3CWB G;  2K1A A;  3V4W A;  4MN4 C;  4NPE A;  1FS0 E;  1URQ D;  1SQP G;  2HML A;  2WMM A;  5K5G B;  3A0H E;  3CXH H;  1BE3 E;  2IBZ E;  3Q5R A;  1YIJ P;  2WQY C;  2Y9Y A;  4EMJ B;  1U57 A;  2C9N Y;  5APX A;  3B5N C;  3CCQ P;  1IK7 A;  1NKN A;  3S4R A;  3L74 J;  4U3F D;  1GL2 A;  3VOP A;  1RE4 C;  1N7L A;  1WRG A;  4QUQ A;  3L70 G;  3H1K D;  2Q5U A;  1RE3 A;  1LNQ A;  2JWD A;  4NBC D;  1OW8 A;  2BAS A;  2E76 C;  3AE1 C;  2KNC B;  5GTH E;  1VF5 C;  1KZU B;  1NAY A;  2R5B A;  1NJI Q;  3L73 J;  1RF1 B;  2UWJ E;  2QJP C;  1L0N K;  2YFJ A;  3MUD A;  1Y47 A;  4PV1 B;  1IFN A;  2D2C C;  2C9L Y;  3WU2 E;  3LIE A;  3L71 J;  1L0N J;  4WBA A;  2HLO A;  2CK3 H;  2M3E A;  3H1J D;  3MD0 A;  3PRJ A;  1HJ0 A;  2W8Z A;  1JM0 A;  1SQV E;  1VQ9 P;  1BE3 G;  4KJM A;  3PLN A;  2M5A B;  3H6P A;  1KMI Z;  4WB4 A;  4HM2 A;  1Q86 Q;  1DH3 A;  1KB9 I;  3E1I A;  4HM1 A;  1SFC A;  2JP3 A;  1NOH A;  2M3B A;  5KAF E;  4DJG A;  3O8Z A;  1IFD A;  3V5B A;  1JMB A;  2HR3 A;  5AVS B;  3HUS A;  2FYU E;  3NFQ A;  4RES B;  1VDF A;  4AYC A;  4PJ0 H;  1VQ6 P;  4H0L D;  2QEX P;  3E7K A;  2J58 A;  3GW6 A;  5APV A;  2IPP A;  2HG5 D;  3II6 A;  5CCG A;  1LWU B;  5APQ A;  3A7O A;  1RFS A;  3PH0 A;  2LXC B;  2NVG A;  4DT0 A;  1SP4 A;  5AVY B;  1RF1 C;  2R3S A;  2MKV A;  1MUU A;  2DE5 D;  1S5L X;  5GTI H;  3D6Z A;  1GD2 E;  4H44 D;  1LGH B;  2L91 A;  3A0H H;  2Q6Q A;  1S9K D;  3CME P;  2FBW C;  1IFJ A;  4AUW A;  4GIF A;  2Y9Z A;  1BSN A;  4RO0 A;  4DZO A;  4HM4 A;  2OYI B;  1EQ7 A;  3H32 A;  3RK2 D;  4OH8 B;  1Y8A A;  3A0B E;  1KIL B;  2KZJ A;  1YTZ T;  2E4P A;  1OXZ A;  1SQQ K;  2A06 G;  5GTH H;  3CCS P;  3GG2 A;  3L75 G;  1N7S D;  4EDF A;  5CBO A;  3VP9 A;  1NWQ A;  4PD4 E;  3Q5P A;  1SQQ J;  2N1T D;  3ZDM A;  5AW2 B;  2E5Y A;  1UUW A;  5AW7 B;  3I5C A;  2NPS C;  1DX7 A;  1BCC G;  4GT1 A;  1BDC A;  3R2P A;  2QSI A;  2G3A A;  1Q7Y Q;  3AE4 C;  1FZF A;  1LWU C;  2OQQ A;  4BWN A;  1LT1 A;  5KAI E;  2B87 A;  5AVU B;  3BCC G;  3H1I E;  4NBD D;  1P84 D;  2A45 G;  2NVE A;  2JWA A;  3GF7 A;  3OW2 O;  2FXM A;  3B8E B;  1MKM A;  1CZQ A;  4JYC A;  1BE3 J;  1VQ8 P;  2BEQ D;  1NU1 K;  1H0T A;  2KLU A;  3AEG C;  3GL2 A;  1AVY A;  1VPC A;  5CCH D;  2OYI C;  1P84 I;  1VCK A;  1E79 H;  3CC7 P;  1ZR2 A;  3VN0 A;  1J1D B;  1KIL C;  4NPD A;  1ZN5 A;  1R5S A;  1L0L G;  2JDI H;  1GW3 A;  1L2P A;  5KJ7 A;  1A02 F;  3USS A;  3QWO C;  4XFJ A;  3GKE A;  3AEF C;  1EZV D;  2PAJ A;  1M57 D;  2Q1K A;  2NPS A;  2FFD B;  3CCU P;  5CMZ A;  3RL0 B;  1KTM A;  3R4Y A;  4GOF A;  3L72 E;  2OYH C;  4QCK A;  4TT3 H;  4YPC A;  2A45 H;  2Y0D A;  3H1I G;  1EZV I;  1KB9 E;  1SQV K;  1EDL A;  4DCK A;  1FZG A;  1HBW A;  2IYO A;  2YXQ B;  3GF3 A;  1HUC A;  1JY2 N;  1SQV J;  1TU3 F;  3A0B H;  2V4H A;  2K9J A;  1RF0 A;  2V7Q H;  1MZ9 A;  2FY8 A;  4HM5 A;  2KS1 A;  1FBM A;  2FYU K;  4IL6 E;  1NU1 D;  1NAF A;  4PD4 H;  5CHX A;  1YBK A;  2FYU J;  1VQM P;  1SQB E;  1G8J B;  4HKV A;  1IK9 A;  2YMK A;  2Y0E A;  1BSH A;  4KHX A;  3L35 A;  4U7J A;  4UB8 H;  1SQX D;  1JY3 P;  1ZLL A;  4L73 A;  1OVR A;  3G9R A;  1J2J B;  3FX0 A;  2M8R A;  1AA0 A;  2OYH A;  2KIK A;  3RL0 C;  4GKG A;  1EXI A;  2QVA A;  3SFE C;  5B66 E;  2CKF A;  4IFF A;  1LP1 A;  1KV4 A;  3PP5 A;  4K3A A;  5DJU B;  1NTM E;  3HE5 B;  3EQ2 A;  4K35 A;  1QX8 A;  5KLV E;  5BVZ A;  4AIV A;  1OIP A;  2H88 C;  1L4A A;  2WVR A;  1JTH B;  2WPR A;  3NTN A;  1G2C A;  3H1H J;  3H1L E;  2V7Q J;  3E1R A;  1ZME C;  2KLV A;  1HTL C;  1GL2 D;  1LTJ B;  2Q9I A;  5AVZ B;  1SS1 A;  5KKZ B;  1ZRT E;  5APY A;  2WPQ A;  1K9M Q;  1KD1 Q;  4HB1 A;  3RK3 B;  3D89 A;  4ZKP A;  2ZYD A;  2Y0C A;  1ULI A;  4CPG A;  3CWB E;  1JNM A;  2ZXX A;  3Q3D A;  1KB9 H;  3M9B A;  4QDF B;  1Q81 Q;  1SQP E;  2E74 B;  2ZT9 B;  1PP9 E;  4Y28 J;  5E79 H;  1M1J B;  2XU6 A;  4JPZ B;  3I55 P;  5APW A;  2YKQ A;  2RKL A;  1FZC B;  2PGD A;  1N73 B;  1P84 E;  3H1I J;  1VQL P;  1GMJ A;  1HGZ A;  3IFM A;  5KLI B;  1GK4 A;  3TGU E;  3MTU E;  4IL6 H;  2WSE J;  3RGU A;  3EFG A;  4GOE A;  1NHL A;  2QE7 H;  2BMR A;  1NVO A;  1NO4 A;  4PJ0 E;  1S2E A;  3H1L G;  4XE5 B;  4HM7 A;  1URQ B;  1GK6 A;  2K9Y A;  3V2R A;  4P1B H;  3PTZ A;  1QEX A;  3FXE A;  2I1J A;  1NGM B;  2GBX A;  1NYK A;  4OVN F;  3T97 B;  2Q3I A;  4BRY B;  1ZXG A;  1VQP P;  1LTJ C;  1NH4 A;  1XTG B;  2NVF A;  2IX7 C;  3CX5 E;  5KKZ C;  2XV5 A;  1VF5 D;  3GCE A;  1KFM A;  1PP9 G;  5GTI E;  4D6T J;  5CJ0 A;  1BGY D;  3WMM 0;  2HPC A;  3N0Q A;  5CCG D;  5B66 H;  2B1X A;  4NBE D;  2OYO A;  3L72 J;  4QUP A;  3M06 A;  2ZT9 C;  2E74 C;  1M1J C;  3S1K A;  3G4S P;  2WSS H;  2BCC D;  2D2C D;  1EG9 A;  1NTK E;  2DW3 A;  1FZC C;  3TGU G;  4NB8 D;  1N73 C;  3AE2 C;  3PJS K;  4RJT A;  1LJ2 A;  3OJA B;  1DEE G;  5TIS H;  4IOI H;  4JF7 A;  1WQL A;  5KLI C;  4B86 A;  4H13 C;  5EFW B;  1YJ9 P;  2B24 A;  1QL1 A;  2WTY A;  4R4L A;  1LT9 B;  1SQB K;  3RBZ A;  3G71 P;  4QUR A;  3F89 A;  2GUV A;  3M0D C;  1R8E A;  4HM0 A;  1AFO A;  1SQB J;  1URQ C;  2WT7 B;  1YTZ I;  3P8C E;  1SQX E;  2JEE A;  1IJD B;  3RBX A;  1CI6 A;  3M9Q A;  1JB0 J;  1PPJ D;  1O7N A;  3GHG C;  1LTA C;  3BRT B;  4OGQ D;  2K3R A;  2KYV A;  2RH0 A;  3VMY A;  1P84 H;  3N7N A;  1M1K Q;  3L74 D;  1JY3 O;  3GL0 A;  3QH9 A;  1IO4 A;  3B5N A;  1S5L E;  2ZAE B;  1NTM K;  1NTK G;  2YVJ B;  3M9H A;  3KZI H;  3MP7 B;  1RE4 A;  1MFT A;  3HD7 B;  2BEZ F;  4W80 A;  4WY4 B;  3TF5 A;  2A06 E;  1W2E A;  2MJZ A;  5KLV K;  2XZR A;  3L75 E;  3K5B A;  2NZ2 A;  3EN1 A;  3L73 D;  5AEU A;  1NTM J;  1FAV A;  4Y99 B;  3TYY A;  4L74 A;  3C9I A;  5KLV J;  3U1A A;  2JO1 A;  2E5T A;  3SWY A;  3O6Q B;  1S1C X;  1BCC E;  2JO6 A;  1EDK A;  1VM9 A;  1LT9 C;  1M56 D;  3Q2Y A;  2O01 H;  3CX5 H;  1H89 A;  3H1L J;  3L71 D;  3JSV C;  1L0N D;  1SQX G;  2R44 A;  3C8V A;  1NTZ E;  2NWF A;  2FYZ A;  3RK2 B;  5KJ7 D;  1X8Y A;  1SQP K;  2XNX A;  1KYO D;  4PV1 C;  3BCC E;  1E5W A;  1W5C E;  3WUU A;  1S3J A;  3GHG A;  2NPS D;  3CWB J;  1AQT A;  1N7S B;  1NKZ B;  2P10 A;  2XND H;  1SQP J;  5AVW B;  3OA7 A;  1PP9 J;  2W83 C;  1HWT C;  1SVF A;  1VQK P;  3RK3 E;  3CXH D;  3CL3 D;  2KOG A;  4C7N B;  1SLQ A;  2N1T B;  4ASV A;  1ZOY C;  1KYO I;  3HE4 B;  3D70 A;  2NRG A;  3EQQ A;  1OW6 A;  4BXL A;  5AW1 B;  1L0L E;  3HD7 C;  3TGU J;  2K37 A;  1KN7 A;  2C0X A;  4WY4 C;  2O1J A;  3L70 J;  2QJY B;  1NYH A;  2KNC A;  3BAT A;  4Y99 C;  4RKU J;  2GM4 A;  5APT A;  3TSI A;  1U7M A;  4UB8 E;  1JMM A;  1RQV A;  2WSC H;  1RF1 A;  1YJW P;  2W90 A;  4NB9 D;  1BDD A;  1KIL D;  1NTZ G;  3MGN A;  5AVR B;  1G1I A;  1JCC A;  2WWW A;  2H43 A;  4C46 A;  2HMN A;  2O01 J;  2DE7 D;  2YKP A;  4HJG H;  1KFN A;  1LTS C;  5AW8 B;  2R5D A;  4NBF D;  1S5L H;  2IFM A;  3TNU B;  2M5A A;  1AJY A;  1T2K D;  2XRX A;  5AVV B;  4AAY B;  4YXW H;  4HYT B;  4U3F E;  2N1T C;  1FZB A;  2Q3E A;  3LID A;  1SQQ D;  1NTK J;  2VRS A;  2ZFC A;  3H1K E;  5AW3 B;  2HMO A;  4UB6 E;  2AEJ A;  2W6B A;  2QJY C;  3LW5 H;  1DD3 A;  5AW9 B;  3VMI D;  1MV8 A;  2PRR A;  1KQS O;  1R5L A;  1L4A D;  2R32 A;  1LWU A;  4XA4 A;  2YFI A;  1GZL A;  1O7M A;  1ZP0 C;  3NXS A;  3MHV A;  1FQT A;  2NUK A;  5E79 E;  2WSC J;  2IZ0 A;  1NDO A;  3H1J E; 
#chains in the Genus database with same CATH homology
 3GLM A;  1ULI A;  1O7H A;  3CWB E;  3Q3D A;  4QDF B;  2ZT9 B;  2E74 B;  1SQP E;  1PP9 E;  4Y28 J;  2QJP C;  2DE6 D;  1KOR A;  3H1H E;  2YFJ A;  3AE7 C;  2E4Q A;  4PV1 B;  2D2C C;  1P84 E;  1GMJ A;  4H44 C;  1O7P A;  1HJ0 A;  1O7G A;  3TGU E;  1SQV E;  2WSE J;  3VMH D;  1UUV A;  1KMI Z;  4HM2 A;  5M1B A;  4HM1 A;  1ULJ A;  2BMR A;  2JP3 A;  3D6Y A;  4HM7 A;  3AED C;  2K9Y A;  4P1B H;  3LW5 J;  5L8R J;  2FYU E;  1NGM B;  2GBX A;  1NYK A;  3AE8 C;  1YQ3 C;  4Z1M H;  3AEA C;  3T97 B;  2BCC E;  4P1C H;  2QIW A;  4H0L D;  2NVF A;  3CX5 E;  5KKZ C;  1VF5 D;  3GCE A;  2QPZ A;  4QDC A;  1RFS A;  3N0Q A;  3AZC A;  3VCP A;  1Y9B A;  4NBE D;  2B1X A;  2NVG A;  1O7W A;  4QUP A;  2ZT9 C;  2E74 C;  1KQF B;  2MKV A;  3O6Q A;  1UIX A;  2QJK C;  2DE5 D;  1S5L X;  3D6Z A;  2D2C D;  1EG9 A;  1NTK E;  1EXJ A;  4H44 D;  4NB8 D;  1K04 A;  4R4M A;  3AE2 C;  2YFL A;  2FBW C;  3RL0 g;  1WQL A;  3Q5S A;  5KLI C;  3D71 A;  3DQY A;  4H13 C;  2Q3W A;  4HM4 A;  2B24 A;  1PV3 A;  4YTP C;  1PPJ E;  1OMI A;  4R4L A;  4QDD A;  2E4P A;  2ZYL A;  5AEW A;  4QUR A;  3L74 E;  3IN6 A;  1R8E A;  4HM0 A;  4HM3 A;  2J5U A;  3FOU A;  5BOK A;  1SQX E;  4PD4 E;  3Q5P A;  2XSH A;  1UUW A;  3AE5 C;  4NBH D;  3L73 E;  3GTS A;  2E75 B;  1JB0 J;  4NBB D;  2QSI A;  2G3A A;  1O7N A;  4OGQ D;  3AE4 C;  2OQQ A;  3GL0 A;  3B71 A;  2ZT9 D;  2E74 D;  2H89 C;  1PL5 A;  3AEE C;  2YVJ B;  4NBG D;  3GZX A;  3H1I E;  4NBD D;  4HM6 A;  3L71 E;  1L0N E;  2NVE A;  2BEZ F;  1Q90 C;  1OW7 A;  2A06 E;  3L75 E;  3Q1M A;  2NZ2 A;  1YQ4 C;  3EN1 A;  3S9O A;  3GF7 A;  5AEU A;  1EZV E;  1KYO E;  2GBW A;  3VMG D;  2E76 D;  4H13 D;  1MKM A;  2BEQ D;  2WPV B;  2JO1 A;  3GL2 A;  3AEG C;  2JZA A;  3ABV C;  1S1C X;  1BCC E;  2JO6 A;  1VCK A;  4IL6 X;  2HMK A;  1VM9 A;  3CXH E;  3Q2Y A;  3AE3 C;  1SJG A;  3C8V A;  1NTZ E;  3AEB C;  2NWF A;  4XFJ A;  3GKE A;  3AEF C;  4PV1 C;  3BCC E;  1K05 A;  1DD4 A;  4I7Z B;  3SFD C;  3H25 A;  2E75 C;  2P10 A;  3FGA D;  1KQG B;  1KTM A;  3R4Y A;  1G8K B;  3L72 E;  3RK3 E;  4QCK A;  4TT3 H;  1NU1 E;  3GTE A;  2HMJ A;  1ZOY C;  1HF9 A;  1KB9 E;  3D70 A;  3C0D A;  3GB4 A;  1VL2 A;  2HMM A;  1KIL E;  3EQQ A;  1OW6 A;  2IDB A;  3GF3 A;  4OGQ B;  1Q90 D;  1L0L E;  1TU3 F;  1NYH A;  3AE9 C;  4RKU J;  4HM5 A;  2G8Y A;  4GDO A;  1RQV A;  2FXP A;  4QDF A;  4NB9 D;  3GMA A;  2BMQ A;  4H0L B;  4HM8 A;  1RQU A;  2E76 B;  4H13 B;  1SQB E;  1G8J B;  4HKV A;  2BMO A;  2YMK A;  1VF5 B;  3L70 E;  4U7J A;  4YXD C;  1SQQ E;  2FYN C;  2HMN A;  2O01 J;  1PIX A;  4PV1 D;  2XR8 A;  3AEC C;  5CXM A;  2DE7 D;  3EWK A;  1FDI A;  1DIP A;  3G9R A;  4NBF D;  4I7Z C;  3IAO A;  3GZY A;  2E75 D;  1AJY A;  5HL4 A;  2XRX A;  2I7F A;  3VCA A;  2D2C B;  4H44 B;  1EXI A;  2NUM A;  4AAY B;  3SFE C;  1FDO A;  4U3F E;  1WMK A;  3AE6 C;  2YIU C;  2CKF A;  3H1K E;  3GOB A;  1NTM E;  4OGQ C;  2HML A;  2HMO A;  4HJL A;  5KLV E;  1BE3 E;  2WSF J;  2IBZ E;  3Q5R A;  2QJY C;  4AIV A;  2WQY C;  2H88 C;  4EMJ B;  1DD3 A;  3VMI D;  1U57 A;  4KT0 J;  1IK7 A;  2YFI A;  1JM1 A;  2XSO A;  1RIE A;  3H1L E;  1O7M A;  2V7Q J;  1ZP0 C;  1ZME C;  4QUQ A;  1FQT A;  2NUK A;  1ZRT E;  4NBC D;  4H0L C;  1OW8 A;  4NBA D;  2WSC J;  1NDO A;  2E76 C;  3AE1 C;  3H1J E;  3D89 A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...