2E75D

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 20
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e75D02
1O7PA 1SQPE 1ULIA 1G8JB 4HM3A 4NBED 5KLVE 4H0LC 3GL2A 4P1BH 2YFLA 1NTKE 4NB8D 4OGQD 1NTZE 2YFJA 1SQVE 4HM7A 4I7ZC 2GBXA 3DQYA 4NBAD 2ZT9D 1UUWA 1O7NA 5AEWA 5HL4A 2E75C 3GOBA 3EN1A 1RIEA 3GKEA 2NVGA 1JM1A 2FYNC 2DE6D 5KLIC 3L74E 1EZVE 3GZXA 1BCCE 2I7FA 1PPJE 1WQLA 3L71E 4QDFA 3H1JE 1RFSA 2YIUC 4AIVA 3CX5E 1SJGA 1SQQE 4HM4A 1KYOE 3GCEA 2B24A 2DE5D 2HMNA 2E75D 4HM6A 3H1KE 3VMGD 3C0DA 4H13C 4AAYB 4QDFB 5BOKA 2BMQA 5KKZC 3GTSA 1O7MA 2IBZE 1VCKA 2QJKC 5AEUA 1O7GA 2E4PA 3VMID 3VCAA 3GL0A 1SQXE 1VF5C 4HM5A 4H13D 1NU1E 2BMRA 2QJPC 2XSOA 3GTEA 1NYKA 4HM1A 2XR8A 4HJLA 2B1XA 4QDCA 4NBDD 4QUQA 2ZYLA 4P1CH 4NBGD 1SQBE 4QDDA 3EQQA 2NUMA 3H1LE 1ULJA 2HMLA 2A06E 4OGQC 1FQTA 3GB4A 1G8KB 2HMMA 3CWBE 3H1HE 4QUPA 4NB9D 4HKVA 2YFIA 4NBBD 1NDOA 2HMOA 1Q90C 4HM0A 3FOUA 1NTME 1P84E 2XRXA 3BCCE 2NVFA 2Q3WA 2NUKA 3H1IE 2HMKA 2QJYC 3L75E 2E74C 2BMOA 1KB9E 1EG9A 2NWFA 4HM2A 2E76D 4PV1C 2NVEA 1VM9A 2JZAA 2QPZA 3CXHE 3D89A 4EMJB 1ZRTE 3L72E 2ZT9C 4H44C 3VMHD 2BCCE 2DE7D 1UUVA 4U3FE 1O7WA 2GBWA 2YVJB 1PP9E 3TGUE 2XSHA 2FYUE 4NBHD 3L70E 4PD4E 4H0LD 1L0LE 2HMJA 1L0NE 2JO6A 5CXMA 3VCPA 3GZYA 4HM8A 2E4QA 4NBCD 1BE3E 2D2CD 3N0QA 4H44D 3AZCA 2CKFA 4NBFD 2E74D 4PV1D 1O7HA 4QCKA 2E76C 2YMKA 2D2CC 3L73E 4QURA 1VF5D
chains in the Genus database with same CATH superfamily
3CC2P 4HM3A 1PGOA 5KJ7C 1LWUC 1BCCJ 4EYYQ 3H1JD 3BASA 3OW2O 2YO3A 1LT9B 2OYIA 3L71E 3H1JE 2I8DA 1LTJC 5AW2B 1SQVJ 1BDDA 2WPQA 4HM4A 2K9YA 1IZNB 2FFDA 1PL5A 1W5CE 1LTJB 3GCEA 2XZRA 3S1KA 3USSA 4JPZB 2JP3A 2XV5A 1QLED 3L73D 1QVFO 4PJ0E 4C46A 2I1JA 4PD4I 3GTEA 2N1TC 2PGDA 1URQC 4EOTA 4Y28J 2OYIC 4L74A 1JB0J 2N1TB 2OGUA 1NTMD 3F5HA 1KMIZ 2YFIA 4ASVA 4H44B 4ZKUA 1RY3A 3CWBJ 4WWIA 4C7NB 1SQXD 1EDLA 1U7JA 1YTZI 2KB7P 3BCCG 1SP4A 1NJIQ 1IK9A 3O8ZA 1P84I 3CLQA 3Q5RA 1LTSC 3GG2A 2O01N 2MKVA 3U1CA 1EZVD 1J1DB 4NBED 3VN0A 1RE4A 3L75G 4TLFA 3V2PA 3M0AA 4I7ZC 2YXQB 1U57A 5KAIH 1UUWA 5AEWA 3CXHI 3R4YA 2FYUD 1AJYA 3HE5A 1LP1B 1J1EC 1PPJE 1SQXK 3U1AA 2Y9ZA 2KZJA 2QJKB 3TYYA 1VQLP 3Q1MA 1JY2P 2B24A 4XA4A 4W7ZA 2HMNA 1AVYA 3TF5A 1URQB 4PJ0H 5AW3B 2B87B 1O7GA 4XE5B 2E75B 3V2RA 3W68A 3KZIE 4Z1MH 2IYOA 3HTKA 1NU1G 5DJUB 4NBDD 1HGZA 2P10A 2GUSA 2MJZA 3B5ND 2PRRA 2OARA 1N7LA 1FDOA 4HKVA 5KJ7D 5E79H 3SWKA 3AE7C 2NUKA 4PD4H 1N73B 1X79B 1SQPJ 1L0NJ 5APQA 3WMM0 3H1HJ 2BEZF 1L4AC 1YI2P 2DE7D 1UUVA 2GBWA 3HE5B 3TGUE 1JCDA 4EI2A 1ZRTD 5CMZA 1LTIC 2JO6A 1FJKA 2QRXA 2D2CD 1KTMA 5APYA 5AVWB 4DJGA 1S5LE 3L73E 4LC1A 4U3FD 1KD1Q 3SWYA 4D6TJ 1EDJA 1NAFA 3GL2A 1NTKE 2Q5UA 1SQBK 1O7NA 1MFTA 1QVGO 5C39A 3HD7A 1KN7A 1JM1A 2FBWC 2PAJA 3RBXA 2B89A 3KQGA 3BRTB 1PGJA 4L76A 2OYOA 3L37A 1VQ4P 3JCUE 1HH0A 1PV3A 1Y8AA 1SQVK 2FFDC 1SQQG 2WITA 3MGNA 3AE5C 3BCCJ 2C9NY 1M1KQ 1M57D 1IK7A 2KSJA 5AVSB 3Q2YA 3H1KG 1VCKA 2JDIH 3HD7C 4YTPC 2B1XA 2ZVNB 4C7RA 1G2CB 3L74D 2H7HA 4QUPA 1OVRA 5E79E 2LR2A 4JYBA 1NWQA 1Q90C 3CMEP 4R4MA 1SS1A 3H1IG 2C0WA 2Q3WA 3RL0B 2R32A 2HLOA 1N86A 5KLIB 1PP9G 3CXHE 5TJHA 2ZT9C 1SQQK 4JBZA 3S4RA 1X22A 5AW5B 2B88A 1NTZK 2WPRA 1L0LG 3H25A 1RH5B 2AEFA 3SFDC 2HR3A 4N3YB 1XTGB 4BRYB 1RE3C 1LTBC 5KKZB 3S9OA 4D6TD 2W6AA 4IL6H 2ZT9D 3FXEA 3G6EP 1D7MA 1DEEG 3F89A 3L72J 4YXDC 1SQXJ 1SQXG 1N7SA 3I5CA 2XNXA 3IN6A 2WPSA 2H89C 1N7SC 2ZYGA 3WU2H 1GL2C 2M0BA 2QJKC 3VMID 1OW6A 1PGPA 2HPCA 4K3AA 4H13D 1NYKA 4ZMDA 2WSFH 5AVZB 1HF9A 1IFIA 5APUA 3A0BH 3C9IA 1SQQD 5KTBA 1KV4A 1SFCB 2HYNA 3H1HE 3CWBE 3OJAB 1YYCA 5B5EE 1BDCA 1KYOI 2KNCA 3L75E 2W6BA 1RF1A 2AXTH 4TT3H 1AVOA 2WSEH 1E79H 4RO0A 1T3UA 5CJ4A 4NBCD 3T97A 2H43A 3VP9A 2P2UA 3SWFA 1CSBA 2GA1A 1O7PA 1FOSE 3P7KA 1SQBJ 1SFCA 1N7SD 3P8MC 3PRJA 1NU1D 1SQVE 2E5YA 1WRGA 1Q2NA 5H2FH 5DJTB 3VTPC 4NBAD 2QSIA 1M7LA 1KILE 3MTUE 1PPJG 3EN1A 4WY4D 2QM7A 2OYHB 1X0TA 3VMAA 1FU1A 3RK3D 1RFSA 2YIUC 1Q90D 2W27A 1JM0A 5H2FE 3H1KD 1PGQA 5APVA 3LIDA 2OYIB 1LTAC 2IFMA 2KP8A 3CX5D 1LTTC 1OW7A 3H1KE 3PTZA 2UWJE 5CCHA 3FGAD 1JY3N 3HUSC 3AE2C 2NPSD 4L73A 4KJMA 1DH3A 2BMRA 2R3CA 2OTKE 4QDCA 5KLVG 2A45H 2Y9YA 4YPCA 2KIKA 1VQ9P 3MUDC 4UB8H 3PH0A 3GLMA 4N6JA 2NUMA 4W80A 1P84E 4NPFX 1KB9I 2D2CB 3CCVP 2E76B 1E5WA 1L0NG 3L70J 4M3LA 2E74B 2ZYAA 1VL2A 2R5BA 3RK2C 2CPBA 1JY3P 1RQUA 2YIUB 5KAFE 2OYHA 1YHQP 1A02J 1G1IA 1O7HA 1ZXGA 2D2CC 4HH2A 1Y9BA 1VF5D 2ZT9B 4AQRD 4ZKPA 1IO4A 3RK3B 2YFJA 2K9JA 2POHA 1KZUB 1K8AQ 1VQOP 5HL4A 2QEXP 3GKEA 2IZ1A 3H1HG 1KQGB 2L5GB 1DX7A 3VYIA 1SQPD 1FOSF 1MZ9A 2Y0EA 1H0TA 2O1KA 3AE8C 3E1IA 3EFGA 1QGKB 3L75D 3QH9A 1OZHA 1SFCD 1BGYD 1HWTC 4HJGH 4GOFA 1NU1J 3M9QA 3MIWA 3CCRP 2KLVA 1NHLA 5KKZC 4IL6X 2WSEJ 5EFWB 3AEGC 1ZOYC 3H1ID 2WPVB 2YMYA 4HJLA 3PHLA 1S3JA 1M1JC 3H32B 1YJNP 1SQBE 3EQQA 1KILB 1GK6A 1Q82Q 2HMOA 4NPDA 2HPCB 1ZV8A 3V2NA 3G4SP 3RL0D 2WSFJ 4ZNCA 2FXMA 2KSEA 2A06D 2E43A 1VQ5P 1N7SB 1FDMA 3D70A 2ZAEB 5KAFH 1L0LE 1H89A 1RE4C 1L2PA 2E4QA 4MN4C 3FXDA 3AZCA 1M56D 1GTWA 1FZCB 4U7JA 1LTGC 3B71A 1PP9J 1SQPE 1VQ6P 1KILD 3JCUH 1OXZA 2GBXA 4BRYA 1K05A 1USDA 1P84H 1NTMG 2FYUJ 3V2QA 2K3RA 3CPWO 3L74E 1X8YA 2I7FA 1UIIA 2B87A 3KDPB 3CCJP 3CX5E 1JCCA 3V5BA 1DD4A 1NH4A 2GM4A 1FBMA 3AEDC 1GZLA 3CCMP 1S4XA 3M0DA 3C0DA 1ZP0C 3P8CE 2BMQA 4GDOA 3R2PA 3VCAA 4Y99C 3SFEC 1NTMJ 5AVUB 2KK7A 5CCGC 2LKMA 4NBGD 3L71G 4N78E 4HYTB 2HMMA 2H88C 4NB9D 1L4AA 2Y0CA 2CK3H 2XRXA 3H1IE 3GMAA 2Q1KA 5AW7B 3G9RA 4IL6E 1N2DC 4EMJB 2AEJA 5AVVB 2KS1B 2BCCE 3L75J 3RK2D 3K5BA 2HMJA 4AYCA 3CCSP 3UIAA 1S72P 2FXPA 4I2LC 5M1BA 2E74D 2KS1A 1NKZB 1FZAA 1NTZJ 5AW8B 5AVRB 1BE3J 1AV1A 5KLVE 3A0BE 1H0TB 4H0LC 1SQBG 2HG5D 1S9KE 5KLVK 2W6JH 2K9JB 5KLIC 3H1LD 1WQLA 3MD0A 2WSSH 3RBZA 3RK3C 4BWNA 3RK2B 4U3FJ 1FZGA 1NU1K 1RF0A 4JF7A 1SFCC 4B86A 2IYPA 2JKVA 4I7ZB 3WU2E 4EDFA 4ASWA 1L0LJ 1N73A 2G8YA 2PFXA 2M3BA 3GF7A 1GU5A 1Q7YQ 2N9YB 2VRSA 1HJBA 2J59M 1PFIA 1KYOD 4HM0A 1SQVD 2Z5IA 3H1HD 4K35A 1KB9E 2E76D 1RQVA 1OVVA 1ZRTE 4RESB 3FWLA 3U59A 3CXHH 1ZR4A 3A2AA 1HBWA 1KILC 1S5LH 4H0LD 1BGYG 1L0NE 1GK4A 1IFNA 4IFDK 3N0QA 1LP1A 2CKFA 3TK1A 4NPEA 2BEQD 2OYHC 1DEBA 1EDIA 2P67A 3AEEC 1EC5A 3BRVB 4P1BH 1AQTA 1OIPA 1RHZB 3D71A 1K9MQ 3GOBA 3RK3E 2WMMA 3CCQP 2XU6A 2A06G 1EZVE 1URQD 4WBAA 1IFJA 4DOJA 3TGUD 1KYOH 3M9BA 1LT1A 1FJPA 2YNYA 1R8EA 3L74J 4LGDE 3HUSB 1FZBA 1BCCD 1JY2O 4GOEA 3HD7D 1O7MA 5AEUA 1FZFA 1LWUB 3VMZA 1NTZD 1PPJD 4PD4D 1DD3A 1P84D 1ULJA 2Z5HA 1GW4A 1JUNA 2J5UA 4WB4A 3N7NA 3AE9C 2QA4P 5CCHD 3L72D 1ZMEC 3TSIA 1LNQA 2NWFA 2JO1A 2BCCG 2IBZD 1GMJA 2QPZA 2W8ZA 4IFMA 3RL0C 3D6YA 1KFMA 1AFOA 3E1RA 2XSHA 5GTIH 1SVFA 3B5NA 2I1KA 2Y0DA 3ZDMA 5B66E 3VCPA 2JWDA 5GTHH 3L4FA 1GU4A 3A7OA 5L8RJ 4QURA 1KB9D 1EZVI 3A3YB 2YFLA 4NB8D 4PV1B 2ZYDA 4LLHA 1M1JA 3KXDA 3H1JG 5AW1B 1UIXA 3Q5SA 3ITKA 1ZW0A 3TNUA 4HKZH 1IFDA 4UB6H 1T2KD 1JOCA 3H6PA 4JYCA 1M1JB 4L75A 5AVXB 4BXLA 2ZVOB 1L0LK 2IBZG 3BATA 3ABVC 2FYNB 2RKLA 3HE4B 1VF5C 1NTKG 5APXA 3B5NB 1J2JB 1QX8A 4HM1A 5AW0B 3H1LE 2IFNA 1NDOA 5CJ0A 1OFCX 3EWKA 5GTHE 5KAIE 2QJYC 2HMKA 2E74C 1EG9A 4N78D 4H44C 1SQPK 1EXJA 3M91A 2XKMA 2J58A 4PD4E 1S5LX 4A7PA 5CXMA 4W7YA 3GZYA 4HM8A 1LWUA 1VQKP 5K5GB 1BE3E 1BSNA 3GW6A 4NBFD 2Z4EA 1EXIA 3HUSA 1CZQA 1RF1B 3KZIH 2KNCB 1NTZE 3V4WA 3A0HE 4Y99B 1NTKK 3KYQA 1ZR2A 2DE6D 2QE7H 2KXPB 3GZXA 2V7QH 2O3JA 3NFQA 1N8RQ 5TISE 2FYUK 4GODA 1QL1A 4AIVA 1YQ4C 3GHGA 3GHGB 3PJSK 1KYOE 3CCEP 2KZIA 3WUTA 4XFJA 2AXCA 3KHUA 2WSCJ 4CPGA 2IDBA 3C1LA 1JMBA 1IFPA 2FYZA 2M5AA 1KQSO 2ITAA 3VMXA 3JC22 1YBKA 4P1CH 2WT7B 1HTLC 2YXRB 2HMLA 3AE3C 3SSUA 1EZVG 1FZCC 4NBBD 4H0LB 5B66H 2O01H 1OX3A 3OAKA 3FOUA 2QIWA 2XDJA 1AA0A 1SQQJ 5AVTB 1JY2N 4AUWA 1KFNA 1O7WA 2YVJB 4NBHD 1RF0C 3AE4C 1AQ5A 1VQ8P 1JMMA 1RF1C 1JTHB 1L4AD 1BGYE 5KLVD 1USEA 5BVZA 4PV1D 2M8RA 3AEAC 2A45G 4IFFA 2WTYA 2QG4A 4RJTA 2NPSC 1YQ3C 2K37A 2V7QJ 2SPZA 1PIXA 1NO4A 5APTA 2Q7CA 1G2CA 1SJGA 2R44A 2BASA 3TNUB 3H32A 1YTZT 2N9BA 5KJ7A 2P1JA 4H13C 4QDFB 1SLQA 3GL0A 4QMAA 2QJPC 4OVNF 2IX7C 5APSA 2ZYLA 3EQ2A 3LW5H 3HD7B 3MUDA 3CC7P 1FE6A 1NKNA 1FDIA 2N1TA 2NPSA 1L4AB 2JWAA 2Q3EA 4I1LA 2ZXEB 2L91A 2WSCH 1CW5A 3HRNA 3WUUA 2WZ7A 2KYVA 2Q9IA 4D6TE 2HODB 1PP9D 1LTJA 3I55P 3NXSA 2YMKA 3L70G 3A5TA 3AE6C 1G8JB 5AW9B 1HJ0A 2WVRA 2O01J 5APWA 3DQYA 3RGUA 2E75C 3L36A 1NAYA 2LXBA 2P7JA 5CCGA 1GDTA 1NTKJ 4QDFA 1JEKA 3CCUP 1KQFB 4R4LA 4O9BA 5AVYB 1J1EB 3Q3DA 4OGQB 4HM6A 3M0DC 1FZEA 3FWNA 1TU3F 3CCLP 1WMKA 3JSVC 3TDKA 1Q86Q 1U7MA 3M9HA 1VQMP 1G1JA 1IC2A 2C0XA 1OVUA 2K1AA 2XR8A 4GIFA 4DCKA 4QUQA 1SQPG 1J1DC 2RH0A 2A06E 1FQTA 1NYHA 1H8AA 5CHXA 1R5SA 2R5DA 3M06A 1YJ9P 2O1JA 1NTME 3Q5PA 5B5EH 2P58A 3OA7A 1VQPP 1EQ7A 2H8PD 1NTZG 1JTHA 3QWOC 1GW3A 3MHVA 2LXCB 2NRGA 3D89A 1BGYJ 1KILA 2FYUG 3L72E 3CMAP 2IBZI 1XTCC 1YITP 1MUUA 2PP6A 4U3FE 3V4QA 2KLUA 1LGHB 1R5LA 1K73Q 1NTKD 4YXWH 1SQBD 2ZJSE 4D6TG 5BU8B 4OWFA 4QCKA 4C7NA 2E76C 3FX0A 1HGVA 3WUVA 4U3FG 1ULIA 1KQLA 3L71D 3W67A 1A02F 1L0LD 3VOPA 1ZN5A 2GUVA 1IJDB 2AEMA 3PP5A 2HFED 2FYNC 3CXHD 3C8VA 1Q81Q 1FAVA 1VPCA 1BCCE 2CPSA 2Q6QA 3O6QA 2RN0A 1T2KC 4EIJA 2HODA 3AE1C 2M3EA 3H1LJ 1VQ7P 3B5NC 1KB9H 2DE5D 1T8ZA 3KPEA 2JJLA 3VMGD 2N1TD 3AECC 5BOKA 2JEEA 2NPSB 3GTSA 5AW4B 2IBZE 4WY4A 3AEBC 2E4PA 1M8OB 2IPPA 2FFDB 1EDKA 4HM5A 2QVAA 1LT9A 3L73G 2YO2A 4QDDA 3MZWB 1G8KB 2C9LY 3B8EB 1BSHA 3E7KA 2V4HA 2QJPB 4I6MC 3L35A 3PLNA 3B4SA 1IFMA 3V6IA 4HM2A 2WQYC 4PV1C 1Y47A 2OQQA 3H1IJ 1OWAA 1JY3O 3BVHA 3L70E 3LIEA 2WWWA 1KORA 2BCCJ 2R3SA 2FKWB 5AW6B 3G3ZA 3CD6P 4KT0J 1Z56A 2ZFCA 2YKQA 3L71J 4OGQD 4DZOA 1FC2C 2FXOA 1W2EA 5TISH 5CBOA 4IOIH 1RIEA 2NVGA 3CI9A 1GD2E 1M90Q 3IF4A 5CCHC 1WT6A 2KOGA 3A0HH 2OTJP 1SQQE 3MP7B 5CBNA 2K88A 4KHXA 2ZXXA 1VF5B 1MFZA 2YKPA 1S9KD 4AAYB 1NTMK 2A45I 5BU5A 3I56P 1YIJP 1HUCA 3AEFC 3RL0g 1NU1E 1K04A 1PZQA 3D6ZA 2XSOA 1SQVG 2IZ0A 4GT1A 2FY8A 3L70D 2WT7A 1FZCA 3P32A 4OGQC 1LT9C 2Q3IA 1NVOA 1JNMA 3BCCE 1OW8A 2NVFA 2M5AB 2BMOA 4WY4C 1GL2A 2NVEA 1VM9A 1NOHA 2JZAA 4OH8B 3VMYA 3TGUG 3G71P 3CX5H 4JQ0D 4WY4B 3H1KJ 1CI6B 2QJYB 1BCCG 1DIPA 2W83C 1BE3G 5AVQB 1T3JA 1W2BO 1CI6A 4H44D 1VQNP 3GHGC 3CWBG 1HVVA 4RKUJ 1GL2B 2XNDH 2DW3A 1S1CX 1YJWP 3O6QB 4H13B 3LW5J 3IFMA 3L73J 2E42A 4UB6E 3BCCD 1BE3D 4HM7A 3T97B 3IR9A 3N4XA 5KLVJ 3H1LG 3L74G 1L0ND 3IAOA 3CWBD 2BCCD 3II6A 3HTKB 2E75D 4WVZA 2W90A 1QEXA 1MKMA 2KUBA 2G3AA 2NZ2A 1X9VA 1FS0E 3NMDA 4DT0A 1GL2D 1URQA 1SQXE 5GTIE 3NTNA 1QL2A 1N73C 1H88A 1NGMB 1VDFA 2YKOA 3P8CD 3GB4A 1KC8Q 2KI7B 2RMZA 3HE4A 3CC4P 1MV8A 3TGUJ 1OMIA 2B9BA 1RE3A 2QM8A 4UB8E 2JR8A 1LJ2A 4GKGA 3H1JJ 2OTLP 1JO5A 3VMHD 3VP8A 2AXTE 1L0NK 1ZLLA 1PP9E 1S2EA 2FYUE 3L72G 3GF3A 3EFFK 2E5TA 1T6AA 4HB1A 5CCGD 3CX5I 3CL3D
chains in the Genus database with same CATH topology
1O7PA 3AE6C 1G8JB 4HM3A 3AEEC 4P1BH 1HJ0A 1SQVE 2O01J 3D71A 3DQYA 4NBAD 2QSIA 1KILE 2E75C 3RK3E 3GOBA 3EN1A 1EZVE 3L71E 4QDFA 3H1JE 1RFSA 2YIUC 1Q90D 4HM4A 2K9YA 1KQFB 4R4LA 1PL5A 3GCEA 1R8EA 3Q3DA 4OGQB 2JP3A 4HM6A 1OW7A 3H1KE 1TU3F 1WMKA 3FGAD 3AE2C 1O7MA 5AEUA 2BMRA 3GTEA 2XR8A 4QDCA 4Y28J 1DD3A 4QUQA 1JB0J 3GLMA 2NUMA 1ULJA 2A06E 1FQTA 1NYHA 1KMIZ 2YFIA 2J5UA 3AE9C 4H44B 1NTME 1P84E 3Q5PA 1ZMEC 2D2CB 2E76B 2NWFA 2JO1A 1GMJA 2QPZA 3D89A 3L72E 3D6YA 4U3FE 2XSHA 2E74B 1VL2A 3VCPA 1RQUA 3Q5RA 1O7HA 4QCKA 2MKVA 2E76C 5L8RJ 2D2CC 4QURA 1Y9BA 1VF5D 2ZT9B 1ULIA 4NBED 2YFLA 4NB8D 4PV1B 2YFJA 4I7ZC 1U57A 1UUWA 5AEWA 5HL4A 3R4YA 3GKEA 1AJYA 1UIXA 2FYNC 3Q5SA 3C8VA 1KQGB 1BCCE 1PPJE 3O6QA 3AE8C 3AE1C 3Q1MA 2B24A 2DE5D 2HMNA 3ABVC 3VMGD 3AECC 5BOKA 5KKZC 3GTSA 4IL6X 2WSEJ 2IBZE 3AEBC 1O7GA 2E4PA 2E75B 1VF5C 4HM5A 3AEGC 1ZOYC 4Z1MH 2WPVB 4HM1A 4HJLA 4NBDD 2P10A 1SQBE 4QDDA 3EQQA 3H1LE 1G8KB 1FDOA 4HKVA 1NDOA 2HMOA 3EWKA 3AE7C 2NUKA 2QJYC 2HMKA 2E74C 1EG9A 2WSFJ 4HM2A 2WQYC 4PV1C 2OQQA 4H44C 2BEZF 1EXJA 3D70A 2DE7D 1UUVA 2GBWA 3TGUE 3L70E 4PD4E 1S5LX 1L0LE 1KORA 2JO6A 5CXMA 3GZYA 4HM8A 2E4QA 1BE3E 2D2CD 1KTMA 3AZCA 4NBFD 4U7JA 4KT0J 3B71A 3L73E 1EXIA 1SQPE 3GL2A 1NTKE 4OGQD 1NTZE 2GBXA 1K05A 1O7NA 1RIEA 2NVGA 1JM1A 2FBWC 2DE6D 3L74E 3GZXA 2I7FA 4AIVA 3CX5E 1YQ4C 1SQQE 1DD4A 1KYOE 1PV3A 4XFJA 3AEDC 2WSCJ 1VF5B 3AE5C 2IDBA 1IK7A 3C0DA 1ZP0C 4AAYB 3Q2YA 2BMQA 4GDOA 1VCKA 3VCAA 3RL0g 3AEFC 1NU1E 1K04A 3SFEC 3D6ZA 2XSOA 4YTPC 2B1XA 4P1CH 4NBGD 2HMLA 3AE3C 4OGQC 2HMMA 4QUPA 2H88C 4NB9D 4NBBD 1Q90C 4R4MA 4H0LB 3FOUA 2XRXA 3BCCE 2QIWA 1OW8A 2NVFA 3GMAA 2Q3WA 3H1IE 3G9RA 2BMOA 2NVEA 1VM9A 2JZAA 3CXHE 4EMJB 2ZT9C 2BCCE 1O7WA 2YVJB 4NBHD 1DIPA 3AE4C 2HMJA 2FXPA 4H44D 5M1BA 3H25A 2E74D 4PV1D 3SFDC 3AEAC 4RKUJ 5KLVE 1S1CX 4H13B 4H0LC 3LW5J 1YQ3C 2V7QJ 3S9OA 1PIXA 4HM7A 3T97B 2ZT9D 5KLIC 3IAOA 1WQLA 1SJGA 4YXDC 2E75D 3IN6A 1MKMA 4I7ZB 2G3AA 2NZ2A 4H13C 2H89C 4QDFB 2G8YA 2QJKC 3VMID 1OW6A 3GL0A 3GF7A 1SQXE 2QJPC 4H13D 1NYKA 1NGMB 1HF9A 2ZYLA 3GB4A 3H1HE 3CWBE 4HM0A 1FDIA 1OMIA 3L75E 1KB9E 2E76D 1RQVA 4TT3H 1ZRTE 3VMHD 1PP9E 2FYUE 3GF3A 4H0LD 1L0NE 4NBCD 3N0QA 2CKFA 2YMKA 2BEQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P A;  1SQP E;  1ULI A;  1G8J B;  4HM3 A;  4NBE D;  5KLV E;  4H0L C;  3GL2 A;  4P1B H;  2YFL A;  1NTK E;  4NB8 D;  4OGQ D;  1NTZ E;  2YFJ A;  1SQV E;  4HM7 A;  4I7Z C;  2GBX A;  3DQY A;  4NBA D;  2ZT9 D;  1UUW A;  1O7N A;  5AEW A;  5HL4 A;  2E75 C;  3GOB A;  3EN1 A;  1RIE A;  3GKE A;  2NVG A;  1JM1 A;  2FYN C;  2DE6 D;  5KLI C;  3L74 E;  1EZV E;  3GZX A;  1BCC E;  2I7F A;  1PPJ E;  1WQL A;  3L71 E;  4QDF A;  3H1J E;  1RFS A;  2YIU C;  4AIV A;  3CX5 E;  1SJG A;  1SQQ E;  4HM4 A;  1KYO E;  3GCE A;  2B24 A;  2DE5 D;  2HMN A;  2E75 D;  4HM6 A;  3H1K E;  3VMG D;  3C0D A;  4H13 C;  4AAY B;  4QDF B;  5BOK A;  2BMQ A;  5KKZ C;  3GTS A;  1O7M A;  2IBZ E;  1VCK A;  2QJK C;  5AEU A;  1O7G A;  2E4P A;  3VMI D;  3VCA A;  3GL0 A;  1SQX E;  1VF5 C;  4HM5 A;  4H13 D;  1NU1 E;  2BMR A;  2QJP C;  2XSO A;  3GTE A;  1NYK A;  4HM1 A;  2XR8 A;  4HJL A;  2B1X A;  4QDC A;  4NBD D;  4QUQ A;  2ZYL A;  4P1C H;  4NBG D;  1SQB E;  4QDD A;  3EQQ A;  2NUM A;  3H1L E;  1ULJ A;  2HML A;  2A06 E;  4OGQ C;  1FQT A;  3GB4 A;  1G8K B;  2HMM A;  3CWB E;  3H1H E;  4QUP A;  4NB9 D;  4HKV A;  2YFI A;  4NBB D;  1NDO A;  2HMO A;  1Q90 C;  4HM0 A;  3FOU A;  1NTM E;  1P84 E;  2XRX A;  3BCC E;  2NVF A;  2Q3W A;  2NUK A;  3H1I E;  2HMK A;  2QJY C;  3L75 E;  2E74 C;  2BMO A;  1KB9 E;  1EG9 A;  2NWF A;  4HM2 A;  2E76 D;  4PV1 C;  2NVE A;  1VM9 A;  2JZA A;  2QPZ A;  3CXH E;  3D89 A;  4EMJ B;  1ZRT E;  3L72 E;  2ZT9 C;  4H44 C;  3VMH D;  2BCC E;  2DE7 D;  1UUV A;  4U3F E;  1O7W A;  2GBW A;  2YVJ B;  1PP9 E;  3TGU E;  2XSH A;  2FYU E;  4NBH D;  3L70 E;  4PD4 E;  4H0L D;  1L0L E;  2HMJ A;  1L0N E;  2JO6 A;  5CXM A;  3VCP A;  3GZY A;  4HM8 A;  2E4Q A;  4NBC D;  1BE3 E;  2D2C D;  3N0Q A;  4H44 D;  3AZC A;  2CKF A;  4NBF D;  2E74 D;  4PV1 D;  1O7H A;  4QCK A;  2E76 C;  2YMK A;  2D2C C;  3L73 E;  4QUR A;  1VF5 D; 
#chains in the Genus database with same CATH topology
 3CC2 P;  4HM3 A;  1PGO A;  5KJ7 C;  1LWU C;  1BCC J;  4EYY Q;  3H1J D;  3BAS A;  3OW2 O;  2YO3 A;  1LT9 B;  2OYI A;  3L71 E;  3H1J E;  2I8D A;  1LTJ C;  5AW2 B;  1SQV J;  1BDD A;  2WPQ A;  4HM4 A;  2K9Y A;  1IZN B;  2FFD A;  1PL5 A;  1W5C E;  1LTJ B;  3GCE A;  2XZR A;  3S1K A;  3USS A;  4JPZ B;  2JP3 A;  2XV5 A;  1QLE D;  3L73 D;  1QVF O;  4PJ0 E;  4C46 A;  2I1J A;  4PD4 I;  3GTE A;  2N1T C;  2PGD A;  1URQ C;  4EOT A;  4Y28 J;  2OYI C;  4L74 A;  1JB0 J;  2N1T B;  2OGU A;  1NTM D;  3F5H A;  1KMI Z;  2YFI A;  4ASV A;  4H44 B;  4ZKU A;  1RY3 A;  3CWB J;  4WWI A;  4C7N B;  1SQX D;  1EDL A;  1U7J A;  1YTZ I;  2KB7 P;  3BCC G;  1SP4 A;  1NJI Q;  1IK9 A;  3O8Z A;  1P84 I;  3CLQ A;  3Q5R A;  1LTS C;  3GG2 A;  2O01 N;  2MKV A;  3U1C A;  1EZV D;  1J1D B;  4NBE D;  3VN0 A;  1RE4 A;  3L75 G;  4TLF A;  3V2P A;  3M0A A;  4I7Z C;  2YXQ B;  1U57 A;  5KAI H;  1UUW A;  5AEW A;  3CXH I;  3R4Y A;  2FYU D;  1AJY A;  3HE5 A;  1LP1 B;  1J1E C;  1PPJ E;  1SQX K;  3U1A A;  2Y9Z A;  2KZJ A;  2QJK B;  3TYY A;  1VQL P;  3Q1M A;  1JY2 P;  2B24 A;  4XA4 A;  4W7Z A;  2HMN A;  1AVY A;  3TF5 A;  1URQ B;  4PJ0 H;  5AW3 B;  2B87 B;  1O7G A;  4XE5 B;  2E75 B;  3V2R A;  3W68 A;  3KZI E;  4Z1M H;  2IYO A;  3HTK A;  1NU1 G;  5DJU B;  4NBD D;  1HGZ A;  2P10 A;  2GUS A;  2MJZ A;  3B5N D;  2PRR A;  2OAR A;  1N7L A;  1FDO A;  4HKV A;  5KJ7 D;  5E79 H;  3SWK A;  3AE7 C;  2NUK A;  4PD4 H;  1N73 B;  1X79 B;  1SQP J;  1L0N J;  5APQ A;  3WMM 0;  3H1H J;  2BEZ F;  1L4A C;  1YI2 P;  2DE7 D;  1UUV A;  2GBW A;  3HE5 B;  3TGU E;  1JCD A;  4EI2 A;  1ZRT D;  5CMZ A;  1LTI C;  2JO6 A;  1FJK A;  2QRX A;  2D2C D;  1KTM A;  5APY A;  5AVW B;  4DJG A;  1S5L E;  3L73 E;  4LC1 A;  4U3F D;  1KD1 Q;  3SWY A;  4D6T J;  1EDJ A;  1NAF A;  3GL2 A;  1NTK E;  2Q5U A;  1SQB K;  1O7N A;  1MFT A;  1QVG O;  5C39 A;  3HD7 A;  1KN7 A;  1JM1 A;  2FBW C;  2PAJ A;  3RBX A;  2B89 A;  3KQG A;  3BRT B;  1PGJ A;  4L76 A;  2OYO A;  3L37 A;  1VQ4 P;  3JCU E;  1HH0 A;  1PV3 A;  1Y8A A;  1SQV K;  2FFD C;  1SQQ G;  2WIT A;  3MGN A;  3AE5 C;  3BCC J;  2C9N Y;  1M1K Q;  1M57 D;  1IK7 A;  2KSJ A;  5AVS B;  3Q2Y A;  3H1K G;  1VCK A;  2JDI H;  3HD7 C;  4YTP C;  2B1X A;  2ZVN B;  4C7R A;  1G2C B;  3L74 D;  2H7H A;  4QUP A;  1OVR A;  5E79 E;  2LR2 A;  4JYB A;  1NWQ A;  1Q90 C;  3CME P;  4R4M A;  1SS1 A;  3H1I G;  2C0W A;  2Q3W A;  3RL0 B;  2R32 A;  2HLO A;  1N86 A;  5KLI B;  1PP9 G;  3CXH E;  5TJH A;  2ZT9 C;  1SQQ K;  4JBZ A;  3S4R A;  1X22 A;  5AW5 B;  2B88 A;  1NTZ K;  2WPR A;  1L0L G;  3H25 A;  1RH5 B;  2AEF A;  3SFD C;  2HR3 A;  4N3Y B;  1XTG B;  4BRY B;  1RE3 C;  1LTB C;  5KKZ B;  3S9O A;  4D6T D;  2W6A A;  4IL6 H;  2ZT9 D;  3FXE A;  3G6E P;  1D7M A;  1DEE G;  3F89 A;  3L72 J;  4YXD C;  1SQX J;  1SQX G;  1N7S A;  3I5C A;  2XNX A;  3IN6 A;  2WPS A;  2H89 C;  1N7S C;  2ZYG A;  3WU2 H;  1GL2 C;  2M0B A;  2QJK C;  3VMI D;  1OW6 A;  1PGP A;  2HPC A;  4K3A A;  4H13 D;  1NYK A;  4ZMD A;  2WSF H;  5AVZ B;  1HF9 A;  1IFI A;  5APU A;  3A0B H;  3C9I A;  1SQQ D;  5KTB A;  1KV4 A;  1SFC B;  2HYN A;  3H1H E;  3CWB E;  3OJA B;  1YYC A;  5B5E E;  1BDC A;  1KYO I;  2KNC A;  3L75 E;  2W6B A;  1RF1 A;  2AXT H;  4TT3 H;  1AVO A;  2WSE H;  1E79 H;  4RO0 A;  1T3U A;  5CJ4 A;  4NBC D;  3T97 A;  2H43 A;  3VP9 A;  2P2U A;  3SWF A;  1CSB A;  2GA1 A;  1O7P A;  1FOS E;  3P7K A;  1SQB J;  1SFC A;  1N7S D;  3P8M C;  3PRJ A;  1NU1 D;  1SQV E;  2E5Y A;  1WRG A;  1Q2N A;  5H2F H;  5DJT B;  3VTP C;  4NBA D;  2QSI A;  1M7L A;  1KIL E;  3MTU E;  1PPJ G;  3EN1 A;  4WY4 D;  2QM7 A;  2OYH B;  1X0T A;  3VMA A;  1FU1 A;  3RK3 D;  1RFS A;  2YIU C;  1Q90 D;  2W27 A;  1JM0 A;  5H2F E;  3H1K D;  1PGQ A;  5APV A;  3LID A;  2OYI B;  1LTA C;  2IFM A;  2KP8 A;  3CX5 D;  1LTT C;  1OW7 A;  3H1K E;  3PTZ A;  2UWJ E;  5CCH A;  3FGA D;  1JY3 N;  3HUS C;  3AE2 C;  2NPS D;  4L73 A;  4KJM A;  1DH3 A;  2BMR A;  2R3C A;  2OTK E;  4QDC A;  5KLV G;  2A45 H;  2Y9Y A;  4YPC A;  2KIK A;  1VQ9 P;  3MUD C;  4UB8 H;  3PH0 A;  3GLM A;  4N6J A;  2NUM A;  4W80 A;  1P84 E;  4NPF X;  1KB9 I;  2D2C B;  3CCV P;  2E76 B;  1E5W A;  1L0N G;  3L70 J;  4M3L A;  2E74 B;  2ZYA A;  1VL2 A;  2R5B A;  3RK2 C;  2CPB A;  1JY3 P;  1RQU A;  2YIU B;  5KAF E;  2OYH A;  1YHQ P;  1A02 J;  1G1I A;  1O7H A;  1ZXG A;  2D2C C;  4HH2 A;  1Y9B A;  1VF5 D;  2ZT9 B;  4AQR D;  4ZKP A;  1IO4 A;  3RK3 B;  2YFJ A;  2K9J A;  2POH A;  1KZU B;  1K8A Q;  1VQO P;  5HL4 A;  2QEX P;  3GKE A;  2IZ1 A;  3H1H G;  1KQG B;  2L5G B;  1DX7 A;  3VYI A;  1SQP D;  1FOS F;  1MZ9 A;  2Y0E A;  1H0T A;  2O1K A;  3AE8 C;  3E1I A;  3EFG A;  1QGK B;  3L75 D;  3QH9 A;  1OZH A;  1SFC D;  1BGY D;  1HWT C;  4HJG H;  4GOF A;  1NU1 J;  3M9Q A;  3MIW A;  3CCR P;  2KLV A;  1NHL A;  5KKZ C;  4IL6 X;  2WSE J;  5EFW B;  3AEG C;  1ZOY C;  3H1I D;  2WPV B;  2YMY A;  4HJL A;  3PHL A;  1S3J A;  1M1J C;  3H32 B;  1YJN P;  1SQB E;  3EQQ A;  1KIL B;  1GK6 A;  1Q82 Q;  2HMO A;  4NPD A;  2HPC B;  1ZV8 A;  3V2N A;  3G4S P;  3RL0 D;  2WSF J;  4ZNC A;  2FXM A;  2KSE A;  2A06 D;  2E43 A;  1VQ5 P;  1N7S B;  1FDM A;  3D70 A;  2ZAE B;  5KAF H;  1L0L E;  1H89 A;  1RE4 C;  1L2P A;  2E4Q A;  4MN4 C;  3FXD A;  3AZC A;  1M56 D;  1GTW A;  1FZC B;  4U7J A;  1LTG C;  3B71 A;  1PP9 J;  1SQP E;  1VQ6 P;  1KIL D;  3JCU H;  1OXZ A;  2GBX A;  4BRY A;  1K05 A;  1USD A;  1P84 H;  1NTM G;  2FYU J;  3V2Q A;  2K3R A;  3CPW O;  3L74 E;  1X8Y A;  2I7F A;  1UII A;  2B87 A;  3KDP B;  3CCJ P;  3CX5 E;  1JCC A;  3V5B A;  1DD4 A;  1NH4 A;  2GM4 A;  1FBM A;  3AED C;  1GZL A;  3CCM P;  1S4X A;  3M0D A;  3C0D A;  1ZP0 C;  3P8C E;  2BMQ A;  4GDO A;  3R2P A;  3VCA A;  4Y99 C;  3SFE C;  1NTM J;  5AVU B;  2KK7 A;  5CCG C;  2LKM A;  4NBG D;  3L71 G;  4N78 E;  4HYT B;  2HMM A;  2H88 C;  4NB9 D;  1L4A A;  2Y0C A;  2CK3 H;  2XRX A;  3H1I E;  3GMA A;  2Q1K A;  5AW7 B;  3G9R A;  4IL6 E;  1N2D C;  4EMJ B;  2AEJ A;  5AVV B;  2KS1 B;  2BCC E;  3L75 J;  3RK2 D;  3K5B A;  2HMJ A;  4AYC A;  3CCS P;  3UIA A;  1S72 P;  2FXP A;  4I2L C;  5M1B A;  2E74 D;  2KS1 A;  1NKZ B;  1FZA A;  1NTZ J;  5AW8 B;  5AVR B;  1BE3 J;  1AV1 A;  5KLV E;  3A0B E;  1H0T B;  4H0L C;  1SQB G;  2HG5 D;  1S9K E;  5KLV K;  2W6J H;  2K9J B;  5KLI C;  3H1L D;  1WQL A;  3MD0 A;  2WSS H;  3RBZ A;  3RK3 C;  4BWN A;  3RK2 B;  4U3F J;  1FZG A;  1NU1 K;  1RF0 A;  4JF7 A;  1SFC C;  4B86 A;  2IYP A;  2JKV A;  4I7Z B;  3WU2 E;  4EDF A;  4ASW A;  1L0L J;  1N73 A;  2G8Y A;  2PFX A;  2M3B A;  3GF7 A;  1GU5 A;  1Q7Y Q;  2N9Y B;  2VRS A;  1HJB A;  2J59 M;  1PFI A;  1KYO D;  4HM0 A;  1SQV D;  2Z5I A;  3H1H D;  4K35 A;  1KB9 E;  2E76 D;  1RQV A;  1OVV A;  1ZRT E;  4RES B;  3FWL A;  3U59 A;  3CXH H;  1ZR4 A;  3A2A A;  1HBW A;  1KIL C;  1S5L H;  4H0L D;  1BGY G;  1L0N E;  1GK4 A;  1IFN A;  4IFD K;  3N0Q A;  1LP1 A;  2CKF A;  3TK1 A;  4NPE A;  2BEQ D;  2OYH C;  1DEB A;  1EDI A;  2P67 A;  3AEE C;  1EC5 A;  3BRV B;  4P1B H;  1AQT A;  1OIP A;  1RHZ B;  3D71 A;  1K9M Q;  3GOB A;  3RK3 E;  2WMM A;  3CCQ P;  2XU6 A;  2A06 G;  1EZV E;  1URQ D;  4WBA A;  1IFJ A;  4DOJ A;  3TGU D;  1KYO H;  3M9B A;  1LT1 A;  1FJP A;  2YNY A;  1R8E A;  3L74 J;  4LGD E;  3HUS B;  1FZB A;  1BCC D;  1JY2 O;  4GOE A;  3HD7 D;  1O7M A;  5AEU A;  1FZF A;  1LWU B;  3VMZ A;  1NTZ D;  1PPJ D;  4PD4 D;  1DD3 A;  1P84 D;  1ULJ A;  2Z5H A;  1GW4 A;  1JUN A;  2J5U A;  4WB4 A;  3N7N A;  3AE9 C;  2QA4 P;  5CCH D;  3L72 D;  1ZME C;  3TSI A;  1LNQ A;  2NWF A;  2JO1 A;  2BCC G;  2IBZ D;  1GMJ A;  2QPZ A;  2W8Z A;  4IFM A;  3RL0 C;  3D6Y A;  1KFM A;  1AFO A;  3E1R A;  2XSH A;  5GTI H;  1SVF A;  3B5N A;  2I1K A;  2Y0D A;  3ZDM A;  5B66 E;  3VCP A;  2JWD A;  5GTH H;  3L4F A;  1GU4 A;  3A7O A;  5L8R J;  4QUR A;  1KB9 D;  1EZV I;  3A3Y B;  2YFL A;  4NB8 D;  4PV1 B;  2ZYD A;  4LLH A;  1M1J A;  3KXD A;  3H1J G;  5AW1 B;  1UIX A;  3Q5S A;  3ITK A;  1ZW0 A;  3TNU A;  4HKZ H;  1IFD A;  4UB6 H;  1T2K D;  1JOC A;  3H6P A;  4JYC A;  1M1J B;  4L75 A;  5AVX B;  4BXL A;  2ZVO B;  1L0L K;  2IBZ G;  3BAT A;  3ABV C;  2FYN B;  2RKL A;  3HE4 B;  1VF5 C;  1NTK G;  5APX A;  3B5N B;  1J2J B;  1QX8 A;  4HM1 A;  5AW0 B;  3H1L E;  2IFN A;  1NDO A;  5CJ0 A;  1OFC X;  3EWK A;  5GTH E;  5KAI E;  2QJY C;  2HMK A;  2E74 C;  1EG9 A;  4N78 D;  4H44 C;  1SQP K;  1EXJ A;  3M91 A;  2XKM A;  2J58 A;  4PD4 E;  1S5L X;  4A7P A;  5CXM A;  4W7Y A;  3GZY A;  4HM8 A;  1LWU A;  1VQK P;  5K5G B;  1BE3 E;  1BSN A;  3GW6 A;  4NBF D;  2Z4E A;  1EXI A;  3HUS A;  1CZQ A;  1RF1 B;  3KZI H;  2KNC B;  1NTZ E;  3V4W A;  3A0H E;  4Y99 B;  1NTK K;  3KYQ A;  1ZR2 A;  2DE6 D;  2QE7 H;  2KXP B;  3GZX A;  2V7Q H;  2O3J A;  3NFQ A;  1N8R Q;  5TIS E;  2FYU K;  4GOD A;  1QL1 A;  4AIV A;  1YQ4 C;  3GHG A;  3GHG B;  3PJS K;  1KYO E;  3CCE P;  2KZI A;  3WUT A;  4XFJ A;  2AXC A;  3KHU A;  2WSC J;  4CPG A;  2IDB A;  3C1L A;  1JMB A;  1IFP A;  2FYZ A;  2M5A A;  1KQS O;  2ITA A;  3VMX A;  3JC2 2;  1YBK A;  4P1C H;  2WT7 B;  1HTL C;  2YXR B;  2HML A;  3AE3 C;  3SSU A;  1EZV G;  1FZC C;  4NBB D;  4H0L B;  5B66 H;  2O01 H;  1OX3 A;  3OAK A;  3FOU A;  2QIW A;  2XDJ A;  1AA0 A;  1SQQ J;  5AVT B;  1JY2 N;  4AUW A;  1KFN A;  1O7W A;  2YVJ B;  4NBH D;  1RF0 C;  3AE4 C;  1AQ5 A;  1VQ8 P;  1JMM A;  1RF1 C;  1JTH B;  1L4A D;  1BGY E;  5KLV D;  1USE A;  5BVZ A;  4PV1 D;  2M8R A;  3AEA C;  2A45 G;  4IFF A;  2WTY A;  2QG4 A;  4RJT A;  2NPS C;  1YQ3 C;  2K37 A;  2V7Q J;  2SPZ A;  1PIX A;  1NO4 A;  5APT A;  2Q7C A;  1G2C A;  1SJG A;  2R44 A;  2BAS A;  3TNU B;  3H32 A;  1YTZ T;  2N9B A;  5KJ7 A;  2P1J A;  4H13 C;  4QDF B;  1SLQ A;  3GL0 A;  4QMA A;  2QJP C;  4OVN F;  2IX7 C;  5APS A;  2ZYL A;  3EQ2 A;  3LW5 H;  3HD7 B;  3MUD A;  3CC7 P;  1FE6 A;  1NKN A;  1FDI A;  2N1T A;  2NPS A;  1L4A B;  2JWA A;  2Q3E A;  4I1L A;  2ZXE B;  2L91 A;  2WSC H;  1CW5 A;  3HRN A;  3WUU A;  2WZ7 A;  2KYV A;  2Q9I A;  4D6T E;  2HOD B;  1PP9 D;  1LTJ A;  3I55 P;  3NXS A;  2YMK A;  3L70 G;  3A5T A;  3AE6 C;  1G8J B;  5AW9 B;  1HJ0 A;  2WVR A;  2O01 J;  5APW A;  3DQY A;  3RGU A;  2E75 C;  3L36 A;  1NAY A;  2LXB A;  2P7J A;  5CCG A;  1GDT A;  1NTK J;  4QDF A;  1JEK A;  3CCU P;  1KQF B;  4R4L A;  4O9B A;  5AVY B;  1J1E B;  3Q3D A;  4OGQ B;  4HM6 A;  3M0D C;  1FZE A;  3FWN A;  1TU3 F;  3CCL P;  1WMK A;  3JSV C;  3TDK A;  1Q86 Q;  1U7M A;  3M9H A;  1VQM P;  1G1J A;  1IC2 A;  2C0X A;  1OVU A;  2K1A A;  2XR8 A;  4GIF A;  4DCK A;  4QUQ A;  1SQP G;  1J1D C;  2RH0 A;  2A06 E;  1FQT A;  1NYH A;  1H8A A;  5CHX A;  1R5S A;  2R5D A;  3M06 A;  1YJ9 P;  2O1J A;  1NTM E;  3Q5P A;  5B5E H;  2P58 A;  3OA7 A;  1VQP P;  1EQ7 A;  2H8P D;  1NTZ G;  1JTH A;  3QWO C;  1GW3 A;  3MHV A;  2LXC B;  2NRG A;  3D89 A;  1BGY J;  1KIL A;  2FYU G;  3L72 E;  3CMA P;  2IBZ I;  1XTC C;  1YIT P;  1MUU A;  2PP6 A;  4U3F E;  3V4Q A;  2KLU A;  1LGH B;  1R5L A;  1K73 Q;  1NTK D;  4YXW H;  1SQB D;  2ZJS E;  4D6T G;  5BU8 B;  4OWF A;  4QCK A;  4C7N A;  2E76 C;  3FX0 A;  1HGV A;  3WUV A;  4U3F G;  1ULI A;  1KQL A;  3L71 D;  3W67 A;  1A02 F;  1L0L D;  3VOP A;  1ZN5 A;  2GUV A;  1IJD B;  2AEM A;  3PP5 A;  2HFE D;  2FYN C;  3CXH D;  3C8V A;  1Q81 Q;  1FAV A;  1VPC A;  1BCC E;  2CPS A;  2Q6Q A;  3O6Q A;  2RN0 A;  1T2K C;  4EIJ A;  2HOD A;  3AE1 C;  2M3E A;  3H1L J;  1VQ7 P;  3B5N C;  1KB9 H;  2DE5 D;  1T8Z A;  3KPE A;  2JJL A;  3VMG D;  2N1T D;  3AEC C;  5BOK A;  2JEE A;  2NPS B;  3GTS A;  5AW4 B;  2IBZ E;  4WY4 A;  3AEB C;  2E4P A;  1M8O B;  2IPP A;  2FFD B;  1EDK A;  4HM5 A;  2QVA A;  1LT9 A;  3L73 G;  2YO2 A;  4QDD A;  3MZW B;  1G8K B;  2C9L Y;  3B8E B;  1BSH A;  3E7K A;  2V4H A;  2QJP B;  4I6M C;  3L35 A;  3PLN A;  3B4S A;  1IFM A;  3V6I A;  4HM2 A;  2WQY C;  4PV1 C;  1Y47 A;  2OQQ A;  3H1I J;  1OWA A;  1JY3 O;  3BVH A;  3L70 E;  3LIE A;  2WWW A;  1KOR A;  2BCC J;  2R3S A;  2FKW B;  5AW6 B;  3G3Z A;  3CD6 P;  4KT0 J;  1Z56 A;  2ZFC A;  2YKQ A;  3L71 J;  4OGQ D;  4DZO A;  1FC2 C;  2FXO A;  1W2E A;  5TIS H;  5CBO A;  4IOI H;  1RIE A;  2NVG A;  3CI9 A;  1GD2 E;  1M90 Q;  3IF4 A;  5CCH C;  1WT6 A;  2KOG A;  3A0H H;  2OTJ P;  1SQQ E;  3MP7 B;  5CBN A;  2K88 A;  4KHX A;  2ZXX A;  1VF5 B;  1MFZ A;  2YKP A;  1S9K D;  4AAY B;  1NTM K;  2A45 I;  5BU5 A;  3I56 P;  1YIJ P;  1HUC A;  3AEF C;  3RL0 g;  1NU1 E;  1K04 A;  1PZQ A;  3D6Z A;  2XSO A;  1SQV G;  2IZ0 A;  4GT1 A;  2FY8 A;  3L70 D;  2WT7 A;  1FZC A;  3P32 A;  4OGQ C;  1LT9 C;  2Q3I A;  1NVO A;  1JNM A;  3BCC E;  1OW8 A;  2NVF A;  2M5A B;  2BMO A;  4WY4 C;  1GL2 A;  2NVE A;  1VM9 A;  1NOH A;  2JZA A;  4OH8 B;  3VMY A;  3TGU G;  3G71 P;  3CX5 H;  4JQ0 D;  4WY4 B;  3H1K J;  1CI6 B;  2QJY B;  1BCC G;  1DIP A;  2W83 C;  1BE3 G;  5AVQ B;  1T3J A;  1W2B O;  1CI6 A;  4H44 D;  1VQN P;  3GHG C;  3CWB G;  1HVV A;  4RKU J;  1GL2 B;  2XND H;  2DW3 A;  1S1C X;  1YJW P;  3O6Q B;  4H13 B;  3LW5 J;  3IFM A;  3L73 J;  2E42 A;  4UB6 E;  3BCC D;  1BE3 D;  4HM7 A;  3T97 B;  3IR9 A;  3N4X A;  5KLV J;  3H1L G;  3L74 G;  1L0N D;  3IAO A;  3CWB D;  2BCC D;  3II6 A;  3HTK B;  2E75 D;  4WVZ A;  2W90 A;  1QEX A;  1MKM A;  2KUB A;  2G3A A;  2NZ2 A;  1X9V A;  1FS0 E;  3NMD A;  4DT0 A;  1GL2 D;  1URQ A;  1SQX E;  5GTI E;  3NTN A;  1QL2 A;  1N73 C;  1H88 A;  1NGM B;  1VDF A;  2YKO A;  3P8C D;  3GB4 A;  1KC8 Q;  2KI7 B;  2RMZ A;  3HE4 A;  3CC4 P;  1MV8 A;  3TGU J;  1OMI A;  2B9B A;  1RE3 A;  2QM8 A;  4UB8 E;  2JR8 A;  1LJ2 A;  4GKG A;  3H1J J;  2OTL P;  1JO5 A;  3VMH D;  3VP8 A;  2AXT E;  1L0N K;  1ZLL A;  1PP9 E;  1S2E A;  2FYU E;  3L72 G;  3GF3 A;  3EFF K;  2E5T A;  1T6A A;  4HB1 A;  5CCG D;  3CX5 I;  3CL3 D; 
#chains in the Genus database with same CATH homology
 1O7P A;  3AE6 C;  1G8J B;  4HM3 A;  3AEE C;  4P1B H;  1HJ0 A;  1SQV E;  2O01 J;  3D71 A;  3DQY A;  4NBA D;  2QSI A;  1KIL E;  2E75 C;  3RK3 E;  3GOB A;  3EN1 A;  1EZV E;  3L71 E;  4QDF A;  3H1J E;  1RFS A;  2YIU C;  1Q90 D;  4HM4 A;  2K9Y A;  1KQF B;  4R4L A;  1PL5 A;  3GCE A;  1R8E A;  3Q3D A;  4OGQ B;  2JP3 A;  4HM6 A;  1OW7 A;  3H1K E;  1TU3 F;  1WMK A;  3FGA D;  3AE2 C;  1O7M A;  5AEU A;  2BMR A;  3GTE A;  2XR8 A;  4QDC A;  4Y28 J;  1DD3 A;  4QUQ A;  1JB0 J;  3GLM A;  2NUM A;  1ULJ A;  2A06 E;  1FQT A;  1NYH A;  1KMI Z;  2YFI A;  2J5U A;  3AE9 C;  4H44 B;  1NTM E;  1P84 E;  3Q5P A;  1ZME C;  2D2C B;  2E76 B;  2NWF A;  2JO1 A;  1GMJ A;  2QPZ A;  3D89 A;  3L72 E;  3D6Y A;  4U3F E;  2XSH A;  2E74 B;  1VL2 A;  3VCP A;  1RQU A;  3Q5R A;  1O7H A;  4QCK A;  2MKV A;  2E76 C;  5L8R J;  2D2C C;  4QUR A;  1Y9B A;  1VF5 D;  2ZT9 B;  1ULI A;  4NBE D;  2YFL A;  4NB8 D;  4PV1 B;  2YFJ A;  4I7Z C;  1U57 A;  1UUW A;  5AEW A;  5HL4 A;  3R4Y A;  3GKE A;  1AJY A;  1UIX A;  2FYN C;  3Q5S A;  3C8V A;  1KQG B;  1BCC E;  1PPJ E;  3O6Q A;  3AE8 C;  3AE1 C;  3Q1M A;  2B24 A;  2DE5 D;  2HMN A;  3ABV C;  3VMG D;  3AEC C;  5BOK A;  5KKZ C;  3GTS A;  4IL6 X;  2WSE J;  2IBZ E;  3AEB C;  1O7G A;  2E4P A;  2E75 B;  1VF5 C;  4HM5 A;  3AEG C;  1ZOY C;  4Z1M H;  2WPV B;  4HM1 A;  4HJL A;  4NBD D;  2P10 A;  1SQB E;  4QDD A;  3EQQ A;  3H1L E;  1G8K B;  1FDO A;  4HKV A;  1NDO A;  2HMO A;  3EWK A;  3AE7 C;  2NUK A;  2QJY C;  2HMK A;  2E74 C;  1EG9 A;  2WSF J;  4HM2 A;  2WQY C;  4PV1 C;  2OQQ A;  4H44 C;  2BEZ F;  1EXJ A;  3D70 A;  2DE7 D;  1UUV A;  2GBW A;  3TGU E;  3L70 E;  4PD4 E;  1S5L X;  1L0L E;  1KOR A;  2JO6 A;  5CXM A;  3GZY A;  4HM8 A;  2E4Q A;  1BE3 E;  2D2C D;  1KTM A;  3AZC A;  4NBF D;  4U7J A;  4KT0 J;  3B71 A;  3L73 E;  1EXI A;  1SQP E;  3GL2 A;  1NTK E;  4OGQ D;  1NTZ E;  2GBX A;  1K05 A;  1O7N A;  1RIE A;  2NVG A;  1JM1 A;  2FBW C;  2DE6 D;  3L74 E;  3GZX A;  2I7F A;  4AIV A;  3CX5 E;  1YQ4 C;  1SQQ E;  1DD4 A;  1KYO E;  1PV3 A;  4XFJ A;  3AED C;  2WSC J;  1VF5 B;  3AE5 C;  2IDB A;  1IK7 A;  3C0D A;  1ZP0 C;  4AAY B;  3Q2Y A;  2BMQ A;  4GDO A;  1VCK A;  3VCA A;  3RL0 g;  3AEF C;  1NU1 E;  1K04 A;  3SFE C;  3D6Z A;  2XSO A;  4YTP C;  2B1X A;  4P1C H;  4NBG D;  2HML A;  3AE3 C;  4OGQ C;  2HMM A;  4QUP A;  2H88 C;  4NB9 D;  4NBB D;  1Q90 C;  4R4M A;  4H0L B;  3FOU A;  2XRX A;  3BCC E;  2QIW A;  1OW8 A;  2NVF A;  3GMA A;  2Q3W A;  3H1I E;  3G9R A;  2BMO A;  2NVE A;  1VM9 A;  2JZA A;  3CXH E;  4EMJ B;  2ZT9 C;  2BCC E;  1O7W A;  2YVJ B;  4NBH D;  1DIP A;  3AE4 C;  2HMJ A;  2FXP A;  4H44 D;  5M1B A;  3H25 A;  2E74 D;  4PV1 D;  3SFD C;  3AEA C;  4RKU J;  5KLV E;  1S1C X;  4H13 B;  4H0L C;  3LW5 J;  1YQ3 C;  2V7Q J;  3S9O A;  1PIX A;  4HM7 A;  3T97 B;  2ZT9 D;  5KLI C;  3IAO A;  1WQL A;  1SJG A;  4YXD C;  2E75 D;  3IN6 A;  1MKM A;  4I7Z B;  2G3A A;  2NZ2 A;  4H13 C;  2H89 C;  4QDF B;  2G8Y A;  2QJK C;  3VMI D;  1OW6 A;  3GL0 A;  3GF7 A;  1SQX E;  2QJP C;  4H13 D;  1NYK A;  1NGM B;  1HF9 A;  2ZYL A;  3GB4 A;  3H1H E;  3CWB E;  4HM0 A;  1FDI A;  1OMI A;  3L75 E;  1KB9 E;  2E76 D;  1RQV A;  4TT3 H;  1ZRT E;  3VMH D;  1PP9 E;  2FYU E;  3GF3 A;  4H0L D;  1L0N E;  4NBC D;  3N0Q A;  2CKF A;  2YMK A;  2BEQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...