2E75D

Crystal structure of the cytochrome b6f complex with 2-nonyl-4-hydroxyquinoline n-oxide (nqno) from m.laminosus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
171
structure length
166
Chain Sequence
DVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Structure of the Cytochrome b(6)f Complex: Quinone Analogue Inhibitors as Ligands of Heme c(n)
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 166
sequence length 171
ec nomenclature ec 7.1.1.6: Plastoquinol--plastocyanin reductase.
pdb deposition date 2007-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00355 Rieske Rieske [2Fe-2S] domain
D PF08802 CytB6-F_Fe-S Cytochrome B6-F complex Fe-S subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.700 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2e75D01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2e75D02
2FYNC 2XR8A 3FOUA 1SQXE 3GTEA 4H44D 4H44C 1WQLA 3L75E 4H0LC 3D89A 3GZYA 2ZT9C 3L70E 3H1JE 3N0QA 1EZVE 4H13D 1SJGA 1SQVE 3H1HE 2GBWA 4P1BH 5KLVE 4HM7A 2B1XA 2HMOA 2IBZE 4QCKA 3GCEA 2XSHA 1SQBE 2BMOA 2YMKA 5AEWA 2XSOA 4AIVA 2NWFA 2QJPC 4HM8A 4NB8D 3EN1A 2NVEA 3BCCE 1PPJE 1SQQE 4HM2A 2BMQA 2HMLA 2YVJB 1KB9E 1O7HA 2NUMA 3GL0A 3H1LE 3GL2A 3GB4A 4NBBD 4H0LD 5AEUA 2ZT9D 3H1KE 4NBDD 5KKZC 1UUVA 3VMGD 1Q90C 5HL4A 4HJLA 4QUPA 4NBGD 2DE5D 1NDOA 4NBCD 2D2CD 1KYOE 2D2CC 1O7PA 5KLIC 2XRXA 2B24A 3L73E 3VMID 1BE3E 3GZXA 1NU1E 2JZAA 3DQYA 4HM6A 4OGQD 3VMHD 4OGQC 3CWBE 4PD4E 3TGUE 1FQTA 2JO6A 4PV1D 3GKEA 4PV1C 1UUWA 1L0LE 4NBFD 1PP9E 3L74E 3GOBA 2YFJA 4P1CH 2Q3WA 1BCCE 2CKFA 2E76C 3CXHE 2HMNA 4QDFA 3GTSA 1VCKA 4NBHD 1SQPE 4HKVA 2YFLA 4NBED 4U3FE 4EMJB 1ULIA 2A06E 1RIEA 2HMMA 4HM3A 1VM9A 2BMRA 3VCPA 5CXMA 1O7MA 3VCAA 3L71E 2HMKA 2QJYC 2YIUC 4AAYB 2E4PA 2E75D 2QPZA 2E75C 4HM1A 2NVFA 2QJKC 4HM5A 4NBAD 2DE6D 1JM1A 1G8JB 1G8KB 1ULJA 3EQQA 4HM4A 1ZRTE 4QDDA 3C0DA 1NTME 5BOKA 2E74D 2E74C 3L72E 2GBXA 1O7GA 2E76D 1NYKA 2DE7D 2HMJA 2NUKA 4H13C 2E4QA 3AZCA 2I7FA 4QDFB 3H1IE 2ZYLA 2BCCE 1O7WA 1NTKE 4QURA 1NTZE 4I7ZC 1O7NA 4QDCA 4QUQA 4NB9D 2YFIA 4HM0A 3CX5E 2NVGA 1VF5D 1EG9A 1VF5C 1P84E 2FYUE 1RFSA 1L0NE
chains in the Genus database with same CATH superfamily
3VTPC 3EWKA 3OJAB 4H44C 5APQA 1Q7YQ 3B5NB 2IX7C 3L72J 2QG4A 1SQVK 2H8PD 3BCCD 1A02J 1JMMA 2FXOA 1LTJA 2V4HA 1SQBK 3F89A 4H0LD 5AEUA 1BSNA 2ZT9D 1YTZT 5KKZC 1URQB 3VMGD 5DJUB 1NTZG 5HL4A 3MUDA 1KFNA 3MGNA 1O7PA 4D6TD 1HJ0A 1NU1E 1SQBD 3B71A 2JO6A 1XTGB 5KAFH 3L75G 1EDIA 1EZVG 4QDFA 3CXHD 2A06E 2ITAA 1NOHA 1Y47A 2YKOA 1AVYA 3C0DA 4WB4A 3G4SP 4GIFA 3FWLA 2WMMA 3AE7C 3AE6C 1JM0A 2NUKA 2JDIH 1HVVA 4Y99B 5AW5B 1Q2NA 2BASA 3GMAA 4WY4A 1VQPP 2WSCH 3P7KA 2J58A 1NVOA 3HUSB 3IF4A 2I1KA 3M0DA 2K9YA 3CCMP 3CCQP 3SFDC 3RL0B 1FOSF 1NHLA 3R2PA 1M90Q 2B1XA 3SFEC 1NTMJ 3CWBJ 5BU5A 1LTJC 3C8VA 2O01H 3BCCE 1H0TB 1S3JA 4HM2A 3MUDC 2NUMA 4NBBD 3H1LD 2KS1A 1PGJA 3H1KD 1NTKG 4IOIH 1SFCB 2ZJSE 2IFNA 3V6IA 1KYOD 2FYNB 2A45I 3V4QA 1LTTC 3FXDA 4OGQD 4BWNA 3RK2B 2O1JA 3AE2C 3CXHE 4HKVA 3AE1C 3Q5RA 4OWFA 3GW6A 3E1RA 1IJDB 3AEGC 3L71E 1HH0A 1J1DB 4W80A 1G8KB 5CCHD 5K5GB 1OW6A 3K5BA 2N1TB 3A0BE 3H1JJ 1EDLA 1OVUA 3U59A 2ZYGA 3IR9A 3L73G 1BE3G 4M3LA 2BCCE 5APVA 4C7NB 2P1JA 3G9RA 1YITP 1O7NA 1LGHB 3M0DC 1ZXGA 3TSIA 1UIXA 1JY2P 5AVQB 4H13D 4MN4C 1GL2D 4P1BH 1ZR4A 4HM7A 1DD3A 3KZIE 5CBNA 1L0LJ 1LTGC 1NAFA 3HD7A 1IFJA 2BMQA 1X9VA 3O6QA 2WPQA 3H1LE 2P10A 2RKLA 1M1JA 3H1KE 1HBWA 1E5WA 1KMIZ 1SQQK 4W7ZA 3NMDA 1KYOE 4BRYA 2Y0CA 2PFXA 4IL6E 2JZAA 3VMHD 4OGQC 2Y9YA 4OVNF 3CI9A 2Q9IA 3L74E 1FBMA 1OFCX 2B87B 4XA4A 1SQVG 4NBHD 1NYHA 5GTHH 3T97B 5B66E 2RH0A 1JNMA 4D6TG 3CXHH 1SQPD 2JWDA 2HFED 2IBZG 1NTZJ 4I1LA 1SQBG 3VCAA 3CMEP 2HPCA 5AVTB 2Y0EA 5CCHC 3Q5PA 2ZVNB 3B5ND 1FE6A 3FX0A 3L75J 3A0BH 2GBXA 1JEKA 3V2NA 1BCCD 3ZDMA 2OYHB 1HGZA 1URQD 4R4MA 1URQA 3OA7A 3WU2H 3GTEA 1GK6A 2IZ1A 2YIUB 1GL2C 2KZJA 1EXJA 2HLOA 2WSFJ 5H2FE 3HD7C 2W83C 1SQXK 2G8YA 1IZNB 2CPSA 3VMZA 1FOSE 4DCKA 2WWWA 1M1JC 2HYNA 2OQQA 1W2EA 4EYYQ 1KB9D 4L75A 1SVFA 2WSCJ 1Z56A 3Q1MA 4HJLA 1PGOA 4GDOA 1KYOH 4HM6A 4QMAA 4IL6H 1JY2N 2XDJA 4WY4B 4N78D 5TJHA 3KYQA 5CMZA 4R4LA 3UIAA 1SQPE 3H1IJ 3LIEA 1NTKJ 1HF9A 2O01J 5B66H 2BMRA 1OX3A 2LR2A 3HUSA 5C39A 1OW7A 4HM5A 1MKMA 3B5NC 4YXDC 4Y28J 4IFMA 4JYBA 1ZN5A 1JMBA 1S2EA 3M9HA 1Y8AA 2E5YA 1JUNA 3RGUA 4IL6X 2D2CB 2DE7D 1JY2O 2HMJA 5KLVJ 1EZVI 1PFIA 1N7LA 5AVUB 5KJ7A 1KILB 1H0TA 1URQC 3GHGB 1VPCA 3ITKA 1DEBA 3CL3D 2XR8A 1YJ9P 1BDDA 1BGYG 3RK2D 1SFCA 3AE8C 3WMM0 2JWAA 1RE3A 3L73J 1PIXA 1MV8A 1BE3J 2R5DA 3B4SA 2E74B 2XSHA 5AW0B 1IFDA 5H2FH 1FU1A 2NVEA 3EFGA 2ZVOB 1VQNP 2YKPA 2GA1A 1W2BO 1KB9E 2N1TD 4DOJA 4RO0A 1N7SB 1Q90C 2N1TA 4NPDA 3D71A 2YXRB 3CCUP 1CI6A 2RMZA 3N4XA 4I6MC 4Y99C 1N86A 1FJPA 4HB1A 4B86A 2O3JA 3V2QA 4ZKUA 3JCUH 3HUSC 1VCKA 1NU1K 2KNCA 3H6PA 4EMJB 1ULIA 1VL2A 1GTWA 2W6AA 2M5AB 4DT0A 2R5BA 1FDOA 3P8MC 4GOEA 3M06A 3RL0C 1K8AQ 1ZRTD 2FXMA 1SQPG 3SWYA 1OVVA 1SQVJ 1FDMA 4GT1A 4D6TJ 3TK1A 1SQBJ 1DD4A 3AEEC 1Q86Q 3VP8A 2BEQD 1SFCC 2P2UA 1BCCG 2FYUD 4JPZB 2FYNC 2W27A 3N7NA 1SLQA 3JC22 3RK2C 3AE4C 1NKNA 4K3AA 1LNQA 3ABVC 2GBWA 3SSUA 3GCEA 4GKGA 2BMOA 1H89A 4NB8D 2B87A 1USEA 1J1DC 1R8EA 2YO2A 1KV4A 3O8ZA 3GL0A 2N1TC 1VQ4P 3AE3C 1UUVA 3KXDA 1LTBC 3BATA 4AUWA 4PD4D 1SQXG 1UUWA 1ZMEC 2K88A 1BDCA 1NGMB 2OYHA 2JO1A 3GTSA 1WT6A 4XFJA 1N73B 3PHLA 1T3UA 1H8AA 1G1JA 4UB8E 2QPZA 1T2KC 3FXEA 1YI2P 1ZRTE 3SWKA 4QDDA 3M91A 3A0HE 3H1HJ 1L4AB 2W90A 4NPFX 4RJTA 1LWUA 1ZP0C 1KTMA 3NFQA 4KHXA 1NH4A 3CCEP 2IBZI 4LC1A 3TGUG 4EIJA 3A5TA 3L71D 2I8DA 3PH0A 2IFMA 2QIWA 3CX5E 2P67A 1EG9A 5APSA 2FYUE 1P84D 2OARA 2XNDH 3CXHI 1RE4A 4U3FG 1LTIC 1KFMA 1S5LE 3HE5B 2XKMA 4WY4D 1KD1Q 3Q2YA 4BXLA 3HE4B 5GTIE 3LIDA 2ZXEB 1HWTC 2BCCD 4HM8A 1PPJD 4IFDK 1BGYJ 2XU6A 2OYIB 2QRXA 4W7YA 1IC2A 2YO3A 2D2CD 1Y9BA 1J1EB 2YKQA 1OIPA 2OTLP 1RH5B 1IK7A 2E5TA 1KILD 2ZYDA 2OYHC 4PD4E 4TLFA 3KDPB 1SP4A 5AW2B 1LP1A 1LT1A 1FZFA 1KILA 1KQSO 4UB6E 2WSEH 2K3RA 4C46A 3GHGA 2HMKA 2YIUC 2DE6D 4UB8H 2O1KA 3I56P 2E74D 1AV1A 1R5SA 1M1KQ 3L74D 1VQKP 2KP8A 5APTA 5CJ0A 3A0HH 2E4QA 1KYOI 1NU1G 3PLNA 2AEJA 1O7WA 1SQQJ 1K73Q 1NJIQ 4IFFA 4NB9D 5CCGA 1P84E 4ASVA 1GU5A 1L0NE 1MZ9A 2KZIA 1N7SA 5APXA 2JJLA 3WUUA 1MFZA 1CI6B 2A06G 2QJYB 2FXPA 1WQLA 4WY4C 3F5HA 1AVOA 1X8YA 1KORA 3L35A 2KNCB 5GTIH 5B5EE 1PP9J 1BCCJ 1PPJE 1M8OB 1QX8A 1JO5A 1FZGA 1YHQP 4TT3H 5AW3B 2P7JA 3NXSA 2SPZA 2M5AA 1VQOP 1UIIA 2M3EA 1IFIA 2V7QJ 4QUPA 2DE5D 1NDOA 2D2CC 5AVYB 3HD7D 3FGAD 1NKZB 2Q1KA 2QM7A 1S5LX 1KILE 1KILC 4EOTA 3CWBD 1S72P 3AE5C 1HJBA 4PD4H 2KYVA 3GHGC 2HMNA 3USSA 1RIEA 1EDKA 3VCPA 4LGDE 5AVSB 4JQ0D 4K35A 1QL2A 4HM1A 3BCCG 1KQGB 2KLUA 1SQPK 3EQQA 2IPPA 3GG2A 4AYCA 2Q7CA 1QVGO 2C0XA 4Z1MH 2E74C 1SQXJ 1RF0A 5APUA 1JOCA 5AW8B 1JB0J 1NYKA 3VMYA 4ZKPA 2NPSA 3L36A 5CCGC 2ZYLA 1N7SC 4L74A 2QVAA 1ZR2A 2KK7A 2QA4P 2E76B 3P8CD 2KUBA 1P84H 1RQUA 2UWJE 1YYCA 5APWA 2YNYA 3L71G 1LTSC 3L70D 2JP3A 3H1JD 2H43A 3PP5A 1IFPA 3TGUJ 1QVFO 3AEAC 3EN1A 5B5EH 2J5UA 3KPEA 3H25A 3L37A 3WUTA 3CMAP 1N73A 4U3FJ 4WBAA 3W67A 1AJYA 4KT0J 2IZ0A 2BCCG 4I7ZB 4AQRD 1CW5A 3GLMA 5KLIC 1PPJG 1LWUB 1WRGA 1S9KD 1H88A 3CWBE 1L4AA 2H88C 3WUVA 3KZIH 4H0LB 2ZT9B 1L0LD 5APYA 3CCVP 1FJKA 3E1IA 1Q90D 3CCRP 2FFDB 1G2CB 1RF0C 1LT9B 2C9NY 5E79E 5BOKA 3HE5A 3H1LG 3VOPA 1M7LA 3H1KG 3KQGA 3HE4A 4ZNCA 3VMAA 1U7MA 3AEBC 1PZQA 2ZAEB 1NTZD 4QUQA 3LW5H 3P8CE 2YFIA 2FBWC 3L74G 3RL0D 2WSEJ 2Y0DA 2E43A 1IFNA 2OYIA 2YXQB 2WSSH 3FOUA 5KJ7D 2PP6A 1X0TA 3MP7B 3L70E 3H1JE 2DW3A 3L75D 3A2AA 1EZVD 1ZV8A 1LP1B 2Z5IA 3CCSP 1NU1J 3AEFC 2YMKA 1N73C 3RK3B 3CCLP 2FKWB 1SFCD 1VQ5P 2J59M 1JCCA 3HTKB 5KAIE 2PGDA 4HJGH 1O7HA 5AVWB 3S1KA 2O01N 3GB4A 2MJZA 2BEZF 1OWAA 1L4AC 2OGUA 3CC2P 3TNUA 4L73A 1VF5B 2NZ2A 2OTKE 3CC7P 1GDTA 1OZHA 3GZXA 1S9KE 1L0LE 4NPEA 1GK4A 4P1CH 3BASA 2QE7H 3H32A 1AFOA 1VM9A 1M56D 1PGPA 3W68A 5CXMA 3BRTB 3M0AA 1FZAA 4WVZA 1ULJA 3FWNA 4GODA 1RF1A 2W8ZA 3TF5A 3L4FA 2WVRA 1O7GA 1BSHA 3AZCA 1YIJP 2KI7B 3H1ID 2ZXXA 1NTZE 2OYIC 3BCCJ 2JKVA 1T2KD 5AVXB 2NVGA 1EQ7A 4HH2A 1J1EC 2KLVA 1RY3A 1JY3P 2AXTE 5KJ7C 3L75E 2JR8A 1EZVE 5KLIB 1N8RQ 2FYUK 2L91A 1L2PA 1FZCB 2FYZA 3SWFA 5KLVD 4JBZA 2QSIA 4L76A 1YJWP 3CX5D 4H13B 3L70G 2M8RA 3G3ZA 1RE3C 1RQVA 1CSBA 3L71J 2ZFCA 2AEFA 4N6JA 2GUSA 2B24A 1S4XA 3L73D 1HGVA 2NPSB 3A3YB 3Q5SA 5TISE 4NBFD 1VDFA 3NTNA 2HG5D 1VQ7P 1E79H 1KB9H 1U57A 2BCCJ 4HM3A 2QJPB 1K05A 1OVRA 2QJYC 2MKVA 2NVFA 1S1CX 5AW6B 1DEEG 1OMIA 1A02F 1JCDA 3R4YA 3E7KA 3U1AA 4DJGA 3H1IE 3D70A 1QGKB 1NTKE 1GW4A 4PV1B 2B89A 2KXPB 4PD4I 2GUVA 3VMXA 3CPWO 3H1LJ 1KQLA 3H1KJ 4PJ0E 2E75B 2AXTH 1SQVD 1L0NK 3I55P 5KLVE 2WPRA 1AQ5A 3CD6P 2IBZD 5AVZB 3MHVA 1D7MA 3L74J 4KJMA 1ZLLA 5EFWB 5M1BA 3CCJP 2PAJA 1L0ND 2FFDA 2ZYAA 4JYCA 1G2CA 3LW5J 1LT9A 4ZMDA 3L73E 1BE3E 3RL0g 1N2DC 1JY3N 1P84I 2WSFH 2QEXP 1AA0A 2YFJA 1T8ZA 3TYYA 5TISH 1YJNP 2E76C 1DH3A 2AEMA 5DJTB 1VQ8P 1KQFB 2QJKC 3PTZA 1LJ2A 3RK3D 1JY3O 1FDIA 3L72D 2WPVB 3PRJA 5AW9B 3G6EP 1WMKA 1FZEA 3GF3A 3HTKA 2Q6QA 2WQYC 4QURA 1MFTA 4I7ZC 1QEXA 4QDCA 3B8EB 2W6JH 4HM0A 2Z4EA 1VF5D 3V5BA 3TNUB 4JF7A 1LWUC 4RESB 3H1IG 4H0LC 2ZT9C 1M57D 4EDFA 1SQVE 4PJ0H 3H1HD 5CCGD 4D6TE 2WT7A 2B88A 2IBZE 1SQBE 3H32B 1N7SD 5AW1B 4AIVA 1RE4C 2FFDC 2R44A 2JEEA 1LT9C 1GMJA 3CX5H 1SQPJ 5GTHE 1JTHA 4RKUJ 1RF1B 5KLVG 1KN7A 1SS1A 4OH8B 2LXBA 2K9JA 1S5LH 4NBGD 1EC5A 3TDKA 2XRXA 3VMID 2FYUG 3MTUE 1Q81Q 1NO4A 4H44B 3L70J 2N9YB 5CCHA 1FZBA 2I1JA 3AEDC 2YFLA 1NTMK 2C0WA 2CPBA 4U7JA 1BGYD 1TU3F 1ZW0A 1X22A 2WTYA 3A7OA 1FS0E 1W5CE 1KC8Q 2L5GB 5AVRB 1G8JB 1OW8A 1VQ6P 2H7HA 3GF7A 3RK3E 3WU2E 1NTMD 3RK3C 5KKZB 3L72E 4N3YB 1FZCA 3Q3DA 2AXCA 4A7PA 1QLED 2HR3A 3C1LA 4C7RA 4YXWH 2I7FA 2KB7P 4UB6H 4WWIA 1NWQA 1GZLA 3BRVB 1GL2A 1Q82Q 1VF5C 4HYTB 2XNXA 1MUUA 5BVZA 2NPSD 2HODB 3D89A 2N9BA 3H1HE 1PV3A 3V4WA 4I2LC 1U7JA 3I5CA 3D6ZA 2P58A 2NWFA 1PGQA 2Q3EA 1EXIA 1SQQD 2XZRA 3QWOC 3MD0A 2K1AA 2QJKB 2M0BA 2IDBA 2KOGA 3VN0A 1YTZI 3CLQA 1L0NG 1K9MQ 3II6A 1XTCC 4PV1D 3GKEA 5CBOA 3VYIA 2RN0A 2Q3WA 1PP9D 3CC4P 3B5NA 3IFMA 3RBZA 1LTJB 1AQTA 2POHA 1BGYE 1L0LK 1L4AD 3EFFK 2PRRA 5L8RJ 2E75D 1HUCA 2WITA 1T3JA 1FZCC 3OW2O 1NTME 1OXZA 1VQLP 2VRSA 3JSVC 1DX7A 1G1IA 4H13C 2QM8A 3MZWB 4YPCA 4QDFB 2GM4A 2WPSA 2KSJA 3M9QA 3PJSK 1X79B 3L72G 2A45H 1KB9I 2NPSC 1NTZK 4O9BA 1SQXD 3N0QA 1SJGA 2FY8A 1PL5A 4DZOA 3QH9A 2B9BA 3P32A 2A45G 2HMOA 4QCKA 2KSEA 1DIPA 4XE5B 2XSOA 2QJPC 1SQQE 3JCUE 2HMLA 1IFMA 3H1HG 5CJ4A 3KHUA 3GL2A 2M3BA 2KIKA 3TGUD 1FQTA 4PV1C 1PP9E 3GOBA 1BCCE 2CKFA 4GOFA 4NBED 2HMMA 2CK3H 4U3FD 1O7MA 1EDJA 2E4PA 3M9BA 2E75C 2KS1B 4CPGA 2FYUJ 4NBAD 4HM4A 2Q3IA 5AW4B 1IO4A 2WT7B 1YQ3C 3IN6A 4HKZH 3D6YA 3S9OA 5CHXA 3V2PA 2Y9ZA 2IYPA 3AE9C 2LKMA 3U1CA 2OTJP 1JTHB 1ZOYC 4OGQB 1NTMG 3CWBG 2R32A 2C9LY 2K9JB 5KTBA 1IK9A 1RFSA 1HTLC 5E79H 2Z5HA 1NTKK 1SQXE 1USDA 4H44D 3V2RA 3GZYA 1VQ9P 3HRNA 1FC2C 2H89C 3IAOA 1LTAC 2NRGA 1RHZB 1CZQA 1YBKA 5AEWA 1NTKD 1KZUB 1T6AA 1J2JB 2Q5UA 4N78E 5KLVK 2YVJB 3S4RA 4ASWA 3MIWA 4C7NA 4NBDD 4YTPC 4NBCD 2IYOA 3BVHA 2R3CA 4EI2A 1SQQG 1NAYA 2W6BA 1NU1D 3DQYA 2G3AA 3TGUE 3EQ2A 5KAFE 1R5LA 1QL1A 1FAVA 3H1JG 3VP9A 1GL2B 5KAIH 3HD7B 4U3FE 3G71P 2LXCB 2A06D 3O6QB 3C9IA 4LLHA 4AAYB 1M1JB 1VQMP 2E42A 5AVVB 1JM1A 1L0NJ 1PP9G 3CX5I 2HODA 1BE3D 2R3SA 2V7QH 4BRYB 5AW7B 2YMYA 3RBXA 2E76D 1GD2E 2OYOA 3AECC 1YQ4C 2K37A 1GU4A 1RF1C 1K04A 1GW3A 3OAKA 1L0LG 5BU8B 2WZ7A 2HPCB 3T97A 2XV5A
chains in the Genus database with same CATH topology
2XR8A 1RQUA 3EWKA 4H44C 3AE8C 4H0LC 2ZT9C 2JP3A 1SQVE 1PIXA 2IBZE 2E74B 2XSHA 1SQBE 4AIVA 3AEAC 3EN1A 2NVEA 2J5UA 3H25A 1GMJA 1KB9E 4RKUJ 1AJYA 4KT0J 4H0LD 5AEUA 2ZT9D 5KKZC 4I7ZB 3VMGD 1Q90C 5HL4A 4NBGD 3GLMA 5KLIC 1O7PA 2XRXA 3VMID 3D71A 1HJ0A 1NU1E 3B71A 3CWBE 2H88C 4H44B 2JO6A 4H0LB 2ZT9B 4QDFA 3AEDC 1VCKA 2YFLA 4EMJB 1ULIA 2A06E 1VL2A 4U7JA 1TU3F 1Q90D 1FDOA 1G8JB 1OW8A 3GF7A 3C0DA 5BOKA 3RK3E 3L72E 3AE7C 3AE6C 3Q3DA 2NUKA 1DD4A 3AEEC 2I7FA 3GMAA 3AEBC 2BEQD 4QUQA 2YFIA 2FBWC 1VF5C 2WSEJ 2FYNC 3FOUA 2K9YA 3AE4C 3D89A 3L70E 3H1JE 3H1HE 3SFDC 3ABVC 1PV3A 2GBWA 3AEFC 2B1XA 3GCEA 3SFEC 2BMOA 3D6ZA 2YMKA 3C8VA 2NWFA 4NB8D 3BCCE 1R8EA 4HM2A 1EXIA 1O7HA 2NUMA 3GL0A 3GB4A 4NBBD 3AE3C 1UUVA 2BEZF 1VF5B 2NZ2A 2IDBA 3GZXA 4OGQD 4PV1D 3GKEA 1L0LE 1UUWA 1ZMEC 4P1CH 2Q3WA 3AE2C 3CXHE 1NGMB 3GTSA 2JO1A 4HKVA 3AE1C 4XFJA 3Q5RA 1VM9A 5CXMA 3AEGC 3L71E 5L8RJ 2E75D 2QPZA 1G8KB 1ULJA 1ZRTE 4QDDA 1OW6A 1NTME 1O7GA 4H13C 3AZCA 1ZP0C 1KTMA 4QDFB 2BCCE 3G9RA 1NTZE 1O7NA 2QIWA 3CX5E 2NVGA 1EG9A 2FYUE 1UIXA 3L75E 3N0QA 1EZVE 4H13D 1SJGA 3Q2YA 1PL5A 4P1BH 4HM7A 2HMOA 4QCKA 1DIPA 1DD3A 2XSOA 2QSIA 2QJPC 4HM8A 1SQQE 4H13B 2BMQA 2HMLA 1RQVA 3O6QA 3H1LE 3GL2A 2P10A 3H1KE 1KMIZ 2D2CD 1KYOE 1Y9BA 2B24A 1IK7A 2JZAA 3VMHD 4OGQC 4PD4E 1FQTA 3Q5SA 4PV1C 4NBFD 1PP9E 3L74E 3GOBA 1BCCE 2CKFA 4NBHD 1NYHA 3T97B 4NBED 1U57A 2HMMA 4HM3A 1K05A 1O7MA 3VCAA 2HMKA 2QJYC 2YIUC 2E4PA 2E75C 2MKVA 2NVFA 1S1CX 4NBAD 2DE6D 4HM4A 3Q5PA 2E74D 1YQ3C 1OMIA 3IN6A 3D6YA 3S9OA 3R4YA 2GBXA 3AE9C 2E4QA 3D70A 3H1IE 1ZOYC 4OGQB 1O7WA 1NTKE 4PV1B 4R4MA 4NB9D 1P84E 1RFSA 1L0NE 1SQXE 3GTEA 4H44D 1WQLA 2FXPA 3GZYA 2E75B 1EXJA 5KLVE 2H89C 2WSFJ 3IAOA 1KORA 2G8YA 5AEWA 5M1BA 1PPJE 2OQQA 2YVJB 4TT3H 2WSCJ 3LW5J 4NBDD 4YTPC 2V7QJ 3Q1MA 4HJLA 4QUPA 2DE5D 1NDOA 4NBCD 2D2CC 3FGAD 3L73E 3RL0g 1BE3E 4GDOA 1S5LX 1KILE 3DQYA 4HM6A 2G3AA 3TGUE 3AE5C 2YFJA 2E76C 4R4LA 2HMNA 1SQPE 4U3FE 1RIEA 1HF9A 2O01J 2BMRA 3VCPA 1KQFB 4AAYB 1OW7A 4HM1A 2QJKC 4HM5A 1KQGB 1JM1A 3EQQA 1MKMA 4YXDC 4Y28J 4Z1MH 2E74C 1FDIA 1JB0J 2WPVB 2E76D 4IL6X 2D2CB 1NYKA 2DE7D 2HMJA 3AECC 1YQ4C 1WMKA 3GF3A 2ZYLA 2WQYC 4QURA 1K04A 4I7ZC 4QDCA 4HM0A 2E76B 1VF5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYN C;  2XR8 A;  3FOU A;  1SQX E;  3GTE A;  4H44 D;  4H44 C;  1WQL A;  3L75 E;  4H0L C;  3D89 A;  3GZY A;  2ZT9 C;  3L70 E;  3H1J E;  3N0Q A;  1EZV E;  4H13 D;  1SJG A;  1SQV E;  3H1H E;  2GBW A;  4P1B H;  5KLV E;  4HM7 A;  2B1X A;  2HMO A;  2IBZ E;  4QCK A;  3GCE A;  2XSH A;  1SQB E;  2BMO A;  2YMK A;  5AEW A;  2XSO A;  4AIV A;  2NWF A;  2QJP C;  4HM8 A;  4NB8 D;  3EN1 A;  2NVE A;  3BCC E;  1PPJ E;  1SQQ E;  4HM2 A;  2BMQ A;  2HML A;  2YVJ B;  1KB9 E;  1O7H A;  2NUM A;  3GL0 A;  3H1L E;  3GL2 A;  3GB4 A;  4NBB D;  4H0L D;  5AEU A;  2ZT9 D;  3H1K E;  4NBD D;  5KKZ C;  1UUV A;  3VMG D;  1Q90 C;  5HL4 A;  4HJL A;  4QUP A;  4NBG D;  2DE5 D;  1NDO A;  4NBC D;  2D2C D;  1KYO E;  2D2C C;  1O7P A;  5KLI C;  2XRX A;  2B24 A;  3L73 E;  3VMI D;  1BE3 E;  3GZX A;  1NU1 E;  2JZA A;  3DQY A;  4HM6 A;  4OGQ D;  3VMH D;  4OGQ C;  3CWB E;  4PD4 E;  3TGU E;  1FQT A;  2JO6 A;  4PV1 D;  3GKE A;  4PV1 C;  1UUW A;  1L0L E;  4NBF D;  1PP9 E;  3L74 E;  3GOB A;  2YFJ A;  4P1C H;  2Q3W A;  1BCC E;  2CKF A;  2E76 C;  3CXH E;  2HMN A;  4QDF A;  3GTS A;  1VCK A;  4NBH D;  1SQP E;  4HKV A;  2YFL A;  4NBE D;  4U3F E;  4EMJ B;  1ULI A;  2A06 E;  1RIE A;  2HMM A;  4HM3 A;  1VM9 A;  2BMR A;  3VCP A;  5CXM A;  1O7M A;  3VCA A;  3L71 E;  2HMK A;  2QJY C;  2YIU C;  4AAY B;  2E4P A;  2E75 D;  2QPZ A;  2E75 C;  4HM1 A;  2NVF A;  2QJK C;  4HM5 A;  4NBA D;  2DE6 D;  1JM1 A;  1G8J B;  1G8K B;  1ULJ A;  3EQQ A;  4HM4 A;  1ZRT E;  4QDD A;  3C0D A;  1NTM E;  5BOK A;  2E74 D;  2E74 C;  3L72 E;  2GBX A;  1O7G A;  2E76 D;  1NYK A;  2DE7 D;  2HMJ A;  2NUK A;  4H13 C;  2E4Q A;  3AZC A;  2I7F A;  4QDF B;  3H1I E;  2ZYL A;  2BCC E;  1O7W A;  1NTK E;  4QUR A;  1NTZ E;  4I7Z C;  1O7N A;  4QDC A;  4QUQ A;  4NB9 D;  2YFI A;  4HM0 A;  3CX5 E;  2NVG A;  1VF5 D;  1EG9 A;  1VF5 C;  1P84 E;  2FYU E;  1RFS A;  1L0N E; 
#chains in the Genus database with same CATH topology
 3VTP C;  3EWK A;  3OJA B;  4H44 C;  5APQ A;  1Q7Y Q;  3B5N B;  2IX7 C;  3L72 J;  2QG4 A;  1SQV K;  2H8P D;  3BCC D;  1A02 J;  1JMM A;  2FXO A;  1LTJ A;  2V4H A;  1SQB K;  3F89 A;  4H0L D;  5AEU A;  1BSN A;  2ZT9 D;  1YTZ T;  5KKZ C;  1URQ B;  3VMG D;  5DJU B;  1NTZ G;  5HL4 A;  3MUD A;  1KFN A;  3MGN A;  1O7P A;  4D6T D;  1HJ0 A;  1NU1 E;  1SQB D;  3B71 A;  2JO6 A;  1XTG B;  5KAF H;  3L75 G;  1EDI A;  1EZV G;  4QDF A;  3CXH D;  2A06 E;  2ITA A;  1NOH A;  1Y47 A;  2YKO A;  1AVY A;  3C0D A;  4WB4 A;  3G4S P;  4GIF A;  3FWL A;  2WMM A;  3AE7 C;  3AE6 C;  1JM0 A;  2NUK A;  2JDI H;  1HVV A;  4Y99 B;  5AW5 B;  1Q2N A;  2BAS A;  3GMA A;  4WY4 A;  1VQP P;  2WSC H;  3P7K A;  2J58 A;  1NVO A;  3HUS B;  3IF4 A;  2I1K A;  3M0D A;  2K9Y A;  3CCM P;  3CCQ P;  3SFD C;  3RL0 B;  1FOS F;  1NHL A;  3R2P A;  1M90 Q;  2B1X A;  3SFE C;  1NTM J;  3CWB J;  5BU5 A;  1LTJ C;  3C8V A;  2O01 H;  3BCC E;  1H0T B;  1S3J A;  4HM2 A;  3MUD C;  2NUM A;  4NBB D;  3H1L D;  2KS1 A;  1PGJ A;  3H1K D;  1NTK G;  4IOI H;  1SFC B;  2ZJS E;  2IFN A;  3V6I A;  1KYO D;  2FYN B;  2A45 I;  3V4Q A;  1LTT C;  3FXD A;  4OGQ D;  4BWN A;  3RK2 B;  2O1J A;  3AE2 C;  3CXH E;  4HKV A;  3AE1 C;  3Q5R A;  4OWF A;  3GW6 A;  3E1R A;  1IJD B;  3AEG C;  3L71 E;  1HH0 A;  1J1D B;  4W80 A;  1G8K B;  5CCH D;  5K5G B;  1OW6 A;  3K5B A;  2N1T B;  3A0B E;  3H1J J;  1EDL A;  1OVU A;  3U59 A;  2ZYG A;  3IR9 A;  3L73 G;  1BE3 G;  4M3L A;  2BCC E;  5APV A;  4C7N B;  2P1J A;  3G9R A;  1YIT P;  1O7N A;  1LGH B;  3M0D C;  1ZXG A;  3TSI A;  1UIX A;  1JY2 P;  5AVQ B;  4H13 D;  4MN4 C;  1GL2 D;  4P1B H;  1ZR4 A;  4HM7 A;  1DD3 A;  3KZI E;  5CBN A;  1L0L J;  1LTG C;  1NAF A;  3HD7 A;  1IFJ A;  2BMQ A;  1X9V A;  3O6Q A;  2WPQ A;  3H1L E;  2P10 A;  2RKL A;  1M1J A;  3H1K E;  1HBW A;  1E5W A;  1KMI Z;  1SQQ K;  4W7Z A;  3NMD A;  1KYO E;  4BRY A;  2Y0C A;  2PFX A;  4IL6 E;  2JZA A;  3VMH D;  4OGQ C;  2Y9Y A;  4OVN F;  3CI9 A;  2Q9I A;  3L74 E;  1FBM A;  1OFC X;  2B87 B;  4XA4 A;  1SQV G;  4NBH D;  1NYH A;  5GTH H;  3T97 B;  5B66 E;  2RH0 A;  1JNM A;  4D6T G;  3CXH H;  1SQP D;  2JWD A;  2HFE D;  2IBZ G;  1NTZ J;  4I1L A;  1SQB G;  3VCA A;  3CME P;  2HPC A;  5AVT B;  2Y0E A;  5CCH C;  3Q5P A;  2ZVN B;  3B5N D;  1FE6 A;  3FX0 A;  3L75 J;  3A0B H;  2GBX A;  1JEK A;  3V2N A;  1BCC D;  3ZDM A;  2OYH B;  1HGZ A;  1URQ D;  4R4M A;  1URQ A;  3OA7 A;  3WU2 H;  3GTE A;  1GK6 A;  2IZ1 A;  2YIU B;  1GL2 C;  2KZJ A;  1EXJ A;  2HLO A;  2WSF J;  5H2F E;  3HD7 C;  2W83 C;  1SQX K;  2G8Y A;  1IZN B;  2CPS A;  3VMZ A;  1FOS E;  4DCK A;  2WWW A;  1M1J C;  2HYN A;  2OQQ A;  1W2E A;  4EYY Q;  1KB9 D;  4L75 A;  1SVF A;  2WSC J;  1Z56 A;  3Q1M A;  4HJL A;  1PGO A;  4GDO A;  1KYO H;  4HM6 A;  4QMA A;  4IL6 H;  1JY2 N;  2XDJ A;  4WY4 B;  4N78 D;  5TJH A;  3KYQ A;  5CMZ A;  4R4L A;  3UIA A;  1SQP E;  3H1I J;  3LIE A;  1NTK J;  1HF9 A;  2O01 J;  5B66 H;  2BMR A;  1OX3 A;  2LR2 A;  3HUS A;  5C39 A;  1OW7 A;  4HM5 A;  1MKM A;  3B5N C;  4YXD C;  4Y28 J;  4IFM A;  4JYB A;  1ZN5 A;  1JMB A;  1S2E A;  3M9H A;  1Y8A A;  2E5Y A;  1JUN A;  3RGU A;  4IL6 X;  2D2C B;  2DE7 D;  1JY2 O;  2HMJ A;  5KLV J;  1EZV I;  1PFI A;  1N7L A;  5AVU B;  5KJ7 A;  1KIL B;  1H0T A;  1URQ C;  3GHG B;  1VPC A;  3ITK A;  1DEB A;  3CL3 D;  2XR8 A;  1YJ9 P;  1BDD A;  1BGY G;  3RK2 D;  1SFC A;  3AE8 C;  3WMM 0;  2JWA A;  1RE3 A;  3L73 J;  1PIX A;  1MV8 A;  1BE3 J;  2R5D A;  3B4S A;  2E74 B;  2XSH A;  5AW0 B;  1IFD A;  5H2F H;  1FU1 A;  2NVE A;  3EFG A;  2ZVO B;  1VQN P;  2YKP A;  2GA1 A;  1W2B O;  1KB9 E;  2N1T D;  4DOJ A;  4RO0 A;  1N7S B;  1Q90 C;  2N1T A;  4NPD A;  3D71 A;  2YXR B;  3CCU P;  1CI6 A;  2RMZ A;  3N4X A;  4I6M C;  4Y99 C;  1N86 A;  1FJP A;  4HB1 A;  4B86 A;  2O3J A;  3V2Q A;  4ZKU A;  3JCU H;  3HUS C;  1VCK A;  1NU1 K;  2KNC A;  3H6P A;  4EMJ B;  1ULI A;  1VL2 A;  1GTW A;  2W6A A;  2M5A B;  4DT0 A;  2R5B A;  1FDO A;  3P8M C;  4GOE A;  3M06 A;  3RL0 C;  1K8A Q;  1ZRT D;  2FXM A;  1SQP G;  3SWY A;  1OVV A;  1SQV J;  1FDM A;  4GT1 A;  4D6T J;  3TK1 A;  1SQB J;  1DD4 A;  3AEE C;  1Q86 Q;  3VP8 A;  2BEQ D;  1SFC C;  2P2U A;  1BCC G;  2FYU D;  4JPZ B;  2FYN C;  2W27 A;  3N7N A;  1SLQ A;  3JC2 2;  3RK2 C;  3AE4 C;  1NKN A;  4K3A A;  1LNQ A;  3ABV C;  2GBW A;  3SSU A;  3GCE A;  4GKG A;  2BMO A;  1H89 A;  4NB8 D;  2B87 A;  1USE A;  1J1D C;  1R8E A;  2YO2 A;  1KV4 A;  3O8Z A;  3GL0 A;  2N1T C;  1VQ4 P;  3AE3 C;  1UUV A;  3KXD A;  1LTB C;  3BAT A;  4AUW A;  4PD4 D;  1SQX G;  1UUW A;  1ZME C;  2K88 A;  1BDC A;  1NGM B;  2OYH A;  2JO1 A;  3GTS A;  1WT6 A;  4XFJ A;  1N73 B;  3PHL A;  1T3U A;  1H8A A;  1G1J A;  4UB8 E;  2QPZ A;  1T2K C;  3FXE A;  1YI2 P;  1ZRT E;  3SWK A;  4QDD A;  3M91 A;  3A0H E;  3H1H J;  1L4A B;  2W90 A;  4NPF X;  4RJT A;  1LWU A;  1ZP0 C;  1KTM A;  3NFQ A;  4KHX A;  1NH4 A;  3CCE P;  2IBZ I;  4LC1 A;  3TGU G;  4EIJ A;  3A5T A;  3L71 D;  2I8D A;  3PH0 A;  2IFM A;  2QIW A;  3CX5 E;  2P67 A;  1EG9 A;  5APS A;  2FYU E;  1P84 D;  2OAR A;  2XND H;  3CXH I;  1RE4 A;  4U3F G;  1LTI C;  1KFM A;  1S5L E;  3HE5 B;  2XKM A;  4WY4 D;  1KD1 Q;  3Q2Y A;  4BXL A;  3HE4 B;  5GTI E;  3LID A;  2ZXE B;  1HWT C;  2BCC D;  4HM8 A;  1PPJ D;  4IFD K;  1BGY J;  2XU6 A;  2OYI B;  2QRX A;  4W7Y A;  1IC2 A;  2YO3 A;  2D2C D;  1Y9B A;  1J1E B;  2YKQ A;  1OIP A;  2OTL P;  1RH5 B;  1IK7 A;  2E5T A;  1KIL D;  2ZYD A;  2OYH C;  4PD4 E;  4TLF A;  3KDP B;  1SP4 A;  5AW2 B;  1LP1 A;  1LT1 A;  1FZF A;  1KIL A;  1KQS O;  4UB6 E;  2WSE H;  2K3R A;  4C46 A;  3GHG A;  2HMK A;  2YIU C;  2DE6 D;  4UB8 H;  2O1K A;  3I56 P;  2E74 D;  1AV1 A;  1R5S A;  1M1K Q;  3L74 D;  1VQK P;  2KP8 A;  5APT A;  5CJ0 A;  3A0H H;  2E4Q A;  1KYO I;  1NU1 G;  3PLN A;  2AEJ A;  1O7W A;  1SQQ J;  1K73 Q;  1NJI Q;  4IFF A;  4NB9 D;  5CCG A;  1P84 E;  4ASV A;  1GU5 A;  1L0N E;  1MZ9 A;  2KZI A;  1N7S A;  5APX A;  2JJL A;  3WUU A;  1MFZ A;  1CI6 B;  2A06 G;  2QJY B;  2FXP A;  1WQL A;  4WY4 C;  3F5H A;  1AVO A;  1X8Y A;  1KOR A;  3L35 A;  2KNC B;  5GTI H;  5B5E E;  1PP9 J;  1BCC J;  1PPJ E;  1M8O B;  1QX8 A;  1JO5 A;  1FZG A;  1YHQ P;  4TT3 H;  5AW3 B;  2P7J A;  3NXS A;  2SPZ A;  2M5A A;  1VQO P;  1UII A;  2M3E A;  1IFI A;  2V7Q J;  4QUP A;  2DE5 D;  1NDO A;  2D2C C;  5AVY B;  3HD7 D;  3FGA D;  1NKZ B;  2Q1K A;  2QM7 A;  1S5L X;  1KIL E;  1KIL C;  4EOT A;  3CWB D;  1S72 P;  3AE5 C;  1HJB A;  4PD4 H;  2KYV A;  3GHG C;  2HMN A;  3USS A;  1RIE A;  1EDK A;  3VCP A;  4LGD E;  5AVS B;  4JQ0 D;  4K35 A;  1QL2 A;  4HM1 A;  3BCC G;  1KQG B;  2KLU A;  1SQP K;  3EQQ A;  2IPP A;  3GG2 A;  4AYC A;  2Q7C A;  1QVG O;  2C0X A;  4Z1M H;  2E74 C;  1SQX J;  1RF0 A;  5APU A;  1JOC A;  5AW8 B;  1JB0 J;  1NYK A;  3VMY A;  4ZKP A;  2NPS A;  3L36 A;  5CCG C;  2ZYL A;  1N7S C;  4L74 A;  2QVA A;  1ZR2 A;  2KK7 A;  2QA4 P;  2E76 B;  3P8C D;  2KUB A;  1P84 H;  1RQU A;  2UWJ E;  1YYC A;  5APW A;  2YNY A;  3L71 G;  1LTS C;  3L70 D;  2JP3 A;  3H1J D;  2H43 A;  3PP5 A;  1IFP A;  3TGU J;  1QVF O;  3AEA C;  3EN1 A;  5B5E H;  2J5U A;  3KPE A;  3H25 A;  3L37 A;  3WUT A;  3CMA P;  1N73 A;  4U3F J;  4WBA A;  3W67 A;  1AJY A;  4KT0 J;  2IZ0 A;  2BCC G;  4I7Z B;  4AQR D;  1CW5 A;  3GLM A;  5KLI C;  1PPJ G;  1LWU B;  1WRG A;  1S9K D;  1H88 A;  3CWB E;  1L4A A;  2H88 C;  3WUV A;  3KZI H;  4H0L B;  2ZT9 B;  1L0L D;  5APY A;  3CCV P;  1FJK A;  3E1I A;  1Q90 D;  3CCR P;  2FFD B;  1G2C B;  1RF0 C;  1LT9 B;  2C9N Y;  5E79 E;  5BOK A;  3HE5 A;  3H1L G;  3VOP A;  1M7L A;  3H1K G;  3KQG A;  3HE4 A;  4ZNC A;  3VMA A;  1U7M A;  3AEB C;  1PZQ A;  2ZAE B;  1NTZ D;  4QUQ A;  3LW5 H;  3P8C E;  2YFI A;  2FBW C;  3L74 G;  3RL0 D;  2WSE J;  2Y0D A;  2E43 A;  1IFN A;  2OYI A;  2YXQ B;  2WSS H;  3FOU A;  5KJ7 D;  2PP6 A;  1X0T A;  3MP7 B;  3L70 E;  3H1J E;  2DW3 A;  3L75 D;  3A2A A;  1EZV D;  1ZV8 A;  1LP1 B;  2Z5I A;  3CCS P;  1NU1 J;  3AEF C;  2YMK A;  1N73 C;  3RK3 B;  3CCL P;  2FKW B;  1SFC D;  1VQ5 P;  2J59 M;  1JCC A;  3HTK B;  5KAI E;  2PGD A;  4HJG H;  1O7H A;  5AVW B;  3S1K A;  2O01 N;  3GB4 A;  2MJZ A;  2BEZ F;  1OWA A;  1L4A C;  2OGU A;  3CC2 P;  3TNU A;  4L73 A;  1VF5 B;  2NZ2 A;  2OTK E;  3CC7 P;  1GDT A;  1OZH A;  3GZX A;  1S9K E;  1L0L E;  4NPE A;  1GK4 A;  4P1C H;  3BAS A;  2QE7 H;  3H32 A;  1AFO A;  1VM9 A;  1M56 D;  1PGP A;  3W68 A;  5CXM A;  3BRT B;  3M0A A;  1FZA A;  4WVZ A;  1ULJ A;  3FWN A;  4GOD A;  1RF1 A;  2W8Z A;  3TF5 A;  3L4F A;  2WVR A;  1O7G A;  1BSH A;  3AZC A;  1YIJ P;  2KI7 B;  3H1I D;  2ZXX A;  1NTZ E;  2OYI C;  3BCC J;  2JKV A;  1T2K D;  5AVX B;  2NVG A;  1EQ7 A;  4HH2 A;  1J1E C;  2KLV A;  1RY3 A;  1JY3 P;  2AXT E;  5KJ7 C;  3L75 E;  2JR8 A;  1EZV E;  5KLI B;  1N8R Q;  2FYU K;  2L91 A;  1L2P A;  1FZC B;  2FYZ A;  3SWF A;  5KLV D;  4JBZ A;  2QSI A;  4L76 A;  1YJW P;  3CX5 D;  4H13 B;  3L70 G;  2M8R A;  3G3Z A;  1RE3 C;  1RQV A;  1CSB A;  3L71 J;  2ZFC A;  2AEF A;  4N6J A;  2GUS A;  2B24 A;  1S4X A;  3L73 D;  1HGV A;  2NPS B;  3A3Y B;  3Q5S A;  5TIS E;  4NBF D;  1VDF A;  3NTN A;  2HG5 D;  1VQ7 P;  1E79 H;  1KB9 H;  1U57 A;  2BCC J;  4HM3 A;  2QJP B;  1K05 A;  1OVR A;  2QJY C;  2MKV A;  2NVF A;  1S1C X;  5AW6 B;  1DEE G;  1OMI A;  1A02 F;  1JCD A;  3R4Y A;  3E7K A;  3U1A A;  4DJG A;  3H1I E;  3D70 A;  1QGK B;  1NTK E;  1GW4 A;  4PV1 B;  2B89 A;  2KXP B;  4PD4 I;  2GUV A;  3VMX A;  3CPW O;  3H1L J;  1KQL A;  3H1K J;  4PJ0 E;  2E75 B;  2AXT H;  1SQV D;  1L0N K;  3I55 P;  5KLV E;  2WPR A;  1AQ5 A;  3CD6 P;  2IBZ D;  5AVZ B;  3MHV A;  1D7M A;  3L74 J;  4KJM A;  1ZLL A;  5EFW B;  5M1B A;  3CCJ P;  2PAJ A;  1L0N D;  2FFD A;  2ZYA A;  4JYC A;  1G2C A;  3LW5 J;  1LT9 A;  4ZMD A;  3L73 E;  1BE3 E;  3RL0 g;  1N2D C;  1JY3 N;  1P84 I;  2WSF H;  2QEX P;  1AA0 A;  2YFJ A;  1T8Z A;  3TYY A;  5TIS H;  1YJN P;  2E76 C;  1DH3 A;  2AEM A;  5DJT B;  1VQ8 P;  1KQF B;  2QJK C;  3PTZ A;  1LJ2 A;  3RK3 D;  1JY3 O;  1FDI A;  3L72 D;  2WPV B;  3PRJ A;  5AW9 B;  3G6E P;  1WMK A;  1FZE A;  3GF3 A;  3HTK A;  2Q6Q A;  2WQY C;  4QUR A;  1MFT A;  4I7Z C;  1QEX A;  4QDC A;  3B8E B;  2W6J H;  4HM0 A;  2Z4E A;  1VF5 D;  3V5B A;  3TNU B;  4JF7 A;  1LWU C;  4RES B;  3H1I G;  4H0L C;  2ZT9 C;  1M57 D;  4EDF A;  1SQV E;  4PJ0 H;  3H1H D;  5CCG D;  4D6T E;  2WT7 A;  2B88 A;  2IBZ E;  1SQB E;  3H32 B;  1N7S D;  5AW1 B;  4AIV A;  1RE4 C;  2FFD C;  2R44 A;  2JEE A;  1LT9 C;  1GMJ A;  3CX5 H;  1SQP J;  5GTH E;  1JTH A;  4RKU J;  1RF1 B;  5KLV G;  1KN7 A;  1SS1 A;  4OH8 B;  2LXB A;  2K9J A;  1S5L H;  4NBG D;  1EC5 A;  3TDK A;  2XRX A;  3VMI D;  2FYU G;  3MTU E;  1Q81 Q;  1NO4 A;  4H44 B;  3L70 J;  2N9Y B;  5CCH A;  1FZB A;  2I1J A;  3AED C;  2YFL A;  1NTM K;  2C0W A;  2CPB A;  4U7J A;  1BGY D;  1TU3 F;  1ZW0 A;  1X22 A;  2WTY A;  3A7O A;  1FS0 E;  1W5C E;  1KC8 Q;  2L5G B;  5AVR B;  1G8J B;  1OW8 A;  1VQ6 P;  2H7H A;  3GF7 A;  3RK3 E;  3WU2 E;  1NTM D;  3RK3 C;  5KKZ B;  3L72 E;  4N3Y B;  1FZC A;  3Q3D A;  2AXC A;  4A7P A;  1QLE D;  2HR3 A;  3C1L A;  4C7R A;  4YXW H;  2I7F A;  2KB7 P;  4UB6 H;  4WWI A;  1NWQ A;  1GZL A;  3BRV B;  1GL2 A;  1Q82 Q;  1VF5 C;  4HYT B;  2XNX A;  1MUU A;  5BVZ A;  2NPS D;  2HOD B;  3D89 A;  2N9B A;  3H1H E;  1PV3 A;  3V4W A;  4I2L C;  1U7J A;  3I5C A;  3D6Z A;  2P58 A;  2NWF A;  1PGQ A;  2Q3E A;  1EXI A;  1SQQ D;  2XZR A;  3QWO C;  3MD0 A;  2K1A A;  2QJK B;  2M0B A;  2IDB A;  2KOG A;  3VN0 A;  1YTZ I;  3CLQ A;  1L0N G;  1K9M Q;  3II6 A;  1XTC C;  4PV1 D;  3GKE A;  5CBO A;  3VYI A;  2RN0 A;  2Q3W A;  1PP9 D;  3CC4 P;  3B5N A;  3IFM A;  3RBZ A;  1LTJ B;  1AQT A;  2POH A;  1BGY E;  1L0L K;  1L4A D;  3EFF K;  2PRR A;  5L8R J;  2E75 D;  1HUC A;  2WIT A;  1T3J A;  1FZC C;  3OW2 O;  1NTM E;  1OXZ A;  1VQL P;  2VRS A;  3JSV C;  1DX7 A;  1G1I A;  4H13 C;  2QM8 A;  3MZW B;  4YPC A;  4QDF B;  2GM4 A;  2WPS A;  2KSJ A;  3M9Q A;  3PJS K;  1X79 B;  3L72 G;  2A45 H;  1KB9 I;  2NPS C;  1NTZ K;  4O9B A;  1SQX D;  3N0Q A;  1SJG A;  2FY8 A;  1PL5 A;  4DZO A;  3QH9 A;  2B9B A;  3P32 A;  2A45 G;  2HMO A;  4QCK A;  2KSE A;  1DIP A;  4XE5 B;  2XSO A;  2QJP C;  1SQQ E;  3JCU E;  2HML A;  1IFM A;  3H1H G;  5CJ4 A;  3KHU A;  3GL2 A;  2M3B A;  2KIK A;  3TGU D;  1FQT A;  4PV1 C;  1PP9 E;  3GOB A;  1BCC E;  2CKF A;  4GOF A;  4NBE D;  2HMM A;  2CK3 H;  4U3F D;  1O7M A;  1EDJ A;  2E4P A;  3M9B A;  2E75 C;  2KS1 B;  4CPG A;  2FYU J;  4NBA D;  4HM4 A;  2Q3I A;  5AW4 B;  1IO4 A;  2WT7 B;  1YQ3 C;  3IN6 A;  4HKZ H;  3D6Y A;  3S9O A;  5CHX A;  3V2P A;  2Y9Z A;  2IYP A;  3AE9 C;  2LKM A;  3U1C A;  2OTJ P;  1JTH B;  1ZOY C;  4OGQ B;  1NTM G;  3CWB G;  2R32 A;  2C9L Y;  2K9J B;  5KTB A;  1IK9 A;  1RFS A;  1HTL C;  5E79 H;  2Z5H A;  1NTK K;  1SQX E;  1USD A;  4H44 D;  3V2R A;  3GZY A;  1VQ9 P;  3HRN A;  1FC2 C;  2H89 C;  3IAO A;  1LTA C;  2NRG A;  1RHZ B;  1CZQ A;  1YBK A;  5AEW A;  1NTK D;  1KZU B;  1T6A A;  1J2J B;  2Q5U A;  4N78 E;  5KLV K;  2YVJ B;  3S4R A;  4ASW A;  3MIW A;  4C7N A;  4NBD D;  4YTP C;  4NBC D;  2IYO A;  3BVH A;  2R3C A;  4EI2 A;  1SQQ G;  1NAY A;  2W6B A;  1NU1 D;  3DQY A;  2G3A A;  3TGU E;  3EQ2 A;  5KAF E;  1R5L A;  1QL1 A;  1FAV A;  3H1J G;  3VP9 A;  1GL2 B;  5KAI H;  3HD7 B;  4U3F E;  3G71 P;  2LXC B;  2A06 D;  3O6Q B;  3C9I A;  4LLH A;  4AAY B;  1M1J B;  1VQM P;  2E42 A;  5AVV B;  1JM1 A;  1L0N J;  1PP9 G;  3CX5 I;  2HOD A;  1BE3 D;  2R3S A;  2V7Q H;  4BRY B;  5AW7 B;  2YMY A;  3RBX A;  2E76 D;  1GD2 E;  2OYO A;  3AEC C;  1YQ4 C;  2K37 A;  1GU4 A;  1RF1 C;  1K04 A;  1GW3 A;  3OAK A;  1L0L G;  5BU8 B;  2WZ7 A;  2HPC B;  3T97 A;  2XV5 A; 
#chains in the Genus database with same CATH homology
 2XR8 A;  1RQU A;  3EWK A;  4H44 C;  3AE8 C;  4H0L C;  2ZT9 C;  2JP3 A;  1SQV E;  1PIX A;  2IBZ E;  2E74 B;  2XSH A;  1SQB E;  4AIV A;  3AEA C;  3EN1 A;  2NVE A;  2J5U A;  3H25 A;  1GMJ A;  1KB9 E;  4RKU J;  1AJY A;  4KT0 J;  4H0L D;  5AEU A;  2ZT9 D;  5KKZ C;  4I7Z B;  3VMG D;  1Q90 C;  5HL4 A;  4NBG D;  3GLM A;  5KLI C;  1O7P A;  2XRX A;  3VMI D;  3D71 A;  1HJ0 A;  1NU1 E;  3B71 A;  3CWB E;  2H88 C;  4H44 B;  2JO6 A;  4H0L B;  2ZT9 B;  4QDF A;  3AED C;  1VCK A;  2YFL A;  4EMJ B;  1ULI A;  2A06 E;  1VL2 A;  4U7J A;  1TU3 F;  1Q90 D;  1FDO A;  1G8J B;  1OW8 A;  3GF7 A;  3C0D A;  5BOK A;  3RK3 E;  3L72 E;  3AE7 C;  3AE6 C;  3Q3D A;  2NUK A;  1DD4 A;  3AEE C;  2I7F A;  3GMA A;  3AEB C;  2BEQ D;  4QUQ A;  2YFI A;  2FBW C;  1VF5 C;  2WSE J;  2FYN C;  3FOU A;  2K9Y A;  3AE4 C;  3D89 A;  3L70 E;  3H1J E;  3H1H E;  3SFD C;  3ABV C;  1PV3 A;  2GBW A;  3AEF C;  2B1X A;  3GCE A;  3SFE C;  2BMO A;  3D6Z A;  2YMK A;  3C8V A;  2NWF A;  4NB8 D;  3BCC E;  1R8E A;  4HM2 A;  1EXI A;  1O7H A;  2NUM A;  3GL0 A;  3GB4 A;  4NBB D;  3AE3 C;  1UUV A;  2BEZ F;  1VF5 B;  2NZ2 A;  2IDB A;  3GZX A;  4OGQ D;  4PV1 D;  3GKE A;  1L0L E;  1UUW A;  1ZME C;  4P1C H;  2Q3W A;  3AE2 C;  3CXH E;  1NGM B;  3GTS A;  2JO1 A;  4HKV A;  3AE1 C;  4XFJ A;  3Q5R A;  1VM9 A;  5CXM A;  3AEG C;  3L71 E;  5L8R J;  2E75 D;  2QPZ A;  1G8K B;  1ULJ A;  1ZRT E;  4QDD A;  1OW6 A;  1NTM E;  1O7G A;  4H13 C;  3AZC A;  1ZP0 C;  1KTM A;  4QDF B;  2BCC E;  3G9R A;  1NTZ E;  1O7N A;  2QIW A;  3CX5 E;  2NVG A;  1EG9 A;  2FYU E;  1UIX A;  3L75 E;  3N0Q A;  1EZV E;  4H13 D;  1SJG A;  3Q2Y A;  1PL5 A;  4P1B H;  4HM7 A;  2HMO A;  4QCK A;  1DIP A;  1DD3 A;  2XSO A;  2QSI A;  2QJP C;  4HM8 A;  1SQQ E;  4H13 B;  2BMQ A;  2HML A;  1RQV A;  3O6Q A;  3H1L E;  3GL2 A;  2P10 A;  3H1K E;  1KMI Z;  2D2C D;  1KYO E;  1Y9B A;  2B24 A;  1IK7 A;  2JZA A;  3VMH D;  4OGQ C;  4PD4 E;  1FQT A;  3Q5S A;  4PV1 C;  4NBF D;  1PP9 E;  3L74 E;  3GOB A;  1BCC E;  2CKF A;  4NBH D;  1NYH A;  3T97 B;  4NBE D;  1U57 A;  2HMM A;  4HM3 A;  1K05 A;  1O7M A;  3VCA A;  2HMK A;  2QJY C;  2YIU C;  2E4P A;  2E75 C;  2MKV A;  2NVF A;  1S1C X;  4NBA D;  2DE6 D;  4HM4 A;  3Q5P A;  2E74 D;  1YQ3 C;  1OMI A;  3IN6 A;  3D6Y A;  3S9O A;  3R4Y A;  2GBX A;  3AE9 C;  2E4Q A;  3D70 A;  3H1I E;  1ZOY C;  4OGQ B;  1O7W A;  1NTK E;  4PV1 B;  4R4M A;  4NB9 D;  1P84 E;  1RFS A;  1L0N E;  1SQX E;  3GTE A;  4H44 D;  1WQL A;  2FXP A;  3GZY A;  2E75 B;  1EXJ A;  5KLV E;  2H89 C;  2WSF J;  3IAO A;  1KOR A;  2G8Y A;  5AEW A;  5M1B A;  1PPJ E;  2OQQ A;  2YVJ B;  4TT3 H;  2WSC J;  3LW5 J;  4NBD D;  4YTP C;  2V7Q J;  3Q1M A;  4HJL A;  4QUP A;  2DE5 D;  1NDO A;  4NBC D;  2D2C C;  3FGA D;  3L73 E;  3RL0 g;  1BE3 E;  4GDO A;  1S5L X;  1KIL E;  3DQY A;  4HM6 A;  2G3A A;  3TGU E;  3AE5 C;  2YFJ A;  2E76 C;  4R4L A;  2HMN A;  1SQP E;  4U3F E;  1RIE A;  1HF9 A;  2O01 J;  2BMR A;  3VCP A;  1KQF B;  4AAY B;  1OW7 A;  4HM1 A;  2QJK C;  4HM5 A;  1KQG B;  1JM1 A;  3EQQ A;  1MKM A;  4YXD C;  4Y28 J;  4Z1M H;  2E74 C;  1FDI A;  1JB0 J;  2WPV B;  2E76 D;  4IL6 X;  2D2C B;  1NYK A;  2DE7 D;  2HMJ A;  3AEC C;  1YQ4 C;  1WMK A;  3GF3 A;  2ZYL A;  2WQY C;  4QUR A;  1K04 A;  4I7Z C;  4QDC A;  4HM0 A;  2E76 B;  1VF5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...