2NVEA

Soluble domain of rieske iron sulfur protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
b'LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGTHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nveA00
3L70E 4AAYB 4HM8A 4AIVA 4U3FE 4NBED 3CXHE 1UUVA 3H1LE 3GKEA 4QUQA 2E4PA 4QUPA 3BCCE 2A06E 2QJPC 4H0LD 2HMMA 1O7PA 2ZT9D 3L72E 3GTSA 3DQYA 1RIEA 4QDCA 2YFLA 3GOBA 3GZXA 1WQLA 2Q3WA 3VMHD 2XSOA 5CXMA 3VMID 2FYUE 1L0NE 2E76D 1PP9E 2BCCE 3FOUA 1SQVE 4NBHD 2JO6A 3VCAA 2E75D 1ZRTE 3L73E 2YFJA 3H1KE 1L0LE 2E74D 4P1CH 4NBDD 2IBZE 1EZVE 5KLIC 5AEUA 3CWBE 4HM5A 3GB4A 4H13D 2NVGA 3GCEA 2HMNA 3GTEA 5KLVE 1O7MA 1BCCE 2QJYC 2B1XA 2BMRA 1O7GA 4HJLA 1O7NA 1G8JB 2YIUC 4HM7A 3L75E 2QPZA 4NBBD 4HM1A 2DE6D 1SJGA 1FQTA 1RFSA 2YFIA 2YVJB 3AZCA 1UUWA 2CKFA 2HMKA 4HM6A 2HMJA 3D89A 2HMOA 3TGUE 2B24A 4PV1D 1O7HA 1NTKE 4NBGD 1P84E 2NVEA 2XR8A 2XSHA 4NBAD 2GBWA 3L71E 3N0QA 3EQQA 4PD4E 3VMGD 4H44D 2NVFA 3H1IE 1PPJE 1VF5D 1O7WA 2XRXA 1JM1A 1NYKA 3H1HE 2E4QA 1VM9A 5BOKA 4HM4A 1Q90C 1G8KB 2BMQA 2NUMA 1SQBE 2GBXA 1NTZE 1EG9A 2JZAA 4QDFA 5HL4A 4EMJB 1KB9E 1BE3E 1KYOE 4QDDA 1NU1E 3GL2A 1NTME 2NWFA 3GL0A 4OGQD 1SQPE 3CX5E 4NB8D 4NB9D 2BMOA 4QDFB 1ULJA 4NBCD 3L74E 4HM3A 1SQXE 4QURA 4QCKA 2D2CD 3VCPA 3H1JE 1SQQE 2NUKA 4NBFD 5KKZC 4HM2A 2QJKC 3C0DA 1ULIA 2DE7D 2HMLA 2ZYLA 5AEWA 4HM0A 1VCKA 1NDOA 2FYNC 4HKVA 3GZYA 2DE5D 3EN1A 2I7FA 4P1BH
chains in the Genus database with same CATH superfamily
3L70E 4AAYB 4HM8A 4AIVA 4U3FE 4NBED 3CXHE 1UUVA 3H1LE 3GKEA 4QUQA 2E4PA 4QUPA 3BCCE 2A06E 2QJPC 4H0LD 2HMMA 1O7PA 2ZT9D 3L72E 3GTSA 3DQYA 1RIEA 4QDCA 2YFLA 3GOBA 3GZXA 1WQLA 2Q3WA 3VMHD 2XSOA 5CXMA 3VMID 2FYUE 1L0NE 2E76D 1PP9E 2BCCE 3FOUA 1SQVE 4NBHD 2JO6A 3VCAA 2E75D 1ZRTE 3L73E 2YFJA 3H1KE 1L0LE 2E74D 4P1CH 4NBDD 2IBZE 1EZVE 5KLIC 5AEUA 3CWBE 4HM5A 3GB4A 4H13D 2NVGA 3GCEA 2HMNA 3GTEA 5KLVE 1O7MA 1BCCE 2QJYC 2B1XA 2BMRA 1O7GA 4HJLA 1O7NA 1G8JB 2YIUC 4HM7A 3L75E 2QPZA 4NBBD 4HM1A 2DE6D 1SJGA 1FQTA 1RFSA 2YFIA 2YVJB 3AZCA 1UUWA 2CKFA 2HMKA 4HM6A 2HMJA 3D89A 2HMOA 3TGUE 2B24A 4PV1D 1O7HA 1NTKE 4NBGD 1P84E 2NVEA 2XR8A 2XSHA 4NBAD 2GBWA 3L71E 3N0QA 3EQQA 4PD4E 3VMGD 4H44D 2NVFA 3H1IE 1PPJE 1VF5D 1O7WA 2XRXA 1JM1A 1NYKA 3H1HE 2E4QA 1VM9A 5BOKA 4HM4A 1Q90C 1G8KB 2BMQA 2NUMA 1SQBE 2GBXA 1NTZE 1EG9A 2JZAA 4QDFA 5HL4A 4EMJB 1KB9E 1BE3E 1KYOE 4QDDA 1NU1E 3GL2A 1NTME 2NWFA 3GL0A 4OGQD 1SQPE 3CX5E 4NB8D 4NB9D 2BMOA 4QDFB 1ULJA 4NBCD 3L74E 4HM3A 1SQXE 4QURA 4QCKA 2D2CD 3VCPA 3H1JE 1SQQE 2NUKA 4NBFD 5KKZC 4HM2A 2QJKC 3C0DA 1ULIA 2DE7D 2HMLA 2ZYLA 5AEWA 4HM0A 1VCKA 1NDOA 2FYNC 4HKVA 3GZYA 2DE5D 3EN1A 2I7FA 4P1BH
chains in the Genus database with same CATH topology
3L70E 4AAYB 4HM8A 4AIVA 4U3FE 4NBED 3CXHE 1UUVA 3H1LE 3GKEA 4QUQA 2E4PA 4QUPA 3BCCE 2A06E 2QJPC 4H0LD 2HMMA 1O7PA 2ZT9D 3L72E 3GTSA 3DQYA 1RIEA 4QDCA 2YFLA 3GOBA 3GZXA 1WQLA 2Q3WA 3VMHD 2XSOA 5CXMA 3VMID 2FYUE 1L0NE 2E76D 1PP9E 2BCCE 3FOUA 1SQVE 4NBHD 2JO6A 3VCAA 2E75D 1ZRTE 3L73E 2YFJA 3H1KE 1L0LE 2E74D 4P1CH 4NBDD 2IBZE 1EZVE 5KLIC 5AEUA 3CWBE 4HM5A 3GB4A 4H13D 2NVGA 3GCEA 2HMNA 3GTEA 5KLVE 1O7MA 1BCCE 2QJYC 2B1XA 2BMRA 1O7GA 4HJLA 1O7NA 1G8JB 2YIUC 4HM7A 3L75E 2QPZA 4NBBD 4HM1A 2DE6D 1SJGA 1FQTA 1RFSA 2YFIA 2YVJB 3AZCA 1UUWA 2CKFA 2HMKA 4HM6A 2HMJA 3D89A 2HMOA 3TGUE 2B24A 4PV1D 1O7HA 1NTKE 4NBGD 1P84E 2NVEA 2XR8A 2XSHA 4NBAD 2GBWA 3L71E 3N0QA 3EQQA 4PD4E 3VMGD 4H44D 2NVFA 3H1IE 1PPJE 1VF5D 1O7WA 2XRXA 1JM1A 1NYKA 3H1HE 2E4QA 1VM9A 5BOKA 4HM4A 1Q90C 1G8KB 2BMQA 2NUMA 1SQBE 2GBXA 1NTZE 1EG9A 2JZAA 4QDFA 5HL4A 4EMJB 1KB9E 1BE3E 1KYOE 4QDDA 1NU1E 3GL2A 1NTME 2NWFA 3GL0A 4OGQD 1SQPE 3CX5E 4NB8D 4NB9D 2BMOA 4QDFB 1ULJA 4NBCD 3L74E 4HM3A 1SQXE 4QURA 4QCKA 2D2CD 3VCPA 3H1JE 1SQQE 2NUKA 4NBFD 5KKZC 4HM2A 2QJKC 3C0DA 1ULIA 2DE7D 2HMLA 2ZYLA 5AEWA 4HM0A 1VCKA 1NDOA 2FYNC 4HKVA 3GZYA 2DE5D 3EN1A 2I7FA 4P1BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 E;  4AAY B;  4HM8 A;  4AIV A;  4U3F E;  4NBE D;  3CXH E;  1UUV A;  3H1L E;  3GKE A;  4QUQ A;  2E4P A;  4QUP A;  3BCC E;  2A06 E;  2QJP C;  4H0L D;  2HMM A;  1O7P A;  2ZT9 D;  3L72 E;  3GTS A;  3DQY A;  1RIE A;  4QDC A;  2YFL A;  3GOB A;  3GZX A;  1WQL A;  2Q3W A;  3VMH D;  2XSO A;  5CXM A;  3VMI D;  2FYU E;  1L0N E;  2E76 D;  1PP9 E;  2BCC E;  3FOU A;  1SQV E;  4NBH D;  2JO6 A;  3VCA A;  2E75 D;  1ZRT E;  3L73 E;  2YFJ A;  3H1K E;  1L0L E;  2E74 D;  4P1C H;  4NBD D;  2IBZ E;  1EZV E;  5KLI C;  5AEU A;  3CWB E;  4HM5 A;  3GB4 A;  4H13 D;  2NVG A;  3GCE A;  2HMN A;  3GTE A;  5KLV E;  1O7M A;  1BCC E;  2QJY C;  2B1X A;  2BMR A;  1O7G A;  4HJL A;  1O7N A;  1G8J B;  2YIU C;  4HM7 A;  3L75 E;  2QPZ A;  4NBB D;  4HM1 A;  2DE6 D;  1SJG A;  1FQT A;  1RFS A;  2YFI A;  2YVJ B;  3AZC A;  1UUW A;  2CKF A;  2HMK A;  4HM6 A;  2HMJ A;  3D89 A;  2HMO A;  3TGU E;  2B24 A;  4PV1 D;  1O7H A;  1NTK E;  4NBG D;  1P84 E;  2NVE A;  2XR8 A;  2XSH A;  4NBA D;  2GBW A;  3L71 E;  3N0Q A;  3EQQ A;  4PD4 E;  3VMG D;  4H44 D;  2NVF A;  3H1I E;  1PPJ E;  1VF5 D;  1O7W A;  2XRX A;  1JM1 A;  1NYK A;  3H1H E;  2E4Q A;  1VM9 A;  5BOK A;  4HM4 A;  1Q90 C;  1G8K B;  2BMQ A;  2NUM A;  1SQB E;  2GBX A;  1NTZ E;  1EG9 A;  2JZA A;  4QDF A;  5HL4 A;  4EMJ B;  1KB9 E;  1BE3 E;  1KYO E;  4QDD A;  1NU1 E;  3GL2 A;  1NTM E;  2NWF A;  3GL0 A;  4OGQ D;  1SQP E;  3CX5 E;  4NB8 D;  4NB9 D;  2BMO A;  4QDF B;  1ULJ A;  4NBC D;  3L74 E;  4HM3 A;  1SQX E;  4QUR A;  4QCK A;  2D2C D;  3VCP A;  3H1J E;  1SQQ E;  2NUK A;  4NBF D;  5KKZ C;  4HM2 A;  2QJK C;  3C0D A;  1ULI A;  2DE7 D;  2HML A;  2ZYL A;  5AEW A;  4HM0 A;  1VCK A;  1NDO A;  2FYN C;  4HKV A;  3GZY A;  2DE5 D;  3EN1 A;  2I7F A;  4P1B H; 
#chains in the Genus database with same CATH topology
 3L70 E;  4AAY B;  4HM8 A;  4AIV A;  4U3F E;  4NBE D;  3CXH E;  1UUV A;  3H1L E;  3GKE A;  4QUQ A;  2E4P A;  4QUP A;  3BCC E;  2A06 E;  2QJP C;  4H0L D;  2HMM A;  1O7P A;  2ZT9 D;  3L72 E;  3GTS A;  3DQY A;  1RIE A;  4QDC A;  2YFL A;  3GOB A;  3GZX A;  1WQL A;  2Q3W A;  3VMH D;  2XSO A;  5CXM A;  3VMI D;  2FYU E;  1L0N E;  2E76 D;  1PP9 E;  2BCC E;  3FOU A;  1SQV E;  4NBH D;  2JO6 A;  3VCA A;  2E75 D;  1ZRT E;  3L73 E;  2YFJ A;  3H1K E;  1L0L E;  2E74 D;  4P1C H;  4NBD D;  2IBZ E;  1EZV E;  5KLI C;  5AEU A;  3CWB E;  4HM5 A;  3GB4 A;  4H13 D;  2NVG A;  3GCE A;  2HMN A;  3GTE A;  5KLV E;  1O7M A;  1BCC E;  2QJY C;  2B1X A;  2BMR A;  1O7G A;  4HJL A;  1O7N A;  1G8J B;  2YIU C;  4HM7 A;  3L75 E;  2QPZ A;  4NBB D;  4HM1 A;  2DE6 D;  1SJG A;  1FQT A;  1RFS A;  2YFI A;  2YVJ B;  3AZC A;  1UUW A;  2CKF A;  2HMK A;  4HM6 A;  2HMJ A;  3D89 A;  2HMO A;  3TGU E;  2B24 A;  4PV1 D;  1O7H A;  1NTK E;  4NBG D;  1P84 E;  2NVE A;  2XR8 A;  2XSH A;  4NBA D;  2GBW A;  3L71 E;  3N0Q A;  3EQQ A;  4PD4 E;  3VMG D;  4H44 D;  2NVF A;  3H1I E;  1PPJ E;  1VF5 D;  1O7W A;  2XRX A;  1JM1 A;  1NYK A;  3H1H E;  2E4Q A;  1VM9 A;  5BOK A;  4HM4 A;  1Q90 C;  1G8K B;  2BMQ A;  2NUM A;  1SQB E;  2GBX A;  1NTZ E;  1EG9 A;  2JZA A;  4QDF A;  5HL4 A;  4EMJ B;  1KB9 E;  1BE3 E;  1KYO E;  4QDD A;  1NU1 E;  3GL2 A;  1NTM E;  2NWF A;  3GL0 A;  4OGQ D;  1SQP E;  3CX5 E;  4NB8 D;  4NB9 D;  2BMO A;  4QDF B;  1ULJ A;  4NBC D;  3L74 E;  4HM3 A;  1SQX E;  4QUR A;  4QCK A;  2D2C D;  3VCP A;  3H1J E;  1SQQ E;  2NUK A;  4NBF D;  5KKZ C;  4HM2 A;  2QJK C;  3C0D A;  1ULI A;  2DE7 D;  2HML A;  2ZYL A;  5AEW A;  4HM0 A;  1VCK A;  1NDO A;  2FYN C;  4HKV A;  3GZY A;  2DE5 D;  3EN1 A;  2I7F A;  4P1B H; 
#chains in the Genus database with same CATH homology
 3L70 E;  4AAY B;  4HM8 A;  4AIV A;  4U3F E;  4NBE D;  3CXH E;  1UUV A;  3H1L E;  3GKE A;  4QUQ A;  2E4P A;  4QUP A;  3BCC E;  2A06 E;  2QJP C;  4H0L D;  2HMM A;  1O7P A;  2ZT9 D;  3L72 E;  3GTS A;  3DQY A;  1RIE A;  4QDC A;  2YFL A;  3GOB A;  3GZX A;  1WQL A;  2Q3W A;  3VMH D;  2XSO A;  5CXM A;  3VMI D;  2FYU E;  1L0N E;  2E76 D;  1PP9 E;  2BCC E;  3FOU A;  1SQV E;  4NBH D;  2JO6 A;  3VCA A;  2E75 D;  1ZRT E;  3L73 E;  2YFJ A;  3H1K E;  1L0L E;  2E74 D;  4P1C H;  4NBD D;  2IBZ E;  1EZV E;  5KLI C;  5AEU A;  3CWB E;  4HM5 A;  3GB4 A;  4H13 D;  2NVG A;  3GCE A;  2HMN A;  3GTE A;  5KLV E;  1O7M A;  1BCC E;  2QJY C;  2B1X A;  2BMR A;  1O7G A;  4HJL A;  1O7N A;  1G8J B;  2YIU C;  4HM7 A;  3L75 E;  2QPZ A;  4NBB D;  4HM1 A;  2DE6 D;  1SJG A;  1FQT A;  1RFS A;  2YFI A;  2YVJ B;  3AZC A;  1UUW A;  2CKF A;  2HMK A;  4HM6 A;  2HMJ A;  3D89 A;  2HMO A;  3TGU E;  2B24 A;  4PV1 D;  1O7H A;  1NTK E;  4NBG D;  1P84 E;  2NVE A;  2XR8 A;  2XSH A;  4NBA D;  2GBW A;  3L71 E;  3N0Q A;  3EQQ A;  4PD4 E;  3VMG D;  4H44 D;  2NVF A;  3H1I E;  1PPJ E;  1VF5 D;  1O7W A;  2XRX A;  1JM1 A;  1NYK A;  3H1H E;  2E4Q A;  1VM9 A;  5BOK A;  4HM4 A;  1Q90 C;  1G8K B;  2BMQ A;  2NUM A;  1SQB E;  2GBX A;  1NTZ E;  1EG9 A;  2JZA A;  4QDF A;  5HL4 A;  4EMJ B;  1KB9 E;  1BE3 E;  1KYO E;  4QDD A;  1NU1 E;  3GL2 A;  1NTM E;  2NWF A;  3GL0 A;  4OGQ D;  1SQP E;  3CX5 E;  4NB8 D;  4NB9 D;  2BMO A;  4QDF B;  1ULJ A;  4NBC D;  3L74 E;  4HM3 A;  1SQX E;  4QUR A;  4QCK A;  2D2C D;  3VCP A;  3H1J E;  1SQQ E;  2NUK A;  4NBF D;  5KKZ C;  4HM2 A;  2QJK C;  3C0D A;  1ULI A;  2DE7 D;  2HML A;  2ZYL A;  5AEW A;  4HM0 A;  1VCK A;  1NDO A;  2FYN C;  4HKV A;  3GZY A;  2DE5 D;  3EN1 A;  2I7F A;  4P1B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...