2NVEA

Soluble domain of rieske iron sulfur protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGTHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nveA00
1G8KB 3VCAA 3BCCE 3VMGD 2HMNA 3CXHE 1Q90C 1RIEA 2B24A 1PP9E 2XRXA 2IBZE 3GZYA 1FQTA 2NUKA 4HKVA 5KLIC 2ZT9D 4QUPA 1RFSA 3GB4A 1KB9E 1VCKA 4NBED 3VMHD 4QURA 3GCEA 4H13D 1NU1E 1UUWA 4OGQD 5CXMA 2HMLA 1EZVE 4PD4E 2FYNC 4HM8A 2E4QA 4HM5A 4EMJB 4NBCD 2BMOA 2GBXA 1O7HA 2HMKA 2YFIA 3H1KE 1NTKE 2NWFA 1JM1A 3N0QA 1L0NE 4NBBD 4HM4A 1EG9A 4AAYB 2YFLA 1VM9A 1ULIA 4HM6A 4AIVA 2HMOA 3GL0A 3D89A 4HM7A 4QDDA 2CKFA 2YIUC 1SJGA 1G8JB 2HMJA 1NTME 2XSOA 3L75E 4HM1A 3L71E 1O7NA 1L0LE 5KLVE 3C0DA 3GZXA 4U3FE 1SQPE 2QJPC 3VMID 3L74E 5BOKA 3H1HE 2NUMA 3EN1A 2E4PA 1SQVE 2QPZA 1BCCE 3VCPA 3DQYA 3GL2A 2D2CD 2QJYC 4QDFA 3TGUE 1ULJA 4HJLA 4NB9D 2BMRA 4HM2A 5AEWA 1KYOE 2B1XA 1PPJE 1O7WA 3L70E 3GTEA 2A06E 2DE6D 2NVEA 2YFJA 5KKZC 2JZAA 3CWBE 2E75D 4NB8D 4QDCA 2XSHA 2FYUE 1NYKA 3H1IE 3AZCA 1UUVA 2JO6A 3GTSA 1SQQE 2E74D 2BMQA 2DE5D 4HM0A 3H1JE 4NBFD 4NBHD 1NTZE 3FOUA 2E76D 1P84E 1VF5D 2Q3WA 4NBDD 1BE3E 2DE7D 5AEUA 1O7MA 4HM3A 2I7FA 2NVFA 3EQQA 1SQXE 4QUQA 4PV1D 2XR8A 4QCKA 3GKEA 3CX5E 2QJKC 3H1LE 2HMMA 2GBWA 4H0LD 2ZYLA 1NDOA 2NVGA 3GOBA 3L72E 1WQLA 2BCCE 4H44D 4NBAD 1ZRTE 2YVJB 1O7PA 4P1CH 5HL4A 1SQBE 1O7GA 4NBGD 4P1BH 4QDFB 3L73E
chains in the Genus database with same CATH superfamily
1G8KB 3VCAA 3BCCE 3VMGD 2HMNA 3CXHE 1Q90C 1RIEA 2B24A 1PP9E 2XRXA 2IBZE 3GZYA 1FQTA 2NUKA 4HKVA 5KLIC 2ZT9D 4QUPA 1RFSA 3GB4A 1KB9E 1VCKA 4NBED 3VMHD 4QURA 3GCEA 4H13D 1NU1E 1UUWA 4OGQD 5CXMA 2HMLA 1EZVE 4PD4E 2FYNC 4HM8A 2E4QA 4HM5A 4EMJB 4NBCD 2BMOA 2GBXA 1O7HA 2HMKA 2YFIA 3H1KE 1NTKE 2NWFA 1JM1A 3N0QA 1L0NE 4NBBD 4HM4A 1EG9A 4AAYB 2YFLA 1VM9A 1ULIA 4HM6A 4AIVA 2HMOA 3GL0A 3D89A 4HM7A 4QDDA 2CKFA 2YIUC 1SJGA 1G8JB 2HMJA 1NTME 2XSOA 3L75E 4HM1A 3L71E 1O7NA 1L0LE 5KLVE 3C0DA 3GZXA 4U3FE 1SQPE 2QJPC 3VMID 3L74E 5BOKA 3H1HE 2NUMA 3EN1A 2E4PA 1SQVE 2QPZA 1BCCE 3VCPA 3DQYA 3GL2A 2D2CD 2QJYC 4QDFA 3TGUE 1ULJA 4HJLA 4NB9D 2BMRA 4HM2A 5AEWA 1KYOE 2B1XA 1PPJE 1O7WA 3L70E 3GTEA 2A06E 2DE6D 2NVEA 2YFJA 5KKZC 2JZAA 3CWBE 2E75D 4NB8D 4QDCA 2XSHA 2FYUE 1NYKA 3H1IE 3AZCA 1UUVA 2JO6A 3GTSA 1SQQE 2E74D 2BMQA 2DE5D 4HM0A 3H1JE 4NBFD 4NBHD 1NTZE 3FOUA 2E76D 1P84E 1VF5D 2Q3WA 4NBDD 1BE3E 2DE7D 5AEUA 1O7MA 4HM3A 2I7FA 2NVFA 3EQQA 1SQXE 4QUQA 4PV1D 2XR8A 4QCKA 3GKEA 3CX5E 2QJKC 3H1LE 2HMMA 2GBWA 4H0LD 2ZYLA 1NDOA 2NVGA 3GOBA 3L72E 1WQLA 2BCCE 4H44D 4NBAD 1ZRTE 2YVJB 1O7PA 4P1CH 5HL4A 1SQBE 1O7GA 4NBGD 4P1BH 4QDFB 3L73E
chains in the Genus database with same CATH topology
1G8KB 3VCAA 3BCCE 3VMGD 2HMNA 3CXHE 1Q90C 1RIEA 2B24A 1PP9E 2XRXA 2IBZE 3GZYA 1FQTA 2NUKA 4HKVA 5KLIC 2ZT9D 4QUPA 1RFSA 3GB4A 1KB9E 1VCKA 4NBED 3VMHD 4QURA 3GCEA 4H13D 1NU1E 1UUWA 4OGQD 5CXMA 2HMLA 1EZVE 4PD4E 2FYNC 4HM8A 2E4QA 4HM5A 4EMJB 4NBCD 2BMOA 2GBXA 1O7HA 2HMKA 2YFIA 3H1KE 1NTKE 2NWFA 1JM1A 3N0QA 1L0NE 4NBBD 4HM4A 1EG9A 4AAYB 2YFLA 1VM9A 1ULIA 4HM6A 4AIVA 2HMOA 3GL0A 3D89A 4HM7A 4QDDA 2CKFA 2YIUC 1SJGA 1G8JB 2HMJA 1NTME 2XSOA 3L75E 4HM1A 3L71E 1O7NA 1L0LE 5KLVE 3C0DA 3GZXA 4U3FE 1SQPE 2QJPC 3VMID 3L74E 5BOKA 3H1HE 2NUMA 3EN1A 2E4PA 1SQVE 2QPZA 1BCCE 3VCPA 3DQYA 3GL2A 2D2CD 2QJYC 4QDFA 3TGUE 1ULJA 4HJLA 4NB9D 2BMRA 4HM2A 5AEWA 1KYOE 2B1XA 1PPJE 1O7WA 3L70E 3GTEA 2A06E 2DE6D 2NVEA 2YFJA 5KKZC 2JZAA 3CWBE 2E75D 4NB8D 4QDCA 2XSHA 2FYUE 1NYKA 3H1IE 3AZCA 1UUVA 2JO6A 3GTSA 1SQQE 2E74D 2BMQA 2DE5D 4HM0A 3H1JE 4NBFD 4NBHD 1NTZE 3FOUA 2E76D 1P84E 1VF5D 2Q3WA 4NBDD 1BE3E 2DE7D 5AEUA 1O7MA 4HM3A 2I7FA 2NVFA 3EQQA 1SQXE 4QUQA 4PV1D 2XR8A 4QCKA 3GKEA 3CX5E 2QJKC 3H1LE 2HMMA 2GBWA 4H0LD 2ZYLA 1NDOA 2NVGA 3GOBA 3L72E 1WQLA 2BCCE 4H44D 4NBAD 1ZRTE 2YVJB 1O7PA 4P1CH 5HL4A 1SQBE 1O7GA 4NBGD 4P1BH 4QDFB 3L73E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G8K B;  3VCA A;  3BCC E;  3VMG D;  2HMN A;  3CXH E;  1Q90 C;  1RIE A;  2B24 A;  1PP9 E;  2XRX A;  2IBZ E;  3GZY A;  1FQT A;  2NUK A;  4HKV A;  5KLI C;  2ZT9 D;  4QUP A;  1RFS A;  3GB4 A;  1KB9 E;  1VCK A;  4NBE D;  3VMH D;  4QUR A;  3GCE A;  4H13 D;  1NU1 E;  1UUW A;  4OGQ D;  5CXM A;  2HML A;  1EZV E;  4PD4 E;  2FYN C;  4HM8 A;  2E4Q A;  4HM5 A;  4EMJ B;  4NBC D;  2BMO A;  2GBX A;  1O7H A;  2HMK A;  2YFI A;  3H1K E;  1NTK E;  2NWF A;  1JM1 A;  3N0Q A;  1L0N E;  4NBB D;  4HM4 A;  1EG9 A;  4AAY B;  2YFL A;  1VM9 A;  1ULI A;  4HM6 A;  4AIV A;  2HMO A;  3GL0 A;  3D89 A;  4HM7 A;  4QDD A;  2CKF A;  2YIU C;  1SJG A;  1G8J B;  2HMJ A;  1NTM E;  2XSO A;  3L75 E;  4HM1 A;  3L71 E;  1O7N A;  1L0L E;  5KLV E;  3C0D A;  3GZX A;  4U3F E;  1SQP E;  2QJP C;  3VMI D;  3L74 E;  5BOK A;  3H1H E;  2NUM A;  3EN1 A;  2E4P A;  1SQV E;  2QPZ A;  1BCC E;  3VCP A;  3DQY A;  3GL2 A;  2D2C D;  2QJY C;  4QDF A;  3TGU E;  1ULJ A;  4HJL A;  4NB9 D;  2BMR A;  4HM2 A;  5AEW A;  1KYO E;  2B1X A;  1PPJ E;  1O7W A;  3L70 E;  3GTE A;  2A06 E;  2DE6 D;  2NVE A;  2YFJ A;  5KKZ C;  2JZA A;  3CWB E;  2E75 D;  4NB8 D;  4QDC A;  2XSH A;  2FYU E;  1NYK A;  3H1I E;  3AZC A;  1UUV A;  2JO6 A;  3GTS A;  1SQQ E;  2E74 D;  2BMQ A;  2DE5 D;  4HM0 A;  3H1J E;  4NBF D;  4NBH D;  1NTZ E;  3FOU A;  2E76 D;  1P84 E;  1VF5 D;  2Q3W A;  4NBD D;  1BE3 E;  2DE7 D;  5AEU A;  1O7M A;  4HM3 A;  2I7F A;  2NVF A;  3EQQ A;  1SQX E;  4QUQ A;  4PV1 D;  2XR8 A;  4QCK A;  3GKE A;  3CX5 E;  2QJK C;  3H1L E;  2HMM A;  2GBW A;  4H0L D;  2ZYL A;  1NDO A;  2NVG A;  3GOB A;  3L72 E;  1WQL A;  2BCC E;  4H44 D;  4NBA D;  1ZRT E;  2YVJ B;  1O7P A;  4P1C H;  5HL4 A;  1SQB E;  1O7G A;  4NBG D;  4P1B H;  4QDF B;  3L73 E; 
#chains in the Genus database with same CATH topology
 1G8K B;  3VCA A;  3BCC E;  3VMG D;  2HMN A;  3CXH E;  1Q90 C;  1RIE A;  2B24 A;  1PP9 E;  2XRX A;  2IBZ E;  3GZY A;  1FQT A;  2NUK A;  4HKV A;  5KLI C;  2ZT9 D;  4QUP A;  1RFS A;  3GB4 A;  1KB9 E;  1VCK A;  4NBE D;  3VMH D;  4QUR A;  3GCE A;  4H13 D;  1NU1 E;  1UUW A;  4OGQ D;  5CXM A;  2HML A;  1EZV E;  4PD4 E;  2FYN C;  4HM8 A;  2E4Q A;  4HM5 A;  4EMJ B;  4NBC D;  2BMO A;  2GBX A;  1O7H A;  2HMK A;  2YFI A;  3H1K E;  1NTK E;  2NWF A;  1JM1 A;  3N0Q A;  1L0N E;  4NBB D;  4HM4 A;  1EG9 A;  4AAY B;  2YFL A;  1VM9 A;  1ULI A;  4HM6 A;  4AIV A;  2HMO A;  3GL0 A;  3D89 A;  4HM7 A;  4QDD A;  2CKF A;  2YIU C;  1SJG A;  1G8J B;  2HMJ A;  1NTM E;  2XSO A;  3L75 E;  4HM1 A;  3L71 E;  1O7N A;  1L0L E;  5KLV E;  3C0D A;  3GZX A;  4U3F E;  1SQP E;  2QJP C;  3VMI D;  3L74 E;  5BOK A;  3H1H E;  2NUM A;  3EN1 A;  2E4P A;  1SQV E;  2QPZ A;  1BCC E;  3VCP A;  3DQY A;  3GL2 A;  2D2C D;  2QJY C;  4QDF A;  3TGU E;  1ULJ A;  4HJL A;  4NB9 D;  2BMR A;  4HM2 A;  5AEW A;  1KYO E;  2B1X A;  1PPJ E;  1O7W A;  3L70 E;  3GTE A;  2A06 E;  2DE6 D;  2NVE A;  2YFJ A;  5KKZ C;  2JZA A;  3CWB E;  2E75 D;  4NB8 D;  4QDC A;  2XSH A;  2FYU E;  1NYK A;  3H1I E;  3AZC A;  1UUV A;  2JO6 A;  3GTS A;  1SQQ E;  2E74 D;  2BMQ A;  2DE5 D;  4HM0 A;  3H1J E;  4NBF D;  4NBH D;  1NTZ E;  3FOU A;  2E76 D;  1P84 E;  1VF5 D;  2Q3W A;  4NBD D;  1BE3 E;  2DE7 D;  5AEU A;  1O7M A;  4HM3 A;  2I7F A;  2NVF A;  3EQQ A;  1SQX E;  4QUQ A;  4PV1 D;  2XR8 A;  4QCK A;  3GKE A;  3CX5 E;  2QJK C;  3H1L E;  2HMM A;  2GBW A;  4H0L D;  2ZYL A;  1NDO A;  2NVG A;  3GOB A;  3L72 E;  1WQL A;  2BCC E;  4H44 D;  4NBA D;  1ZRT E;  2YVJ B;  1O7P A;  4P1C H;  5HL4 A;  1SQB E;  1O7G A;  4NBG D;  4P1B H;  4QDF B;  3L73 E; 
#chains in the Genus database with same CATH homology
 1G8K B;  3VCA A;  3BCC E;  3VMG D;  2HMN A;  3CXH E;  1Q90 C;  1RIE A;  2B24 A;  1PP9 E;  2XRX A;  2IBZ E;  3GZY A;  1FQT A;  2NUK A;  4HKV A;  5KLI C;  2ZT9 D;  4QUP A;  1RFS A;  3GB4 A;  1KB9 E;  1VCK A;  4NBE D;  3VMH D;  4QUR A;  3GCE A;  4H13 D;  1NU1 E;  1UUW A;  4OGQ D;  5CXM A;  2HML A;  1EZV E;  4PD4 E;  2FYN C;  4HM8 A;  2E4Q A;  4HM5 A;  4EMJ B;  4NBC D;  2BMO A;  2GBX A;  1O7H A;  2HMK A;  2YFI A;  3H1K E;  1NTK E;  2NWF A;  1JM1 A;  3N0Q A;  1L0N E;  4NBB D;  4HM4 A;  1EG9 A;  4AAY B;  2YFL A;  1VM9 A;  1ULI A;  4HM6 A;  4AIV A;  2HMO A;  3GL0 A;  3D89 A;  4HM7 A;  4QDD A;  2CKF A;  2YIU C;  1SJG A;  1G8J B;  2HMJ A;  1NTM E;  2XSO A;  3L75 E;  4HM1 A;  3L71 E;  1O7N A;  1L0L E;  5KLV E;  3C0D A;  3GZX A;  4U3F E;  1SQP E;  2QJP C;  3VMI D;  3L74 E;  5BOK A;  3H1H E;  2NUM A;  3EN1 A;  2E4P A;  1SQV E;  2QPZ A;  1BCC E;  3VCP A;  3DQY A;  3GL2 A;  2D2C D;  2QJY C;  4QDF A;  3TGU E;  1ULJ A;  4HJL A;  4NB9 D;  2BMR A;  4HM2 A;  5AEW A;  1KYO E;  2B1X A;  1PPJ E;  1O7W A;  3L70 E;  3GTE A;  2A06 E;  2DE6 D;  2NVE A;  2YFJ A;  5KKZ C;  2JZA A;  3CWB E;  2E75 D;  4NB8 D;  4QDC A;  2XSH A;  2FYU E;  1NYK A;  3H1I E;  3AZC A;  1UUV A;  2JO6 A;  3GTS A;  1SQQ E;  2E74 D;  2BMQ A;  2DE5 D;  4HM0 A;  3H1J E;  4NBF D;  4NBH D;  1NTZ E;  3FOU A;  2E76 D;  1P84 E;  1VF5 D;  2Q3W A;  4NBD D;  1BE3 E;  2DE7 D;  5AEU A;  1O7M A;  4HM3 A;  2I7F A;  2NVF A;  3EQQ A;  1SQX E;  4QUQ A;  4PV1 D;  2XR8 A;  4QCK A;  3GKE A;  3CX5 E;  2QJK C;  3H1L E;  2HMM A;  2GBW A;  4H0L D;  2ZYL A;  1NDO A;  2NVG A;  3GOB A;  3L72 E;  1WQL A;  2BCC E;  4H44 D;  4NBA D;  1ZRT E;  2YVJ B;  1O7P A;  4P1C H;  5HL4 A;  1SQB E;  1O7G A;  4NBG D;  4P1B H;  4QDF B;  3L73 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...