2NVEA

Soluble domain of rieske iron sulfur protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGTHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nveA00
4P1CH 2BMQA 2DE6D 3H1JE 4HM7A 4HM1A 2XRXA 3GKEA 1WQLA 4NBGD 1JM1A 2E4QA 3L70E 4AIVA 2YIUC 4HJLA 2NUKA 2NVFA 1O7MA 4PD4E 4QURA 4HM6A 3GOBA 1ZRTE 2E75D 1NTZE 2YFIA 3GZXA 2HMLA 2YFLA 1NTME 1PP9E 1SQPE 3DQYA 3EQQA 4NBFD 4HM5A 3CXHE 3GB4A 4QCKA 1SQXE 2D2CD 4HM8A 1VCKA 1BE3E 1L0NE 3VMID 3VMHD 4AAYB 5HL4A 3L73E 2QPZA 3L74E 4NBCD 2YFJA 2E4PA 2Q3WA 2NWFA 2NVEA 4HKVA 4OGQD 2BMRA 2HMMA 2E76D 1Q90C 4H44D 4QDDA 1FQTA 2XR8A 2B1XA 2E74D 3L75E 2ZT9D 4NB9D 2HMJA 2B24A 3VCPA 1O7NA 4NBBD 4QUPA 3BCCE 1G8KB 5KLVE 4EMJB 4H0LD 1G8JB 5CXMA 1UUVA 1O7HA 2FYUE 2CKFA 3GCEA 4HM0A 4PV1D 1NU1E 3GZYA 4QDFB 1KB9E 4NBED 1O7WA 5AEWA 1L0LE 3TGUE 3VCAA 1O7GA 4NBDD 3H1LE 1NYKA 3N0QA 2BCCE 2NUMA 4NB8D 2GBXA 3AZCA 1O7PA 1ULIA 3H1IE 2HMOA 4QDFA 1NTKE 1SQVE 4NBAD 1EG9A 1VM9A 2YVJB 3GL2A 2A06E 2HMNA 1SQQE 4HM2A 3D89A 4P1BH 3GTEA 3C0DA 1ULJA 3VMGD 2DE5D 2NVGA 1NDOA 2BMOA 4H13D 5BOKA 1BCCE 1VF5D 2HMKA 5KLIC 1P84E 2JO6A 3GTSA 5AEUA 3FOUA 3L72E 1KYOE 1RIEA 4QUQA 2ZYLA 3CX5E 2GBWA 1PPJE 2QJYC 4NBHD 2DE7D 2FYNC 3L71E 4HM4A 5KKZC 2XSHA 2I7FA 2IBZE 2QJKC 1SJGA 2XSOA 4QDCA 3H1KE 2QJPC 1RFSA 1EZVE 3GL0A 4HM3A 3CWBE 3EN1A 3H1HE 1UUWA 2JZAA 4U3FE 1SQBE
chains in the Genus database with same CATH superfamily
4P1CH 2BMQA 2DE6D 3H1JE 4HM7A 4HM1A 2XRXA 3GKEA 1WQLA 4NBGD 1JM1A 2E4QA 3L70E 4AIVA 2YIUC 4HJLA 2NUKA 2NVFA 1O7MA 4PD4E 4QURA 4HM6A 3GOBA 1ZRTE 2E75D 1NTZE 2YFIA 3GZXA 2HMLA 2YFLA 1NTME 1PP9E 1SQPE 3DQYA 3EQQA 4NBFD 4HM5A 3CXHE 3GB4A 4QCKA 1SQXE 2D2CD 4HM8A 1VCKA 1BE3E 1L0NE 3VMID 3VMHD 4AAYB 5HL4A 3L73E 2QPZA 3L74E 4NBCD 2YFJA 2E4PA 2Q3WA 2NWFA 2NVEA 4HKVA 4OGQD 2BMRA 2HMMA 2E76D 1Q90C 4H44D 4QDDA 1FQTA 2XR8A 2B1XA 2E74D 3L75E 2ZT9D 4NB9D 2HMJA 2B24A 3VCPA 1O7NA 4NBBD 4QUPA 3BCCE 1G8KB 5KLVE 4EMJB 4H0LD 1G8JB 5CXMA 1UUVA 1O7HA 2FYUE 2CKFA 3GCEA 4HM0A 4PV1D 1NU1E 3GZYA 4QDFB 1KB9E 4NBED 1O7WA 5AEWA 1L0LE 3TGUE 3VCAA 1O7GA 4NBDD 3H1LE 1NYKA 3N0QA 2BCCE 2NUMA 4NB8D 2GBXA 3AZCA 1O7PA 1ULIA 3H1IE 2HMOA 4QDFA 1NTKE 1SQVE 4NBAD 1EG9A 1VM9A 2YVJB 3GL2A 2A06E 2HMNA 1SQQE 4HM2A 3D89A 4P1BH 3GTEA 3C0DA 1ULJA 3VMGD 2DE5D 2NVGA 1NDOA 2BMOA 4H13D 5BOKA 1BCCE 1VF5D 2HMKA 5KLIC 1P84E 2JO6A 3GTSA 5AEUA 3FOUA 3L72E 1KYOE 1RIEA 4QUQA 2ZYLA 3CX5E 2GBWA 1PPJE 2QJYC 4NBHD 2DE7D 2FYNC 3L71E 4HM4A 5KKZC 2XSHA 2I7FA 2IBZE 2QJKC 1SJGA 2XSOA 4QDCA 3H1KE 2QJPC 1RFSA 1EZVE 3GL0A 4HM3A 3CWBE 3EN1A 3H1HE 1UUWA 2JZAA 4U3FE 1SQBE
chains in the Genus database with same CATH topology
4P1CH 2BMQA 2DE6D 3H1JE 4HM7A 4HM1A 2XRXA 3GKEA 1WQLA 4NBGD 1JM1A 2E4QA 3L70E 4AIVA 2YIUC 4HJLA 2NUKA 2NVFA 1O7MA 4PD4E 4QURA 4HM6A 3GOBA 1ZRTE 2E75D 1NTZE 2YFIA 3GZXA 2HMLA 2YFLA 1NTME 1PP9E 1SQPE 3DQYA 3EQQA 4NBFD 4HM5A 3CXHE 3GB4A 4QCKA 1SQXE 2D2CD 4HM8A 1VCKA 1BE3E 1L0NE 3VMID 3VMHD 4AAYB 5HL4A 3L73E 2QPZA 3L74E 4NBCD 2YFJA 2E4PA 2Q3WA 2NWFA 2NVEA 4HKVA 4OGQD 2BMRA 2HMMA 2E76D 1Q90C 4H44D 4QDDA 1FQTA 2XR8A 2B1XA 2E74D 3L75E 2ZT9D 4NB9D 2HMJA 2B24A 3VCPA 1O7NA 4NBBD 4QUPA 3BCCE 1G8KB 5KLVE 4EMJB 4H0LD 1G8JB 5CXMA 1UUVA 1O7HA 2FYUE 2CKFA 3GCEA 4HM0A 4PV1D 1NU1E 3GZYA 4QDFB 1KB9E 4NBED 1O7WA 5AEWA 1L0LE 3TGUE 3VCAA 1O7GA 4NBDD 3H1LE 1NYKA 3N0QA 2BCCE 2NUMA 4NB8D 2GBXA 3AZCA 1O7PA 1ULIA 3H1IE 2HMOA 4QDFA 1NTKE 1SQVE 4NBAD 1EG9A 1VM9A 2YVJB 3GL2A 2A06E 2HMNA 1SQQE 4HM2A 3D89A 4P1BH 3GTEA 3C0DA 1ULJA 3VMGD 2DE5D 2NVGA 1NDOA 2BMOA 4H13D 5BOKA 1BCCE 1VF5D 2HMKA 5KLIC 1P84E 2JO6A 3GTSA 5AEUA 3FOUA 3L72E 1KYOE 1RIEA 4QUQA 2ZYLA 3CX5E 2GBWA 1PPJE 2QJYC 4NBHD 2DE7D 2FYNC 3L71E 4HM4A 5KKZC 2XSHA 2I7FA 2IBZE 2QJKC 1SJGA 2XSOA 4QDCA 3H1KE 2QJPC 1RFSA 1EZVE 3GL0A 4HM3A 3CWBE 3EN1A 3H1HE 1UUWA 2JZAA 4U3FE 1SQBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1C H;  2BMQ A;  2DE6 D;  3H1J E;  4HM7 A;  4HM1 A;  2XRX A;  3GKE A;  1WQL A;  4NBG D;  1JM1 A;  2E4Q A;  3L70 E;  4AIV A;  2YIU C;  4HJL A;  2NUK A;  2NVF A;  1O7M A;  4PD4 E;  4QUR A;  4HM6 A;  3GOB A;  1ZRT E;  2E75 D;  1NTZ E;  2YFI A;  3GZX A;  2HML A;  2YFL A;  1NTM E;  1PP9 E;  1SQP E;  3DQY A;  3EQQ A;  4NBF D;  4HM5 A;  3CXH E;  3GB4 A;  4QCK A;  1SQX E;  2D2C D;  4HM8 A;  1VCK A;  1BE3 E;  1L0N E;  3VMI D;  3VMH D;  4AAY B;  5HL4 A;  3L73 E;  2QPZ A;  3L74 E;  4NBC D;  2YFJ A;  2E4P A;  2Q3W A;  2NWF A;  2NVE A;  4HKV A;  4OGQ D;  2BMR A;  2HMM A;  2E76 D;  1Q90 C;  4H44 D;  4QDD A;  1FQT A;  2XR8 A;  2B1X A;  2E74 D;  3L75 E;  2ZT9 D;  4NB9 D;  2HMJ A;  2B24 A;  3VCP A;  1O7N A;  4NBB D;  4QUP A;  3BCC E;  1G8K B;  5KLV E;  4EMJ B;  4H0L D;  1G8J B;  5CXM A;  1UUV A;  1O7H A;  2FYU E;  2CKF A;  3GCE A;  4HM0 A;  4PV1 D;  1NU1 E;  3GZY A;  4QDF B;  1KB9 E;  4NBE D;  1O7W A;  5AEW A;  1L0L E;  3TGU E;  3VCA A;  1O7G A;  4NBD D;  3H1L E;  1NYK A;  3N0Q A;  2BCC E;  2NUM A;  4NB8 D;  2GBX A;  3AZC A;  1O7P A;  1ULI A;  3H1I E;  2HMO A;  4QDF A;  1NTK E;  1SQV E;  4NBA D;  1EG9 A;  1VM9 A;  2YVJ B;  3GL2 A;  2A06 E;  2HMN A;  1SQQ E;  4HM2 A;  3D89 A;  4P1B H;  3GTE A;  3C0D A;  1ULJ A;  3VMG D;  2DE5 D;  2NVG A;  1NDO A;  2BMO A;  4H13 D;  5BOK A;  1BCC E;  1VF5 D;  2HMK A;  5KLI C;  1P84 E;  2JO6 A;  3GTS A;  5AEU A;  3FOU A;  3L72 E;  1KYO E;  1RIE A;  4QUQ A;  2ZYL A;  3CX5 E;  2GBW A;  1PPJ E;  2QJY C;  4NBH D;  2DE7 D;  2FYN C;  3L71 E;  4HM4 A;  5KKZ C;  2XSH A;  2I7F A;  2IBZ E;  2QJK C;  1SJG A;  2XSO A;  4QDC A;  3H1K E;  2QJP C;  1RFS A;  1EZV E;  3GL0 A;  4HM3 A;  3CWB E;  3EN1 A;  3H1H E;  1UUW A;  2JZA A;  4U3F E;  1SQB E; 
#chains in the Genus database with same CATH topology
 4P1C H;  2BMQ A;  2DE6 D;  3H1J E;  4HM7 A;  4HM1 A;  2XRX A;  3GKE A;  1WQL A;  4NBG D;  1JM1 A;  2E4Q A;  3L70 E;  4AIV A;  2YIU C;  4HJL A;  2NUK A;  2NVF A;  1O7M A;  4PD4 E;  4QUR A;  4HM6 A;  3GOB A;  1ZRT E;  2E75 D;  1NTZ E;  2YFI A;  3GZX A;  2HML A;  2YFL A;  1NTM E;  1PP9 E;  1SQP E;  3DQY A;  3EQQ A;  4NBF D;  4HM5 A;  3CXH E;  3GB4 A;  4QCK A;  1SQX E;  2D2C D;  4HM8 A;  1VCK A;  1BE3 E;  1L0N E;  3VMI D;  3VMH D;  4AAY B;  5HL4 A;  3L73 E;  2QPZ A;  3L74 E;  4NBC D;  2YFJ A;  2E4P A;  2Q3W A;  2NWF A;  2NVE A;  4HKV A;  4OGQ D;  2BMR A;  2HMM A;  2E76 D;  1Q90 C;  4H44 D;  4QDD A;  1FQT A;  2XR8 A;  2B1X A;  2E74 D;  3L75 E;  2ZT9 D;  4NB9 D;  2HMJ A;  2B24 A;  3VCP A;  1O7N A;  4NBB D;  4QUP A;  3BCC E;  1G8K B;  5KLV E;  4EMJ B;  4H0L D;  1G8J B;  5CXM A;  1UUV A;  1O7H A;  2FYU E;  2CKF A;  3GCE A;  4HM0 A;  4PV1 D;  1NU1 E;  3GZY A;  4QDF B;  1KB9 E;  4NBE D;  1O7W A;  5AEW A;  1L0L E;  3TGU E;  3VCA A;  1O7G A;  4NBD D;  3H1L E;  1NYK A;  3N0Q A;  2BCC E;  2NUM A;  4NB8 D;  2GBX A;  3AZC A;  1O7P A;  1ULI A;  3H1I E;  2HMO A;  4QDF A;  1NTK E;  1SQV E;  4NBA D;  1EG9 A;  1VM9 A;  2YVJ B;  3GL2 A;  2A06 E;  2HMN A;  1SQQ E;  4HM2 A;  3D89 A;  4P1B H;  3GTE A;  3C0D A;  1ULJ A;  3VMG D;  2DE5 D;  2NVG A;  1NDO A;  2BMO A;  4H13 D;  5BOK A;  1BCC E;  1VF5 D;  2HMK A;  5KLI C;  1P84 E;  2JO6 A;  3GTS A;  5AEU A;  3FOU A;  3L72 E;  1KYO E;  1RIE A;  4QUQ A;  2ZYL A;  3CX5 E;  2GBW A;  1PPJ E;  2QJY C;  4NBH D;  2DE7 D;  2FYN C;  3L71 E;  4HM4 A;  5KKZ C;  2XSH A;  2I7F A;  2IBZ E;  2QJK C;  1SJG A;  2XSO A;  4QDC A;  3H1K E;  2QJP C;  1RFS A;  1EZV E;  3GL0 A;  4HM3 A;  3CWB E;  3EN1 A;  3H1H E;  1UUW A;  2JZA A;  4U3F E;  1SQB E; 
#chains in the Genus database with same CATH homology
 4P1C H;  2BMQ A;  2DE6 D;  3H1J E;  4HM7 A;  4HM1 A;  2XRX A;  3GKE A;  1WQL A;  4NBG D;  1JM1 A;  2E4Q A;  3L70 E;  4AIV A;  2YIU C;  4HJL A;  2NUK A;  2NVF A;  1O7M A;  4PD4 E;  4QUR A;  4HM6 A;  3GOB A;  1ZRT E;  2E75 D;  1NTZ E;  2YFI A;  3GZX A;  2HML A;  2YFL A;  1NTM E;  1PP9 E;  1SQP E;  3DQY A;  3EQQ A;  4NBF D;  4HM5 A;  3CXH E;  3GB4 A;  4QCK A;  1SQX E;  2D2C D;  4HM8 A;  1VCK A;  1BE3 E;  1L0N E;  3VMI D;  3VMH D;  4AAY B;  5HL4 A;  3L73 E;  2QPZ A;  3L74 E;  4NBC D;  2YFJ A;  2E4P A;  2Q3W A;  2NWF A;  2NVE A;  4HKV A;  4OGQ D;  2BMR A;  2HMM A;  2E76 D;  1Q90 C;  4H44 D;  4QDD A;  1FQT A;  2XR8 A;  2B1X A;  2E74 D;  3L75 E;  2ZT9 D;  4NB9 D;  2HMJ A;  2B24 A;  3VCP A;  1O7N A;  4NBB D;  4QUP A;  3BCC E;  1G8K B;  5KLV E;  4EMJ B;  4H0L D;  1G8J B;  5CXM A;  1UUV A;  1O7H A;  2FYU E;  2CKF A;  3GCE A;  4HM0 A;  4PV1 D;  1NU1 E;  3GZY A;  4QDF B;  1KB9 E;  4NBE D;  1O7W A;  5AEW A;  1L0L E;  3TGU E;  3VCA A;  1O7G A;  4NBD D;  3H1L E;  1NYK A;  3N0Q A;  2BCC E;  2NUM A;  4NB8 D;  2GBX A;  3AZC A;  1O7P A;  1ULI A;  3H1I E;  2HMO A;  4QDF A;  1NTK E;  1SQV E;  4NBA D;  1EG9 A;  1VM9 A;  2YVJ B;  3GL2 A;  2A06 E;  2HMN A;  1SQQ E;  4HM2 A;  3D89 A;  4P1B H;  3GTE A;  3C0D A;  1ULJ A;  3VMG D;  2DE5 D;  2NVG A;  1NDO A;  2BMO A;  4H13 D;  5BOK A;  1BCC E;  1VF5 D;  2HMK A;  5KLI C;  1P84 E;  2JO6 A;  3GTS A;  5AEU A;  3FOU A;  3L72 E;  1KYO E;  1RIE A;  4QUQ A;  2ZYL A;  3CX5 E;  2GBW A;  1PPJ E;  2QJY C;  4NBH D;  2DE7 D;  2FYN C;  3L71 E;  4HM4 A;  5KKZ C;  2XSH A;  2I7F A;  2IBZ E;  2QJK C;  1SJG A;  2XSO A;  4QDC A;  3H1K E;  2QJP C;  1RFS A;  1EZV E;  3GL0 A;  4HM3 A;  3CWB E;  3EN1 A;  3H1H E;  1UUW A;  2JZA A;  4U3F E;  1SQB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...