2NVEA

Soluble domain of rieske iron sulfur protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGTHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nveA00
2XSHA 1KB9E 3DQYA 2B24A 1RIEA 2DE7D 1PP9E 3GB4A 2A06E 4QUQA 4H13D 1L0LE 1NDOA 3H1IE 1SQXE 2ZT9D 2B1XA 4NBAD 2NVFA 1SQBE 4H0LD 3GZYA 3VMID 5KKZC 5KLIC 3EQQA 2DE5D 4NBGD 2FYUE 2HMNA 1ULJA 4QDDA 2JO6A 4P1BH 4HM7A 1NTME 1O7MA 4NB8D 2YFJA 4HM1A 1ULIA 4QDCA 2BCCE 3L71E 1VM9A 3L73E 2NVEA 4NBFD 4HM4A 2HMOA 3BCCE 1L0NE 2GBWA 1SQVE 4H44D 4AAYB 2GBXA 1PPJE 4HM3A 2BMRA 2D2CD 3FOUA 4QDFB 2NUKA 2FYNC 4QCKA 1EZVE 3N0QA 1VCKA 1O7GA 3D89A 4NBHD 4U3FE 1NTZE 2BMQA 2YFLA 4HJLA 3H1KE 4QUPA 1SQPE 1G8KB 3VCPA 4HM8A 4HM5A 3GZXA 2E4QA 2JZAA 5HL4A 1NYKA 2I7FA 1G8JB 2NUMA 1RFSA 1KYOE 2HMMA 3TGUE 1VF5D 3VMGD 5KLVE 1NTKE 2CKFA 5AEWA 2DE6D 4QDFA 1FQTA 2YIUC 3VCAA 1WQLA 2BMOA 1NU1E 1Q90C 2E76D 2NVGA 3CWBE 3EN1A 3GL0A 2QJKC 3H1JE 1BE3E 2HMKA 4NB9D 4HM6A 4EMJB 1O7PA 1BCCE 5CXMA 2QJYC 3VMHD 1JM1A 2XRXA 4HM0A 2Q3WA 1EG9A 4PV1D 4HM2A 4HKVA 4NBED 1O7HA 2E4PA 3H1LE 3L72E 4PD4E 1UUWA 4QURA 2HMLA 2XSOA 2QJPC 4NBBD 1SJGA 2HMJA 4NBDD 1ZRTE 2XR8A 4AIVA 2NWFA 4NBCD 3L74E 1O7NA 3GTEA 3GKEA 2YVJB 5BOKA 2E74D 1O7WA 3CXHE 3GTSA 2E75D 3GCEA 1P84E 2ZYLA 3H1HE 2IBZE 1UUVA 4OGQD 2YFIA 3GL2A 3GOBA 4P1CH 3L75E 3AZCA 3CX5E 2QPZA 3C0DA 5AEUA 3L70E 1SQQE
chains in the Genus database with same CATH superfamily
2XSHA 1KB9E 3DQYA 2B24A 1RIEA 2DE7D 1PP9E 3GB4A 2A06E 4QUQA 4H13D 1L0LE 1NDOA 3H1IE 1SQXE 2ZT9D 2B1XA 4NBAD 2NVFA 1SQBE 4H0LD 3GZYA 3VMID 5KKZC 5KLIC 3EQQA 2DE5D 4NBGD 2FYUE 2HMNA 1ULJA 4QDDA 2JO6A 4P1BH 4HM7A 1NTME 1O7MA 4NB8D 2YFJA 4HM1A 1ULIA 4QDCA 2BCCE 3L71E 1VM9A 3L73E 2NVEA 4NBFD 4HM4A 2HMOA 3BCCE 1L0NE 2GBWA 1SQVE 4H44D 4AAYB 2GBXA 1PPJE 4HM3A 2BMRA 2D2CD 3FOUA 4QDFB 2NUKA 2FYNC 4QCKA 1EZVE 3N0QA 1VCKA 1O7GA 3D89A 4NBHD 4U3FE 1NTZE 2BMQA 2YFLA 4HJLA 3H1KE 4QUPA 1SQPE 1G8KB 3VCPA 4HM8A 4HM5A 3GZXA 2E4QA 2JZAA 5HL4A 1NYKA 2I7FA 1G8JB 2NUMA 1RFSA 1KYOE 2HMMA 3TGUE 1VF5D 3VMGD 5KLVE 1NTKE 2CKFA 5AEWA 2DE6D 4QDFA 1FQTA 2YIUC 3VCAA 1WQLA 2BMOA 1NU1E 1Q90C 2E76D 2NVGA 3CWBE 3EN1A 3GL0A 2QJKC 3H1JE 1BE3E 2HMKA 4NB9D 4HM6A 4EMJB 1O7PA 1BCCE 5CXMA 2QJYC 3VMHD 1JM1A 2XRXA 4HM0A 2Q3WA 1EG9A 4PV1D 4HM2A 4HKVA 4NBED 1O7HA 2E4PA 3H1LE 3L72E 4PD4E 1UUWA 4QURA 2HMLA 2XSOA 2QJPC 4NBBD 1SJGA 2HMJA 4NBDD 1ZRTE 2XR8A 4AIVA 2NWFA 4NBCD 3L74E 1O7NA 3GTEA 3GKEA 2YVJB 5BOKA 2E74D 1O7WA 3CXHE 3GTSA 2E75D 3GCEA 1P84E 2ZYLA 3H1HE 2IBZE 1UUVA 4OGQD 2YFIA 3GL2A 3GOBA 4P1CH 3L75E 3AZCA 3CX5E 2QPZA 3C0DA 5AEUA 3L70E 1SQQE
chains in the Genus database with same CATH topology
2XSHA 1KB9E 3DQYA 2B24A 1RIEA 2DE7D 1PP9E 3GB4A 2A06E 4QUQA 4H13D 1L0LE 1NDOA 3H1IE 1SQXE 2ZT9D 2B1XA 4NBAD 2NVFA 1SQBE 4H0LD 3GZYA 3VMID 5KKZC 5KLIC 3EQQA 2DE5D 4NBGD 2FYUE 2HMNA 1ULJA 4QDDA 2JO6A 4P1BH 4HM7A 1NTME 1O7MA 4NB8D 2YFJA 4HM1A 1ULIA 4QDCA 2BCCE 3L71E 1VM9A 3L73E 2NVEA 4NBFD 4HM4A 2HMOA 3BCCE 1L0NE 2GBWA 1SQVE 4H44D 4AAYB 2GBXA 1PPJE 4HM3A 2BMRA 2D2CD 3FOUA 4QDFB 2NUKA 2FYNC 4QCKA 1EZVE 3N0QA 1VCKA 1O7GA 3D89A 4NBHD 4U3FE 1NTZE 2BMQA 2YFLA 4HJLA 3H1KE 4QUPA 1SQPE 1G8KB 3VCPA 4HM8A 4HM5A 3GZXA 2E4QA 2JZAA 5HL4A 1NYKA 2I7FA 1G8JB 2NUMA 1RFSA 1KYOE 2HMMA 3TGUE 1VF5D 3VMGD 5KLVE 1NTKE 2CKFA 5AEWA 2DE6D 4QDFA 1FQTA 2YIUC 3VCAA 1WQLA 2BMOA 1NU1E 1Q90C 2E76D 2NVGA 3CWBE 3EN1A 3GL0A 2QJKC 3H1JE 1BE3E 2HMKA 4NB9D 4HM6A 4EMJB 1O7PA 1BCCE 5CXMA 2QJYC 3VMHD 1JM1A 2XRXA 4HM0A 2Q3WA 1EG9A 4PV1D 4HM2A 4HKVA 4NBED 1O7HA 2E4PA 3H1LE 3L72E 4PD4E 1UUWA 4QURA 2HMLA 2XSOA 2QJPC 4NBBD 1SJGA 2HMJA 4NBDD 1ZRTE 2XR8A 4AIVA 2NWFA 4NBCD 3L74E 1O7NA 3GTEA 3GKEA 2YVJB 5BOKA 2E74D 1O7WA 3CXHE 3GTSA 2E75D 3GCEA 1P84E 2ZYLA 3H1HE 2IBZE 1UUVA 4OGQD 2YFIA 3GL2A 3GOBA 4P1CH 3L75E 3AZCA 3CX5E 2QPZA 3C0DA 5AEUA 3L70E 1SQQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSH A;  1KB9 E;  3DQY A;  2B24 A;  1RIE A;  2DE7 D;  1PP9 E;  3GB4 A;  2A06 E;  4QUQ A;  4H13 D;  1L0L E;  1NDO A;  3H1I E;  1SQX E;  2ZT9 D;  2B1X A;  4NBA D;  2NVF A;  1SQB E;  4H0L D;  3GZY A;  3VMI D;  5KKZ C;  5KLI C;  3EQQ A;  2DE5 D;  4NBG D;  2FYU E;  2HMN A;  1ULJ A;  4QDD A;  2JO6 A;  4P1B H;  4HM7 A;  1NTM E;  1O7M A;  4NB8 D;  2YFJ A;  4HM1 A;  1ULI A;  4QDC A;  2BCC E;  3L71 E;  1VM9 A;  3L73 E;  2NVE A;  4NBF D;  4HM4 A;  2HMO A;  3BCC E;  1L0N E;  2GBW A;  1SQV E;  4H44 D;  4AAY B;  2GBX A;  1PPJ E;  4HM3 A;  2BMR A;  2D2C D;  3FOU A;  4QDF B;  2NUK A;  2FYN C;  4QCK A;  1EZV E;  3N0Q A;  1VCK A;  1O7G A;  3D89 A;  4NBH D;  4U3F E;  1NTZ E;  2BMQ A;  2YFL A;  4HJL A;  3H1K E;  4QUP A;  1SQP E;  1G8K B;  3VCP A;  4HM8 A;  4HM5 A;  3GZX A;  2E4Q A;  2JZA A;  5HL4 A;  1NYK A;  2I7F A;  1G8J B;  2NUM A;  1RFS A;  1KYO E;  2HMM A;  3TGU E;  1VF5 D;  3VMG D;  5KLV E;  1NTK E;  2CKF A;  5AEW A;  2DE6 D;  4QDF A;  1FQT A;  2YIU C;  3VCA A;  1WQL A;  2BMO A;  1NU1 E;  1Q90 C;  2E76 D;  2NVG A;  3CWB E;  3EN1 A;  3GL0 A;  2QJK C;  3H1J E;  1BE3 E;  2HMK A;  4NB9 D;  4HM6 A;  4EMJ B;  1O7P A;  1BCC E;  5CXM A;  2QJY C;  3VMH D;  1JM1 A;  2XRX A;  4HM0 A;  2Q3W A;  1EG9 A;  4PV1 D;  4HM2 A;  4HKV A;  4NBE D;  1O7H A;  2E4P A;  3H1L E;  3L72 E;  4PD4 E;  1UUW A;  4QUR A;  2HML A;  2XSO A;  2QJP C;  4NBB D;  1SJG A;  2HMJ A;  4NBD D;  1ZRT E;  2XR8 A;  4AIV A;  2NWF A;  4NBC D;  3L74 E;  1O7N A;  3GTE A;  3GKE A;  2YVJ B;  5BOK A;  2E74 D;  1O7W A;  3CXH E;  3GTS A;  2E75 D;  3GCE A;  1P84 E;  2ZYL A;  3H1H E;  2IBZ E;  1UUV A;  4OGQ D;  2YFI A;  3GL2 A;  3GOB A;  4P1C H;  3L75 E;  3AZC A;  3CX5 E;  2QPZ A;  3C0D A;  5AEU A;  3L70 E;  1SQQ E; 
#chains in the Genus database with same CATH topology
 2XSH A;  1KB9 E;  3DQY A;  2B24 A;  1RIE A;  2DE7 D;  1PP9 E;  3GB4 A;  2A06 E;  4QUQ A;  4H13 D;  1L0L E;  1NDO A;  3H1I E;  1SQX E;  2ZT9 D;  2B1X A;  4NBA D;  2NVF A;  1SQB E;  4H0L D;  3GZY A;  3VMI D;  5KKZ C;  5KLI C;  3EQQ A;  2DE5 D;  4NBG D;  2FYU E;  2HMN A;  1ULJ A;  4QDD A;  2JO6 A;  4P1B H;  4HM7 A;  1NTM E;  1O7M A;  4NB8 D;  2YFJ A;  4HM1 A;  1ULI A;  4QDC A;  2BCC E;  3L71 E;  1VM9 A;  3L73 E;  2NVE A;  4NBF D;  4HM4 A;  2HMO A;  3BCC E;  1L0N E;  2GBW A;  1SQV E;  4H44 D;  4AAY B;  2GBX A;  1PPJ E;  4HM3 A;  2BMR A;  2D2C D;  3FOU A;  4QDF B;  2NUK A;  2FYN C;  4QCK A;  1EZV E;  3N0Q A;  1VCK A;  1O7G A;  3D89 A;  4NBH D;  4U3F E;  1NTZ E;  2BMQ A;  2YFL A;  4HJL A;  3H1K E;  4QUP A;  1SQP E;  1G8K B;  3VCP A;  4HM8 A;  4HM5 A;  3GZX A;  2E4Q A;  2JZA A;  5HL4 A;  1NYK A;  2I7F A;  1G8J B;  2NUM A;  1RFS A;  1KYO E;  2HMM A;  3TGU E;  1VF5 D;  3VMG D;  5KLV E;  1NTK E;  2CKF A;  5AEW A;  2DE6 D;  4QDF A;  1FQT A;  2YIU C;  3VCA A;  1WQL A;  2BMO A;  1NU1 E;  1Q90 C;  2E76 D;  2NVG A;  3CWB E;  3EN1 A;  3GL0 A;  2QJK C;  3H1J E;  1BE3 E;  2HMK A;  4NB9 D;  4HM6 A;  4EMJ B;  1O7P A;  1BCC E;  5CXM A;  2QJY C;  3VMH D;  1JM1 A;  2XRX A;  4HM0 A;  2Q3W A;  1EG9 A;  4PV1 D;  4HM2 A;  4HKV A;  4NBE D;  1O7H A;  2E4P A;  3H1L E;  3L72 E;  4PD4 E;  1UUW A;  4QUR A;  2HML A;  2XSO A;  2QJP C;  4NBB D;  1SJG A;  2HMJ A;  4NBD D;  1ZRT E;  2XR8 A;  4AIV A;  2NWF A;  4NBC D;  3L74 E;  1O7N A;  3GTE A;  3GKE A;  2YVJ B;  5BOK A;  2E74 D;  1O7W A;  3CXH E;  3GTS A;  2E75 D;  3GCE A;  1P84 E;  2ZYL A;  3H1H E;  2IBZ E;  1UUV A;  4OGQ D;  2YFI A;  3GL2 A;  3GOB A;  4P1C H;  3L75 E;  3AZC A;  3CX5 E;  2QPZ A;  3C0D A;  5AEU A;  3L70 E;  1SQQ E; 
#chains in the Genus database with same CATH homology
 2XSH A;  1KB9 E;  3DQY A;  2B24 A;  1RIE A;  2DE7 D;  1PP9 E;  3GB4 A;  2A06 E;  4QUQ A;  4H13 D;  1L0L E;  1NDO A;  3H1I E;  1SQX E;  2ZT9 D;  2B1X A;  4NBA D;  2NVF A;  1SQB E;  4H0L D;  3GZY A;  3VMI D;  5KKZ C;  5KLI C;  3EQQ A;  2DE5 D;  4NBG D;  2FYU E;  2HMN A;  1ULJ A;  4QDD A;  2JO6 A;  4P1B H;  4HM7 A;  1NTM E;  1O7M A;  4NB8 D;  2YFJ A;  4HM1 A;  1ULI A;  4QDC A;  2BCC E;  3L71 E;  1VM9 A;  3L73 E;  2NVE A;  4NBF D;  4HM4 A;  2HMO A;  3BCC E;  1L0N E;  2GBW A;  1SQV E;  4H44 D;  4AAY B;  2GBX A;  1PPJ E;  4HM3 A;  2BMR A;  2D2C D;  3FOU A;  4QDF B;  2NUK A;  2FYN C;  4QCK A;  1EZV E;  3N0Q A;  1VCK A;  1O7G A;  3D89 A;  4NBH D;  4U3F E;  1NTZ E;  2BMQ A;  2YFL A;  4HJL A;  3H1K E;  4QUP A;  1SQP E;  1G8K B;  3VCP A;  4HM8 A;  4HM5 A;  3GZX A;  2E4Q A;  2JZA A;  5HL4 A;  1NYK A;  2I7F A;  1G8J B;  2NUM A;  1RFS A;  1KYO E;  2HMM A;  3TGU E;  1VF5 D;  3VMG D;  5KLV E;  1NTK E;  2CKF A;  5AEW A;  2DE6 D;  4QDF A;  1FQT A;  2YIU C;  3VCA A;  1WQL A;  2BMO A;  1NU1 E;  1Q90 C;  2E76 D;  2NVG A;  3CWB E;  3EN1 A;  3GL0 A;  2QJK C;  3H1J E;  1BE3 E;  2HMK A;  4NB9 D;  4HM6 A;  4EMJ B;  1O7P A;  1BCC E;  5CXM A;  2QJY C;  3VMH D;  1JM1 A;  2XRX A;  4HM0 A;  2Q3W A;  1EG9 A;  4PV1 D;  4HM2 A;  4HKV A;  4NBE D;  1O7H A;  2E4P A;  3H1L E;  3L72 E;  4PD4 E;  1UUW A;  4QUR A;  2HML A;  2XSO A;  2QJP C;  4NBB D;  1SJG A;  2HMJ A;  4NBD D;  1ZRT E;  2XR8 A;  4AIV A;  2NWF A;  4NBC D;  3L74 E;  1O7N A;  3GTE A;  3GKE A;  2YVJ B;  5BOK A;  2E74 D;  1O7W A;  3CXH E;  3GTS A;  2E75 D;  3GCE A;  1P84 E;  2ZYL A;  3H1H E;  2IBZ E;  1UUV A;  4OGQ D;  2YFI A;  3GL2 A;  3GOB A;  4P1C H;  3L75 E;  3AZC A;  3CX5 E;  2QPZ A;  3C0D A;  5AEU A;  3L70 E;  1SQQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...