2NVEA

Soluble domain of rieske iron sulfur protein
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
141
structure length
141
Chain Sequence
b'LASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGTHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase iron-sulfur subunit
publication title Atomic resolution structures of rieske iron-sulfur protein: role of hydrogen bonds in tuning the redox potential of iron-sulfur clusters.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 40
structure length 141
sequence length 141
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2006-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2nveA00
3L70E 2IBZE 1VF5D 1EZVE 4NBCD 2XRXA 1NTZE 2YFJA 1EG9A 1BCCE 1SQQE 3EQQA 1VM9A 2B1XA 2BMOA 3H1LE 2DE5D 2ZT9D 1G8KB 3VCAA 2YIUC 4HM1A 1ZRTE 4NBGD 4H13D 4HJLA 2E75D 2NVFA 2JZAA 4QURA 4HM2A 5KLIC 2XSOA 1L0NE 2NUKA 1NTKE 2GBXA 2E4QA 2JO6A 3L71E 3VMHD 1FQTA 3GCEA 2HMMA 2NVGA 4HKVA 4P1BH 1BE3E 1PPJE 2I7FA 2HMOA 2FYNC 3L72E 2QJYC 2BCCE 1SQPE 2D2CD 3GL0A 3GL2A 4NBED 1O7WA 3L73E 1Q90C 2E74D 3D89A 3L74E 2BMRA 3GTSA 3GZXA 3H1JE 3TGUE 1L0LE 4QDFA 2NUMA 2HMLA 3N0QA 4OGQD 5AEWA 2HMKA 4QDCA 4HM5A 1SQBE 4NB8D 4HM4A 4QCKA 4HM3A 2B24A 1O7HA 1ULJA 3VCPA 3H1HE 2FYUE 2HMJA 3GOBA 3CXHE 3GB4A 4P1CH 2E4PA 3GZYA 1VCKA 4QDDA 4QDFB 1NYKA 1RIEA 4PV1D 2HMNA 1KB9E 2YVJB 5CXMA 2GBWA 5KKZC 4HM7A 4NBDD 1SJGA 4HM6A 3GTEA 4NB9D 3L75E 3CX5E 3BCCE 3FOUA 4NBBD 3GKEA 4AAYB 1UUVA 3CWBE 4H44D 3EN1A 1RFSA 2NWFA 2XR8A 4H0LD 1SQXE 2CKFA 2DE6D 2QJPC 1O7PA 4NBHD 4PD4E 2ZYLA 4HM8A 3H1KE 5HL4A 1G8JB 2YFIA 3AZCA 4EMJB 2BMQA 2YFLA 1UUWA 2A06E 5AEUA 1SQVE 3DQYA 2DE7D 4HM0A 1O7MA 1KYOE 3H1IE 1O7GA 1WQLA 3C0DA 3VMGD 2NVEA 4QUPA 5BOKA 4AIVA 1P84E 3VMID 5KLVE 1O7NA 1NU1E 1ULIA 1NDOA 4NBFD 4QUQA 4NBAD 2QJKC 2E76D 2Q3WA 2XSHA 4U3FE 2QPZA 1JM1A 1NTME 1PP9E
chains in the Genus database with same CATH superfamily
3L70E 2IBZE 1VF5D 1EZVE 4NBCD 2XRXA 1NTZE 2YFJA 1EG9A 1BCCE 1SQQE 3EQQA 1VM9A 2B1XA 2BMOA 3H1LE 2DE5D 2ZT9D 1G8KB 3VCAA 2YIUC 4HM1A 1ZRTE 4NBGD 4H13D 4HJLA 2E75D 2NVFA 2JZAA 4QURA 4HM2A 5KLIC 2XSOA 1L0NE 2NUKA 1NTKE 2GBXA 2E4QA 2JO6A 3L71E 3VMHD 1FQTA 3GCEA 2HMMA 2NVGA 4HKVA 4P1BH 1BE3E 1PPJE 2I7FA 2HMOA 2FYNC 3L72E 2QJYC 2BCCE 1SQPE 2D2CD 3GL0A 3GL2A 4NBED 1O7WA 3L73E 1Q90C 2E74D 3D89A 3L74E 2BMRA 3GTSA 3GZXA 3H1JE 3TGUE 1L0LE 4QDFA 2NUMA 2HMLA 3N0QA 4OGQD 5AEWA 2HMKA 4QDCA 4HM5A 1SQBE 4NB8D 4HM4A 4QCKA 4HM3A 2B24A 1O7HA 1ULJA 3VCPA 3H1HE 2FYUE 2HMJA 3GOBA 3CXHE 3GB4A 4P1CH 2E4PA 3GZYA 1VCKA 4QDDA 4QDFB 1NYKA 1RIEA 4PV1D 2HMNA 1KB9E 2YVJB 5CXMA 2GBWA 5KKZC 4HM7A 4NBDD 1SJGA 4HM6A 3GTEA 4NB9D 3L75E 3CX5E 3BCCE 3FOUA 4NBBD 3GKEA 4AAYB 1UUVA 3CWBE 4H44D 3EN1A 1RFSA 2NWFA 2XR8A 4H0LD 1SQXE 2CKFA 2DE6D 2QJPC 1O7PA 4NBHD 4PD4E 2ZYLA 4HM8A 3H1KE 5HL4A 1G8JB 2YFIA 3AZCA 4EMJB 2BMQA 2YFLA 1UUWA 2A06E 5AEUA 1SQVE 3DQYA 2DE7D 4HM0A 1O7MA 1KYOE 3H1IE 1O7GA 1WQLA 3C0DA 3VMGD 2NVEA 4QUPA 5BOKA 4AIVA 1P84E 3VMID 5KLVE 1O7NA 1NU1E 1ULIA 1NDOA 4NBFD 4QUQA 4NBAD 2QJKC 2E76D 2Q3WA 2XSHA 4U3FE 2QPZA 1JM1A 1NTME 1PP9E
chains in the Genus database with same CATH topology
3L70E 2IBZE 1VF5D 1EZVE 4NBCD 2XRXA 1NTZE 2YFJA 1EG9A 1BCCE 1SQQE 3EQQA 1VM9A 2B1XA 2BMOA 3H1LE 2DE5D 2ZT9D 1G8KB 3VCAA 2YIUC 4HM1A 1ZRTE 4NBGD 4H13D 4HJLA 2E75D 2NVFA 2JZAA 4QURA 4HM2A 5KLIC 2XSOA 1L0NE 2NUKA 1NTKE 2GBXA 2E4QA 2JO6A 3L71E 3VMHD 1FQTA 3GCEA 2HMMA 2NVGA 4HKVA 4P1BH 1BE3E 1PPJE 2I7FA 2HMOA 2FYNC 3L72E 2QJYC 2BCCE 1SQPE 2D2CD 3GL0A 3GL2A 4NBED 1O7WA 3L73E 1Q90C 2E74D 3D89A 3L74E 2BMRA 3GTSA 3GZXA 3H1JE 3TGUE 1L0LE 4QDFA 2NUMA 2HMLA 3N0QA 4OGQD 5AEWA 2HMKA 4QDCA 4HM5A 1SQBE 4NB8D 4HM4A 4QCKA 4HM3A 2B24A 1O7HA 1ULJA 3VCPA 3H1HE 2FYUE 2HMJA 3GOBA 3CXHE 3GB4A 4P1CH 2E4PA 3GZYA 1VCKA 4QDDA 4QDFB 1NYKA 1RIEA 4PV1D 2HMNA 1KB9E 2YVJB 5CXMA 2GBWA 5KKZC 4HM7A 4NBDD 1SJGA 4HM6A 3GTEA 4NB9D 3L75E 3CX5E 3BCCE 3FOUA 4NBBD 3GKEA 4AAYB 1UUVA 3CWBE 4H44D 3EN1A 1RFSA 2NWFA 2XR8A 4H0LD 1SQXE 2CKFA 2DE6D 2QJPC 1O7PA 4NBHD 4PD4E 2ZYLA 4HM8A 3H1KE 5HL4A 1G8JB 2YFIA 3AZCA 4EMJB 2BMQA 2YFLA 1UUWA 2A06E 5AEUA 1SQVE 3DQYA 2DE7D 4HM0A 1O7MA 1KYOE 3H1IE 1O7GA 1WQLA 3C0DA 3VMGD 2NVEA 4QUPA 5BOKA 4AIVA 1P84E 3VMID 5KLVE 1O7NA 1NU1E 1ULIA 1NDOA 4NBFD 4QUQA 4NBAD 2QJKC 2E76D 2Q3WA 2XSHA 4U3FE 2QPZA 1JM1A 1NTME 1PP9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 E;  2IBZ E;  1VF5 D;  1EZV E;  4NBC D;  2XRX A;  1NTZ E;  2YFJ A;  1EG9 A;  1BCC E;  1SQQ E;  3EQQ A;  1VM9 A;  2B1X A;  2BMO A;  3H1L E;  2DE5 D;  2ZT9 D;  1G8K B;  3VCA A;  2YIU C;  4HM1 A;  1ZRT E;  4NBG D;  4H13 D;  4HJL A;  2E75 D;  2NVF A;  2JZA A;  4QUR A;  4HM2 A;  5KLI C;  2XSO A;  1L0N E;  2NUK A;  1NTK E;  2GBX A;  2E4Q A;  2JO6 A;  3L71 E;  3VMH D;  1FQT A;  3GCE A;  2HMM A;  2NVG A;  4HKV A;  4P1B H;  1BE3 E;  1PPJ E;  2I7F A;  2HMO A;  2FYN C;  3L72 E;  2QJY C;  2BCC E;  1SQP E;  2D2C D;  3GL0 A;  3GL2 A;  4NBE D;  1O7W A;  3L73 E;  1Q90 C;  2E74 D;  3D89 A;  3L74 E;  2BMR A;  3GTS A;  3GZX A;  3H1J E;  3TGU E;  1L0L E;  4QDF A;  2NUM A;  2HML A;  3N0Q A;  4OGQ D;  5AEW A;  2HMK A;  4QDC A;  4HM5 A;  1SQB E;  4NB8 D;  4HM4 A;  4QCK A;  4HM3 A;  2B24 A;  1O7H A;  1ULJ A;  3VCP A;  3H1H E;  2FYU E;  2HMJ A;  3GOB A;  3CXH E;  3GB4 A;  4P1C H;  2E4P A;  3GZY A;  1VCK A;  4QDD A;  4QDF B;  1NYK A;  1RIE A;  4PV1 D;  2HMN A;  1KB9 E;  2YVJ B;  5CXM A;  2GBW A;  5KKZ C;  4HM7 A;  4NBD D;  1SJG A;  4HM6 A;  3GTE A;  4NB9 D;  3L75 E;  3CX5 E;  3BCC E;  3FOU A;  4NBB D;  3GKE A;  4AAY B;  1UUV A;  3CWB E;  4H44 D;  3EN1 A;  1RFS A;  2NWF A;  2XR8 A;  4H0L D;  1SQX E;  2CKF A;  2DE6 D;  2QJP C;  1O7P A;  4NBH D;  4PD4 E;  2ZYL A;  4HM8 A;  3H1K E;  5HL4 A;  1G8J B;  2YFI A;  3AZC A;  4EMJ B;  2BMQ A;  2YFL A;  1UUW A;  2A06 E;  5AEU A;  1SQV E;  3DQY A;  2DE7 D;  4HM0 A;  1O7M A;  1KYO E;  3H1I E;  1O7G A;  1WQL A;  3C0D A;  3VMG D;  2NVE A;  4QUP A;  5BOK A;  4AIV A;  1P84 E;  3VMI D;  5KLV E;  1O7N A;  1NU1 E;  1ULI A;  1NDO A;  4NBF D;  4QUQ A;  4NBA D;  2QJK C;  2E76 D;  2Q3W A;  2XSH A;  4U3F E;  2QPZ A;  1JM1 A;  1NTM E;  1PP9 E; 
#chains in the Genus database with same CATH topology
 3L70 E;  2IBZ E;  1VF5 D;  1EZV E;  4NBC D;  2XRX A;  1NTZ E;  2YFJ A;  1EG9 A;  1BCC E;  1SQQ E;  3EQQ A;  1VM9 A;  2B1X A;  2BMO A;  3H1L E;  2DE5 D;  2ZT9 D;  1G8K B;  3VCA A;  2YIU C;  4HM1 A;  1ZRT E;  4NBG D;  4H13 D;  4HJL A;  2E75 D;  2NVF A;  2JZA A;  4QUR A;  4HM2 A;  5KLI C;  2XSO A;  1L0N E;  2NUK A;  1NTK E;  2GBX A;  2E4Q A;  2JO6 A;  3L71 E;  3VMH D;  1FQT A;  3GCE A;  2HMM A;  2NVG A;  4HKV A;  4P1B H;  1BE3 E;  1PPJ E;  2I7F A;  2HMO A;  2FYN C;  3L72 E;  2QJY C;  2BCC E;  1SQP E;  2D2C D;  3GL0 A;  3GL2 A;  4NBE D;  1O7W A;  3L73 E;  1Q90 C;  2E74 D;  3D89 A;  3L74 E;  2BMR A;  3GTS A;  3GZX A;  3H1J E;  3TGU E;  1L0L E;  4QDF A;  2NUM A;  2HML A;  3N0Q A;  4OGQ D;  5AEW A;  2HMK A;  4QDC A;  4HM5 A;  1SQB E;  4NB8 D;  4HM4 A;  4QCK A;  4HM3 A;  2B24 A;  1O7H A;  1ULJ A;  3VCP A;  3H1H E;  2FYU E;  2HMJ A;  3GOB A;  3CXH E;  3GB4 A;  4P1C H;  2E4P A;  3GZY A;  1VCK A;  4QDD A;  4QDF B;  1NYK A;  1RIE A;  4PV1 D;  2HMN A;  1KB9 E;  2YVJ B;  5CXM A;  2GBW A;  5KKZ C;  4HM7 A;  4NBD D;  1SJG A;  4HM6 A;  3GTE A;  4NB9 D;  3L75 E;  3CX5 E;  3BCC E;  3FOU A;  4NBB D;  3GKE A;  4AAY B;  1UUV A;  3CWB E;  4H44 D;  3EN1 A;  1RFS A;  2NWF A;  2XR8 A;  4H0L D;  1SQX E;  2CKF A;  2DE6 D;  2QJP C;  1O7P A;  4NBH D;  4PD4 E;  2ZYL A;  4HM8 A;  3H1K E;  5HL4 A;  1G8J B;  2YFI A;  3AZC A;  4EMJ B;  2BMQ A;  2YFL A;  1UUW A;  2A06 E;  5AEU A;  1SQV E;  3DQY A;  2DE7 D;  4HM0 A;  1O7M A;  1KYO E;  3H1I E;  1O7G A;  1WQL A;  3C0D A;  3VMG D;  2NVE A;  4QUP A;  5BOK A;  4AIV A;  1P84 E;  3VMI D;  5KLV E;  1O7N A;  1NU1 E;  1ULI A;  1NDO A;  4NBF D;  4QUQ A;  4NBA D;  2QJK C;  2E76 D;  2Q3W A;  2XSH A;  4U3F E;  2QPZ A;  1JM1 A;  1NTM E;  1PP9 E; 
#chains in the Genus database with same CATH homology
 3L70 E;  2IBZ E;  1VF5 D;  1EZV E;  4NBC D;  2XRX A;  1NTZ E;  2YFJ A;  1EG9 A;  1BCC E;  1SQQ E;  3EQQ A;  1VM9 A;  2B1X A;  2BMO A;  3H1L E;  2DE5 D;  2ZT9 D;  1G8K B;  3VCA A;  2YIU C;  4HM1 A;  1ZRT E;  4NBG D;  4H13 D;  4HJL A;  2E75 D;  2NVF A;  2JZA A;  4QUR A;  4HM2 A;  5KLI C;  2XSO A;  1L0N E;  2NUK A;  1NTK E;  2GBX A;  2E4Q A;  2JO6 A;  3L71 E;  3VMH D;  1FQT A;  3GCE A;  2HMM A;  2NVG A;  4HKV A;  4P1B H;  1BE3 E;  1PPJ E;  2I7F A;  2HMO A;  2FYN C;  3L72 E;  2QJY C;  2BCC E;  1SQP E;  2D2C D;  3GL0 A;  3GL2 A;  4NBE D;  1O7W A;  3L73 E;  1Q90 C;  2E74 D;  3D89 A;  3L74 E;  2BMR A;  3GTS A;  3GZX A;  3H1J E;  3TGU E;  1L0L E;  4QDF A;  2NUM A;  2HML A;  3N0Q A;  4OGQ D;  5AEW A;  2HMK A;  4QDC A;  4HM5 A;  1SQB E;  4NB8 D;  4HM4 A;  4QCK A;  4HM3 A;  2B24 A;  1O7H A;  1ULJ A;  3VCP A;  3H1H E;  2FYU E;  2HMJ A;  3GOB A;  3CXH E;  3GB4 A;  4P1C H;  2E4P A;  3GZY A;  1VCK A;  4QDD A;  4QDF B;  1NYK A;  1RIE A;  4PV1 D;  2HMN A;  1KB9 E;  2YVJ B;  5CXM A;  2GBW A;  5KKZ C;  4HM7 A;  4NBD D;  1SJG A;  4HM6 A;  3GTE A;  4NB9 D;  3L75 E;  3CX5 E;  3BCC E;  3FOU A;  4NBB D;  3GKE A;  4AAY B;  1UUV A;  3CWB E;  4H44 D;  3EN1 A;  1RFS A;  2NWF A;  2XR8 A;  4H0L D;  1SQX E;  2CKF A;  2DE6 D;  2QJP C;  1O7P A;  4NBH D;  4PD4 E;  2ZYL A;  4HM8 A;  3H1K E;  5HL4 A;  1G8J B;  2YFI A;  3AZC A;  4EMJ B;  2BMQ A;  2YFL A;  1UUW A;  2A06 E;  5AEU A;  1SQV E;  3DQY A;  2DE7 D;  4HM0 A;  1O7M A;  1KYO E;  3H1I E;  1O7G A;  1WQL A;  3C0D A;  3VMG D;  2NVE A;  4QUP A;  5BOK A;  4AIV A;  1P84 E;  3VMI D;  5KLV E;  1O7N A;  1NU1 E;  1ULI A;  1NDO A;  4NBF D;  4QUQ A;  4NBA D;  2QJK C;  2E76 D;  2Q3W A;  2XSH A;  4U3F E;  2QPZ A;  1JM1 A;  1NTM E;  1PP9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...