3VCAA

Quaternary ammonium oxidative demethylation: x-ray crystallographic, resonance raman and uv-visible spectroscopic analysis of a rieske-type demethylase
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quaternary Ammonium Oxidative Demethylation: X-ray Crystallographic, Resonance Raman, and UV-Visible Spectroscopic Analysis of a Rieske-Type Demethylase.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Ring-hydroxylating dioxygenase
total genus 124
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2012-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3vcaA02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 3vcaA01
2E75D 1P84E 3L73E 1NTME 2HMNA 2I7FA 1NTZE 2HMJA 1WW9A 3GOBA 1O7MA 2JZAA 2BMOA 2E74D 2DE7A 2XSOA 2YFLA 3L75E 3GZYA 3GKEA 3VMHA 3VMGD 4NBGA 2E4PA 4NBHA 1KYOE 1VF5D 2E76D 2FYUE 2NUKA 1NDOA 3BCCE 3H1KE 3VMID 2QJKC 4QUPA 4AAYB 5BOKA 1Z02A 2HMKA 4NBEA 4P1CH 2DE7D 4HM6A 4OGQD 2QJYC 4EMJB 4NB9A 4QURA 4NBGD 4QCKA 3GZXA 4PV1D 4NB8A 1RIEA 3H1JE 4NBHD 4U3FE 1O7PA 2NWFA 2NVFA 2DE6D 4NBAD 3EN1A 2BMQA 2D2CD 2NUMA 2YVJB 1ULJA 3GL0A 1Q90C 5HL4A 1JM1A 4NBCA 4NBBA 1G8JB 4NB9D 5CXMA 5AEWA 1O7WA 1ZRTE 1BCCE 2CKFA 3L70E 1SQQE 1SQBE 1KB9E 3GCEA 1FQTA 1PPJE 2B24A 3FOUA 3GKQA 1VM9A 4HM2A 3GB4A 3DQYA 1BE3E 4QDCA 2Q3WA 4NBDA 2BCCE 1Z01A 1O7HA 4NBED 1L0LE 3N0QA 3TGUE 2HMMA 3GCFA 3D89A 1UUWA 2XRXA 2NVEA 1VCKA 3CXHE 3GL2A 4PD4E 5AEUA 2GBXA 2XSHA 1Z03A 4HM8A 1WQLA 4H0LD 3H1IE 1NTKE 5KLIC 2B1XA 4NBBD 1O7GA 4NBCD 4H44D 3VMGA 3GTEA 1NYKA 2YFJA 4HM3A 5KLVE 4H13D 1L0NE 4HJLA 1ULIA 1G8KB 4AIVA 2QPZA 3VCPA 2A06E 3VCAA 4P1BH 3VMIA 4QDFB 1RFSA 2E4QA 3H1LE 5KKZC 4NBFD 1SJGA 2ZT9D 3GTSA 3H1HE 2NVGA 2HMOA 4NB8D 3L71E 3CX5E 1SQXE 3L74E 1SQVE 2HMLA 4QDDA 1EG9A 2DE6A 4NBAA 2IBZE 3AZCA 2ZYLA 1SQPE 4QUQA 2BMRA 2GBWA 3EQQA 2QJPC 2DE5A 1PP9E 1UUVA 4QDFA 1NU1E 4HKVA 1O7NA 4HM4A 4HM1A 4HM0A 2JO6A 2XR8A 3L72E 2YIUC 1EZVE 4HM5A 4NBDD 2FYNC 3CWBE 4HM7A 4NBFA 3VMHD 3C0DA 2DE5D 2YFIA
chains in the Genus database with same CATH superfamily
2E75D 1P84E 3L73E 1NTME 2HMNA 2I7FA 1NTZE 2HMJA 1WW9A 3GOBA 1O7MA 2JZAA 2BMOA 2E74D 2DE7A 2XSOA 2YFLA 3L75E 3GZYA 3GKEA 3VMHA 3VMGD 4NBGA 2E4PA 4NBHA 1KYOE 1VF5D 2E76D 2FYUE 2NUKA 1NDOA 3BCCE 3H1KE 3VMID 2QJKC 4QUPA 4AAYB 5BOKA 1Z02A 2HMKA 4NBEA 4P1CH 2DE7D 4HM6A 4OGQD 2QJYC 4EMJB 4NB9A 4QURA 4NBGD 4QCKA 3GZXA 4PV1D 4NB8A 1RIEA 3H1JE 4NBHD 4U3FE 1O7PA 2NWFA 2NVFA 2DE6D 4NBAD 3EN1A 2BMQA 2D2CD 2NUMA 2YVJB 1ULJA 3GL0A 1Q90C 5HL4A 1JM1A 4NBCA 4NBBA 1G8JB 4NB9D 5CXMA 5AEWA 1O7WA 1ZRTE 1BCCE 2CKFA 3L70E 1SQQE 1SQBE 1KB9E 3GCEA 1FQTA 1PPJE 2B24A 3FOUA 3GKQA 1VM9A 4HM2A 3GB4A 3DQYA 1BE3E 4QDCA 2Q3WA 4NBDA 2BCCE 1Z01A 1O7HA 4NBED 1L0LE 3N0QA 3TGUE 2HMMA 3GCFA 3D89A 1UUWA 2XRXA 2NVEA 1VCKA 3CXHE 3GL2A 4PD4E 5AEUA 2GBXA 2XSHA 1Z03A 4HM8A 1WQLA 4H0LD 3H1IE 1NTKE 5KLIC 2B1XA 4NBBD 1O7GA 4NBCD 4H44D 3VMGA 3GTEA 1NYKA 2YFJA 4HM3A 5KLVE 4H13D 1L0NE 4HJLA 1ULIA 1G8KB 4AIVA 2QPZA 3VCPA 2A06E 3VCAA 4P1BH 3VMIA 4QDFB 1RFSA 2E4QA 3H1LE 5KKZC 4NBFD 1SJGA 2ZT9D 3GTSA 3H1HE 2NVGA 2HMOA 4NB8D 3L71E 3CX5E 1SQXE 3L74E 1SQVE 2HMLA 4QDDA 1EG9A 2DE6A 4NBAA 2IBZE 3AZCA 2ZYLA 1SQPE 4QUQA 2BMRA 2GBWA 3EQQA 2QJPC 2DE5A 1PP9E 1UUVA 4QDFA 1NU1E 4HKVA 1O7NA 4HM4A 4HM1A 4HM0A 2JO6A 2XR8A 3L72E 2YIUC 1EZVE 4HM5A 4NBDD 2FYNC 3CWBE 4HM7A 4NBFA 3VMHD 3C0DA 2DE5D 2YFIA
chains in the Genus database with same CATH topology
2E75D 1P84E 3L73E 1NTME 2HMNA 2I7FA 1NTZE 2HMJA 1WW9A 3GOBA 1O7MA 2JZAA 2BMOA 2E74D 2DE7A 2XSOA 2YFLA 3L75E 3GZYA 3GKEA 3VMHA 3VMGD 4NBGA 2E4PA 4NBHA 1KYOE 1VF5D 2E76D 2FYUE 2NUKA 1NDOA 3BCCE 3H1KE 3VMID 2QJKC 4QUPA 4AAYB 5BOKA 1Z02A 2HMKA 4NBEA 4P1CH 2DE7D 4HM6A 4OGQD 2QJYC 4EMJB 4NB9A 4QURA 4NBGD 4QCKA 3GZXA 4PV1D 4NB8A 1RIEA 3H1JE 4NBHD 4U3FE 1O7PA 2NWFA 2NVFA 2DE6D 4NBAD 3EN1A 2BMQA 2D2CD 2NUMA 2YVJB 1ULJA 3GL0A 1Q90C 5HL4A 1JM1A 4NBCA 4NBBA 1G8JB 4NB9D 5CXMA 5AEWA 1O7WA 1ZRTE 1BCCE 2CKFA 3L70E 1SQQE 1SQBE 1KB9E 3GCEA 1FQTA 1PPJE 2B24A 3FOUA 3GKQA 1VM9A 4HM2A 3GB4A 3DQYA 1BE3E 4QDCA 2Q3WA 4NBDA 2BCCE 1Z01A 1O7HA 4NBED 1L0LE 3N0QA 3TGUE 2HMMA 3GCFA 3D89A 1UUWA 2XRXA 2NVEA 1VCKA 3CXHE 3GL2A 4PD4E 5AEUA 2GBXA 2XSHA 1Z03A 4HM8A 1WQLA 4H0LD 3H1IE 1NTKE 5KLIC 2B1XA 4NBBD 1O7GA 4NBCD 4H44D 3VMGA 3GTEA 1NYKA 2YFJA 4HM3A 5KLVE 4H13D 1L0NE 4HJLA 1ULIA 1G8KB 4AIVA 2QPZA 3VCPA 2A06E 3VCAA 4P1BH 3VMIA 4QDFB 1RFSA 2E4QA 3H1LE 5KKZC 4NBFD 1SJGA 2ZT9D 3GTSA 3H1HE 2NVGA 2HMOA 4NB8D 3L71E 3CX5E 1SQXE 3L74E 1SQVE 2HMLA 4QDDA 1EG9A 2DE6A 4NBAA 2IBZE 3AZCA 2ZYLA 1SQPE 4QUQA 2BMRA 2GBWA 3EQQA 2QJPC 2DE5A 1PP9E 1UUVA 4QDFA 1NU1E 4HKVA 1O7NA 4HM4A 4HM1A 4HM0A 2JO6A 2XR8A 3L72E 2YIUC 1EZVE 4HM5A 4NBDD 2FYNC 3CWBE 4HM7A 4NBFA 3VMHD 3C0DA 2DE5D 2YFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 D;  1P84 E;  3L73 E;  1NTM E;  2HMN A;  2I7F A;  1NTZ E;  2HMJ A;  1WW9 A;  3GOB A;  1O7M A;  2JZA A;  2BMO A;  2E74 D;  2DE7 A;  2XSO A;  2YFL A;  3L75 E;  3GZY A;  3GKE A;  3VMH A;  3VMG D;  4NBG A;  2E4P A;  4NBH A;  1KYO E;  1VF5 D;  2E76 D;  2FYU E;  2NUK A;  1NDO A;  3BCC E;  3H1K E;  3VMI D;  2QJK C;  4QUP A;  4AAY B;  5BOK A;  1Z02 A;  2HMK A;  4NBE A;  4P1C H;  2DE7 D;  4HM6 A;  4OGQ D;  2QJY C;  4EMJ B;  4NB9 A;  4QUR A;  4NBG D;  4QCK A;  3GZX A;  4PV1 D;  4NB8 A;  1RIE A;  3H1J E;  4NBH D;  4U3F E;  1O7P A;  2NWF A;  2NVF A;  2DE6 D;  4NBA D;  3EN1 A;  2BMQ A;  2D2C D;  2NUM A;  2YVJ B;  1ULJ A;  3GL0 A;  1Q90 C;  5HL4 A;  1JM1 A;  4NBC A;  4NBB A;  1G8J B;  4NB9 D;  5CXM A;  5AEW A;  1O7W A;  1ZRT E;  1BCC E;  2CKF A;  3L70 E;  1SQQ E;  1SQB E;  1KB9 E;  3GCE A;  1FQT A;  1PPJ E;  2B24 A;  3FOU A;  3GKQ A;  1VM9 A;  4HM2 A;  3GB4 A;  3DQY A;  1BE3 E;  4QDC A;  2Q3W A;  4NBD A;  2BCC E;  1Z01 A;  1O7H A;  4NBE D;  1L0L E;  3N0Q A;  3TGU E;  2HMM A;  3GCF A;  3D89 A;  1UUW A;  2XRX A;  2NVE A;  1VCK A;  3CXH E;  3GL2 A;  4PD4 E;  5AEU A;  2GBX A;  2XSH A;  1Z03 A;  4HM8 A;  1WQL A;  4H0L D;  3H1I E;  1NTK E;  5KLI C;  2B1X A;  4NBB D;  1O7G A;  4NBC D;  4H44 D;  3VMG A;  3GTE A;  1NYK A;  2YFJ A;  4HM3 A;  5KLV E;  4H13 D;  1L0N E;  4HJL A;  1ULI A;  1G8K B;  4AIV A;  2QPZ A;  3VCP A;  2A06 E;  3VCA A;  4P1B H;  3VMI A;  4QDF B;  1RFS A;  2E4Q A;  3H1L E;  5KKZ C;  4NBF D;  1SJG A;  2ZT9 D;  3GTS A;  3H1H E;  2NVG A;  2HMO A;  4NB8 D;  3L71 E;  3CX5 E;  1SQX E;  3L74 E;  1SQV E;  2HML A;  4QDD A;  1EG9 A;  2DE6 A;  4NBA A;  2IBZ E;  3AZC A;  2ZYL A;  1SQP E;  4QUQ A;  2BMR A;  2GBW A;  3EQQ A;  2QJP C;  2DE5 A;  1PP9 E;  1UUV A;  4QDF A;  1NU1 E;  4HKV A;  1O7N A;  4HM4 A;  4HM1 A;  4HM0 A;  2JO6 A;  2XR8 A;  3L72 E;  2YIU C;  1EZV E;  4HM5 A;  4NBD D;  2FYN C;  3CWB E;  4HM7 A;  4NBF A;  3VMH D;  3C0D A;  2DE5 D;  2YFI A; 
#chains in the Genus database with same CATH topology
 2E75 D;  1P84 E;  3L73 E;  1NTM E;  2HMN A;  2I7F A;  1NTZ E;  2HMJ A;  1WW9 A;  3GOB A;  1O7M A;  2JZA A;  2BMO A;  2E74 D;  2DE7 A;  2XSO A;  2YFL A;  3L75 E;  3GZY A;  3GKE A;  3VMH A;  3VMG D;  4NBG A;  2E4P A;  4NBH A;  1KYO E;  1VF5 D;  2E76 D;  2FYU E;  2NUK A;  1NDO A;  3BCC E;  3H1K E;  3VMI D;  2QJK C;  4QUP A;  4AAY B;  5BOK A;  1Z02 A;  2HMK A;  4NBE A;  4P1C H;  2DE7 D;  4HM6 A;  4OGQ D;  2QJY C;  4EMJ B;  4NB9 A;  4QUR A;  4NBG D;  4QCK A;  3GZX A;  4PV1 D;  4NB8 A;  1RIE A;  3H1J E;  4NBH D;  4U3F E;  1O7P A;  2NWF A;  2NVF A;  2DE6 D;  4NBA D;  3EN1 A;  2BMQ A;  2D2C D;  2NUM A;  2YVJ B;  1ULJ A;  3GL0 A;  1Q90 C;  5HL4 A;  1JM1 A;  4NBC A;  4NBB A;  1G8J B;  4NB9 D;  5CXM A;  5AEW A;  1O7W A;  1ZRT E;  1BCC E;  2CKF A;  3L70 E;  1SQQ E;  1SQB E;  1KB9 E;  3GCE A;  1FQT A;  1PPJ E;  2B24 A;  3FOU A;  3GKQ A;  1VM9 A;  4HM2 A;  3GB4 A;  3DQY A;  1BE3 E;  4QDC A;  2Q3W A;  4NBD A;  2BCC E;  1Z01 A;  1O7H A;  4NBE D;  1L0L E;  3N0Q A;  3TGU E;  2HMM A;  3GCF A;  3D89 A;  1UUW A;  2XRX A;  2NVE A;  1VCK A;  3CXH E;  3GL2 A;  4PD4 E;  5AEU A;  2GBX A;  2XSH A;  1Z03 A;  4HM8 A;  1WQL A;  4H0L D;  3H1I E;  1NTK E;  5KLI C;  2B1X A;  4NBB D;  1O7G A;  4NBC D;  4H44 D;  3VMG A;  3GTE A;  1NYK A;  2YFJ A;  4HM3 A;  5KLV E;  4H13 D;  1L0N E;  4HJL A;  1ULI A;  1G8K B;  4AIV A;  2QPZ A;  3VCP A;  2A06 E;  3VCA A;  4P1B H;  3VMI A;  4QDF B;  1RFS A;  2E4Q A;  3H1L E;  5KKZ C;  4NBF D;  1SJG A;  2ZT9 D;  3GTS A;  3H1H E;  2NVG A;  2HMO A;  4NB8 D;  3L71 E;  3CX5 E;  1SQX E;  3L74 E;  1SQV E;  2HML A;  4QDD A;  1EG9 A;  2DE6 A;  4NBA A;  2IBZ E;  3AZC A;  2ZYL A;  1SQP E;  4QUQ A;  2BMR A;  2GBW A;  3EQQ A;  2QJP C;  2DE5 A;  1PP9 E;  1UUV A;  4QDF A;  1NU1 E;  4HKV A;  1O7N A;  4HM4 A;  4HM1 A;  4HM0 A;  2JO6 A;  2XR8 A;  3L72 E;  2YIU C;  1EZV E;  4HM5 A;  4NBD D;  2FYN C;  3CWB E;  4HM7 A;  4NBF A;  3VMH D;  3C0D A;  2DE5 D;  2YFI A; 
#chains in the Genus database with same CATH homology
 2E75 D;  1P84 E;  3L73 E;  1NTM E;  2HMN A;  2I7F A;  1NTZ E;  2HMJ A;  1WW9 A;  3GOB A;  1O7M A;  2JZA A;  2BMO A;  2E74 D;  2DE7 A;  2XSO A;  2YFL A;  3L75 E;  3GZY A;  3GKE A;  3VMH A;  3VMG D;  4NBG A;  2E4P A;  4NBH A;  1KYO E;  1VF5 D;  2E76 D;  2FYU E;  2NUK A;  1NDO A;  3BCC E;  3H1K E;  3VMI D;  2QJK C;  4QUP A;  4AAY B;  5BOK A;  1Z02 A;  2HMK A;  4NBE A;  4P1C H;  2DE7 D;  4HM6 A;  4OGQ D;  2QJY C;  4EMJ B;  4NB9 A;  4QUR A;  4NBG D;  4QCK A;  3GZX A;  4PV1 D;  4NB8 A;  1RIE A;  3H1J E;  4NBH D;  4U3F E;  1O7P A;  2NWF A;  2NVF A;  2DE6 D;  4NBA D;  3EN1 A;  2BMQ A;  2D2C D;  2NUM A;  2YVJ B;  1ULJ A;  3GL0 A;  1Q90 C;  5HL4 A;  1JM1 A;  4NBC A;  4NBB A;  1G8J B;  4NB9 D;  5CXM A;  5AEW A;  1O7W A;  1ZRT E;  1BCC E;  2CKF A;  3L70 E;  1SQQ E;  1SQB E;  1KB9 E;  3GCE A;  1FQT A;  1PPJ E;  2B24 A;  3FOU A;  3GKQ A;  1VM9 A;  4HM2 A;  3GB4 A;  3DQY A;  1BE3 E;  4QDC A;  2Q3W A;  4NBD A;  2BCC E;  1Z01 A;  1O7H A;  4NBE D;  1L0L E;  3N0Q A;  3TGU E;  2HMM A;  3GCF A;  3D89 A;  1UUW A;  2XRX A;  2NVE A;  1VCK A;  3CXH E;  3GL2 A;  4PD4 E;  5AEU A;  2GBX A;  2XSH A;  1Z03 A;  4HM8 A;  1WQL A;  4H0L D;  3H1I E;  1NTK E;  5KLI C;  2B1X A;  4NBB D;  1O7G A;  4NBC D;  4H44 D;  3VMG A;  3GTE A;  1NYK A;  2YFJ A;  4HM3 A;  5KLV E;  4H13 D;  1L0N E;  4HJL A;  1ULI A;  1G8K B;  4AIV A;  2QPZ A;  3VCP A;  2A06 E;  3VCA A;  4P1B H;  3VMI A;  4QDF B;  1RFS A;  2E4Q A;  3H1L E;  5KKZ C;  4NBF D;  1SJG A;  2ZT9 D;  3GTS A;  3H1H E;  2NVG A;  2HMO A;  4NB8 D;  3L71 E;  3CX5 E;  1SQX E;  3L74 E;  1SQV E;  2HML A;  4QDD A;  1EG9 A;  2DE6 A;  4NBA A;  2IBZ E;  3AZC A;  2ZYL A;  1SQP E;  4QUQ A;  2BMR A;  2GBW A;  3EQQ A;  2QJP C;  2DE5 A;  1PP9 E;  1UUV A;  4QDF A;  1NU1 E;  4HKV A;  1O7N A;  4HM4 A;  4HM1 A;  4HM0 A;  2JO6 A;  2XR8 A;  3L72 E;  2YIU C;  1EZV E;  4HM5 A;  4NBD D;  2FYN C;  3CWB E;  4HM7 A;  4NBF A;  3VMH D;  3C0D A;  2DE5 D;  2YFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...