5HL4A

Acoustic injectors for drop-on-demand serial femtosecond crystallography
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
401
structure length
397
Chain Sequence
TSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQWLYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVAKLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQTFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPLDPEVAGVGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMDGKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLVHKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQFVDWYAASLERALAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acoustic Injectors for Drop-On-Demand Serial Femtosecond Crystallography.
pubmed doi rcsb
source organism Sinorhizobium meliloti 1021
molecule tags Oxidoreductase
molecule keywords Ring-hydroxylating dioxygenase
total genus 108
structure length 397
sequence length 401
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5hl4A02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 5hl4A01
4NBCA 4NBHA 4NBAA 2E4QA 1UUWA 5KLVE 2HMKA 1RIEA 5AEUA 5AEWA 2BCCE 4HM4A 1L0LE 1EZVE 3N0QA 2NWFA 2DE6A 1EG9A 2BMQA 3VMHD 3VMIA 2DE5D 4H0LD 1FQTA 2B1XA 1G8KB 2XRXA 1Z02A 1NTZE 1PP9E 3VMID 1BE3E 2YFIA 3CWBE 2XSOA 2D2CD 4P1CH 1Z03A 4QCKA 4AAYB 3L71E 3L72E 3CXHE 5KKZC 4NBFD 1NYKA 2NUMA 1KB9E 3CX5E 4HM8A 2CKFA 2JO6A 4OGQD 4QDFB 3D89A 3GKQA 3GKEA 1PPJE 4NBHD 4NBCD 4H44D 3AZCA 3L73E 3GTSA 2B24A 2QPZA 4NB8D 3GCFA 1RFSA 4PV1D 2GBXA 2GBWA 2NVEA 3L74E 4HM3A 4HM5A 2A06E 1UUVA 1Z01A 3H1HE 3BCCE 4QDCA 1BCCE 2E4PA 3GZYA 2DE7D 3GZXA 1VM9A 2DE5A 2YFLA 4NB9A 4HM1A 4P1BH 2BMRA 3VMHA 5KLIC 1WQLA 2YFJA 4NB8A 2BMOA 2QJPC 3L75E 1Q90C 5BOKA 3GCEA 4U3FE 4NBED 3H1KE 1NDOA 2Q3WA 3H1IE 3VCAA 1O7NA 4QUPA 4NBEA 1ZRTE 4NBFA 2ZYLA 1NTME 1ULIA 2NVGA 1SJGA 1O7PA 4EMJB 2ZT9D 4NBBA 2XR8A 4NB9D 3C0DA 1NTKE 4QURA 3FOUA 3GL0A 3GOBA 2HMJA 1SQXE 2DE6D 2IBZE 1VF5D 2DE7A 1JM1A 4QDFA 4HM7A 1KYOE 4HJLA 4NBAD 2I7FA 3H1LE 2HMOA 3GB4A 1P84E 4HM6A 1WW9A 1O7WA 4H13D 4QUQA 3DQYA 2JZAA 1SQBE 4HM2A 3EQQA 1SQQE 3H1JE 5CXMA 2HMNA 4AIVA 2XSHA 2YIUC 1O7MA 2E75D 1O7GA 2E76D 2HMMA 3L70E 3VMGD 5HL4A 3GL2A 4HM0A 4NBDD 1ULJA 2NUKA 4NBGA 3VMGA 4NBGD 2FYUE 4HKVA 2NVFA 2FYNC 4NBDA 3VCPA 4NBBD 1G8JB 4QDDA 4PD4E 1VCKA 2YVJB 2HMLA 1NU1E 1SQPE 3TGUE 1SQVE 2QJYC 3EN1A 1L0NE 2QJKC 3GTEA 1O7HA 2E74D
chains in the Genus database with same CATH superfamily
4NBCA 4NBHA 4NBAA 2E4QA 1UUWA 5KLVE 2HMKA 1RIEA 5AEUA 5AEWA 2BCCE 4HM4A 1L0LE 1EZVE 3N0QA 2NWFA 2DE6A 1EG9A 2BMQA 3VMHD 3VMIA 2DE5D 4H0LD 1FQTA 2B1XA 1G8KB 2XRXA 1Z02A 1NTZE 1PP9E 3VMID 1BE3E 2YFIA 3CWBE 2XSOA 2D2CD 4P1CH 1Z03A 4QCKA 4AAYB 3L71E 3L72E 3CXHE 5KKZC 4NBFD 1NYKA 2NUMA 1KB9E 3CX5E 4HM8A 2CKFA 2JO6A 4OGQD 4QDFB 3D89A 3GKQA 3GKEA 1PPJE 4NBHD 4NBCD 4H44D 3AZCA 3L73E 3GTSA 2B24A 2QPZA 4NB8D 3GCFA 1RFSA 4PV1D 2GBXA 2GBWA 2NVEA 3L74E 4HM3A 4HM5A 2A06E 1UUVA 1Z01A 3H1HE 3BCCE 4QDCA 1BCCE 2E4PA 3GZYA 2DE7D 3GZXA 1VM9A 2DE5A 2YFLA 4NB9A 4HM1A 4P1BH 2BMRA 3VMHA 5KLIC 1WQLA 2YFJA 4NB8A 2BMOA 2QJPC 3L75E 1Q90C 5BOKA 3GCEA 4U3FE 4NBED 3H1KE 1NDOA 2Q3WA 3H1IE 3VCAA 1O7NA 4QUPA 4NBEA 1ZRTE 4NBFA 2ZYLA 1NTME 1ULIA 2NVGA 1SJGA 1O7PA 4EMJB 2ZT9D 4NBBA 2XR8A 4NB9D 3C0DA 1NTKE 4QURA 3FOUA 3GL0A 3GOBA 2HMJA 1SQXE 2DE6D 2IBZE 1VF5D 2DE7A 1JM1A 4QDFA 4HM7A 1KYOE 4HJLA 4NBAD 2I7FA 3H1LE 2HMOA 3GB4A 1P84E 4HM6A 1WW9A 1O7WA 4H13D 4QUQA 3DQYA 2JZAA 1SQBE 4HM2A 3EQQA 1SQQE 3H1JE 5CXMA 2HMNA 4AIVA 2XSHA 2YIUC 1O7MA 2E75D 1O7GA 2E76D 2HMMA 3L70E 3VMGD 5HL4A 3GL2A 4HM0A 4NBDD 1ULJA 2NUKA 4NBGA 3VMGA 4NBGD 2FYUE 4HKVA 2NVFA 2FYNC 4NBDA 3VCPA 4NBBD 1G8JB 4QDDA 4PD4E 1VCKA 2YVJB 2HMLA 1NU1E 1SQPE 3TGUE 1SQVE 2QJYC 3EN1A 1L0NE 2QJKC 3GTEA 1O7HA 2E74D
chains in the Genus database with same CATH topology
4NBCA 4NBHA 4NBAA 2E4QA 1UUWA 5KLVE 2HMKA 1RIEA 5AEUA 5AEWA 2BCCE 4HM4A 1L0LE 1EZVE 3N0QA 2NWFA 2DE6A 1EG9A 2BMQA 3VMHD 3VMIA 2DE5D 4H0LD 1FQTA 2B1XA 1G8KB 2XRXA 1Z02A 1NTZE 1PP9E 3VMID 1BE3E 2YFIA 3CWBE 2XSOA 2D2CD 4P1CH 1Z03A 4QCKA 4AAYB 3L71E 3L72E 3CXHE 5KKZC 4NBFD 1NYKA 2NUMA 1KB9E 3CX5E 4HM8A 2CKFA 2JO6A 4OGQD 4QDFB 3D89A 3GKQA 3GKEA 1PPJE 4NBHD 4NBCD 4H44D 3AZCA 3L73E 3GTSA 2B24A 2QPZA 4NB8D 3GCFA 1RFSA 4PV1D 2GBXA 2GBWA 2NVEA 3L74E 4HM3A 4HM5A 2A06E 1UUVA 1Z01A 3H1HE 3BCCE 4QDCA 1BCCE 2E4PA 3GZYA 2DE7D 3GZXA 1VM9A 2DE5A 2YFLA 4NB9A 4HM1A 4P1BH 2BMRA 3VMHA 5KLIC 1WQLA 2YFJA 4NB8A 2BMOA 2QJPC 3L75E 1Q90C 5BOKA 3GCEA 4U3FE 4NBED 3H1KE 1NDOA 2Q3WA 3H1IE 3VCAA 1O7NA 4QUPA 4NBEA 1ZRTE 4NBFA 2ZYLA 1NTME 1ULIA 2NVGA 1SJGA 1O7PA 4EMJB 2ZT9D 4NBBA 2XR8A 4NB9D 3C0DA 1NTKE 4QURA 3FOUA 3GL0A 3GOBA 2HMJA 1SQXE 2DE6D 2IBZE 1VF5D 2DE7A 1JM1A 4QDFA 4HM7A 1KYOE 4HJLA 4NBAD 2I7FA 3H1LE 2HMOA 3GB4A 1P84E 4HM6A 1WW9A 1O7WA 4H13D 4QUQA 3DQYA 2JZAA 1SQBE 4HM2A 3EQQA 1SQQE 3H1JE 5CXMA 2HMNA 4AIVA 2XSHA 2YIUC 1O7MA 2E75D 1O7GA 2E76D 2HMMA 3L70E 3VMGD 5HL4A 3GL2A 4HM0A 4NBDD 1ULJA 2NUKA 4NBGA 3VMGA 4NBGD 2FYUE 4HKVA 2NVFA 2FYNC 4NBDA 3VCPA 4NBBD 1G8JB 4QDDA 4PD4E 1VCKA 2YVJB 2HMLA 1NU1E 1SQPE 3TGUE 1SQVE 2QJYC 3EN1A 1L0NE 2QJKC 3GTEA 1O7HA 2E74D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NBC A;  4NBH A;  4NBA A;  2E4Q A;  1UUW A;  5KLV E;  2HMK A;  1RIE A;  5AEU A;  5AEW A;  2BCC E;  4HM4 A;  1L0L E;  1EZV E;  3N0Q A;  2NWF A;  2DE6 A;  1EG9 A;  2BMQ A;  3VMH D;  3VMI A;  2DE5 D;  4H0L D;  1FQT A;  2B1X A;  1G8K B;  2XRX A;  1Z02 A;  1NTZ E;  1PP9 E;  3VMI D;  1BE3 E;  2YFI A;  3CWB E;  2XSO A;  2D2C D;  4P1C H;  1Z03 A;  4QCK A;  4AAY B;  3L71 E;  3L72 E;  3CXH E;  5KKZ C;  4NBF D;  1NYK A;  2NUM A;  1KB9 E;  3CX5 E;  4HM8 A;  2CKF A;  2JO6 A;  4OGQ D;  4QDF B;  3D89 A;  3GKQ A;  3GKE A;  1PPJ E;  4NBH D;  4NBC D;  4H44 D;  3AZC A;  3L73 E;  3GTS A;  2B24 A;  2QPZ A;  4NB8 D;  3GCF A;  1RFS A;  4PV1 D;  2GBX A;  2GBW A;  2NVE A;  3L74 E;  4HM3 A;  4HM5 A;  2A06 E;  1UUV A;  1Z01 A;  3H1H E;  3BCC E;  4QDC A;  1BCC E;  2E4P A;  3GZY A;  2DE7 D;  3GZX A;  1VM9 A;  2DE5 A;  2YFL A;  4NB9 A;  4HM1 A;  4P1B H;  2BMR A;  3VMH A;  5KLI C;  1WQL A;  2YFJ A;  4NB8 A;  2BMO A;  2QJP C;  3L75 E;  1Q90 C;  5BOK A;  3GCE A;  4U3F E;  4NBE D;  3H1K E;  1NDO A;  2Q3W A;  3H1I E;  3VCA A;  1O7N A;  4QUP A;  4NBE A;  1ZRT E;  4NBF A;  2ZYL A;  1NTM E;  1ULI A;  2NVG A;  1SJG A;  1O7P A;  4EMJ B;  2ZT9 D;  4NBB A;  2XR8 A;  4NB9 D;  3C0D A;  1NTK E;  4QUR A;  3FOU A;  3GL0 A;  3GOB A;  2HMJ A;  1SQX E;  2DE6 D;  2IBZ E;  1VF5 D;  2DE7 A;  1JM1 A;  4QDF A;  4HM7 A;  1KYO E;  4HJL A;  4NBA D;  2I7F A;  3H1L E;  2HMO A;  3GB4 A;  1P84 E;  4HM6 A;  1WW9 A;  1O7W A;  4H13 D;  4QUQ A;  3DQY A;  2JZA A;  1SQB E;  4HM2 A;  3EQQ A;  1SQQ E;  3H1J E;  5CXM A;  2HMN A;  4AIV A;  2XSH A;  2YIU C;  1O7M A;  2E75 D;  1O7G A;  2E76 D;  2HMM A;  3L70 E;  3VMG D;  5HL4 A;  3GL2 A;  4HM0 A;  4NBD D;  1ULJ A;  2NUK A;  4NBG A;  3VMG A;  4NBG D;  2FYU E;  4HKV A;  2NVF A;  2FYN C;  4NBD A;  3VCP A;  4NBB D;  1G8J B;  4QDD A;  4PD4 E;  1VCK A;  2YVJ B;  2HML A;  1NU1 E;  1SQP E;  3TGU E;  1SQV E;  2QJY C;  3EN1 A;  1L0N E;  2QJK C;  3GTE A;  1O7H A;  2E74 D; 
#chains in the Genus database with same CATH topology
 4NBC A;  4NBH A;  4NBA A;  2E4Q A;  1UUW A;  5KLV E;  2HMK A;  1RIE A;  5AEU A;  5AEW A;  2BCC E;  4HM4 A;  1L0L E;  1EZV E;  3N0Q A;  2NWF A;  2DE6 A;  1EG9 A;  2BMQ A;  3VMH D;  3VMI A;  2DE5 D;  4H0L D;  1FQT A;  2B1X A;  1G8K B;  2XRX A;  1Z02 A;  1NTZ E;  1PP9 E;  3VMI D;  1BE3 E;  2YFI A;  3CWB E;  2XSO A;  2D2C D;  4P1C H;  1Z03 A;  4QCK A;  4AAY B;  3L71 E;  3L72 E;  3CXH E;  5KKZ C;  4NBF D;  1NYK A;  2NUM A;  1KB9 E;  3CX5 E;  4HM8 A;  2CKF A;  2JO6 A;  4OGQ D;  4QDF B;  3D89 A;  3GKQ A;  3GKE A;  1PPJ E;  4NBH D;  4NBC D;  4H44 D;  3AZC A;  3L73 E;  3GTS A;  2B24 A;  2QPZ A;  4NB8 D;  3GCF A;  1RFS A;  4PV1 D;  2GBX A;  2GBW A;  2NVE A;  3L74 E;  4HM3 A;  4HM5 A;  2A06 E;  1UUV A;  1Z01 A;  3H1H E;  3BCC E;  4QDC A;  1BCC E;  2E4P A;  3GZY A;  2DE7 D;  3GZX A;  1VM9 A;  2DE5 A;  2YFL A;  4NB9 A;  4HM1 A;  4P1B H;  2BMR A;  3VMH A;  5KLI C;  1WQL A;  2YFJ A;  4NB8 A;  2BMO A;  2QJP C;  3L75 E;  1Q90 C;  5BOK A;  3GCE A;  4U3F E;  4NBE D;  3H1K E;  1NDO A;  2Q3W A;  3H1I E;  3VCA A;  1O7N A;  4QUP A;  4NBE A;  1ZRT E;  4NBF A;  2ZYL A;  1NTM E;  1ULI A;  2NVG A;  1SJG A;  1O7P A;  4EMJ B;  2ZT9 D;  4NBB A;  2XR8 A;  4NB9 D;  3C0D A;  1NTK E;  4QUR A;  3FOU A;  3GL0 A;  3GOB A;  2HMJ A;  1SQX E;  2DE6 D;  2IBZ E;  1VF5 D;  2DE7 A;  1JM1 A;  4QDF A;  4HM7 A;  1KYO E;  4HJL A;  4NBA D;  2I7F A;  3H1L E;  2HMO A;  3GB4 A;  1P84 E;  4HM6 A;  1WW9 A;  1O7W A;  4H13 D;  4QUQ A;  3DQY A;  2JZA A;  1SQB E;  4HM2 A;  3EQQ A;  1SQQ E;  3H1J E;  5CXM A;  2HMN A;  4AIV A;  2XSH A;  2YIU C;  1O7M A;  2E75 D;  1O7G A;  2E76 D;  2HMM A;  3L70 E;  3VMG D;  5HL4 A;  3GL2 A;  4HM0 A;  4NBD D;  1ULJ A;  2NUK A;  4NBG A;  3VMG A;  4NBG D;  2FYU E;  4HKV A;  2NVF A;  2FYN C;  4NBD A;  3VCP A;  4NBB D;  1G8J B;  4QDD A;  4PD4 E;  1VCK A;  2YVJ B;  2HML A;  1NU1 E;  1SQP E;  3TGU E;  1SQV E;  2QJY C;  3EN1 A;  1L0N E;  2QJK C;  3GTE A;  1O7H A;  2E74 D; 
#chains in the Genus database with same CATH homology
 4NBC A;  4NBH A;  4NBA A;  2E4Q A;  1UUW A;  5KLV E;  2HMK A;  1RIE A;  5AEU A;  5AEW A;  2BCC E;  4HM4 A;  1L0L E;  1EZV E;  3N0Q A;  2NWF A;  2DE6 A;  1EG9 A;  2BMQ A;  3VMH D;  3VMI A;  2DE5 D;  4H0L D;  1FQT A;  2B1X A;  1G8K B;  2XRX A;  1Z02 A;  1NTZ E;  1PP9 E;  3VMI D;  1BE3 E;  2YFI A;  3CWB E;  2XSO A;  2D2C D;  4P1C H;  1Z03 A;  4QCK A;  4AAY B;  3L71 E;  3L72 E;  3CXH E;  5KKZ C;  4NBF D;  1NYK A;  2NUM A;  1KB9 E;  3CX5 E;  4HM8 A;  2CKF A;  2JO6 A;  4OGQ D;  4QDF B;  3D89 A;  3GKQ A;  3GKE A;  1PPJ E;  4NBH D;  4NBC D;  4H44 D;  3AZC A;  3L73 E;  3GTS A;  2B24 A;  2QPZ A;  4NB8 D;  3GCF A;  1RFS A;  4PV1 D;  2GBX A;  2GBW A;  2NVE A;  3L74 E;  4HM3 A;  4HM5 A;  2A06 E;  1UUV A;  1Z01 A;  3H1H E;  3BCC E;  4QDC A;  1BCC E;  2E4P A;  3GZY A;  2DE7 D;  3GZX A;  1VM9 A;  2DE5 A;  2YFL A;  4NB9 A;  4HM1 A;  4P1B H;  2BMR A;  3VMH A;  5KLI C;  1WQL A;  2YFJ A;  4NB8 A;  2BMO A;  2QJP C;  3L75 E;  1Q90 C;  5BOK A;  3GCE A;  4U3F E;  4NBE D;  3H1K E;  1NDO A;  2Q3W A;  3H1I E;  3VCA A;  1O7N A;  4QUP A;  4NBE A;  1ZRT E;  4NBF A;  2ZYL A;  1NTM E;  1ULI A;  2NVG A;  1SJG A;  1O7P A;  4EMJ B;  2ZT9 D;  4NBB A;  2XR8 A;  4NB9 D;  3C0D A;  1NTK E;  4QUR A;  3FOU A;  3GL0 A;  3GOB A;  2HMJ A;  1SQX E;  2DE6 D;  2IBZ E;  1VF5 D;  2DE7 A;  1JM1 A;  4QDF A;  4HM7 A;  1KYO E;  4HJL A;  4NBA D;  2I7F A;  3H1L E;  2HMO A;  3GB4 A;  1P84 E;  4HM6 A;  1WW9 A;  1O7W A;  4H13 D;  4QUQ A;  3DQY A;  2JZA A;  1SQB E;  4HM2 A;  3EQQ A;  1SQQ E;  3H1J E;  5CXM A;  2HMN A;  4AIV A;  2XSH A;  2YIU C;  1O7M A;  2E75 D;  1O7G A;  2E76 D;  2HMM A;  3L70 E;  3VMG D;  5HL4 A;  3GL2 A;  4HM0 A;  4NBD D;  1ULJ A;  2NUK A;  4NBG A;  3VMG A;  4NBG D;  2FYU E;  4HKV A;  2NVF A;  2FYN C;  4NBD A;  3VCP A;  4NBB D;  1G8J B;  4QDD A;  4PD4 E;  1VCK A;  2YVJ B;  2HML A;  1NU1 E;  1SQP E;  3TGU E;  1SQV E;  2QJY C;  3EN1 A;  1L0N E;  2QJK C;  3GTE A;  1O7H A;  2E74 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...