2D6YA

Crystal structure of transcriptional factor sco4008 from streptomyces coelicolor a3(2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
EATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKMLDLAISVPVDPDDIEGWIDRLLDYHAAHPELLRLLFWEGMEYGTAELPHEAERQEHYARKVAAVRDGQERGVITDAIPAPDLLFLLVAMANWAVVVPQMKRILVGGGDAGTDGLRDSIKKAARRIVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords putative tetR family regulatory protein
publication title SCO4008, a Putative TetR Transcriptional Repressor from Streptomyces coelicolor A3(2), Regulates Transcription of sco4007 by Multidrug Recognition.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 64
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17926 TetR_C_21 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2d6yA00
3BR6A 4D7MA 2XDNA 4NELA 2ID3A 5EZHA 4AUXA 5GP9A 4AC6A 5C4YA 1ZK8A 5K7ZA 3HTAA 3FK6A 2HYJA 2Y2ZA 5J1UA 3DCFA 2HYTA 3F1BA 2JK3A 2NX4A 4D5CA 3LJLA 3ZQHA 3KKDA 5CXIA 2VPRA 1UI5A 3QPLA 2HQ5A 3O8GA 5K7FA 3GZIA 3BT9A 2NS7A 2GUHA 3QPSA 4UDSA 4XK4A 4AF5A 3VOXA 3TP3A 2UXHA 2XPUA 5F0HA 4JKZA 2DG8A 4YZEA 3TP0A 2QWTA 5DAJA 3O8HA 5H9TA 1BJZA 2GENA 2QOPA 5F27A 3VUQA 3BR5A 4M3EA 4I6ZA 2EH3A 5IP6A 3DPJA 2G0EA 3T6NA 2YVHA 4V2FA 3B6CA 2ZOZA 3KKCA 3BR3A 2WUIA 4M3DA 3HGGA 3V78A 1U9OA 5EZGA 2XGDA 3VW2A 4PXIA 1ZKGA 5D1RA 3Q0UA 3ZQLA 3NNRA 3BQYA 3FIWA 2NS8A 2XGCA 5GPAA 3RH2A 3G56A 2OI8A 4DW6A 4M3BA 2HKUA 3VIBA 2TRTA 2HXOA 3AQSA 3QQAA 2X6OA 3P9TA 3HE0A 3VW0A 5FKMA 4I76A 5AQCA 3LOCA 3BJBA 2XRLA 3HTIA 3HTHA 3C2BA 1JUMA 2G3BA 1U9NA 3BR1A 3BR2A 4V2GA 3CWRA 3BTIA 5HSZA 2UXPA 2PBXA 4M3FA 2ZOYA 2X9DA 2D6YA 1QPIA 3VOKA 5GPCA 3ANPA 3ZQGA 3C07A 1RKTA 5F0FA 2GFNA 4AC0A 2IBDA 2XPWA 3PM1A 5FHPA 3LHQA 2RAEA 3PPBA 3LSPA 2IEKA 3ZQIA 4X1EA 2O7OA 3ON2A 1RPWA 2FJ1A 2NP3A 4ICHA 1JUSA 3BTJA 4D7NA 1VI0A 3G7RA 1JT6A 2G7GA 3IH2A 2FD5A 2WGBA 3S5RA 2UXIA 3BCGA 3LWJA 4GCKA 3LSJA 5K7HA 1JTYA 5IPAA 5K58A 3SFIA 2QIBA 4G12A 4MO7A 4JL3A 1T56A 3GEUA 2QKOA 3VPRA 2UXOA 5FKOA 1SGMA 1A6IA 1UI6A 5D19A 3B81A 2XPVA 5D18A 3KZ9A 5FMPA 3CJDA 2RHAA 2QCOA 2ID6A 3ANGA 2Y30A 3VW1A 3ON4A 3F0CA 1Z0XA 4GFLA 2G7LA 3BHQA 2GBYA 2IAIA 3CDLA 3ZQFA 2XB5A 3Q0WA 3BNIA 2JJ7A 3BTLA 1Z77A 4GFKA 3IH4A 3BR0A 3KNWA 3MVPA 2XGEA 3O60A 3NI7A 3B6AA 3EGQA 3NRGA 4JNNA 3BTCA 5HBUA 5CW8A 1JTXA 3NPIA 4M3GA 3BRUA 2FQ4A 4CGRA 3V6GA 5F1JA 3EUPA 5IOYA 3CRJA 2TCTA 5J3LA 2DG7A 4B1RA 1ORKA 3DEWA 3E7QA 4JYKA 3JSJA 3LSRA 3WHBA 4HKUA 3BQZA 5CXGA 5IOZA 3QKXA 3SDGA 3HGYA 5F08A 4GCLA 5F0CA 4ABZA 5EYRA 1RKWA 2Y31A 2YVEA 2WV1A 2VKEA 3IUVA 2OERA 3AQTA 3Q3SA 2NP5A 2ZB9A 3MNLA 3G1LA 2W53A 5F04A 2UXUA 4NN1A 4MK6A 3WHCA 4ACIA 3FRQA 4MXMA 2OPTA 2VKVA 2V57A 4D5FA 3VVYA 4GCTA 3CCYA 5J1RA 3PASA 5FKNA 2ZCMA 2FX0A 3Q0VA 2DTZA 5J1YA 2RASA 5FKLA 3VVXA 2PZ9A 4W97A 2G7SA 3HTJA 5FKKA 4ME9A 1QVUA 3G1OA 2ZCXA 2OF7A 4B3AA 4W1UA 1JT0A 5EFYA 3VVZA 1T33A 5HAWA 2O7TA 3VP5A 3NXCA 3RD3A 5FGLA 4KWAA 3G1MA 2REKA 4L62A 2FBQA 1QVTA 2F07A 3COLA 2I10A 2QTQA 1JUPA 2IU5A 2Q24A 2ZCNA 2HXIA 3IH3A 3HIMA 3QBMA 3FK7A
chains in the Genus database with same CATH superfamily
3BR6A 4D7MA 2XDNA 4NELA 2ID3A 5EZHA 4AUXA 5GP9A 4AC6A 3NS4A 5C4YA 1ZK8A 3VTIA 5K7ZA 3HTAA 2R7QA 3FK6A 2HYJA 2Y2ZA 5J1UA 3DCFA 2HYTA 3F1BA 2JK3A 2NX4A 4D5CA 3LJLA 3ZQHA 3KKDA 5CXIA 2VPRA 1UI5A 3QPLA 2B3WA 2HQ5A 3O8GA 5K7FA 3GZIA 3BT9A 5CQGA 2NS7A 2GUHA 3QPSA 4UDSA 4XK4A 4AF5A 3VOXA 3TP3A 2UXHA 2XPUA 5F0HA 3DU5A 4JKZA 2DG8A 4YZEA 3TP0A 2QWTA 5DAJA 3O8HA 5H9TA 1BJZA 2GENA 2QOPA 5F27A 3VUQA 3BR5A 4M3EA 4I6ZA 2EH3A 5IP6A 3DPJA 2G0EA 3T6NA 2YVHA 4V2FA 3B6CA 4IRVA 2ZOZA 3KKCA 3BR3A 2WUIA 4M3DA 3HGGA 3V78A 1U9OA 5EZGA 2XGDA 3VW2A 4PXIA 4U9NA 1ZKGA 5D1RA 3Q0UA 2A2FX 3ZQLA 3NNRA 3BQYA 3FIWA 2NS8A 2XGCA 5GPAA 3RH2A 3G56A 2OI8A 4DW6A 4M3BA 2HKUA 3VIBA 2TRTA 2HXOA 3AQSA 3QQAA 2X6OA 3P9TA 3HE0A 3VW0A 5FKMA 4I76A 5AQCA 3LOCA 3SWHA 3BJBA 2XRLA 2FJI1 3HTIA 3HTHA 3C2BA 1JUMA 2G3BA 1U9NA 3BR1A 3BR2A 4V2GA 4U9LA 2ZY9A 3CWRA 3BTIA 5HSZA 2UXPA 2PBXA 4M3FA 2ZOYA 2X9DA 2D6YA 1QPIA 3VOKA 5GPCA 3ANPA 3ZQGA 3C07A 1RKTA 5F0FA 2GFNA 4AC0A 2IBDA 2XPWA 3PM1A 5FHPA 3LHQA 2RAEA 3PPBA 3LSPA 2IEKA 3ZQIA 4X1EA 2R7UA 2O7OA 3ON2A 1RPWA 2FJ1A 4WIBA 2NP3A 4ICHA 1JUSA 3BTJA 4D7NA 1VI0A 3G7RA 1JT6A 2G7GA 3IH2A 2FD5A 2WGBA 3KYLA 3S5RA 2UXIA 3BCGA 3LWJA 4GCKA 3LSJA 5K7HA 1JTYA 5IPAA 5K58A 3SFIA 2QIBA 4G12A 4MO7A 4JL3A 1T56A 3GEUA 2QKOA 3VPRA 2UXOA 5FKOA 1SGMA 1A6IA 1UI6A 5D19A 3B81A 2XPVA 5D18A 3KZ9A 5FMPA 3CJDA 2RHAA 2QCOA 2ID6A 3ANGA 2Y30A 3VW1A 3ON4A 2R7SA 3F0CA 1Z0XA 4GFLA 2G7LA 3BHQA 2R7VA 2GBYA 2IAIA 3CDLA 3ZQFA 2XB5A 3Q0WA 3BNIA 2JJ7A 3K8PC 3BTLA 1Z77A 4GFKA 3IH4A 3BR0A 3KNWA 3MVPA 2XGEA 3O60A 3NI7A 3B6AA 3EGQA 3NRGA 4JNNA 2R7RA 3BTCA 5HBUA 5CW8A 1JTXA 3NPIA 4M3GA 3BRUA 2FQ4A 4CGRA 3V6GA 5F1JA 3EUPA 5IOYA 3CRJA 2TCTA 5J3LA 2DG7A 4B1RA 1ORKA 3DEWA 3E7QA 4JYKA 3JSJA 3LSRA 3WHBA 4OD4A 4HKUA 2R7WA 3BQZA 5CXGA 5IOZA 3QKXA 3SDGA 3HGYA 5F08A 4GCLA 5F0CA 3DU6A 4ABZA 5EYRA 1RKWA 2Y31A 2YVEA 2WV1A 4OD5A 2VKEA 3IUVA 2OERA 3AQTA 3Q3SA 2PFVA 2NP5A 2ZB9A 3MNLA 3G1LA 2W53A 5F04A 2UXUA 4NN1A 4MK6A 2YVXA 3WHCA 4ACIA 3FRQA 4MXMA 3FHNA 2OPTA 2VKVA 2V57A 4D5FA 3VVYA 4GCTA 3CCYA 5J1RA 3PASA 5FKNA 2ZCMA 2FX0A 3Q0VA 2DTZA 5J1YA 2RASA 5FKLA 3VVXA 2PZ9A 4W97A 2G7SA 3HTJA 5FKKA 4ME9A 1QVUA 3G1OA 2ZCXA 2OF7A 4B3AA 4DVYP 4W1UA 1JT0A 5EFYA 3VVZA 1T33A 5HAWA 2O7TA 3VP5A 3NXCA 3RD3A 5FGLA 4KWAA 3G1MA 2REKA 4L62A 2FBQA 1QVTA 2F07A 3COLA 4C2MA 2I10A 2R7XA 2QTQA 1JUPA 2R7OA 2IU5A 2Q24A 2R7TA 2ZCNA 2HXIA 3IH3A 3HIMA 3QBMA 3FK7A 2B1EA
chains in the Genus database with same CATH topology
3BR6A 4D7MA 2XDNA 4NELA 2ID3A 5EZHA 4AUXA 5GP9A 4AC6A 5C4YA 1ZK8A 5K7ZA 3HTAA 3FK6A 2HYJA 2Y2ZA 5J1UA 3DCFA 2HYTA 3F1BA 2JK3A 2NX4A 4D5CA 3LJLA 3ZQHA 3KKDA 5CXIA 2VPRA 1UI5A 3QPLA 2HQ5A 3O8GA 5K7FA 3GZIA 3BT9A 2NS7A 2GUHA 3QPSA 4UDSA 4XK4A 4AF5A 3VOXA 3TP3A 2UXHA 2XPUA 5F0HA 4JKZA 2DG8A 4YZEA 3TP0A 2QWTA 5DAJA 3O8HA 5H9TA 1BJZA 2GENA 2QOPA 5F27A 3VUQA 3BR5A 4M3EA 4I6ZA 2EH3A 5IP6A 3DPJA 2G0EA 3T6NA 2YVHA 4V2FA 3B6CA 2ZOZA 3KKCA 3BR3A 2WUIA 4M3DA 3HGGA 3V78A 1U9OA 5EZGA 2XGDA 3VW2A 4PXIA 1ZKGA 5D1RA 3Q0UA 3ZQLA 3NNRA 3BQYA 3FIWA 2NS8A 2XGCA 5GPAA 3RH2A 3G56A 2OI8A 4DW6A 4M3BA 2HKUA 3VIBA 2TRTA 2HXOA 3AQSA 3QQAA 2X6OA 3P9TA 3HE0A 3VW0A 5FKMA 4I76A 5AQCA 3LOCA 3BJBA 2XRLA 3HTIA 3HTHA 3C2BA 1JUMA 2G3BA 1U9NA 3BR1A 3BR2A 4V2GA 3CWRA 3BTIA 5HSZA 2UXPA 2PBXA 4M3FA 2ZOYA 2X9DA 2D6YA 1QPIA 3VOKA 5GPCA 3ANPA 3ZQGA 3C07A 1RKTA 5F0FA 2GFNA 4AC0A 2IBDA 2XPWA 3PM1A 5FHPA 3LHQA 2RAEA 3PPBA 3LSPA 2IEKA 3ZQIA 4X1EA 2O7OA 3ON2A 1RPWA 2FJ1A 2NP3A 4ICHA 1JUSA 3BTJA 4D7NA 1VI0A 3G7RA 1JT6A 2G7GA 3IH2A 2FD5A 2WGBA 3S5RA 2UXIA 3BCGA 3LWJA 4GCKA 3LSJA 5K7HA 1JTYA 5IPAA 5K58A 3SFIA 2QIBA 4G12A 4MO7A 4JL3A 1T56A 3GEUA 2QKOA 3VPRA 2UXOA 5FKOA 1SGMA 1A6IA 1UI6A 5D19A 3B81A 2XPVA 5D18A 3KZ9A 5FMPA 3CJDA 2RHAA 2QCOA 2ID6A 3ANGA 2Y30A 3VW1A 3ON4A 3F0CA 1Z0XA 4GFLA 2G7LA 3BHQA 2GBYA 2IAIA 3CDLA 3ZQFA 2XB5A 3Q0WA 3BNIA 2JJ7A 3BTLA 1Z77A 4GFKA 3IH4A 3BR0A 3KNWA 3MVPA 2XGEA 3O60A 3NI7A 3B6AA 3EGQA 3NRGA 4JNNA 3BTCA 5HBUA 5CW8A 1JTXA 3NPIA 4M3GA 3BRUA 2FQ4A 4CGRA 3V6GA 5F1JA 3EUPA 5IOYA 3CRJA 2TCTA 5J3LA 2DG7A 4B1RA 1ORKA 3DEWA 3E7QA 4JYKA 3JSJA 3LSRA 3WHBA 4HKUA 3BQZA 5CXGA 5IOZA 3QKXA 3SDGA 3HGYA 5F08A 4GCLA 5F0CA 4ABZA 5EYRA 1RKWA 2Y31A 2YVEA 2WV1A 2VKEA 3IUVA 2OERA 3AQTA 3Q3SA 2NP5A 2ZB9A 3MNLA 3G1LA 2W53A 5F04A 2UXUA 4NN1A 4MK6A 3WHCA 4ACIA 3FRQA 4MXMA 2OPTA 2VKVA 2V57A 4D5FA 3VVYA 4GCTA 3CCYA 5J1RA 3PASA 5FKNA 2ZCMA 2FX0A 3Q0VA 2DTZA 5J1YA 2RASA 5FKLA 3VVXA 2PZ9A 4W97A 2G7SA 3HTJA 5FKKA 4ME9A 1QVUA 3G1OA 2ZCXA 2OF7A 4B3AA 4W1UA 1JT0A 5EFYA 3VVZA 1T33A 5HAWA 2O7TA 3VP5A 3NXCA 3RD3A 5FGLA 4KWAA 3G1MA 2REKA 4L62A 2FBQA 1QVTA 2F07A 3COLA 2I10A 2QTQA 1JUPA 2IU5A 2Q24A 2ZCNA 2HXIA 3IH3A 3HIMA 3QBMA 3FK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR6 A;  4D7M A;  2XDN A;  4NEL A;  2ID3 A;  5EZH A;  4AUX A;  5GP9 A;  4AC6 A;  5C4Y A;  1ZK8 A;  5K7Z A;  3HTA A;  3FK6 A;  2HYJ A;  2Y2Z A;  5J1U A;  3DCF A;  2HYT A;  3F1B A;  2JK3 A;  2NX4 A;  4D5C A;  3LJL A;  3ZQH A;  3KKD A;  5CXI A;  2VPR A;  1UI5 A;  3QPL A;  2HQ5 A;  3O8G A;  5K7F A;  3GZI A;  3BT9 A;  2NS7 A;  2GUH A;  3QPS A;  4UDS A;  4XK4 A;  4AF5 A;  3VOX A;  3TP3 A;  2UXH A;  2XPU A;  5F0H A;  4JKZ A;  2DG8 A;  4YZE A;  3TP0 A;  2QWT A;  5DAJ A;  3O8H A;  5H9T A;  1BJZ A;  2GEN A;  2QOP A;  5F27 A;  3VUQ A;  3BR5 A;  4M3E A;  4I6Z A;  2EH3 A;  5IP6 A;  3DPJ A;  2G0E A;  3T6N A;  2YVH A;  4V2F A;  3B6C A;  2ZOZ A;  3KKC A;  3BR3 A;  2WUI A;  4M3D A;  3HGG A;  3V78 A;  1U9O A;  5EZG A;  2XGD A;  3VW2 A;  4PXI A;  1ZKG A;  5D1R A;  3Q0U A;  3ZQL A;  3NNR A;  3BQY A;  3FIW A;  2NS8 A;  2XGC A;  5GPA A;  3RH2 A;  3G56 A;  2OI8 A;  4DW6 A;  4M3B A;  2HKU A;  3VIB A;  2TRT A;  2HXO A;  3AQS A;  3QQA A;  2X6O A;  3P9T A;  3HE0 A;  3VW0 A;  5FKM A;  4I76 A;  5AQC A;  3LOC A;  3BJB A;  2XRL A;  3HTI A;  3HTH A;  3C2B A;  1JUM A;  2G3B A;  1U9N A;  3BR1 A;  3BR2 A;  4V2G A;  3CWR A;  3BTI A;  5HSZ A;  2UXP A;  2PBX A;  4M3F A;  2ZOY A;  2X9D A;  2D6Y A;  1QPI A;  3VOK A;  5GPC A;  3ANP A;  3ZQG A;  3C07 A;  1RKT A;  5F0F A;  2GFN A;  4AC0 A;  2IBD A;  2XPW A;  3PM1 A;  5FHP A;  3LHQ A;  2RAE A;  3PPB A;  3LSP A;  2IEK A;  3ZQI A;  4X1E A;  2O7O A;  3ON2 A;  1RPW A;  2FJ1 A;  2NP3 A;  4ICH A;  1JUS A;  3BTJ A;  4D7N A;  1VI0 A;  3G7R A;  1JT6 A;  2G7G A;  3IH2 A;  2FD5 A;  2WGB A;  3S5R A;  2UXI A;  3BCG A;  3LWJ A;  4GCK A;  3LSJ A;  5K7H A;  1JTY A;  5IPA A;  5K58 A;  3SFI A;  2QIB A;  4G12 A;  4MO7 A;  4JL3 A;  1T56 A;  3GEU A;  2QKO A;  3VPR A;  2UXO A;  5FKO A;  1SGM A;  1A6I A;  1UI6 A;  5D19 A;  3B81 A;  2XPV A;  5D18 A;  3KZ9 A;  5FMP A;  3CJD A;  2RHA A;  2QCO A;  2ID6 A;  3ANG A;  2Y30 A;  3VW1 A;  3ON4 A;  3F0C A;  1Z0X A;  4GFL A;  2G7L A;  3BHQ A;  2GBY A;  2IAI A;  3CDL A;  3ZQF A;  2XB5 A;  3Q0W A;  3BNI A;  2JJ7 A;  3BTL A;  1Z77 A;  4GFK A;  3IH4 A;  3BR0 A;  3KNW A;  3MVP A;  2XGE A;  3O60 A;  3NI7 A;  3B6A A;  3EGQ A;  3NRG A;  4JNN A;  3BTC A;  5HBU A;  5CW8 A;  1JTX A;  3NPI A;  4M3G A;  3BRU A;  2FQ4 A;  4CGR A;  3V6G A;  5F1J A;  3EUP A;  5IOY A;  3CRJ A;  2TCT A;  5J3L A;  2DG7 A;  4B1R A;  1ORK A;  3DEW A;  3E7Q A;  4JYK A;  3JSJ A;  3LSR A;  3WHB A;  4HKU A;  3BQZ A;  5CXG A;  5IOZ A;  3QKX A;  3SDG A;  3HGY A;  5F08 A;  4GCL A;  5F0C A;  4ABZ A;  5EYR A;  1RKW A;  2Y31 A;  2YVE A;  2WV1 A;  2VKE A;  3IUV A;  2OER A;  3AQT A;  3Q3S A;  2NP5 A;  2ZB9 A;  3MNL A;  3G1L A;  2W53 A;  5F04 A;  2UXU A;  4NN1 A;  4MK6 A;  3WHC A;  4ACI A;  3FRQ A;  4MXM A;  2OPT A;  2VKV A;  2V57 A;  4D5F A;  3VVY A;  4GCT A;  3CCY A;  5J1R A;  3PAS A;  5FKN A;  2ZCM A;  2FX0 A;  3Q0V A;  2DTZ A;  5J1Y A;  2RAS A;  5FKL A;  3VVX A;  2PZ9 A;  4W97 A;  2G7S A;  3HTJ A;  5FKK A;  4ME9 A;  1QVU A;  3G1O A;  2ZCX A;  2OF7 A;  4B3A A;  4W1U A;  1JT0 A;  5EFY A;  3VVZ A;  1T33 A;  5HAW A;  2O7T A;  3VP5 A;  3NXC A;  3RD3 A;  5FGL A;  4KWA A;  3G1M A;  2REK A;  4L62 A;  2FBQ A;  1QVT A;  2F07 A;  3COL A;  2I10 A;  2QTQ A;  1JUP A;  2IU5 A;  2Q24 A;  2ZCN A;  2HXI A;  3IH3 A;  3HIM A;  3QBM A;  3FK7 A; 
#chains in the Genus database with same CATH topology
 3BR6 A;  4D7M A;  2XDN A;  4NEL A;  2ID3 A;  5EZH A;  4AUX A;  5GP9 A;  4AC6 A;  3NS4 A;  5C4Y A;  1ZK8 A;  3VTI A;  5K7Z A;  3HTA A;  2R7Q A;  3FK6 A;  2HYJ A;  2Y2Z A;  5J1U A;  3DCF A;  2HYT A;  3F1B A;  2JK3 A;  2NX4 A;  4D5C A;  3LJL A;  3ZQH A;  3KKD A;  5CXI A;  2VPR A;  1UI5 A;  3QPL A;  2B3W A;  2HQ5 A;  3O8G A;  5K7F A;  3GZI A;  3BT9 A;  5CQG A;  2NS7 A;  2GUH A;  3QPS A;  4UDS A;  4XK4 A;  4AF5 A;  3VOX A;  3TP3 A;  2UXH A;  2XPU A;  5F0H A;  3DU5 A;  4JKZ A;  2DG8 A;  4YZE A;  3TP0 A;  2QWT A;  5DAJ A;  3O8H A;  5H9T A;  1BJZ A;  2GEN A;  2QOP A;  5F27 A;  3VUQ A;  3BR5 A;  4M3E A;  4I6Z A;  2EH3 A;  5IP6 A;  3DPJ A;  2G0E A;  3T6N A;  2YVH A;  4V2F A;  3B6C A;  4IRV A;  2ZOZ A;  3KKC A;  3BR3 A;  2WUI A;  4M3D A;  3HGG A;  3V78 A;  1U9O A;  5EZG A;  2XGD A;  3VW2 A;  4PXI A;  4U9N A;  1ZKG A;  5D1R A;  3Q0U A;  2A2F X;  3ZQL A;  3NNR A;  3BQY A;  3FIW A;  2NS8 A;  2XGC A;  5GPA A;  3RH2 A;  3G56 A;  2OI8 A;  4DW6 A;  4M3B A;  2HKU A;  3VIB A;  2TRT A;  2HXO A;  3AQS A;  3QQA A;  2X6O A;  3P9T A;  3HE0 A;  3VW0 A;  5FKM A;  4I76 A;  5AQC A;  3LOC A;  3SWH A;  3BJB A;  2XRL A;  2FJI 1;  3HTI A;  3HTH A;  3C2B A;  1JUM A;  2G3B A;  1U9N A;  3BR1 A;  3BR2 A;  4V2G A;  4U9L A;  2ZY9 A;  3CWR A;  3BTI A;  5HSZ A;  2UXP A;  2PBX A;  4M3F A;  2ZOY A;  2X9D A;  2D6Y A;  1QPI A;  3VOK A;  5GPC A;  3ANP A;  3ZQG A;  3C07 A;  1RKT A;  5F0F A;  2GFN A;  4AC0 A;  2IBD A;  2XPW A;  3PM1 A;  5FHP A;  3LHQ A;  2RAE A;  3PPB A;  3LSP A;  2IEK A;  3ZQI A;  4X1E A;  2R7U A;  2O7O A;  3ON2 A;  1RPW A;  2FJ1 A;  4WIB A;  2NP3 A;  4ICH A;  1JUS A;  3BTJ A;  4D7N A;  1VI0 A;  3G7R A;  1JT6 A;  2G7G A;  3IH2 A;  2FD5 A;  2WGB A;  3KYL A;  3S5R A;  2UXI A;  3BCG A;  3LWJ A;  4GCK A;  3LSJ A;  5K7H A;  1JTY A;  5IPA A;  5K58 A;  3SFI A;  2QIB A;  4G12 A;  4MO7 A;  4JL3 A;  1T56 A;  3GEU A;  2QKO A;  3VPR A;  2UXO A;  5FKO A;  1SGM A;  1A6I A;  1UI6 A;  5D19 A;  3B81 A;  2XPV A;  5D18 A;  3KZ9 A;  5FMP A;  3CJD A;  2RHA A;  2QCO A;  2ID6 A;  3ANG A;  2Y30 A;  3VW1 A;  3ON4 A;  2R7S A;  3F0C A;  1Z0X A;  4GFL A;  2G7L A;  3BHQ A;  2R7V A;  2GBY A;  2IAI A;  3CDL A;  3ZQF A;  2XB5 A;  3Q0W A;  3BNI A;  2JJ7 A;  3K8P C;  3BTL A;  1Z77 A;  4GFK A;  3IH4 A;  3BR0 A;  3KNW A;  3MVP A;  2XGE A;  3O60 A;  3NI7 A;  3B6A A;  3EGQ A;  3NRG A;  4JNN A;  2R7R A;  3BTC A;  5HBU A;  5CW8 A;  1JTX A;  3NPI A;  4M3G A;  3BRU A;  2FQ4 A;  4CGR A;  3V6G A;  5F1J A;  3EUP A;  5IOY A;  3CRJ A;  2TCT A;  5J3L A;  2DG7 A;  4B1R A;  1ORK A;  3DEW A;  3E7Q A;  4JYK A;  3JSJ A;  3LSR A;  3WHB A;  4OD4 A;  4HKU A;  2R7W A;  3BQZ A;  5CXG A;  5IOZ A;  3QKX A;  3SDG A;  3HGY A;  5F08 A;  4GCL A;  5F0C A;  3DU6 A;  4ABZ A;  5EYR A;  1RKW A;  2Y31 A;  2YVE A;  2WV1 A;  4OD5 A;  2VKE A;  3IUV A;  2OER A;  3AQT A;  3Q3S A;  2PFV A;  2NP5 A;  2ZB9 A;  3MNL A;  3G1L A;  2W53 A;  5F04 A;  2UXU A;  4NN1 A;  4MK6 A;  2YVX A;  3WHC A;  4ACI A;  3FRQ A;  4MXM A;  3FHN A;  2OPT A;  2VKV A;  2V57 A;  4D5F A;  3VVY A;  4GCT A;  3CCY A;  5J1R A;  3PAS A;  5FKN A;  2ZCM A;  2FX0 A;  3Q0V A;  2DTZ A;  5J1Y A;  2RAS A;  5FKL A;  3VVX A;  2PZ9 A;  4W97 A;  2G7S A;  3HTJ A;  5FKK A;  4ME9 A;  1QVU A;  3G1O A;  2ZCX A;  2OF7 A;  4B3A A;  4DVY P;  4W1U A;  1JT0 A;  5EFY A;  3VVZ A;  1T33 A;  5HAW A;  2O7T A;  3VP5 A;  3NXC A;  3RD3 A;  5FGL A;  4KWA A;  3G1M A;  2REK A;  4L62 A;  2FBQ A;  1QVT A;  2F07 A;  3COL A;  4C2M A;  2I10 A;  2R7X A;  2QTQ A;  1JUP A;  2R7O A;  2IU5 A;  2Q24 A;  2R7T A;  2ZCN A;  2HXI A;  3IH3 A;  3HIM A;  3QBM A;  3FK7 A;  2B1E A; 
#chains in the Genus database with same CATH homology
 3BR6 A;  4D7M A;  2XDN A;  4NEL A;  2ID3 A;  5EZH A;  4AUX A;  5GP9 A;  4AC6 A;  5C4Y A;  1ZK8 A;  5K7Z A;  3HTA A;  3FK6 A;  2HYJ A;  2Y2Z A;  5J1U A;  3DCF A;  2HYT A;  3F1B A;  2JK3 A;  2NX4 A;  4D5C A;  3LJL A;  3ZQH A;  3KKD A;  5CXI A;  2VPR A;  1UI5 A;  3QPL A;  2HQ5 A;  3O8G A;  5K7F A;  3GZI A;  3BT9 A;  2NS7 A;  2GUH A;  3QPS A;  4UDS A;  4XK4 A;  4AF5 A;  3VOX A;  3TP3 A;  2UXH A;  2XPU A;  5F0H A;  4JKZ A;  2DG8 A;  4YZE A;  3TP0 A;  2QWT A;  5DAJ A;  3O8H A;  5H9T A;  1BJZ A;  2GEN A;  2QOP A;  5F27 A;  3VUQ A;  3BR5 A;  4M3E A;  4I6Z A;  2EH3 A;  5IP6 A;  3DPJ A;  2G0E A;  3T6N A;  2YVH A;  4V2F A;  3B6C A;  2ZOZ A;  3KKC A;  3BR3 A;  2WUI A;  4M3D A;  3HGG A;  3V78 A;  1U9O A;  5EZG A;  2XGD A;  3VW2 A;  4PXI A;  1ZKG A;  5D1R A;  3Q0U A;  3ZQL A;  3NNR A;  3BQY A;  3FIW A;  2NS8 A;  2XGC A;  5GPA A;  3RH2 A;  3G56 A;  2OI8 A;  4DW6 A;  4M3B A;  2HKU A;  3VIB A;  2TRT A;  2HXO A;  3AQS A;  3QQA A;  2X6O A;  3P9T A;  3HE0 A;  3VW0 A;  5FKM A;  4I76 A;  5AQC A;  3LOC A;  3BJB A;  2XRL A;  3HTI A;  3HTH A;  3C2B A;  1JUM A;  2G3B A;  1U9N A;  3BR1 A;  3BR2 A;  4V2G A;  3CWR A;  3BTI A;  5HSZ A;  2UXP A;  2PBX A;  4M3F A;  2ZOY A;  2X9D A;  2D6Y A;  1QPI A;  3VOK A;  5GPC A;  3ANP A;  3ZQG A;  3C07 A;  1RKT A;  5F0F A;  2GFN A;  4AC0 A;  2IBD A;  2XPW A;  3PM1 A;  5FHP A;  3LHQ A;  2RAE A;  3PPB A;  3LSP A;  2IEK A;  3ZQI A;  4X1E A;  2O7O A;  3ON2 A;  1RPW A;  2FJ1 A;  2NP3 A;  4ICH A;  1JUS A;  3BTJ A;  4D7N A;  1VI0 A;  3G7R A;  1JT6 A;  2G7G A;  3IH2 A;  2FD5 A;  2WGB A;  3S5R A;  2UXI A;  3BCG A;  3LWJ A;  4GCK A;  3LSJ A;  5K7H A;  1JTY A;  5IPA A;  5K58 A;  3SFI A;  2QIB A;  4G12 A;  4MO7 A;  4JL3 A;  1T56 A;  3GEU A;  2QKO A;  3VPR A;  2UXO A;  5FKO A;  1SGM A;  1A6I A;  1UI6 A;  5D19 A;  3B81 A;  2XPV A;  5D18 A;  3KZ9 A;  5FMP A;  3CJD A;  2RHA A;  2QCO A;  2ID6 A;  3ANG A;  2Y30 A;  3VW1 A;  3ON4 A;  3F0C A;  1Z0X A;  4GFL A;  2G7L A;  3BHQ A;  2GBY A;  2IAI A;  3CDL A;  3ZQF A;  2XB5 A;  3Q0W A;  3BNI A;  2JJ7 A;  3BTL A;  1Z77 A;  4GFK A;  3IH4 A;  3BR0 A;  3KNW A;  3MVP A;  2XGE A;  3O60 A;  3NI7 A;  3B6A A;  3EGQ A;  3NRG A;  4JNN A;  3BTC A;  5HBU A;  5CW8 A;  1JTX A;  3NPI A;  4M3G A;  3BRU A;  2FQ4 A;  4CGR A;  3V6G A;  5F1J A;  3EUP A;  5IOY A;  3CRJ A;  2TCT A;  5J3L A;  2DG7 A;  4B1R A;  1ORK A;  3DEW A;  3E7Q A;  4JYK A;  3JSJ A;  3LSR A;  3WHB A;  4HKU A;  3BQZ A;  5CXG A;  5IOZ A;  3QKX A;  3SDG A;  3HGY A;  5F08 A;  4GCL A;  5F0C A;  4ABZ A;  5EYR A;  1RKW A;  2Y31 A;  2YVE A;  2WV1 A;  2VKE A;  3IUV A;  2OER A;  3AQT A;  3Q3S A;  2NP5 A;  2ZB9 A;  3MNL A;  3G1L A;  2W53 A;  5F04 A;  2UXU A;  4NN1 A;  4MK6 A;  3WHC A;  4ACI A;  3FRQ A;  4MXM A;  2OPT A;  2VKV A;  2V57 A;  4D5F A;  3VVY A;  4GCT A;  3CCY A;  5J1R A;  3PAS A;  5FKN A;  2ZCM A;  2FX0 A;  3Q0V A;  2DTZ A;  5J1Y A;  2RAS A;  5FKL A;  3VVX A;  2PZ9 A;  4W97 A;  2G7S A;  3HTJ A;  5FKK A;  4ME9 A;  1QVU A;  3G1O A;  2ZCX A;  2OF7 A;  4B3A A;  4W1U A;  1JT0 A;  5EFY A;  3VVZ A;  1T33 A;  5HAW A;  2O7T A;  3VP5 A;  3NXC A;  3RD3 A;  5FGL A;  4KWA A;  3G1M A;  2REK A;  4L62 A;  2FBQ A;  1QVT A;  2F07 A;  3COL A;  2I10 A;  2QTQ A;  1JUP A;  2IU5 A;  2Q24 A;  2ZCN A;  2HXI A;  3IH3 A;  3HIM A;  3QBM A;  3FK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...