2D6YA

Crystal structure of transcriptional factor sco4008 from streptomyces coelicolor a3(2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
EATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKMLDLAISVPVDPDDIEGWIDRLLDYHAAHPELLRLLFWEGMEYGTAELPHEAERQEHYARKVAAVRDGQERGVITDAIPAPDLLFLLVAMANWAVVVPQMKRILVGGGDAGTDGLRDSIKKAARRIVDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative tetR family regulatory protein
publication title SCO4008, a Putative TetR Transcriptional Repressor from Streptomyces coelicolor A3(2), Regulates Transcription of sco4007 by Multidrug Recognition.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Gene regulation
total genus 64
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17926 TetR_C_21 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2d6yA00
2TCTA 2V57A 3COLA 5F0FA 2O7OA 2X9DA 3Q3SA 3G1MA 3BR0A 5FKOA 3G1OA 2HXOA 3QPLA 2FJ1A 1U9NA 3AQTA 4JKZA 4JYKA 5FKLA 4UDSA 4XK4A 5CW8A 2QTQA 4L62A 3ZQGA 3MNLA 5FKKA 2ZCNA 3C07A 3HTHA 4V2FA 3VPRA 3LSJA 3B81A 1JT0A 2IU5A 1Z77A 2YVEA 4W1UA 3QBMA 2I10A 3BR6A 1VI0A 3IUVA 1JUSA 3LSRA 5EZGA 3FRQA 2OF7A 2OI8A 3DEWA 5H9TA 2RAEA 3CJDA 2TRTA 2G7GA 3BJBA 5K58A 3BR3A 3BTLA 3KKCA 3VOXA 2REKA 3CRJA 2G7SA 3QPSA 3VUQA 3NXCA 4AC0A 3O8GA 3PASA 3CDLA 4X1EA 2XPVA 3F0CA 2YVHA 2QCOA 2UXIA 3ANPA 3HGYA 3G56A 3VW0A 2OPTA 3B6AA 3BR2A 5FKMA 3DCFA 4D7MA 2QIBA 2OERA 2Y31A 3KKDA 2HYTA 5F0CA 3TP3A 5FMPA 4ICHA 2D6YA 2HKUA 3DPJA 2XRLA 5D18A 5D19A 3BR1A 3FIWA 2Y2ZA 3VVYA 2F07A 2FBQA 2VKEA 3G7RA 5F1JA 5F0HA 3VP5A 1T56A 2GBYA 3ZQHA 4I6ZA 4M3DA 1JUPA 5CXGA 2JK3A 2RHAA 3ZQIA 2NP5A 3PM1A 3KZ9A 3Q0UA 3EGQA 5FGLA 3BRUA 2UXPA 4AC6A 2G0EA 3P9TA 3CCYA 3BTJA 1SGMA 3BQZA 5K7HA 4D5FA 2QOPA 3F1BA 4MK6A 5HBUA 3HGGA 4B3AA 2HXIA 2VPRA 5FKNA 3SFIA 3VOKA 1QVTA 3QQAA 4MO7A 3IH4A 3ZQFA 2ZCXA 2VKVA 2NX4A 3BQYA 4GFLA 3G1LA 4M3EA 3E7QA 3LSPA 2O7TA 3FK7A 5AQCA 3FK6A 1T33A 3AQSA 5EYRA 3CWRA 1JTXA 2NP3A 1BJZA 5C4YA 4V2GA 2FQ4A 3HE0A 3BHQA 2G3BA 3GZIA 1UI5A 3BT9A 4JNNA 3BR5A 4M3FA 4MXMA 1RPWA 5EZHA 5GPCA 1JTYA 3EUPA 4D5CA 4ACIA 2ZCMA 5FHPA 2RASA 3V78A 4ABZA 1ZKGA 3NNRA 2XGCA 2IBDA 4DW6A 4PXIA 2UXOA 2ID3A 2G7LA 3O8HA 1QVUA 3B6CA 2FD5A 5GP9A 3VVXA 5J1UA 4YZEA 4GCTA 5F08A 3WHBA 1JT6A 3VIBA 3LOCA 4AF5A 3QKXA 4CGRA 3VW1A 5CXIA 3C2BA 1Z0XA 2XGEA 4KWAA 4M3BA 3Q0WA 4AUXA 3MVPA 3BTIA 4G12A 4GFKA 3HTAA 2QKOA 3BTCA 3RD3A 5F04A 3WHCA 3LHQA 4M3GA 3IH2A 3ZQLA 4GCKA 5GPAA 3PPBA 2DG7A 3IH3A 2ZOZA 3NRGA 3LWJA 1A6IA 2ID6A 2XPWA 1ZK8A 1RKWA 5J3LA 2Q24A 5IPAA 2QWTA 2W53A 3HTIA 5K7FA 1QPIA 5DAJA 3BNIA 5K7ZA 1JUMA 3LJLA 2GFNA 2NS7A 3Q0VA 2X6OA 5J1RA 4B1RA 3NPIA 3T6NA 2XDNA 2DTZA 2DG8A 2IEKA 4JL3A 3HIMA 2IAIA 1RKTA 5HSZA 4NN1A 1U9OA 5D1RA 3JSJA 4I76A 3V6GA 2UXUA 2GENA 3O60A 4NELA 5F27A 2FX0A 1ORKA 4HKUA 2WV1A 3TP0A 2WGBA 3GEUA 3NI7A 3HTJA 2XPUA 5IOYA 3BCGA 2UXHA 3SDGA 1UI6A 2XGDA 4D7NA 5EFYA 5IP6A 3S5RA 3RH2A 3KNWA 4W97A 5J1YA 5HAWA 4GCLA 2GUHA 2PZ9A 2HQ5A 2ZB9A 3VW2A 2PBXA 2XB5A 3VVZA 3ANGA 2WUIA 5IOZA 3ON2A 2EH3A 4ME9A 2HYJA 2JJ7A 2Y30A 2NS8A 2ZOYA 3ON4A
chains in the Genus database with same CATH superfamily
2TCTA 2V57A 3COLA 5F0FA 2O7OA 2X9DA 3Q3SA 3G1MA 3BR0A 5FKOA 3G1OA 2HXOA 3QPLA 2FJ1A 1U9NA 3AQTA 4JKZA 4JYKA 5FKLA 2R7WA 4UDSA 4XK4A 5CW8A 2QTQA 4L62A 3ZQGA 3MNLA 5FKKA 2ZCNA 3C07A 3HTHA 4V2FA 3VPRA 3LSJA 3B81A 1JT0A 2IU5A 1Z77A 2YVEA 4W1UA 2A2FX 3QBMA 2I10A 3BR6A 1VI0A 3IUVA 1JUSA 3LSRA 5EZGA 3FRQA 2OF7A 2OI8A 3DEWA 5H9TA 2RAEA 3CJDA 2TRTA 2G7GA 3BJBA 5K58A 3BR3A 3BTLA 3KKCA 3VOXA 2REKA 3CRJA 2G7SA 3QPSA 3VUQA 3NXCA 4AC0A 3O8GA 3PASA 3CDLA 2FJI1 4X1EA 2XPVA 3F0CA 2YVHA 2QCOA 2UXIA 3ANPA 3HGYA 3G56A 3VW0A 3DU6A 2OPTA 3B6AA 3BR2A 5FKMA 3DCFA 4D7MA 2QIBA 2OERA 2Y31A 3KKDA 2HYTA 5F0CA 3TP3A 5FMPA 4ICHA 2D6YA 2HKUA 3DPJA 2XRLA 5D18A 5D19A 3BR1A 3NS4A 3FIWA 2Y2ZA 3VVYA 2F07A 2FBQA 4C2MA 5CQGA 2R7QA 2VKEA 3G7RA 5F1JA 5F0HA 3VP5A 1T56A 2GBYA 3ZQHA 4I6ZA 4M3DA 1JUPA 5CXGA 2JK3A 2RHAA 3ZQIA 2NP5A 3PM1A 2R7UA 2B1EA 4IRVA 3KZ9A 3Q0UA 3EGQA 5FGLA 3BRUA 2UXPA 3VTIA 4AC6A 2G0EA 2R7RA 3P9TA 3CCYA 3BTJA 2R7XA 1SGMA 3BQZA 5K7HA 4D5FA 2QOPA 3F1BA 4MK6A 5HBUA 3HGGA 4B3AA 3FHNA 2HXIA 2VPRA 5FKNA 3SFIA 3VOKA 1QVTA 3QQAA 4MO7A 3IH4A 3ZQFA 2ZCXA 2VKVA 2NX4A 3BQYA 4GFLA 3G1LA 4M3EA 3E7QA 3LSPA 2O7TA 3FK7A 5AQCA 3FK6A 1T33A 3AQSA 5EYRA 3CWRA 1JTXA 2NP3A 1BJZA 5C4YA 4V2GA 2FQ4A 3HE0A 4U9LA 3BHQA 2G3BA 3GZIA 1UI5A 3BT9A 4JNNA 3BR5A 4M3FA 4MXMA 1RPWA 5EZHA 2PFVA 5GPCA 1JTYA 3EUPA 4WIBA 4D5CA 4ACIA 2ZCMA 5FHPA 2R7VA 2RASA 3V78A 4ABZA 1ZKGA 3SWHA 3NNRA 2XGCA 4OD5A 2ZY9A 2IBDA 4DW6A 4PXIA 2UXOA 2ID3A 4U9NA 2G7LA 3O8HA 1QVUA 3B6CA 2FD5A 5GP9A 3VVXA 3K8PC 5J1UA 4YZEA 4GCTA 5F08A 3WHBA 1JT6A 3VIBA 3LOCA 4AF5A 3QKXA 4CGRA 3VW1A 5CXIA 3C2BA 1Z0XA 2XGEA 4KWAA 4M3BA 3Q0WA 4AUXA 3MVPA 3BTIA 2B3WA 4G12A 4DVYP 4GFKA 3HTAA 2QKOA 3BTCA 3RD3A 5F04A 3WHCA 3LHQA 4M3GA 3IH2A 3ZQLA 4GCKA 5GPAA 3PPBA 2R7TA 2DG7A 3IH3A 2ZOZA 3NRGA 3LWJA 1A6IA 2ID6A 2XPWA 1ZK8A 1RKWA 2YVXA 5J3LA 2Q24A 5IPAA 2QWTA 2W53A 3HTIA 5K7FA 1QPIA 5DAJA 3BNIA 5K7ZA 1JUMA 3LJLA 2GFNA 2NS7A 3Q0VA 2X6OA 5J1RA 4B1RA 3NPIA 3T6NA 2XDNA 4OD4A 2DTZA 2DG8A 2IEKA 4JL3A 3HIMA 2IAIA 1RKTA 3KYLA 5HSZA 4NN1A 1U9OA 5D1RA 3JSJA 4I76A 3V6GA 2UXUA 2GENA 3O60A 4NELA 5F27A 2FX0A 1ORKA 4HKUA 2WV1A 3TP0A 2WGBA 3GEUA 3NI7A 3HTJA 2XPUA 2R7SA 5IOYA 3BCGA 2UXHA 3SDGA 1UI6A 2XGDA 4D7NA 5EFYA 5IP6A 3S5RA 3RH2A 3KNWA 4W97A 5J1YA 5HAWA 4GCLA 2GUHA 2PZ9A 2HQ5A 2ZB9A 3VW2A 2PBXA 2XB5A 3VVZA 3DU5A 3ANGA 2WUIA 5IOZA 3ON2A 2EH3A 4ME9A 2HYJA 2JJ7A 2R7OA 2Y30A 2NS8A 2ZOYA 3ON4A
chains in the Genus database with same CATH topology
2TCTA 2V57A 3COLA 5F0FA 2O7OA 2X9DA 3Q3SA 3G1MA 3BR0A 5FKOA 3G1OA 2HXOA 3QPLA 2FJ1A 1U9NA 3AQTA 4JKZA 4JYKA 5FKLA 4UDSA 4XK4A 5CW8A 2QTQA 4L62A 3ZQGA 3MNLA 5FKKA 2ZCNA 3C07A 3HTHA 4V2FA 3VPRA 3LSJA 3B81A 1JT0A 2IU5A 1Z77A 2YVEA 4W1UA 3QBMA 2I10A 3BR6A 1VI0A 3IUVA 1JUSA 3LSRA 5EZGA 3FRQA 2OF7A 2OI8A 3DEWA 5H9TA 2RAEA 3CJDA 2TRTA 2G7GA 3BJBA 5K58A 3BR3A 3BTLA 3KKCA 3VOXA 2REKA 3CRJA 2G7SA 3QPSA 3VUQA 3NXCA 4AC0A 3O8GA 3PASA 3CDLA 4X1EA 2XPVA 3F0CA 2YVHA 2QCOA 2UXIA 3ANPA 3HGYA 3G56A 3VW0A 2OPTA 3B6AA 3BR2A 5FKMA 3DCFA 4D7MA 2QIBA 2OERA 2Y31A 3KKDA 2HYTA 5F0CA 3TP3A 5FMPA 4ICHA 2D6YA 2HKUA 3DPJA 2XRLA 5D18A 5D19A 3BR1A 3FIWA 2Y2ZA 3VVYA 2F07A 2FBQA 2VKEA 3G7RA 5F1JA 5F0HA 3VP5A 1T56A 2GBYA 3ZQHA 4I6ZA 4M3DA 1JUPA 5CXGA 2JK3A 2RHAA 3ZQIA 2NP5A 3PM1A 3KZ9A 3Q0UA 3EGQA 5FGLA 3BRUA 2UXPA 4AC6A 2G0EA 3P9TA 3CCYA 3BTJA 1SGMA 3BQZA 5K7HA 4D5FA 2QOPA 3F1BA 4MK6A 5HBUA 3HGGA 4B3AA 2HXIA 2VPRA 5FKNA 3SFIA 3VOKA 1QVTA 3QQAA 4MO7A 3IH4A 3ZQFA 2ZCXA 2VKVA 2NX4A 3BQYA 4GFLA 3G1LA 4M3EA 3E7QA 3LSPA 2O7TA 3FK7A 5AQCA 3FK6A 1T33A 3AQSA 5EYRA 3CWRA 1JTXA 2NP3A 1BJZA 5C4YA 4V2GA 2FQ4A 3HE0A 3BHQA 2G3BA 3GZIA 1UI5A 3BT9A 4JNNA 3BR5A 4M3FA 4MXMA 1RPWA 5EZHA 5GPCA 1JTYA 3EUPA 4D5CA 4ACIA 2ZCMA 5FHPA 2RASA 3V78A 4ABZA 1ZKGA 3NNRA 2XGCA 2IBDA 4DW6A 4PXIA 2UXOA 2ID3A 2G7LA 3O8HA 1QVUA 3B6CA 2FD5A 5GP9A 3VVXA 5J1UA 4YZEA 4GCTA 5F08A 3WHBA 1JT6A 3VIBA 3LOCA 4AF5A 3QKXA 4CGRA 3VW1A 5CXIA 3C2BA 1Z0XA 2XGEA 4KWAA 4M3BA 3Q0WA 4AUXA 3MVPA 3BTIA 4G12A 4GFKA 3HTAA 2QKOA 3BTCA 3RD3A 5F04A 3WHCA 3LHQA 4M3GA 3IH2A 3ZQLA 4GCKA 5GPAA 3PPBA 2DG7A 3IH3A 2ZOZA 3NRGA 3LWJA 1A6IA 2ID6A 2XPWA 1ZK8A 1RKWA 5J3LA 2Q24A 5IPAA 2QWTA 2W53A 3HTIA 5K7FA 1QPIA 5DAJA 3BNIA 5K7ZA 1JUMA 3LJLA 2GFNA 2NS7A 3Q0VA 2X6OA 5J1RA 4B1RA 3NPIA 3T6NA 2XDNA 2DTZA 2DG8A 2IEKA 4JL3A 3HIMA 2IAIA 1RKTA 5HSZA 4NN1A 1U9OA 5D1RA 3JSJA 4I76A 3V6GA 2UXUA 2GENA 3O60A 4NELA 5F27A 2FX0A 1ORKA 4HKUA 2WV1A 3TP0A 2WGBA 3GEUA 3NI7A 3HTJA 2XPUA 5IOYA 3BCGA 2UXHA 3SDGA 1UI6A 2XGDA 4D7NA 5EFYA 5IP6A 3S5RA 3RH2A 3KNWA 4W97A 5J1YA 5HAWA 4GCLA 2GUHA 2PZ9A 2HQ5A 2ZB9A 3VW2A 2PBXA 2XB5A 3VVZA 3ANGA 2WUIA 5IOZA 3ON2A 2EH3A 4ME9A 2HYJA 2JJ7A 2Y30A 2NS8A 2ZOYA 3ON4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TCT A;  2V57 A;  3COL A;  5F0F A;  2O7O A;  2X9D A;  3Q3S A;  3G1M A;  3BR0 A;  5FKO A;  3G1O A;  2HXO A;  3QPL A;  2FJ1 A;  1U9N A;  3AQT A;  4JKZ A;  4JYK A;  5FKL A;  4UDS A;  4XK4 A;  5CW8 A;  2QTQ A;  4L62 A;  3ZQG A;  3MNL A;  5FKK A;  2ZCN A;  3C07 A;  3HTH A;  4V2F A;  3VPR A;  3LSJ A;  3B81 A;  1JT0 A;  2IU5 A;  1Z77 A;  2YVE A;  4W1U A;  3QBM A;  2I10 A;  3BR6 A;  1VI0 A;  3IUV A;  1JUS A;  3LSR A;  5EZG A;  3FRQ A;  2OF7 A;  2OI8 A;  3DEW A;  5H9T A;  2RAE A;  3CJD A;  2TRT A;  2G7G A;  3BJB A;  5K58 A;  3BR3 A;  3BTL A;  3KKC A;  3VOX A;  2REK A;  3CRJ A;  2G7S A;  3QPS A;  3VUQ A;  3NXC A;  4AC0 A;  3O8G A;  3PAS A;  3CDL A;  4X1E A;  2XPV A;  3F0C A;  2YVH A;  2QCO A;  2UXI A;  3ANP A;  3HGY A;  3G56 A;  3VW0 A;  2OPT A;  3B6A A;  3BR2 A;  5FKM A;  3DCF A;  4D7M A;  2QIB A;  2OER A;  2Y31 A;  3KKD A;  2HYT A;  5F0C A;  3TP3 A;  5FMP A;  4ICH A;  2D6Y A;  2HKU A;  3DPJ A;  2XRL A;  5D18 A;  5D19 A;  3BR1 A;  3FIW A;  2Y2Z A;  3VVY A;  2F07 A;  2FBQ A;  2VKE A;  3G7R A;  5F1J A;  5F0H A;  3VP5 A;  1T56 A;  2GBY A;  3ZQH A;  4I6Z A;  4M3D A;  1JUP A;  5CXG A;  2JK3 A;  2RHA A;  3ZQI A;  2NP5 A;  3PM1 A;  3KZ9 A;  3Q0U A;  3EGQ A;  5FGL A;  3BRU A;  2UXP A;  4AC6 A;  2G0E A;  3P9T A;  3CCY A;  3BTJ A;  1SGM A;  3BQZ A;  5K7H A;  4D5F A;  2QOP A;  3F1B A;  4MK6 A;  5HBU A;  3HGG A;  4B3A A;  2HXI A;  2VPR A;  5FKN A;  3SFI A;  3VOK A;  1QVT A;  3QQA A;  4MO7 A;  3IH4 A;  3ZQF A;  2ZCX A;  2VKV A;  2NX4 A;  3BQY A;  4GFL A;  3G1L A;  4M3E A;  3E7Q A;  3LSP A;  2O7T A;  3FK7 A;  5AQC A;  3FK6 A;  1T33 A;  3AQS A;  5EYR A;  3CWR A;  1JTX A;  2NP3 A;  1BJZ A;  5C4Y A;  4V2G A;  2FQ4 A;  3HE0 A;  3BHQ A;  2G3B A;  3GZI A;  1UI5 A;  3BT9 A;  4JNN A;  3BR5 A;  4M3F A;  4MXM A;  1RPW A;  5EZH A;  5GPC A;  1JTY A;  3EUP A;  4D5C A;  4ACI A;  2ZCM A;  5FHP A;  2RAS A;  3V78 A;  4ABZ A;  1ZKG A;  3NNR A;  2XGC A;  2IBD A;  4DW6 A;  4PXI A;  2UXO A;  2ID3 A;  2G7L A;  3O8H A;  1QVU A;  3B6C A;  2FD5 A;  5GP9 A;  3VVX A;  5J1U A;  4YZE A;  4GCT A;  5F08 A;  3WHB A;  1JT6 A;  3VIB A;  3LOC A;  4AF5 A;  3QKX A;  4CGR A;  3VW1 A;  5CXI A;  3C2B A;  1Z0X A;  2XGE A;  4KWA A;  4M3B A;  3Q0W A;  4AUX A;  3MVP A;  3BTI A;  4G12 A;  4GFK A;  3HTA A;  2QKO A;  3BTC A;  3RD3 A;  5F04 A;  3WHC A;  3LHQ A;  4M3G A;  3IH2 A;  3ZQL A;  4GCK A;  5GPA A;  3PPB A;  2DG7 A;  3IH3 A;  2ZOZ A;  3NRG A;  3LWJ A;  1A6I A;  2ID6 A;  2XPW A;  1ZK8 A;  1RKW A;  5J3L A;  2Q24 A;  5IPA A;  2QWT A;  2W53 A;  3HTI A;  5K7F A;  1QPI A;  5DAJ A;  3BNI A;  5K7Z A;  1JUM A;  3LJL A;  2GFN A;  2NS7 A;  3Q0V A;  2X6O A;  5J1R A;  4B1R A;  3NPI A;  3T6N A;  2XDN A;  2DTZ A;  2DG8 A;  2IEK A;  4JL3 A;  3HIM A;  2IAI A;  1RKT A;  5HSZ A;  4NN1 A;  1U9O A;  5D1R A;  3JSJ A;  4I76 A;  3V6G A;  2UXU A;  2GEN A;  3O60 A;  4NEL A;  5F27 A;  2FX0 A;  1ORK A;  4HKU A;  2WV1 A;  3TP0 A;  2WGB A;  3GEU A;  3NI7 A;  3HTJ A;  2XPU A;  5IOY A;  3BCG A;  2UXH A;  3SDG A;  1UI6 A;  2XGD A;  4D7N A;  5EFY A;  5IP6 A;  3S5R A;  3RH2 A;  3KNW A;  4W97 A;  5J1Y A;  5HAW A;  4GCL A;  2GUH A;  2PZ9 A;  2HQ5 A;  2ZB9 A;  3VW2 A;  2PBX A;  2XB5 A;  3VVZ A;  3ANG A;  2WUI A;  5IOZ A;  3ON2 A;  2EH3 A;  4ME9 A;  2HYJ A;  2JJ7 A;  2Y30 A;  2NS8 A;  2ZOY A;  3ON4 A; 
#chains in the Genus database with same CATH topology
 2TCT A;  2V57 A;  3COL A;  5F0F A;  2O7O A;  2X9D A;  3Q3S A;  3G1M A;  3BR0 A;  5FKO A;  3G1O A;  2HXO A;  3QPL A;  2FJ1 A;  1U9N A;  3AQT A;  4JKZ A;  4JYK A;  5FKL A;  2R7W A;  4UDS A;  4XK4 A;  5CW8 A;  2QTQ A;  4L62 A;  3ZQG A;  3MNL A;  5FKK A;  2ZCN A;  3C07 A;  3HTH A;  4V2F A;  3VPR A;  3LSJ A;  3B81 A;  1JT0 A;  2IU5 A;  1Z77 A;  2YVE A;  4W1U A;  2A2F X;  3QBM A;  2I10 A;  3BR6 A;  1VI0 A;  3IUV A;  1JUS A;  3LSR A;  5EZG A;  3FRQ A;  2OF7 A;  2OI8 A;  3DEW A;  5H9T A;  2RAE A;  3CJD A;  2TRT A;  2G7G A;  3BJB A;  5K58 A;  3BR3 A;  3BTL A;  3KKC A;  3VOX A;  2REK A;  3CRJ A;  2G7S A;  3QPS A;  3VUQ A;  3NXC A;  4AC0 A;  3O8G A;  3PAS A;  3CDL A;  2FJI 1;  4X1E A;  2XPV A;  3F0C A;  2YVH A;  2QCO A;  2UXI A;  3ANP A;  3HGY A;  3G56 A;  3VW0 A;  3DU6 A;  2OPT A;  3B6A A;  3BR2 A;  5FKM A;  3DCF A;  4D7M A;  2QIB A;  2OER A;  2Y31 A;  3KKD A;  2HYT A;  5F0C A;  3TP3 A;  5FMP A;  4ICH A;  2D6Y A;  2HKU A;  3DPJ A;  2XRL A;  5D18 A;  5D19 A;  3BR1 A;  3NS4 A;  3FIW A;  2Y2Z A;  3VVY A;  2F07 A;  2FBQ A;  4C2M A;  5CQG A;  2R7Q A;  2VKE A;  3G7R A;  5F1J A;  5F0H A;  3VP5 A;  1T56 A;  2GBY A;  3ZQH A;  4I6Z A;  4M3D A;  1JUP A;  5CXG A;  2JK3 A;  2RHA A;  3ZQI A;  2NP5 A;  3PM1 A;  2R7U A;  2B1E A;  4IRV A;  3KZ9 A;  3Q0U A;  3EGQ A;  5FGL A;  3BRU A;  2UXP A;  3VTI A;  4AC6 A;  2G0E A;  2R7R A;  3P9T A;  3CCY A;  3BTJ A;  2R7X A;  1SGM A;  3BQZ A;  5K7H A;  4D5F A;  2QOP A;  3F1B A;  4MK6 A;  5HBU A;  3HGG A;  4B3A A;  3FHN A;  2HXI A;  2VPR A;  5FKN A;  3SFI A;  3VOK A;  1QVT A;  3QQA A;  4MO7 A;  3IH4 A;  3ZQF A;  2ZCX A;  2VKV A;  2NX4 A;  3BQY A;  4GFL A;  3G1L A;  4M3E A;  3E7Q A;  3LSP A;  2O7T A;  3FK7 A;  5AQC A;  3FK6 A;  1T33 A;  3AQS A;  5EYR A;  3CWR A;  1JTX A;  2NP3 A;  1BJZ A;  5C4Y A;  4V2G A;  2FQ4 A;  3HE0 A;  4U9L A;  3BHQ A;  2G3B A;  3GZI A;  1UI5 A;  3BT9 A;  4JNN A;  3BR5 A;  4M3F A;  4MXM A;  1RPW A;  5EZH A;  2PFV A;  5GPC A;  1JTY A;  3EUP A;  4WIB A;  4D5C A;  4ACI A;  2ZCM A;  5FHP A;  2R7V A;  2RAS A;  3V78 A;  4ABZ A;  1ZKG A;  3SWH A;  3NNR A;  2XGC A;  4OD5 A;  2ZY9 A;  2IBD A;  4DW6 A;  4PXI A;  2UXO A;  2ID3 A;  4U9N A;  2G7L A;  3O8H A;  1QVU A;  3B6C A;  2FD5 A;  5GP9 A;  3VVX A;  3K8P C;  5J1U A;  4YZE A;  4GCT A;  5F08 A;  3WHB A;  1JT6 A;  3VIB A;  3LOC A;  4AF5 A;  3QKX A;  4CGR A;  3VW1 A;  5CXI A;  3C2B A;  1Z0X A;  2XGE A;  4KWA A;  4M3B A;  3Q0W A;  4AUX A;  3MVP A;  3BTI A;  2B3W A;  4G12 A;  4DVY P;  4GFK A;  3HTA A;  2QKO A;  3BTC A;  3RD3 A;  5F04 A;  3WHC A;  3LHQ A;  4M3G A;  3IH2 A;  3ZQL A;  4GCK A;  5GPA A;  3PPB A;  2R7T A;  2DG7 A;  3IH3 A;  2ZOZ A;  3NRG A;  3LWJ A;  1A6I A;  2ID6 A;  2XPW A;  1ZK8 A;  1RKW A;  2YVX A;  5J3L A;  2Q24 A;  5IPA A;  2QWT A;  2W53 A;  3HTI A;  5K7F A;  1QPI A;  5DAJ A;  3BNI A;  5K7Z A;  1JUM A;  3LJL A;  2GFN A;  2NS7 A;  3Q0V A;  2X6O A;  5J1R A;  4B1R A;  3NPI A;  3T6N A;  2XDN A;  4OD4 A;  2DTZ A;  2DG8 A;  2IEK A;  4JL3 A;  3HIM A;  2IAI A;  1RKT A;  3KYL A;  5HSZ A;  4NN1 A;  1U9O A;  5D1R A;  3JSJ A;  4I76 A;  3V6G A;  2UXU A;  2GEN A;  3O60 A;  4NEL A;  5F27 A;  2FX0 A;  1ORK A;  4HKU A;  2WV1 A;  3TP0 A;  2WGB A;  3GEU A;  3NI7 A;  3HTJ A;  2XPU A;  2R7S A;  5IOY A;  3BCG A;  2UXH A;  3SDG A;  1UI6 A;  2XGD A;  4D7N A;  5EFY A;  5IP6 A;  3S5R A;  3RH2 A;  3KNW A;  4W97 A;  5J1Y A;  5HAW A;  4GCL A;  2GUH A;  2PZ9 A;  2HQ5 A;  2ZB9 A;  3VW2 A;  2PBX A;  2XB5 A;  3VVZ A;  3DU5 A;  3ANG A;  2WUI A;  5IOZ A;  3ON2 A;  2EH3 A;  4ME9 A;  2HYJ A;  2JJ7 A;  2R7O A;  2Y30 A;  2NS8 A;  2ZOY A;  3ON4 A; 
#chains in the Genus database with same CATH homology
 2TCT A;  2V57 A;  3COL A;  5F0F A;  2O7O A;  2X9D A;  3Q3S A;  3G1M A;  3BR0 A;  5FKO A;  3G1O A;  2HXO A;  3QPL A;  2FJ1 A;  1U9N A;  3AQT A;  4JKZ A;  4JYK A;  5FKL A;  4UDS A;  4XK4 A;  5CW8 A;  2QTQ A;  4L62 A;  3ZQG A;  3MNL A;  5FKK A;  2ZCN A;  3C07 A;  3HTH A;  4V2F A;  3VPR A;  3LSJ A;  3B81 A;  1JT0 A;  2IU5 A;  1Z77 A;  2YVE A;  4W1U A;  3QBM A;  2I10 A;  3BR6 A;  1VI0 A;  3IUV A;  1JUS A;  3LSR A;  5EZG A;  3FRQ A;  2OF7 A;  2OI8 A;  3DEW A;  5H9T A;  2RAE A;  3CJD A;  2TRT A;  2G7G A;  3BJB A;  5K58 A;  3BR3 A;  3BTL A;  3KKC A;  3VOX A;  2REK A;  3CRJ A;  2G7S A;  3QPS A;  3VUQ A;  3NXC A;  4AC0 A;  3O8G A;  3PAS A;  3CDL A;  4X1E A;  2XPV A;  3F0C A;  2YVH A;  2QCO A;  2UXI A;  3ANP A;  3HGY A;  3G56 A;  3VW0 A;  2OPT A;  3B6A A;  3BR2 A;  5FKM A;  3DCF A;  4D7M A;  2QIB A;  2OER A;  2Y31 A;  3KKD A;  2HYT A;  5F0C A;  3TP3 A;  5FMP A;  4ICH A;  2D6Y A;  2HKU A;  3DPJ A;  2XRL A;  5D18 A;  5D19 A;  3BR1 A;  3FIW A;  2Y2Z A;  3VVY A;  2F07 A;  2FBQ A;  2VKE A;  3G7R A;  5F1J A;  5F0H A;  3VP5 A;  1T56 A;  2GBY A;  3ZQH A;  4I6Z A;  4M3D A;  1JUP A;  5CXG A;  2JK3 A;  2RHA A;  3ZQI A;  2NP5 A;  3PM1 A;  3KZ9 A;  3Q0U A;  3EGQ A;  5FGL A;  3BRU A;  2UXP A;  4AC6 A;  2G0E A;  3P9T A;  3CCY A;  3BTJ A;  1SGM A;  3BQZ A;  5K7H A;  4D5F A;  2QOP A;  3F1B A;  4MK6 A;  5HBU A;  3HGG A;  4B3A A;  2HXI A;  2VPR A;  5FKN A;  3SFI A;  3VOK A;  1QVT A;  3QQA A;  4MO7 A;  3IH4 A;  3ZQF A;  2ZCX A;  2VKV A;  2NX4 A;  3BQY A;  4GFL A;  3G1L A;  4M3E A;  3E7Q A;  3LSP A;  2O7T A;  3FK7 A;  5AQC A;  3FK6 A;  1T33 A;  3AQS A;  5EYR A;  3CWR A;  1JTX A;  2NP3 A;  1BJZ A;  5C4Y A;  4V2G A;  2FQ4 A;  3HE0 A;  3BHQ A;  2G3B A;  3GZI A;  1UI5 A;  3BT9 A;  4JNN A;  3BR5 A;  4M3F A;  4MXM A;  1RPW A;  5EZH A;  5GPC A;  1JTY A;  3EUP A;  4D5C A;  4ACI A;  2ZCM A;  5FHP A;  2RAS A;  3V78 A;  4ABZ A;  1ZKG A;  3NNR A;  2XGC A;  2IBD A;  4DW6 A;  4PXI A;  2UXO A;  2ID3 A;  2G7L A;  3O8H A;  1QVU A;  3B6C A;  2FD5 A;  5GP9 A;  3VVX A;  5J1U A;  4YZE A;  4GCT A;  5F08 A;  3WHB A;  1JT6 A;  3VIB A;  3LOC A;  4AF5 A;  3QKX A;  4CGR A;  3VW1 A;  5CXI A;  3C2B A;  1Z0X A;  2XGE A;  4KWA A;  4M3B A;  3Q0W A;  4AUX A;  3MVP A;  3BTI A;  4G12 A;  4GFK A;  3HTA A;  2QKO A;  3BTC A;  3RD3 A;  5F04 A;  3WHC A;  3LHQ A;  4M3G A;  3IH2 A;  3ZQL A;  4GCK A;  5GPA A;  3PPB A;  2DG7 A;  3IH3 A;  2ZOZ A;  3NRG A;  3LWJ A;  1A6I A;  2ID6 A;  2XPW A;  1ZK8 A;  1RKW A;  5J3L A;  2Q24 A;  5IPA A;  2QWT A;  2W53 A;  3HTI A;  5K7F A;  1QPI A;  5DAJ A;  3BNI A;  5K7Z A;  1JUM A;  3LJL A;  2GFN A;  2NS7 A;  3Q0V A;  2X6O A;  5J1R A;  4B1R A;  3NPI A;  3T6N A;  2XDN A;  2DTZ A;  2DG8 A;  2IEK A;  4JL3 A;  3HIM A;  2IAI A;  1RKT A;  5HSZ A;  4NN1 A;  1U9O A;  5D1R A;  3JSJ A;  4I76 A;  3V6G A;  2UXU A;  2GEN A;  3O60 A;  4NEL A;  5F27 A;  2FX0 A;  1ORK A;  4HKU A;  2WV1 A;  3TP0 A;  2WGB A;  3GEU A;  3NI7 A;  3HTJ A;  2XPU A;  5IOY A;  3BCG A;  2UXH A;  3SDG A;  1UI6 A;  2XGD A;  4D7N A;  5EFY A;  5IP6 A;  3S5R A;  3RH2 A;  3KNW A;  4W97 A;  5J1Y A;  5HAW A;  4GCL A;  2GUH A;  2PZ9 A;  2HQ5 A;  2ZB9 A;  3VW2 A;  2PBX A;  2XB5 A;  3VVZ A;  3ANG A;  2WUI A;  5IOZ A;  3ON2 A;  2EH3 A;  4ME9 A;  2HYJ A;  2JJ7 A;  2Y30 A;  2NS8 A;  2ZOY A;  3ON4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...