2D6YA

Crystal structure of transcriptional factor sco4008 from streptomyces coelicolor a3(2)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
186
structure length
186
Chain Sequence
b'EATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKMLDLAISVPVDPDDIEGWIDRLLDYHAAHPELLRLLFWEGMEYGTAELPHEAERQEHYARKVAAVRDGQERGVITDAIPAPDLLFLLVAMANWAVVVPQMKRILVGGGDAGTDGLRDSIKKAARRIVDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative tetR family regulatory protein
publication title SCO4008, a Putative TetR Transcriptional Repressor from Streptomyces coelicolor A3(2), Regulates Transcription of sco4007 by Multidrug Recognition.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Gene regulation
total genus 64
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17926 TetR_C_21 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2d6yA00
3BTLA 3NI7A 5EZHA 2UXOA 3LOCA 4I76A 3BR6A 2OERA 5EZGA 4NN1A 3LSPA 1JUSA 3BTJA 3T6NA 3QBMA 1QPIA 4ABZA 3NPIA 4B3AA 2ZOYA 2OF7A 2Y2ZA 2YVHA 2QIBA 5C4YA 3BT9A 5CXGA 2YVEA 3TP0A 5J1YA 3RD3A 2WV1A 3LHQA 5D18A 3VP5A 5F0FA 2HQ5A 4AF5A 2HYJA 3E7QA 3IH2A 2GBYA 1JUMA 4M3GA 3VVYA 4GCLA 3RH2A 3CRJA 4B1RA 2IEKA 5GP9A 4JYKA 4MK6A 2X9DA 3F1BA 3B6CA 2Y31A 3HTJA 2TRTA 3CWRA 3SFIA 3V6GA 3S5RA 3LSJA 2HXOA 3FK7A 5J3LA 5K7FA 1JT6A 4AC6A 5K7HA 4D5CA 1QVUA 3HTIA 3BQYA 3BRUA 3KNWA 1JTYA 3CCYA 3BTCA 2QWTA 5K58A 2QOPA 4M3DA 2GENA 2RAEA 4GFKA 2FD5A 3LJLA 3PPBA 1JUPA 3Q0WA 3HTAA 3PM1A 3Q0UA 4AUXA 3IH4A 3G56A 4GFLA 3VIBA 4KWAA 2ID3A 1U9NA 4UDSA 2OPTA 2W53A 4D7NA 3FIWA 4M3BA 1QVTA 5F1JA 3BR1A 2ZOZA 5AQCA 3ANGA 2WUIA 3QPLA 3BR2A 3DCFA 2FX0A 2DG7A 4GCKA 3DEWA 2VKVA 3F0CA 2XPWA 3B6AA 4NELA 2DTZA 2XPUA 5H9TA 5EYRA 1ZK8A 1RPWA 3MNLA 3IUVA 3O60A 2QTQA 2ZB9A 3HTHA 2REKA 2G0EA 5CXIA 2RASA 3LSRA 2XGEA 2VPRA 3ANPA 3G1MA 2F07A 3EUPA 3GZIA 5HSZA 3KKCA 2G7SA 2RHAA 3VW0A 5GPCA 3VUQA 3BJBA 4D7MA 2DG8A 2IU5A 3VOXA 5F27A 4DW6A 2X6OA 2HKUA 2NS8A 2VKEA 3BTIA 1UI5A 3HGYA 4I6ZA 2ZCMA 5F08A 1SGMA 2Y30A 4HKUA 3CJDA 3AQTA 3VOKA 4ICHA 2D6YA 3G7RA 1U9OA 5IP6A 5EFYA 2GUHA 4JL3A 4V2FA 3GEUA 3VVZA 2QKOA 3G1LA 3BR3A 5FKNA 2XGDA 1JTXA 3ON2A 2O7TA 2XRLA 2UXHA 3BR0A 5FMPA 3NNRA 1VI0A 4GCTA 3HIMA 3BHQA 3BQZA 2XPVA 4V2GA 5CW8A 2FQ4A 2Q24A 4XK4A 1ZKGA 3VPRA 3WHCA 1JT0A 2TCTA 2UXUA 2XGCA 4ACIA 3ZQGA 3O8GA 3EGQA 3PASA 5DAJA 3Q3SA 3NXCA 5IOZA 4M3EA 5FGLA 3VW2A 2NS7A 4AC0A 2JJ7A 2I10A 3ZQIA 3BNIA 2XB5A 1T56A 1ORKA 3KZ9A 2V57A 5HAWA 3O8HA 1T33A 3MVPA 3QPSA 5FKOA 1RKWA 2ZCNA 5J1RA 3TP3A 2G7GA 5GPAA 4G12A 4M3FA 4L62A 3FRQA 2QCOA 1A6IA 2GFNA 5J1UA 3C2BA 3G1OA 2NP3A 1RKTA 4MXMA 2O7OA 3HGGA 3AQSA 3IH3A 3SDGA 4W1UA 4D5FA 4W97A 3Q0VA 2XDNA 5F0HA 2G3BA 3WHBA 1Z77A 4MO7A 4CGRA 5FKLA 3ZQFA 3VVXA 2PZ9A 2NP5A 3B81A 2PBXA 2IBDA 3CDLA 5D1RA 3KKDA 2ID6A 4ME9A 1Z0XA 4YZEA 5HBUA 3C07A 4JNNA 3FK6A 3COLA 2FJ1A 5D19A 3ON4A 4PXIA 5F04A 3VW1A 2FBQA 3QQAA 2JK3A 1UI6A 4JKZA 5FKKA 3BR5A 2IAIA 2OI8A 3ZQHA 3QKXA 2WGBA 3HE0A 2UXIA 5F0CA 5K7ZA 3BCGA 2EH3A 3LWJA 3DPJA 5IPAA 5FKMA 3JSJA 3V78A 3P9TA 5FHPA 4X1EA 2HXIA 2ZCXA 2HYTA 1BJZA 3ZQLA 5IOYA 2NX4A 2G7LA 2UXPA 3NRGA
chains in the Genus database with same CATH superfamily
3BTLA 3NI7A 5EZHA 2UXOA 3LOCA 4I76A 3BR6A 2OERA 5EZGA 4NN1A 3LSPA 1JUSA 3BTJA 3T6NA 3QBMA 1QPIA 4ABZA 3NPIA 4B3AA 2ZOYA 2OF7A 2Y2ZA 2YVHA 2QIBA 5C4YA 3BT9A 5CXGA 2YVEA 3TP0A 5J1YA 3RD3A 2WV1A 3LHQA 5D18A 3VP5A 5F0FA 2HQ5A 4AF5A 2HYJA 3E7QA 3IH2A 2GBYA 1JUMA 4M3GA 3VVYA 4GCLA 3RH2A 3CRJA 4B1RA 2IEKA 5GP9A 4JYKA 4MK6A 2X9DA 3F1BA 3B6CA 3SWHA 2Y31A 3HTJA 2TRTA 3CWRA 3SFIA 3V6GA 3S5RA 3LSJA 2HXOA 3FK7A 5J3LA 5K7FA 1JT6A 4AC6A 5K7HA 4D5CA 2R7SA 1QVUA 3HTIA 3BQYA 3BRUA 3KNWA 2B3WA 1JTYA 3CCYA 3BTCA 2QWTA 5K58A 5CQGA 2QOPA 4M3DA 2GENA 2RAEA 4GFKA 2FD5A 3LJLA 3PPBA 1JUPA 3Q0WA 3HTAA 2R7XA 3PM1A 3Q0UA 4AUXA 3IH4A 3G56A 4GFLA 3VIBA 4KWAA 2R7RA 2ID3A 1U9NA 4UDSA 2OPTA 2W53A 4D7NA 3FIWA 4M3BA 1QVTA 5F1JA 3BR1A 2ZOZA 3DU6A 5AQCA 3ANGA 3VTIA 2WUIA 3QPLA 3BR2A 3DCFA 2FX0A 2DG7A 4GCKA 3DEWA 2VKVA 3K8PC 3F0CA 2XPWA 3B6AA 4NELA 2DTZA 2XPUA 5H9TA 5EYRA 1ZK8A 1RPWA 3MNLA 3IUVA 2R7OA 3O60A 2QTQA 2ZB9A 3HTHA 2REKA 2G0EA 5CXIA 2RASA 3LSRA 2XGEA 2VPRA 3ANPA 3G1MA 2F07A 4C2MA 3EUPA 4DVYP 3GZIA 5HSZA 3KKCA 2G7SA 2RHAA 3VW0A 2FJI1 5GPCA 3VUQA 3BJBA 4D7MA 2DG8A 2IU5A 3VOXA 5F27A 4DW6A 2X6OA 2HKUA 2NS8A 2VKEA 3BTIA 1UI5A 3HGYA 4I6ZA 2ZCMA 5F08A 1SGMA 2Y30A 4HKUA 3CJDA 3AQTA 3VOKA 4ICHA 2D6YA 3G7RA 1U9OA 2R7WA 5IP6A 2ZY9A 5EFYA 2GUHA 4WIBA 4OD5A 4JL3A 4V2FA 3GEUA 3VVZA 2QKOA 3G1LA 3FHNA 3BR3A 5FKNA 2XGDA 1JTXA 3ON2A 2O7TA 2XRLA 2UXHA 3BR0A 5FMPA 3NNRA 1VI0A 4GCTA 3HIMA 3BHQA 3BQZA 2XPVA 4V2GA 5CW8A 2FQ4A 2Q24A 4IRVA 4XK4A 1ZKGA 3VPRA 3WHCA 1JT0A 2TCTA 2UXUA 2XGCA 4ACIA 3ZQGA 3O8GA 3EGQA 3PASA 5DAJA 3Q3SA 3NXCA 5IOZA 2R7VA 4M3EA 4U9LA 4U9NA 5FGLA 3VW2A 2NS7A 4AC0A 2JJ7A 2I10A 3ZQIA 3BNIA 2XB5A 1T56A 1ORKA 3KZ9A 2V57A 5HAWA 3O8HA 1T33A 3MVPA 3QPSA 5FKOA 1RKWA 2ZCNA 5J1RA 3TP3A 2G7GA 5GPAA 4G12A 4M3FA 4L62A 3FRQA 2QCOA 1A6IA 2GFNA 5J1UA 3C2BA 3G1OA 2NP3A 4OD4A 1RKTA 4MXMA 2O7OA 3HGGA 3AQSA 3IH3A 3SDGA 4W1UA 2PFVA 4D5FA 4W97A 3Q0VA 2XDNA 5F0HA 2G3BA 3WHBA 1Z77A 4MO7A 4CGRA 3NS4A 5FKLA 3ZQFA 3VVXA 2PZ9A 2A2FX 2NP5A 3B81A 2PBXA 2IBDA 3CDLA 5D1RA 3KKDA 2ID6A 4ME9A 1Z0XA 4YZEA 5HBUA 3C07A 4JNNA 3FK6A 3COLA 2FJ1A 5D19A 3ON4A 4PXIA 5F04A 2B1EA 3VW1A 2FBQA 3QQAA 3DU5A 3KYLA 2JK3A 1UI6A 4JKZA 5FKKA 3BR5A 2IAIA 2OI8A 3ZQHA 3QKXA 2WGBA 3HE0A 2UXIA 5F0CA 2R7QA 5K7ZA 3BCGA 2EH3A 3LWJA 2R7TA 3DPJA 5IPAA 5FKMA 3JSJA 2YVXA 3V78A 3P9TA 5FHPA 4X1EA 2HXIA 2ZCXA 2HYTA 1BJZA 3ZQLA 2R7UA 5IOYA 2NX4A 2G7LA 2UXPA 3NRGA
chains in the Genus database with same CATH topology
3BTLA 3NI7A 5EZHA 2UXOA 3LOCA 4I76A 3BR6A 2OERA 5EZGA 4NN1A 3LSPA 1JUSA 3BTJA 3T6NA 3QBMA 1QPIA 4ABZA 3NPIA 4B3AA 2ZOYA 2OF7A 2Y2ZA 2YVHA 2QIBA 5C4YA 3BT9A 5CXGA 2YVEA 3TP0A 5J1YA 3RD3A 2WV1A 3LHQA 5D18A 3VP5A 5F0FA 2HQ5A 4AF5A 2HYJA 3E7QA 3IH2A 2GBYA 1JUMA 4M3GA 3VVYA 4GCLA 3RH2A 3CRJA 4B1RA 2IEKA 5GP9A 4JYKA 4MK6A 2X9DA 3F1BA 3B6CA 2Y31A 3HTJA 2TRTA 3CWRA 3SFIA 3V6GA 3S5RA 3LSJA 2HXOA 3FK7A 5J3LA 5K7FA 1JT6A 4AC6A 5K7HA 4D5CA 1QVUA 3HTIA 3BQYA 3BRUA 3KNWA 1JTYA 3CCYA 3BTCA 2QWTA 5K58A 2QOPA 4M3DA 2GENA 2RAEA 4GFKA 2FD5A 3LJLA 3PPBA 1JUPA 3Q0WA 3HTAA 3PM1A 3Q0UA 4AUXA 3IH4A 3G56A 4GFLA 3VIBA 4KWAA 2ID3A 1U9NA 4UDSA 2OPTA 2W53A 4D7NA 3FIWA 4M3BA 1QVTA 5F1JA 3BR1A 2ZOZA 5AQCA 3ANGA 2WUIA 3QPLA 3BR2A 3DCFA 2FX0A 2DG7A 4GCKA 3DEWA 2VKVA 3F0CA 2XPWA 3B6AA 4NELA 2DTZA 2XPUA 5H9TA 5EYRA 1ZK8A 1RPWA 3MNLA 3IUVA 3O60A 2QTQA 2ZB9A 3HTHA 2REKA 2G0EA 5CXIA 2RASA 3LSRA 2XGEA 2VPRA 3ANPA 3G1MA 2F07A 3EUPA 3GZIA 5HSZA 3KKCA 2G7SA 2RHAA 3VW0A 5GPCA 3VUQA 3BJBA 4D7MA 2DG8A 2IU5A 3VOXA 5F27A 4DW6A 2X6OA 2HKUA 2NS8A 2VKEA 3BTIA 1UI5A 3HGYA 4I6ZA 2ZCMA 5F08A 1SGMA 2Y30A 4HKUA 3CJDA 3AQTA 3VOKA 4ICHA 2D6YA 3G7RA 1U9OA 5IP6A 5EFYA 2GUHA 4JL3A 4V2FA 3GEUA 3VVZA 2QKOA 3G1LA 3BR3A 5FKNA 2XGDA 1JTXA 3ON2A 2O7TA 2XRLA 2UXHA 3BR0A 5FMPA 3NNRA 1VI0A 4GCTA 3HIMA 3BHQA 3BQZA 2XPVA 4V2GA 5CW8A 2FQ4A 2Q24A 4XK4A 1ZKGA 3VPRA 3WHCA 1JT0A 2TCTA 2UXUA 2XGCA 4ACIA 3ZQGA 3O8GA 3EGQA 3PASA 5DAJA 3Q3SA 3NXCA 5IOZA 4M3EA 5FGLA 3VW2A 2NS7A 4AC0A 2JJ7A 2I10A 3ZQIA 3BNIA 2XB5A 1T56A 1ORKA 3KZ9A 2V57A 5HAWA 3O8HA 1T33A 3MVPA 3QPSA 5FKOA 1RKWA 2ZCNA 5J1RA 3TP3A 2G7GA 5GPAA 4G12A 4M3FA 4L62A 3FRQA 2QCOA 1A6IA 2GFNA 5J1UA 3C2BA 3G1OA 2NP3A 1RKTA 4MXMA 2O7OA 3HGGA 3AQSA 3IH3A 3SDGA 4W1UA 4D5FA 4W97A 3Q0VA 2XDNA 5F0HA 2G3BA 3WHBA 1Z77A 4MO7A 4CGRA 5FKLA 3ZQFA 3VVXA 2PZ9A 2NP5A 3B81A 2PBXA 2IBDA 3CDLA 5D1RA 3KKDA 2ID6A 4ME9A 1Z0XA 4YZEA 5HBUA 3C07A 4JNNA 3FK6A 3COLA 2FJ1A 5D19A 3ON4A 4PXIA 5F04A 3VW1A 2FBQA 3QQAA 2JK3A 1UI6A 4JKZA 5FKKA 3BR5A 2IAIA 2OI8A 3ZQHA 3QKXA 2WGBA 3HE0A 2UXIA 5F0CA 5K7ZA 3BCGA 2EH3A 3LWJA 3DPJA 5IPAA 5FKMA 3JSJA 3V78A 3P9TA 5FHPA 4X1EA 2HXIA 2ZCXA 2HYTA 1BJZA 3ZQLA 5IOYA 2NX4A 2G7LA 2UXPA 3NRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTL A;  3NI7 A;  5EZH A;  2UXO A;  3LOC A;  4I76 A;  3BR6 A;  2OER A;  5EZG A;  4NN1 A;  3LSP A;  1JUS A;  3BTJ A;  3T6N A;  3QBM A;  1QPI A;  4ABZ A;  3NPI A;  4B3A A;  2ZOY A;  2OF7 A;  2Y2Z A;  2YVH A;  2QIB A;  5C4Y A;  3BT9 A;  5CXG A;  2YVE A;  3TP0 A;  5J1Y A;  3RD3 A;  2WV1 A;  3LHQ A;  5D18 A;  3VP5 A;  5F0F A;  2HQ5 A;  4AF5 A;  2HYJ A;  3E7Q A;  3IH2 A;  2GBY A;  1JUM A;  4M3G A;  3VVY A;  4GCL A;  3RH2 A;  3CRJ A;  4B1R A;  2IEK A;  5GP9 A;  4JYK A;  4MK6 A;  2X9D A;  3F1B A;  3B6C A;  2Y31 A;  3HTJ A;  2TRT A;  3CWR A;  3SFI A;  3V6G A;  3S5R A;  3LSJ A;  2HXO A;  3FK7 A;  5J3L A;  5K7F A;  1JT6 A;  4AC6 A;  5K7H A;  4D5C A;  1QVU A;  3HTI A;  3BQY A;  3BRU A;  3KNW A;  1JTY A;  3CCY A;  3BTC A;  2QWT A;  5K58 A;  2QOP A;  4M3D A;  2GEN A;  2RAE A;  4GFK A;  2FD5 A;  3LJL A;  3PPB A;  1JUP A;  3Q0W A;  3HTA A;  3PM1 A;  3Q0U A;  4AUX A;  3IH4 A;  3G56 A;  4GFL A;  3VIB A;  4KWA A;  2ID3 A;  1U9N A;  4UDS A;  2OPT A;  2W53 A;  4D7N A;  3FIW A;  4M3B A;  1QVT A;  5F1J A;  3BR1 A;  2ZOZ A;  5AQC A;  3ANG A;  2WUI A;  3QPL A;  3BR2 A;  3DCF A;  2FX0 A;  2DG7 A;  4GCK A;  3DEW A;  2VKV A;  3F0C A;  2XPW A;  3B6A A;  4NEL A;  2DTZ A;  2XPU A;  5H9T A;  5EYR A;  1ZK8 A;  1RPW A;  3MNL A;  3IUV A;  3O60 A;  2QTQ A;  2ZB9 A;  3HTH A;  2REK A;  2G0E A;  5CXI A;  2RAS A;  3LSR A;  2XGE A;  2VPR A;  3ANP A;  3G1M A;  2F07 A;  3EUP A;  3GZI A;  5HSZ A;  3KKC A;  2G7S A;  2RHA A;  3VW0 A;  5GPC A;  3VUQ A;  3BJB A;  4D7M A;  2DG8 A;  2IU5 A;  3VOX A;  5F27 A;  4DW6 A;  2X6O A;  2HKU A;  2NS8 A;  2VKE A;  3BTI A;  1UI5 A;  3HGY A;  4I6Z A;  2ZCM A;  5F08 A;  1SGM A;  2Y30 A;  4HKU A;  3CJD A;  3AQT A;  3VOK A;  4ICH A;  2D6Y A;  3G7R A;  1U9O A;  5IP6 A;  5EFY A;  2GUH A;  4JL3 A;  4V2F A;  3GEU A;  3VVZ A;  2QKO A;  3G1L A;  3BR3 A;  5FKN A;  2XGD A;  1JTX A;  3ON2 A;  2O7T A;  2XRL A;  2UXH A;  3BR0 A;  5FMP A;  3NNR A;  1VI0 A;  4GCT A;  3HIM A;  3BHQ A;  3BQZ A;  2XPV A;  4V2G A;  5CW8 A;  2FQ4 A;  2Q24 A;  4XK4 A;  1ZKG A;  3VPR A;  3WHC A;  1JT0 A;  2TCT A;  2UXU A;  2XGC A;  4ACI A;  3ZQG A;  3O8G A;  3EGQ A;  3PAS A;  5DAJ A;  3Q3S A;  3NXC A;  5IOZ A;  4M3E A;  5FGL A;  3VW2 A;  2NS7 A;  4AC0 A;  2JJ7 A;  2I10 A;  3ZQI A;  3BNI A;  2XB5 A;  1T56 A;  1ORK A;  3KZ9 A;  2V57 A;  5HAW A;  3O8H A;  1T33 A;  3MVP A;  3QPS A;  5FKO A;  1RKW A;  2ZCN A;  5J1R A;  3TP3 A;  2G7G A;  5GPA A;  4G12 A;  4M3F A;  4L62 A;  3FRQ A;  2QCO A;  1A6I A;  2GFN A;  5J1U A;  3C2B A;  3G1O A;  2NP3 A;  1RKT A;  4MXM A;  2O7O A;  3HGG A;  3AQS A;  3IH3 A;  3SDG A;  4W1U A;  4D5F A;  4W97 A;  3Q0V A;  2XDN A;  5F0H A;  2G3B A;  3WHB A;  1Z77 A;  4MO7 A;  4CGR A;  5FKL A;  3ZQF A;  3VVX A;  2PZ9 A;  2NP5 A;  3B81 A;  2PBX A;  2IBD A;  3CDL A;  5D1R A;  3KKD A;  2ID6 A;  4ME9 A;  1Z0X A;  4YZE A;  5HBU A;  3C07 A;  4JNN A;  3FK6 A;  3COL A;  2FJ1 A;  5D19 A;  3ON4 A;  4PXI A;  5F04 A;  3VW1 A;  2FBQ A;  3QQA A;  2JK3 A;  1UI6 A;  4JKZ A;  5FKK A;  3BR5 A;  2IAI A;  2OI8 A;  3ZQH A;  3QKX A;  2WGB A;  3HE0 A;  2UXI A;  5F0C A;  5K7Z A;  3BCG A;  2EH3 A;  3LWJ A;  3DPJ A;  5IPA A;  5FKM A;  3JSJ A;  3V78 A;  3P9T A;  5FHP A;  4X1E A;  2HXI A;  2ZCX A;  2HYT A;  1BJZ A;  3ZQL A;  5IOY A;  2NX4 A;  2G7L A;  2UXP A;  3NRG A; 
#chains in the Genus database with same CATH topology
 3BTL A;  3NI7 A;  5EZH A;  2UXO A;  3LOC A;  4I76 A;  3BR6 A;  2OER A;  5EZG A;  4NN1 A;  3LSP A;  1JUS A;  3BTJ A;  3T6N A;  3QBM A;  1QPI A;  4ABZ A;  3NPI A;  4B3A A;  2ZOY A;  2OF7 A;  2Y2Z A;  2YVH A;  2QIB A;  5C4Y A;  3BT9 A;  5CXG A;  2YVE A;  3TP0 A;  5J1Y A;  3RD3 A;  2WV1 A;  3LHQ A;  5D18 A;  3VP5 A;  5F0F A;  2HQ5 A;  4AF5 A;  2HYJ A;  3E7Q A;  3IH2 A;  2GBY A;  1JUM A;  4M3G A;  3VVY A;  4GCL A;  3RH2 A;  3CRJ A;  4B1R A;  2IEK A;  5GP9 A;  4JYK A;  4MK6 A;  2X9D A;  3F1B A;  3B6C A;  3SWH A;  2Y31 A;  3HTJ A;  2TRT A;  3CWR A;  3SFI A;  3V6G A;  3S5R A;  3LSJ A;  2HXO A;  3FK7 A;  5J3L A;  5K7F A;  1JT6 A;  4AC6 A;  5K7H A;  4D5C A;  2R7S A;  1QVU A;  3HTI A;  3BQY A;  3BRU A;  3KNW A;  2B3W A;  1JTY A;  3CCY A;  3BTC A;  2QWT A;  5K58 A;  5CQG A;  2QOP A;  4M3D A;  2GEN A;  2RAE A;  4GFK A;  2FD5 A;  3LJL A;  3PPB A;  1JUP A;  3Q0W A;  3HTA A;  2R7X A;  3PM1 A;  3Q0U A;  4AUX A;  3IH4 A;  3G56 A;  4GFL A;  3VIB A;  4KWA A;  2R7R A;  2ID3 A;  1U9N A;  4UDS A;  2OPT A;  2W53 A;  4D7N A;  3FIW A;  4M3B A;  1QVT A;  5F1J A;  3BR1 A;  2ZOZ A;  3DU6 A;  5AQC A;  3ANG A;  3VTI A;  2WUI A;  3QPL A;  3BR2 A;  3DCF A;  2FX0 A;  2DG7 A;  4GCK A;  3DEW A;  2VKV A;  3K8P C;  3F0C A;  2XPW A;  3B6A A;  4NEL A;  2DTZ A;  2XPU A;  5H9T A;  5EYR A;  1ZK8 A;  1RPW A;  3MNL A;  3IUV A;  2R7O A;  3O60 A;  2QTQ A;  2ZB9 A;  3HTH A;  2REK A;  2G0E A;  5CXI A;  2RAS A;  3LSR A;  2XGE A;  2VPR A;  3ANP A;  3G1M A;  2F07 A;  4C2M A;  3EUP A;  4DVY P;  3GZI A;  5HSZ A;  3KKC A;  2G7S A;  2RHA A;  3VW0 A;  2FJI 1;  5GPC A;  3VUQ A;  3BJB A;  4D7M A;  2DG8 A;  2IU5 A;  3VOX A;  5F27 A;  4DW6 A;  2X6O A;  2HKU A;  2NS8 A;  2VKE A;  3BTI A;  1UI5 A;  3HGY A;  4I6Z A;  2ZCM A;  5F08 A;  1SGM A;  2Y30 A;  4HKU A;  3CJD A;  3AQT A;  3VOK A;  4ICH A;  2D6Y A;  3G7R A;  1U9O A;  2R7W A;  5IP6 A;  2ZY9 A;  5EFY A;  2GUH A;  4WIB A;  4OD5 A;  4JL3 A;  4V2F A;  3GEU A;  3VVZ A;  2QKO A;  3G1L A;  3FHN A;  3BR3 A;  5FKN A;  2XGD A;  1JTX A;  3ON2 A;  2O7T A;  2XRL A;  2UXH A;  3BR0 A;  5FMP A;  3NNR A;  1VI0 A;  4GCT A;  3HIM A;  3BHQ A;  3BQZ A;  2XPV A;  4V2G A;  5CW8 A;  2FQ4 A;  2Q24 A;  4IRV A;  4XK4 A;  1ZKG A;  3VPR A;  3WHC A;  1JT0 A;  2TCT A;  2UXU A;  2XGC A;  4ACI A;  3ZQG A;  3O8G A;  3EGQ A;  3PAS A;  5DAJ A;  3Q3S A;  3NXC A;  5IOZ A;  2R7V A;  4M3E A;  4U9L A;  4U9N A;  5FGL A;  3VW2 A;  2NS7 A;  4AC0 A;  2JJ7 A;  2I10 A;  3ZQI A;  3BNI A;  2XB5 A;  1T56 A;  1ORK A;  3KZ9 A;  2V57 A;  5HAW A;  3O8H A;  1T33 A;  3MVP A;  3QPS A;  5FKO A;  1RKW A;  2ZCN A;  5J1R A;  3TP3 A;  2G7G A;  5GPA A;  4G12 A;  4M3F A;  4L62 A;  3FRQ A;  2QCO A;  1A6I A;  2GFN A;  5J1U A;  3C2B A;  3G1O A;  2NP3 A;  4OD4 A;  1RKT A;  4MXM A;  2O7O A;  3HGG A;  3AQS A;  3IH3 A;  3SDG A;  4W1U A;  2PFV A;  4D5F A;  4W97 A;  3Q0V A;  2XDN A;  5F0H A;  2G3B A;  3WHB A;  1Z77 A;  4MO7 A;  4CGR A;  3NS4 A;  5FKL A;  3ZQF A;  3VVX A;  2PZ9 A;  2A2F X;  2NP5 A;  3B81 A;  2PBX A;  2IBD A;  3CDL A;  5D1R A;  3KKD A;  2ID6 A;  4ME9 A;  1Z0X A;  4YZE A;  5HBU A;  3C07 A;  4JNN A;  3FK6 A;  3COL A;  2FJ1 A;  5D19 A;  3ON4 A;  4PXI A;  5F04 A;  2B1E A;  3VW1 A;  2FBQ A;  3QQA A;  3DU5 A;  3KYL A;  2JK3 A;  1UI6 A;  4JKZ A;  5FKK A;  3BR5 A;  2IAI A;  2OI8 A;  3ZQH A;  3QKX A;  2WGB A;  3HE0 A;  2UXI A;  5F0C A;  2R7Q A;  5K7Z A;  3BCG A;  2EH3 A;  3LWJ A;  2R7T A;  3DPJ A;  5IPA A;  5FKM A;  3JSJ A;  2YVX A;  3V78 A;  3P9T A;  5FHP A;  4X1E A;  2HXI A;  2ZCX A;  2HYT A;  1BJZ A;  3ZQL A;  2R7U A;  5IOY A;  2NX4 A;  2G7L A;  2UXP A;  3NRG A; 
#chains in the Genus database with same CATH homology
 3BTL A;  3NI7 A;  5EZH A;  2UXO A;  3LOC A;  4I76 A;  3BR6 A;  2OER A;  5EZG A;  4NN1 A;  3LSP A;  1JUS A;  3BTJ A;  3T6N A;  3QBM A;  1QPI A;  4ABZ A;  3NPI A;  4B3A A;  2ZOY A;  2OF7 A;  2Y2Z A;  2YVH A;  2QIB A;  5C4Y A;  3BT9 A;  5CXG A;  2YVE A;  3TP0 A;  5J1Y A;  3RD3 A;  2WV1 A;  3LHQ A;  5D18 A;  3VP5 A;  5F0F A;  2HQ5 A;  4AF5 A;  2HYJ A;  3E7Q A;  3IH2 A;  2GBY A;  1JUM A;  4M3G A;  3VVY A;  4GCL A;  3RH2 A;  3CRJ A;  4B1R A;  2IEK A;  5GP9 A;  4JYK A;  4MK6 A;  2X9D A;  3F1B A;  3B6C A;  2Y31 A;  3HTJ A;  2TRT A;  3CWR A;  3SFI A;  3V6G A;  3S5R A;  3LSJ A;  2HXO A;  3FK7 A;  5J3L A;  5K7F A;  1JT6 A;  4AC6 A;  5K7H A;  4D5C A;  1QVU A;  3HTI A;  3BQY A;  3BRU A;  3KNW A;  1JTY A;  3CCY A;  3BTC A;  2QWT A;  5K58 A;  2QOP A;  4M3D A;  2GEN A;  2RAE A;  4GFK A;  2FD5 A;  3LJL A;  3PPB A;  1JUP A;  3Q0W A;  3HTA A;  3PM1 A;  3Q0U A;  4AUX A;  3IH4 A;  3G56 A;  4GFL A;  3VIB A;  4KWA A;  2ID3 A;  1U9N A;  4UDS A;  2OPT A;  2W53 A;  4D7N A;  3FIW A;  4M3B A;  1QVT A;  5F1J A;  3BR1 A;  2ZOZ A;  5AQC A;  3ANG A;  2WUI A;  3QPL A;  3BR2 A;  3DCF A;  2FX0 A;  2DG7 A;  4GCK A;  3DEW A;  2VKV A;  3F0C A;  2XPW A;  3B6A A;  4NEL A;  2DTZ A;  2XPU A;  5H9T A;  5EYR A;  1ZK8 A;  1RPW A;  3MNL A;  3IUV A;  3O60 A;  2QTQ A;  2ZB9 A;  3HTH A;  2REK A;  2G0E A;  5CXI A;  2RAS A;  3LSR A;  2XGE A;  2VPR A;  3ANP A;  3G1M A;  2F07 A;  3EUP A;  3GZI A;  5HSZ A;  3KKC A;  2G7S A;  2RHA A;  3VW0 A;  5GPC A;  3VUQ A;  3BJB A;  4D7M A;  2DG8 A;  2IU5 A;  3VOX A;  5F27 A;  4DW6 A;  2X6O A;  2HKU A;  2NS8 A;  2VKE A;  3BTI A;  1UI5 A;  3HGY A;  4I6Z A;  2ZCM A;  5F08 A;  1SGM A;  2Y30 A;  4HKU A;  3CJD A;  3AQT A;  3VOK A;  4ICH A;  2D6Y A;  3G7R A;  1U9O A;  5IP6 A;  5EFY A;  2GUH A;  4JL3 A;  4V2F A;  3GEU A;  3VVZ A;  2QKO A;  3G1L A;  3BR3 A;  5FKN A;  2XGD A;  1JTX A;  3ON2 A;  2O7T A;  2XRL A;  2UXH A;  3BR0 A;  5FMP A;  3NNR A;  1VI0 A;  4GCT A;  3HIM A;  3BHQ A;  3BQZ A;  2XPV A;  4V2G A;  5CW8 A;  2FQ4 A;  2Q24 A;  4XK4 A;  1ZKG A;  3VPR A;  3WHC A;  1JT0 A;  2TCT A;  2UXU A;  2XGC A;  4ACI A;  3ZQG A;  3O8G A;  3EGQ A;  3PAS A;  5DAJ A;  3Q3S A;  3NXC A;  5IOZ A;  4M3E A;  5FGL A;  3VW2 A;  2NS7 A;  4AC0 A;  2JJ7 A;  2I10 A;  3ZQI A;  3BNI A;  2XB5 A;  1T56 A;  1ORK A;  3KZ9 A;  2V57 A;  5HAW A;  3O8H A;  1T33 A;  3MVP A;  3QPS A;  5FKO A;  1RKW A;  2ZCN A;  5J1R A;  3TP3 A;  2G7G A;  5GPA A;  4G12 A;  4M3F A;  4L62 A;  3FRQ A;  2QCO A;  1A6I A;  2GFN A;  5J1U A;  3C2B A;  3G1O A;  2NP3 A;  1RKT A;  4MXM A;  2O7O A;  3HGG A;  3AQS A;  3IH3 A;  3SDG A;  4W1U A;  4D5F A;  4W97 A;  3Q0V A;  2XDN A;  5F0H A;  2G3B A;  3WHB A;  1Z77 A;  4MO7 A;  4CGR A;  5FKL A;  3ZQF A;  3VVX A;  2PZ9 A;  2NP5 A;  3B81 A;  2PBX A;  2IBD A;  3CDL A;  5D1R A;  3KKD A;  2ID6 A;  4ME9 A;  1Z0X A;  4YZE A;  5HBU A;  3C07 A;  4JNN A;  3FK6 A;  3COL A;  2FJ1 A;  5D19 A;  3ON4 A;  4PXI A;  5F04 A;  3VW1 A;  2FBQ A;  3QQA A;  2JK3 A;  1UI6 A;  4JKZ A;  5FKK A;  3BR5 A;  2IAI A;  2OI8 A;  3ZQH A;  3QKX A;  2WGB A;  3HE0 A;  2UXI A;  5F0C A;  5K7Z A;  3BCG A;  2EH3 A;  3LWJ A;  3DPJ A;  5IPA A;  5FKM A;  3JSJ A;  3V78 A;  3P9T A;  5FHP A;  4X1E A;  2HXI A;  2ZCX A;  2HYT A;  1BJZ A;  3ZQL A;  5IOY A;  2NX4 A;  2G7L A;  2UXP A;  3NRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...