3IH4A

Tm1030 crystallized at 277k
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 68
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih4A02
4A3GJ 2ZOZA 5IYDJ 1ETXA 1WPKA 1ZGWA 1NTCA 3S16J 2NVQJ 1HDPA 1P7IA 4DZPA 3HOUJ 2CQXA 4D7NA 4FTHA 1B72B 1HLVA 2E2HJ 3PPBA 1RESA 4PXIA 2PMZN 4I6ZA 3D1NI 5D1RA 3DEWA 1NK3P 4QSHA 4JX4A 5HODA 2YUSA 2ID6A 1GV2A 3S1QJ 2DA1A 5EFYA 2MSYA 3A01B 2JA8J 2WV1A 1UHSA 3GTPJ 1GDTA 1FTZA 3NI7A 3PASA 2JA7J 2QWTA 4DYRA 3MVPA 3VW1A 2CJJA 2B63J 3C07A 3S5RA 3G7RA 3GTJJ 2QTQA 1I3QJ 4X6AJ 4MFEA 1WGXA 2D5VA 1IDYA 2X9DA 2F07A 1OCPA 4BXXJ 5F0CA 4DZJA 1K83J 1XC5A 2ZCXA 2G7LA 3VW0A 4GCKA 3HEFA 2REKA 4G12A 9ANTA 2R5YA 2ZB9A 4JNNA 1ETYA 1BW5A 1MBKA 2IEKA 4IHYA 4MFDA 2G7GA 5J3LA 4XRMA 4RBOA 2ECBA 5FKMA 3GTKJ 5CW8A 4B1RA 1JTYA 2L9RA 3S1MJ 3BJBA 2E2IJ 2HXOA 2FQ4A 3NARA 4GCLA 4CGRA 4FISA 1JT0A 5FGLA 1RKTA 2NVYJ 2FBQA 3Q0UA 4LOCA 4AYBN 2DA2A 4IHXA 1Y1VJ 2UXUA 3G1LA 2AHQA 4FE4A 4BKXA 2JWTA 2L7ZA 4DYQA 1FTTA 4NN1A 1E3OC 3VOXA 1UMQA 1AU7A 5CXGA 2EQRA 2UXHA 2YVHA 2K9SA 3NRGA 3B81A 2LP0A 3JRFA 1A6IA 2DG7A 5EZHA 3F1BA 3HTIA 5GPCA 3VVZA 1MH4A 2K9QA 3F0CA 3BG9A 4L5EA 2M0CA 1MBHA 3Q0VA 1WCMJ 2DA7A 3GTGJ 4A3CJ 3VOKA 1OFCX 4JX6A 2AO9A 1FJLA 5JLXA 3CQZJ 2OERA 1JKPC 2EH3A 3ANGA 2LLKA 2QF7A 3Q3SA 5K58A 4Y7NJ 2WAQN 2ELKA 4C2MJ 5F0FA 1LE8A 3TW6A 1I6HJ 4JKZA 4NELA 1SANA 2MGQA 2WGBA 3WHBA 5F27A 5GP9A 2I10A 4HNVA 1G2HA 1HDDC 5F1JA 1WH7A 2QOPA 1TWAJ 2ID3A 3BRUA 1D5YA 2XSDC 3BR2A 3E7LA 1Z77A 2FX0A 3LSPA 2UXIA 2NS8A 2GFNA 2IU5A 2N8GA 3PO3J 3FK6A 5F08A 3BR5A 2KDZA 5FKLA 2G0EA 1I50J 3GTLJ 2FD5A 1JT6A 2W48A 4W1UA 4FE7A 4IEJA 5FKKA 3LJLA 1AKHA 3MNLA 3SJMA 3B6AA 3S1RJ 5M5XJ 3O60A 1SFOJ 2CU7A 2OF7A 3BTCA 2DTZA 5EG0A 3AQSA 5K7FA 1IJWC 4D5CA 1APLC 2XDNA 4B4CA 3VUQA 2XB0X 3HTAA 4A3KJ 3IV5A 4CYCB 1MBEA 1WH5A 3M3YJ 5H9TA 2CUEA 2MW8A 4ACIA 1O4XA 1MSEC 2O7TA 2KT0A 3A01A 1ITYA 1FIPA 1YRNB 1FIAA 1VFCA 2R93J 4C3JJ 3FISA 5EG0B 1VI0A 4XICA 5K7HA 4GFKA 4JP0A 1XG1A 2H1KA 1UI6A 4C3IJ 1BA5A 1BJZA 3M4OJ 2ECCA 2NP3A 1NK2P 1B8IA 4AC6A 1ZK8A 1AHDP 3S15J 2E2JJ 3COLA 1ZTRA 1H8AC 1AKHB 2EBIA 2YVEA 4MO7A 4A3EJ 3HBLA 2HOSA 4C3HJ 1TWFJ 5E3MA 4IHWA 2OPTA 2LKXA 2M8GX 5M3FJ 3HOYJ 3ZQHA 4M3FA 1IDZA 5C4YA 2Y9YA 1HOMA 3LSGA 5J1YA 4UUSA 1ETQA 2JN6A 2COBA 1DU0A 1U8BA 3HKZN 3RZDJ 5K7ZA 2DMPA 5FHPA 3G1OA 3OSFA 2DA5A 2LY9A 1HF0A 3HOWJ 2GENA 3BNIA 2IBDA 3BR0A 1CQTA 3TW7A 2L0KA 3RKQA 2Y30A 3HOXJ 1U9OA 3H0GJ 2W53A 3I4MJ 1MBFA 4AUXA 2VKVA 4D7MA 2R5YB 2ME6A 1ZR2A 3GEUA 5IPAA 2WUIA 1IUFA 3GTMJ 2O9LA 2JJ7A 3ZQLA 1Y1WJ 2HOTA 2Q24A 5CXIA 3T6NA 2Y0SN 4A69C 3BTJA 2RHAA 1GT0C 2XPVA 2X6OA 3QQAA 2QKOA 5FLVA 2DMNA 4HKUA 4IHVA 2NVTJ 1JGGA 1IG7A 3OOUA 1MBJA 3CWRA 3KNWA 3B6CA 1P7JA 5FMPA 2XRLA 5FLMJ 3TEDA 2JA5J 3K7AJ 2Y2ZA 4JYKA 3NPIA 4RDUA 1JUMA 2DG8A 3CCYA 4A93J 2FJ1A 1HCRA 1YRNA 1H89C 4GCTA 3A03A 1JJ6C 1QVUA 3JRGA 2DMTA 4B3AA 1ETVA 3S2DJ 1JKRC 1Z0XA 4BY1J 1IV6A 3S14J 4J19A 3MKLA 2CQQA 3BTLA 3L1PA 3VIBA 2EZLA 3ZQCA 2WB1N 1IGNA 5FKOA 2G3BA 5E3NA 4XRSA 3ANPA 3K2AA 2XGDA 1ZQ3P 1ENHA 4YZEA 4M6VA 2HYTA 4XIDA 3LOCA 2R0QC 1K61A 2RASA 4M3DA 5IP6A 2K9NA 3JRAA 2XGCA 2YS9A 3RH2A 1A5JA 1RETA 3HE0A 1WI3A 3KZ9A 1X2NA 1JKOC 4UDSA 4AF5A 3O8HA 5IOYA 4W97A 2VI6A 3IH2A 1VF9A 2NOGA 3JR9A 5EDNA 3KKCA 3RD3A 1B8IB 2LD5A 3JSJA 3GZIA 1ORKA 2QCOA 4KWAA 4I76A 2GBYA 2RAEA 3HOVJ 2L7FP 2NS7A 3Q0WA 1H88C 1QVTA 3IUVA 1B72A 4JX5A 3VVYA 3IH3A 4GFLA 1UI5A 4A3JJ 1QPIA 3IH4A 5J1RA 3HTHA 3HTJA 3S17J 1QRYA 5IP9J 2VUMJ 2M2EA 1OJLA 1W0TA 4XRSG 2IAIA 3BHQA 3LNQA 1LFUP 3SDGA 3FIWA 5HBUA 2UXPA 4L62A 4BY7J 2LK2A 5E3OA 5C4XJ 3RQIA 2E19A 2GUHA 2L7MP 1LE8B 2M34A 2ZCMA 3A02A 1F36A 5EEAA 3LSJA 3O8GA 1X58A 1RR7A 1BL0A 4MXMA 2LR8A 2PBXA 1GVDA 5M3MJ 5FJ8J 2ZOYA 3G56A 3TP3A 1EF4A 3BTIA 3GTOJ 4ABZA 2HQ5A 2QIBA 1LFBA 1FEXA 2HOAA 3TP0A 3PO2J 4X1EA 3BR6A 2R5ZB 3VW2A 5M5WJ 3KKDA 2HI3A 1T33A 1VNDA 3HOZJ 2XPWA 3BG5A 3GBGA 2E1OA 1U9NA 4A3LJ 2CRGA 4QTRA 3VPRA 2ZCNA 3BG3A 3I4NJ 1OCTC 4JL3A 5F0HA 3S2HJ 5J1UA 4FCYA 2H8RA 2UXOA 4S0HB 5C3EJ 4CYCA 2G7SA 5D18A 2HDDA 4Y52J 2MG4A 3HIMA 4A3MJ 1W0UA 3ZQIA 4A3FJ 2Y9ZA 3QPLA 3S1NJ 1DU6A 5F04A 3NNRA 5HSZA 3V6GA 2TRTA 3C2BA 2M9HA 3BR1A 5DAJA 4EEFG 2GM4A 3UKGA 2OI8A 2XPUA 2DA6A 1ETKA 5IYBJ 1GV5A 4M3EA 4DYCA 1ZR4A 1SGMA 1TWGJ 2LTPA 3CMYA 2P81A 2VKEA 1GUUA 3HGYA 4A3IJ 2DN0A 2O8KA 3ON2A 2YU9J 1S7EA 3EGQA 1PUFB 3CRJA 4MIMA 4XK4A 4BBSJ 1POGA 2NVXJ 1IC8A 1ETOA 3G1MA 4QIWN 5JLWA 1XS9A 3ON4A 1ZKGA 4NDLA 2XGEA 1TC3C 2VPRA 2DMQA 4M3GA 3MN2A 5M5YJ 2EZIA 5IYCJ 1BW6A 2DA3A 1JUPA 3E7QA 1Q1VA 2HYJA 5GPAA 5HAWA 3V78A 5D19A 5DS9A 1TWCJ 1MBGA 3W6VA 3QKXA 3SFIA 4V2FA 5EF6A 3BCGA 3CJDA 3QBMA 3ZOBA 3PM1A 3RZOJ 1UG2A 2NP5A 2O7OA 1IRZA 3BR3A 2V57A 5IOZA 2DMUA 3HGGA 3JRHA 3HDDA 5E3LA 1U78A 4UUSB 1JKQC 3FK7A 3WHCA 1RKWA 4V2GA 5EGOB 2PZ9A 3BT9A 5C4JJ 3OIOA 3ZQGA 5BNGA 1JJ8C 3H3VK 4A3BJ 2D6YA 2Y31A 5DTDA 3LWJA 3VP5A 3JRDA 2LFBA 2K40A 3CDLA 2DA4A 5C44J 3P9TA 2CUFA 3JRCA 2R5ZA 1MNMC 3HB9A 3EUPA 2HKUA 2EZHA 4DW6A 3JRIA 4MK6A 5EGOA 5AQCA 2LVSA 2XB5A 1JTXA 4MLOA 2GLOA 1JUSA 2ME0A 4M3BA 3LSRA 2R7ZJ 2R92J 4ME9A 3BQZA 4ICHA 2EZKA 4UUTA 4D5FA 3JRBA 3DCFA 2X48A 4AC0A 1PUFA 2JK3A 4BBRJ 3JREA 3DPJA 1R9TJ 3VVXA 5EZGA 5FKNA 4A3DJ 1T56A 3QPSA 4GFBA 3NXCA 3BQYA 5EYRA 1RPWA 3LHQA 3ZQFA 2JA6J 1X2MA 3OSGA 1MH3A 2HXIA 3HM5A 1F43A 3GTQJ 3FKIJ 5IP7J 2DJNA 2NX4A 3AQTA 1TWHJ 2JMWA 2TCTA 1ETWA 3FRQA 3NAUA 1MSFC
chains in the Genus database with same CATH superfamily
4A3GJ 5E18F 5IYDJ 4YIIA 4HDVA 3CO7C 3I9V2 3NQOA 3S16J 1HDPA 1P7IA 4ZH4F 3WE2A 4D7NA 4TV7A 2IA1A 2KDOA 3GF2A 1B72B 1HLVA 1XGMA 2E2HJ 1TBXA 2L9SA 4I6ZA 2FXAA 3U1KA 5D1RA 1ZRFA 1KQ9A 3FXKA 3COAC 4WF2A 4JX4A 1UG0A 1FYKA 2YUSA 4KNYA 3IUOA 2COMA 4B48A 3JCUC 2MSYA 2L7KA 1UHSA 3NI7A 1AA7A 4GDFA 2CJJA 1NHAA 5HDKA 1HKQA 3CUQA 2QTQA 4EJOA 1VTNC 1YS7A 3RKYA 1R5ID 3CJTB 1XTAA 3WU1B 2PFVA 2LSOA 1ZHFA 2BVLA 4MTDA 1IDYA 2X9DA 5LLQA 1OCPA 1RUNA 5F0CA 1MW7A 2F07A 4U7BA 1K83J 5D5XB 5TGTA 3F3XA 1MJ9A 2HVRA 1T0FA 4HX8A 4IL6C 4D0PA 2Q2EB 9ANTA 4BQAA 4JNNA 4IPAA 1ETYA 3KIOA 1P4WA 1XMKA 3ASOH 1VQ8I 3RYRA 5FKMA 3CCUI 1LKXA 3GYHX 3DTIA 3ESWB 1JTYA 4LMYA 4M73A 3GEZA 3NARA 1QA6A 1KYZA 5D6FA 4BJ5C 2QA4I 3PNTA 2QQBA 3OIQA 3HXLA 5LGNA 5FGLA 1RKTA 2NVYJ 3QP5A 3K2ZA 1SFUA 3T5XA 2X51A 4ZDPA 2DA2A 4IHXA 1B59A 3ECHA 1BJAA 2GAUA 1AWCA 5AIQA 1Y0NA 4G9YA 2G9WA 4DYQA 4L0YB 2QBYB 2EFQA 1I27A 4N4NB 1FOYA 1E3OC 4ZYAA 1D5VA 1UMQA 1AU7A 3KEOA 2HTSA 2YVHA 3HRTA 3KP3A 1J59A 1G3YA 3EYIA 4OIQF 1FT9A 4C2UA 2A6EF 3LFUA 4HLYA 1O7LA 2HPIA 2DG7A 3L2UA 1O3RA 1ERDA 3VVZA 4CUGA 5JR3A 3PNYA 3AAFA 2K9QA 3WG7H 3BG9A 2VC0A 2WB1A 4BHPA 3GTGJ 3SFZA 2WY8Q 2M4KA 5B3SH 3CQZJ 1SD4A 2LLKA 2XAGA 4IZZA 1J5YA 3T0YA 2QM3A 1WZ2A 4Y7NJ 2BW3B 4I02A 2WAQN 5F0FA 1LE8A 1G3SA 2Y0SA 5F27A 4EM0B 4EJUA 2KP6A 3LAPA 4CCJA 2DBBA 1X1BA 5CKTA 2QOPA 1UZCA 1X1CA 3IKTA 4XLNF 3KLOA 3HRMA 3BR2A 3CUOA 3E7LA 1Z77A 3DBLB 1DGWY 3LSPA 2JT1A 2MBFA 2YVXA 3PFYA 2L9VA 3KYDB 4RLQA 2IU5A 1R1TA 1IN7A 3BR5A 4HYEA 2KDZA 3I58A 3GTLJ 4EV0A 2FD5A 2W48A 4KJZA 5DD8A 5CVRA 5ILSA 3TQNA 1N77A 3MNLA 2P6SA 1ZREA 2NYXA 1A31A 1SFOJ 2CU7A 3AQSA 5LRRA 3V4GA 2CMPA 3HTAA 4A3KJ 1MMSA 1IO2A 4CYCB 1OCCH 1WH5A 2X6YA 1UAAA 4E7HA 2CUEA 3KZYA 2BOLA 1O4XA 1MSEC 2P4WA 2IRFG 2O7TA 4B44A 1FIPA 2M7BA 3TKYA 4O5VA 1YRNB 1VFCA 2PMHA 2YPRA 1X3UA 2BBYA 3S8PA 3HKZA 1XG1A 2V7FA 5ILVA 1UI6A 2O8XA 2NS0A 2LMDA 2H94A 4ON0A 5L3FA 5K1YA 3UR3C 1WRJA 2KIMA 5HNHA 4WWCA 3G3ZA 3GFMA 4JOMA 4ANJA 4U0YA 4KMFA 3VWBA 1Z67A 3COLA 2OC6A 1AKHB 3BJ6A 3A0BC 4ZZDA 2RQQA 2Y75A 4G6TB 4HLXA 4C3HJ 1XN7A 1H9GA 2LRDA 3QP6A 4A0XA 2UZKA 4IHWA 2OPTA 3LMMA 4UXNA 4NQWB 2VE9A 4IO9F 4XOPA 2PMZA 3OV8A 2Y9YA 2F5VA 2EFWA 1HOMA 1T95A 3KYLA 2JN6A 1DU0A 3UNGC 1U8BA 4V19K 2VT2A 2DMPA 5FHPA 3R0AA 2A3SA 3HOWJ 3BNIA 2IBDA 1O3SA 1S7OA 2BXZA 3K4BA 4F3QA 3FHNA 4DJAA 2BY3A 2Q2EA 3H0GJ 3GXOA 4AUXA 1Y8QB 2VKVA 2VOOA 3GLLA 2HZDA 2O9LA 2JJ7A 3OIPA 3ZQLA 1Y1WJ 4MEXF 2HOTA 3M7GA 1QZEA 1GHCA 4A69C 3BTJA 1D1CA 3OR1C 2JVHA 3QQAA 3OYJA 3VSKA 5FLVA 2JRMA 4LJZF 1BC7C 1SVOA 2JSPA 3KP4A 3ZCOA 3V7RA 4XKWA 2EV0A 5D5WB 2XRLA 1VQ4I 2AXLA 3S2WA 5J40A 3OS2A 1UCRA 4RDUA 3CCYA 4MQVA 2EIKH 1HCRA 1YRNA 2QBYA 2R7VA 1FNNA 3JRGA 4G7OF 1TT5B 2ACJA 1R4NB 2E60A 2Z2SB 2KJCA 4BY1J 3CF2A 3VIBA 4XOTA 3K8PC 3KP6A 2DFIA 4KITB 2XGDA 2O0YA 4XIDA 1HC8A 1I39A 2F48A 2MFZA 4DIQA 4EJWA 2VKDA 1K61A 1VQKI 4M3DA 3JRAA 2WAFA 3RH2A 4HQMA 4LB5A 2VT3A 4HF2A 2D2WA 2D1VA 2IGMA 1JKOC 4L18B 4G7HF 2F4MB 1FBQA 3DBRB 5IOYA 1F9NA 4PJMA 5GAGJ 3LA2A 2EIMH 3QPHA 3CDHA 4RGSA 3JR9A 2VKHA 5GTHC 4HF0A 3A1YA 5LEKA 1VQ7I 1ORKA 1SFXA 4XKVA 2Q1ZB 2HFHA 2QCOA 2GBYA 1H88C 1QVTA 1K6YA 4F55A 3IUVA 1D3YA 1YX5A 3VVYA 1IXRC 1E2XA 3LFKA 3DBHB 2DJIA 5J1RA 1V4RA 3S17J 2IW5A 2M30A 2VUMJ 4OWRB 2E5ZA 2IAIA 3CJNA 1J7KA 4BDYA 2CUJA 3LNQA 2P5LC 3FIWA 4ESBA 3QRFF 5E3OA 5C4XJ 3RQIA 2E19A 2M34A 2ZCMA 2X1EA 4G94A 2M7AA 3R60A 2EILH 3K1PA 3K4JA 1GXQA 4XLHA 1MZBA 3CJQB 3CUQB 4ZC3A 3S93A 1LDJA 4EGZA 1RR7A 2ZJPF 2KKOA 1MMAA 4AVZA 2QWWA 3G56A 2V9VA 3HG9A 4AYBA 4HNTA 4WXHA 1T8IA 3BTIA 3I4PA 2K02A 3PNVA 2XIGA 4ZTFA 2QIBA 2HOAA 5FGMA 2RREA 2XKOA 4X1EA 5ERIA 4N4OB 2L5QA 3H3UA 3AL0C 4IQ4A 1BI3A 2QYOA 2XPWA 3GBGA 2OZUA 4IRGA 1IN8A 3FF5A 5L3BA 2CRGA 3VPRA 3L2CA 3ECOA 4ETSA 3BG3A 3PFIA 1G59A 4BNCA 1WVRA 1Y0UA 2VQLA 3S2HJ 4FCYA 3BLYA 1LJ9A 3QPTA 4I98B 3ERED 3ZMDA 2YX7A 5HLTA 3OY9A 3R61A 1IXCA 4AIHA 4A3MJ 3TOBA 3HZJA 4FASD 4R1HA 5F04A 3ULQB 3HPGA 2QVOA 3FDYA 2TRTA 5HSZA 3DV8A 2UXXA 2P7VB 2M9HA 5FROA 5DYMA 2DA6A 4P55A 2L4AA 5IYBJ 1GV5A 5E17F 4DYCA 1ZR4A 1F1ZA 1XMAA 4AD9A 2C6YA 2LTPA 3HGYA 4HV5A 4XQFA 3U21A 2WA0A 2DN0A 3ABMH 1S7EA 1PUFB 4LK0F 4EMSA 5J8FA 3WTYC 2JUGA 1R1VA 1KZHA 3T8RA 4AU7A 1IC8A 2NVXJ 4OMZA 3S3OA 3E0JB 1C0WA 3ON4A 1U5TC 3ABKH 1TC3C 2I5UA 4XLPF 4PK4A 4CZCA 5IYCJ 1BOAA 3CC2I 2WWYA 1JI8A 1OPCA 2VQCA 2DTRA 2FE3A 2HYJA 3R4KA 4D9JA 5GPAA 1E3PA 4BXUA 3H35A 4YELA 5ICCA 3J7AY 4AIDA 3W6VA 2O5RA 2BXYA 3SFIA 3WODF 4YEJA 4DOZA 3BCGA 3RZOJ 3VYTB 2ZC2A 1IRZA 3BR3A 2W4SA 5K5QA 3OWTA 2V57A 3JRHA 5KVRA 1U0JA 1O7FA 4UUSB 1JKQC 1S7AA 3FK7A 3FMSA 3DPTA 3WHCA 3OYDA 3ZXSA 4ZDOA 1YO5C 2PZ9A 3BT9A 5C4JJ 3KEQA 3ZQGA 2D6YA 2K5CA 2LFBA 2WY7Q 4EATA 1NG6A 5CVIA 5AONA 3DTEA 2K40A 3CDLA 2FF4A 2J5PA 2W25A 1LDKB 3BDDA 2DFEA 2RQPA 3DLAA 2R5ZA 3IP4B 3SWHA 4KFCA 2EZHA 5FD6A 3CCRI 4MK6A 2EFPA 5D8KB 2QKLB 1CGPA 3LSRA 1JGSA 2R7ZJ 2FBHA 3F22A 2B9SA 2R92J 1WI9A 2UXNA 3WGIA 4RB0A 3OL3A 3JSOA 2EZKA 4EM1A 2XHKA 2VB6A 5DV5A 1PUFA 4BBRJ 3VYSB 2FSWA 1JHFA 1R5GA 3BQYA 3KFWX 2RDPA 3DLLF 4A6EA 4DQ2A 3VOEA 2FU4A 1HKTA 3V7CA 1XB4A 2DDBA 1OKRA 1F43A 4NBQA 5CVVA 2R7RA 2ZY9A 2ZXJA 3NAUA 2PLYA 2KJBA 2DQRA 2ZOZA 1ETXA 4QLCU 2UV1A 5DCMB 1NTCA 3FXJA 3HOUJ 1Z3YA 4I2OA 3PPBA 1RESA 2W84A 1W5TA 2PMZN 4JBAA 2A2FX 2CV0A 5HVQC 1I1SA 2XF5A 5HODA 5E79C 3ZPLA 1GV2A 2KRCA 1QO0D 4FQGA 3S3NA 3NRVA 3REOA 4E7IA 2WV1A 3PASA 1GDTA 4BGDA 2IP2A 3CCEI 2V1NA 2KPMA 2V6CA 4PJ0C 5FLXZ 2JA7J 4EGYA 1W1WE 2R3SA 2DFHA 2H6CA 3DKYA 3MZ8A 3F21A 2O03A 1FSEA 4RM2A 4YRVA 2VQGA 1I3QJ 3EQLF 3VDXA 1YOVB 4FX4A 1WGXA 2LKPA 2LY2A 2WAEA 5CJ9A 2D5VA 1XGNA 4FETA 1WSUA 2X0LA 3CESA 1FX7A 3ZQQA 1BC8C 1D1BA 2DOFA 3KE2A 4GCKA 1BI0A 1W7PB 1LB2A 1T0FC 1D8KA 3E5UA 4I0AA 3WTUC 2REKA 1D0XA 2EWNA 2JZYA 2CS3A 1MBKA 2IEKA 5CVUA 4XRMA 5CW8A 1MD0A 5F1RA 1DDNA 2GXGA 2LF7A 2FOKA 1B1BA 1UJ8A 4FX0A 3TO7A 3L2WA 3DTKA 5E1ZB 3TDUC 1REPC 1R71A 2VJ5A 5LHGA 3VB2A 4CGRA 1XCBA 3EETA 3LSTA 3CP8A 3GFLA 4GYIA 4LOCA 1SC7A 1MMDA 4MTEA 3FM5A 3HSFA 2FMYA 2UXUA 2DI3A 5BPDA 5J47A 2FQ3A 2AHQA 2XAJA 4FE4A 4BKXA 3G6EI 2L7ZA 5LFAA 5DCMA 4ZTJA 1YITI 2D1HA 2LDUA 1HA8A 2D45A 2EQRA 1YX3A 2UXHA 3MAJA 2V26A 2LY1A 2F6CA 3NRGA 1HSJA 1A6IA 5EEHA 4BJ6C 2L2OA 2K9LA 2OQRA 4LITA 1MH4A 1MNDA 3F0CA 5DUKA 4P96A 4L5EA 1MBHA 1WCMJ 3I56I 3VOKA 2IVMA 3FXRA 1FJLA 4BACA 5JLXA 5A2QK 2E7XA 3QYEA 2Z9OA 2QQ9A 1R23A 1MIJA 4RAGA 4JKZA 4NELA 2Z1DA 2QQ8A 3BROA 2MGQA 4Q47A 3QODA 3E6DA 1YQAA 2FNAA 1SMTA 4BS9A 1IW7F 1R5HA 1HDDC 3E97A 2CFXA 5F1JA 5IY5H 1TWAJ 2BYVE 2ID3A 3EUKL 4OIPF 4KT6A 1D5YA 3ZN0A 1E0EA 2OA4A 5JHFA 1YFHA 2QSHX 1XD7A 1LNWA 4CH7A 2MLKA 2RC4A 3KCCA 2N8GA 3ZN1A 4OD4A 3FK6A 4UNOA 5F08A 2NNNA 3OYKA 4CCOA 2BZTA 5FKLA 4WK8F 4WIBA 2YSRA 4FE7A 3FHZA 2V9PA 1T2KA 1GVJA 5FKKA 5ICEA 3RTRA 1AKHA 3HTUA 3B6AA 2BY1A 2M1BA 4A6DA 4ENJA 1KQ0A 2EA4A 2OAZA 1L0OC 1IRFA 1S29A 5K7FA 1IJWC 2M3AA 4D5CA 4WX9A 1APLC 2XDNA 1RI7A 3N97A 2NOJB 3K4NA 2IS2A 3O6BB 2OCCH 1V54H 5GAEJ 4CHUA 4HDUA 5H9TA 4Y15A 5L3EA 3IAM2 2KT0A 2WTEA 2R7UA 2DYRH 4NC6A 3GFJA 5E8IA 3M1EA 2R93J 4KICA 3FISA 4YIFA 1VI0A 5EG0B 3WTSC 4IRVA 4BL0B 4JP0A 2DT7B 2DOAA 4C3IJ 1FOWA 2DODA 2ECCA 1SVMA 4Y13A 4RB2C 1EH6A 3S15J 2VJJA 2E2JJ 1ZTRA 3QOPA 4XBFA 3SZPA 1SMYF 1MDMB 1GLNA 1YJ9I 3FXMA 3WGHA 2HOSA 3AG2H 5D6EA 5E3MA 2M8GX 2QUFA 3HOYJ 1P92A 2M87A 2ISYA 3I55I 3MZHA 1IDZA 2F5FA 5C4YA 2R4GA 2W00A 4AVPA 4LLNA 5J1YA 4ZYDA 4UUSA 3I71A 2HKXA 2COBA 4IX7A 2FBKA 4GGGA 1W4MA 2OTLI 1VQ6I 3HKZN 5E1WA 2A69F 1R6RA 2ELJA 2DO7A 4IRHA 1G6NA 2YU3A 2CW7A 1ULYA 2VONA 1KU3A 4UVBA 2RKHA 4EVIA 1MBFA 1LEAA 2WADA 4F91B 2ME6A 4KIGA 1TP4A 3NWSA 1OCRH 5DCFA 3HOSA 1B9MA 5CXIA 3T6NA 3IHUA 1V55H 3NWTA 2AQFA 2RHAA 4Z2YA 1OR7A 4PUSA 4PJJA 1U6GA 4MHGA 4LLLA 4WCGA 1FC3A 4IHVA 3GZ6A 5LGTA 3DEEA 1MBJA 2QEXI 3CCJI 4XONA 1A36A 2ZSIB 3G71I 2IS1A 5FLMJ 1I3AA 2CWEA 3W2VA 1K6OA 1XGSA 2EB7A 3ELKA 2Y2ZA 3WGGA 3NPIA 1I6XA 2RV8A 1E3HA 4GCTA 2F5CA 4OAYA 1WJCA 1WQ2A 3IWZA 4GRIA 1JJ6C 1ETVA 2CQ7A 1HSTA 3CTAA 2MC4A 2OU2A 3S2DJ 3F8BA 3OYCA 1ZG1A 3S14J 3S3MA 2CQQA 3KP7A 3BTLA 1IGNA 2WB1N 2DDAA 3Q5FA 2R0QC 2RASA 3WG9A 2K9NA 2B0LA 4BE1A 5HNFA 1FPQA 5HS9A 2ZJRF 4LG3A 4UDSA 3O8HA 1LVKA 4W97A 4KA4A 2VI6A 1CF7B 3PL8A 4AF5A 1EV7A 2G7UA 2MD0A 2XVCA 4EM2A 3KKCA 1OYIA 3K70C 1OLTA 3VODA 3F6OA 2PEXA 2CO5A 2RAEA 2NS7A 3Q0WA 1N75A 3K70D 1FSHA 3BZ6A 3HSEA 4JX5A 4A0ZA 4DGWB 2DLLA 4ZJZA 2L54A 1I1GA 2FEZA 4YG2F 1HW5A 1W7PD 3IH4A 5LD2C 1H9TA 1P2FA 3HTHA 1EKEA 2M5WA 2K4JA 3OYBA 3QWLA 1W0TA 3B73A 2KLOA 1DQUA 2CW0F 3BJOA 3L2VA 4IQJA 4CCMA 2HOEA 5HLIA 1PJRA 2ELHA 4N9HA 4L62A 4BY7J 2LK2A 3CC7I 2R7WA 4AIKA 1U5TB 4HPQA 3BC8A 5ICGA 2LH9A 2KFDA 3J80Z 1LE8B 1BBYA 1X4PA 3CCSI 1F36A 1MJBA 1RIOH 2GQQA 2CQKA 3LSJA 1A35A 4KN7X 1D0YA 3O8GA 1X58A 4C2MA 1WFXA 3OYHA 4CCNA 2PBXA 5M3MJ 3LSKA 3CP2A 3ISPA 2DK5A 1J0RA 1K78B 4HZFA 5B1BH 3SZGA 1YJNI 3ZMUA 3GTOJ 3PSIA 5K5RA 3SXYA 5FB2A 3DF8A 2Z16A 3BPVA 4LFUA 1W36D 2DOEA 3TOAA 1IN5A 1B4AA 3A4CA 1Z7LA 4MQ9F 2W24A 4G6DA 2R5ZB 3VW2A 2A6TA 5M5WJ 2HI3A 3HOZJ 3IWFA 1U9NA 3BP8A 5FD5A 4QTRA 1VQPI 3F23A 2ZCNA 1TZLA 5EJCA 4P9UA 2GXAA 4ESFA 1OCTC 2FA5A 4JL3A 3EUAA 5DM7F 2DQLA 5J1UA 4RAYA 2PG4A 4S0HB 2GOMA 2CV2A 4N9IA 1S5LC 3TO6A 4ZZLA 5HLHA 2VODA 2Y9ZA 3V6GA 1FYLA 1WHUA 5HLGA 3IL2A 4G7ZF 5TISC 3BR1A 4IHTA 5DAJA 3UKGA 2MA3A 2XPUA 2OI8A 1TQIA 3GCMA 2CSOA 3LSHA 4L9NA 1QHHD 2A68F 1XX5A 3AG1H 1TWGJ 2P0WA 2VXDA 3FKJA 2P81A 2VKEA 2LREA 3QYFA 4A3IJ 3L2RA 3NEUA 1YS6A 5BQTA 2X1DA 3F8MA 4MIMA 4XK4A 4BBSJ 4UY8I 3H5RA 1ETOA 2ZFWA 1U5TA 3G1MA 2LBFA 1KONA 5JLWA 1R4MB 4O6JA 4CICA 4RM3A 3PJRA 2VE8A 4M3GA 4C9YA 1BW6A 3E7QA 1Q1VA 5D5VB 2XASA 4YFNF 1BOBA 3ZP5A 3V42A 3OL4A 1D8JA 5HDNA 2QSFX 5DS9A 4PZJA 2OZ6A 3LL7A 5DUIA 2LOOA 3QKXA 1PP8F 1ACIA 1Z6TA 4BQOA 3HUGA 5EF6A 1VQ9I 3QBMA 3PM1A 3BCBA 1UG2A 4KIFA 3VSLA 2O7OA 2JUCA 1LQ1A 5IOZA 4XM3A 3HGGA 3K4LA 1U78A 3U9GA 1SFEA 3OYMA 3MEXA 5HS8A 3K6GA 4II3A 1SFKA 3J80K 3OR2C 3H3VK 3OIOA 5BNGA 1JJ8C 2E35A 1XPXA 3M8FA 3RKXA 5DTDA 3DPUA 1DGRM 1U2WA 2A05A 2PQ8A 1YG2A 1PYVA 1WJ5A 2FNPA 5C44J 4R8HA 4LIVA 1KGSA 2XRNA 4U0VA 1MNMC 1ZRCA 2XAFA 1VZ0A 4D1QA 3MMYB 3TO9A 3HJEA 3D5SC 3L2QA 3JRIA 5EGOA 5AQCA 1QPMA 2XB5A 4IJAA 3KZIC 1JTXA 1ZLKA 1JUSA 1EA3A 2OBPA 2R7TA 2CUZA 4BH9A 4UB6C 2H6BA 5AIPA 4OU0A 4ICHA 1O3TA 2XUBA 3C2GA 3CCMI 1U3EM 3AKZA 2CW8A 2JK3A 3VVXA 5FKNA 4OAZA 3MKZA 1UB9A 2HU9A 1Q1HA 4E7SA 2ZMEA 2A61A 4L9TA 3ZQFA 2JA6J 1FZPB 5H2FC 2FOWA 4HRIA 1MH3A 2HXIA 3HM5A 3HOTA 3GTQJ 5IP7J 4B8XA 2WV0A 3W2WA 3MCZA 2P5VA 4DNCA 3SYTA 3D5LA 1MSFC 1YW9A 1WPKA 2HPMA 1ZGWA 1TTYA 2FBIA 2ICWG 2V1UA 3LSIA 3SEQA 3E6CC 4DZPA 4FTHA 2KHMA 2DT6A 3HUGB 1KU7A 4EJVA 4CCKA 3AG4H 4IF4A 3CD6I 2VL8A 3SEZA 3HC7A 3D1NI 4LG0B 1WJFA 4BUPA 1NK3P 4QSHA 4PJNA 4CXFA 4O3MA 3LA7A 1BR4A 5EFYA 3A01B 3H92A 1FTZA 1SAUA 1R00A 2QWTA 4DYRA 2Z99A 1HQCA 2MH9A 1YHQI 4EJTA 2B63J 2HQAA 2KQRA 2MLGA 3S5RA 3GTJJ 3HRUA 4X6AJ 4MFEA 4BEHA 4KDPA 3RYPA 3OYNA 3O3KA 3RJPA 4BXXJ 3E1SA 4NB5A 4LLGF 3F9KA 4BQNA 3D0SA 2ZCXA 3L09A 2VJIA 2G7LA 3VW0A 3JAMZ 3MFKA 1TL8A 4G12A 1KU9A 2R5YA 2ZB9A 1SVLA 3JAMK 2ISZA 1BW5A 4M9ZA 4WXCA 1OQYA 4IHYA 2PBIA 4RBOA 3GTKJ 1ZRDA 4E6KG 2Z3YA 3K1NA 2M45A 4G8XA 4RGRA 4H0EA 3BJBA 3E6MA 2EV5A 2FQ4A 3S32A 3SHFA 3VTIA 2DK8A 2EV6A 4QPOA 2NNYA 4FISA 4GCLA 1USTA 5B1AH 2FBQA 2XSJC 1FOKA 3Q0UA 2QKMB 3RPUD 1UELB 1Y1VJ 2WAQA 4WXDA 2DCEA 3G1LA 3X2QH 3MD2A 3PQKA 3FWEA 1L3LA 1ZGJA 1A6QA 2LKSA 4XN3A 2NVUB 1FTTA 1QNTA 2JA2A 1LPQA 2MABA 5KNLA 3AL0B 4IOCF 5CXGA 3C2HA 3K69A 4M9XA 2HVSA 2V4JC 1UHWA 2YR2A 6PAXA 3JRFA 5CQGA 3F1BA 5GPCA 2P7CB 4G6QA 3NS4A 3JSPA 1IV8A 2K3PA 2M0CA 3J7AO 5F6FA 3QYBA 1OFCX 4JX6A 2Y48A 4PCQA 3JTGA 1JKPC 2EH3A 2VBXA 1QQIA 3LQQA 2GA2A 1RRJA 5K58A 1S9HA 1D1AA 2ELKA 4C2MJ 2AS5F 3TW6A 1I6HJ 3MWMA 1LDDA 1SANA 1T08B 4MNUA 3WTTC 5D5UB 2ETHA 2KZGA 4AIJA 2STWA 1BI1A 1G2HA 1MJAA 4JQFA 1WKMA 4BAYA 3BRUA 5GAHJ 3FMQA 2LG4A 2XSDC 2MYSA 2VIXA 2FX0A 2OTJI 2UXIA 1K4TA 5EEGA 2NS8A 2PJPA 2H1LA 2XAHA 3V8LA 2GFNA 1LVAA 1QGPA 3PO3J 2E1CA 2KMUA 1K79A 3HRSA 2IA2A 1JT6A 4W1UA 2O61A 1B6AA 3M8EA 2BEOA 2X85A 3LJLA 2HR3A 3CC4I 5M5XJ 4U87A 3OYFA 2IS4A 2JTVA 2V1XA 3O60A 3BTCA 1KU2A 4E7LA 2GIVA 4RAFA 2HEOA 2XB0X 1UFMA 2VXZA 1ZELA 3C18A 3IV5A 4BDZA 1MBEA 4ZYHA 3M3YJ 3DU6A 2JRTA 2MW8A 4II2A 5JHUA 4UV8A 1J75A 2R7OA 1ITYA 1FIAA 3I3LA 2ESNA 3FXOA 4C3JJ 2CG4A 5GTIC 4XICA 3K1MA 5K7HA 3LQRA 3PIPF 1R36A 1WWXA 2E7WA 4UB8C 4M71A 1STZA 1BJZA 2GWRA 3FZVA 3M4OJ 2NP3A 1KYWA 1RZ4A 5FFXA 2XV4S 2V79A 1B8IA 1R1UA 5FRNA 1ZK8A 1AHDP 2E34A 2M4GA 1T6SA 2EK5A 4I0BA 1H8AC 1AOYA 2EBIA 3DPLC 2V6EA 4A3EJ 2HS5A 3HBLA 1TWFJ 1JHHA 4ASNA 2LKXA 3OYGA 2HQRA 2HZTA 2QLZA 2ZCWA 3VYRB 2LYCA 1SD5A 2OCEA 2HDWA 2PN6A 1IZ1A 3RZDJ 5K7ZA 3G1OA 3OSFA 1HF0A 1B9NA 2GENA 1CQTA 5A2QZ 4E7JA 2L0KA 1BIAA 4UVCA 2Y30A 5IT3A 3HOXJ 3RKQA 1UHMA 2W53A 3I4MJ 4N0BA 4D7MA 1ZR2A 2IXSA 1IUFA 3GTMJ 1PVEA 1SD7A 3P9IA 4XLFA 2K3FA 2Y0SN 3RPQA 3HSRA 2ZXHA 1GT0C 4BE2A 2X6OA 3P9KA 4JK1X 4OD5A 3H0DA 2DMNA 2L02A 1X3WB 2NVTJ 1TW2A 1JGGA 4PSXA 1IG7A 3B6CA 1P7JA 5FMPA 2BY0A 1W36C 2EIJH 3K7AJ 4JYKA 2EJRA 3IC7A 2VBYA 2DG8A 3I59B 4A93J 2FJ1A 2VQHA 2GA1A 3RSNA 1H89C 1QZZA 2ZXIA 3ZGKA 1DP7P 2EFOA 1IF1A 1QVUA 3V7SA 2A5YB 2DMTA 4L5IA 1R7JA 1FY7A 1Z0XA 1IV6A 4F93B 4J19A 3MKLA 4LGWA 4BHBA 3ZQCA 5FKOA 2Z33A 1Y6IA 3ANPA 4A5NA 4YZEA 1ZQ3P 4U0WA 4XLCA 4ENKA 5HOOA 2HYTA 3LOCA 3CMEI 2NRAC 5IP6A 1TNSA 2NAZA 2XGCA 4E70A 2YS9A 3SQNA 4BYYA 1X1PA 1RETA 3HE0A 1WI3A 2HNHA 2DAOA 4RB3C 2E71A 1VF9A 2VBZA 3EPZA 2NOGA 3M07A 4RS8A 3H9GA 4Y17A 4BJTA 2JPCA 1Y56A 4HW0A 4RAZA 3RKWA 4UUVA 2Z5UA 3JSJA 3GZIA 1D0ZA 4E4HA 3U2RA 1TT0A 2GZWA 4GO1A 4LK1F 2VC1A 3FX3A 1HXDA 3HHHA 3IH3A 1UI5A 2H8WA 4BE0A 1QPIA 4BHCA 2VN2A 3HTJA 2VPLA 1X1DA 2M2EA 1OJLA 2BVMA 3BHQA 4XSZF 4B43A 3GX4X 1RUOA 1ZLJA 1LFUP 3SDGA 2DPDA 5BPIA 2R7DA 4HBLA 2I8DA 3GWZA 4A12A 3TBIA 2GUHA 5JI6A 2XAUA 2L7MP 1LEBA 5H6QA 3V8JA 3A02A 3AG3H 5JVTA 5EEAA 3CCLI 1IN4A 4HQEA 1K7AA 3ZQ7A 4R79A 5D4RA 4PJLA 4HNUA 3H9JA 3GW2A 1GVDA 5FJ8J 2M0MA 2GXBA 1FBSA 2OD5A 3KX2A 3W3CA 1X3ZB 3ROUA 3SDBA 4F92B 4IVNA 3W6KB 1ZGAA 2A5WA 1YI2I 5H20A 1BM9A 3HYIA 4NQWA 4ABZA 1WJBA 1MGTA 2HQ5A 3DEUA 2VASA 4X0GA 4C30A 1FEXA 3TP0A 4XKCA 3M1CA 3CMMA 4J00A 3PO2J 2M8EA 2DT5A 4DBRA 1T33A 1VNDA 4KT5C 3BG5A 3C1DA 2E1OA 1Y8RB 2ZSHB 4P9FA 2L4MA 3P5JA 1FYMA 2LBFB 3Q9SA 2E1MC 2KRFA 3I4NJ 2JVGA 2JQ7A 3ZR8X 3CZ6A 2H8RA 2BHZA 5C3EJ 4U9LA 4Y52J 3ZQIA 4A3FJ 1DU6A 3QPLA 3NNRA 3KPHA 3OYEA 2X6WA 4K2EA 4E7KA 3FXQA 2GM4A 4S05A 1ZN2A 2NXNB 4J01A 1ETKA 4PGHA 4U7DA 1BN5A 1Z7UA 4M3EA 4PSWA 1F4KA 2B1EA 3K4CA 4XR6A 4A2UA 1GUUA 2IT0A 1SAXA 3ON2A 4HA8A 3CRJA 3WTWC 2B3WA 5BOXA 3N4MA 2ZNYA 2E1NA 2ZMEB 5CPRB 2E5NA 4QIWN 3CDIA 4NDLA 2PI0A 1Z1DA 2VPRA 2DMQA 3MN2A 2EZIA 3GO5A 2DA3A 3K4MA 5D4SA 4ZYGA 1YW7A 1MMNA 3KEYA 5LEJA 1YTYA 3K4KA 4S04A 3V78A 3U1DA 1YIJI 2HYFA 1RC9A 2RGVA 3DWLE 2X4HA 1TWCJ 3EYYA 1MBGA 1SD6A 3LAJA 2V9KA 1DUXC 1JXSA 2EA2A 2YX4A 3CJDA 3PUBA 3ZOBA 4KISA 2FJI1 3W6JB 2ZBKA 2ZO4A 2KIFA 2DMUA 2RVCA 1XCVA 1TLHB 4KUMA 4CA0A 1ODDA 2E36A 2OV7A 3TDZC 2Y31A 3LWJA 3JRDA 4I99C 3O2PE 3P9CA 2MH2A 1KQ8A 2ESHA 2X6XA 3KP2A 2V1DA 5LGUA 1Z6RA 4M9SA 3JRCA 3GVAA 3HB9A 4B09A 4LIUA 4KYWA 4OMYA 1S6LA 2HKUA 3EUPA 5TJJA 3H36A 4NUBA 3OMYA 2LVSA 3M9AA 5CVJA 4IHSA 4Q4ZF 2GLOA 2XDVA 4ZDLA 3H9QA 1WJDA 2KIQA 2K27A 4E7ZA 3OYIA 2W7NA 4ENNA 1VQNI 4Q5SF 5CYVA 4CO8A 3BQZA 4BXFA 1OMIA 4CCLA 1IAWA 1EJ9A 4D5FA 3DP7A 4GCVA 1VQMI 3E6BA 2VOPA 1X19A 1YYVA 1BI2A 5EZGA 4ITVA 4A3DJ 4L9JA 1T56A 3QPSA 1Y39A 2DU9A 2QZ8A 1OCOH 4YIRX 4HEA2 3LHQA 1R58A 1K4SA 3HHGA 4U9NA 2JPBA 3HL2A 3OSGA 5L3GA 3GFIA 1V5EA 4ZYEA 1J2XA 3AQTA 2NX4A 2WBMA 2F2EA 2IS6A 2HGCA 1ON1A 4L0ZB 3DFGA 5DDGA 2NVQJ 1Z9CA 3KLNA 3QU3A 2CQXA 1G4DA 1TNTA 2DYSH 4PXIA 3DEWA 4XSXF 5B66C 1CF7A 2ZMEC 5ED4A 3T8TA 3WU2C 4F52A 2ADUA 2ID6A 4ENMA 1BR2A 2HVQA 3S1QJ 2DA1A 4IKFA 3JTHA 2JA8J 1WJEA 4B3XA 3GZNB 2BY2A 3GTPJ 2PX9A 2W85A 4ESJA 3KYCB 3MVPA 3VW1A 2B7EA 3HPHA 4LG0A 3C07A 3MQ0A 2Q0OA 3G7RA 2XKPA 2RNGA 3RPUA 3M8JA 1EH7A 3J7YJ 3PIOF 5KCMA 3OS1A 4PFPA 1R22A 1YJWI 4DZJA 1XC5A 4RGXA 5FRMA 3HEFA 3ABTA 4IOAF 1PDNC 4XMYA 4QWQA 3D5RC 2F5DA 3IRQA 2G7GA 4MFDA 1LFPA 1XMXA 5J3LA 5LBQA 2ECBA 3I54A 1FMVA 4B1RA 1X4OA 2L9RA 3S1MJ 4QPQA 4BQQA 4CSWA 2E2IJ 2W57A 2HXOA 3EUHA 2F5EA 1VQ5I 4IRIA 4UV9A 2H09A 1JT0A 2BW3A 4HOBA 3L00A 4AYBN 3ASNH 5LRSA 4M74A 4NC8A 3CCQI 2TDXA 1DPUA 1P4AA 4HSRA 4OIRF 4A0YA 2JWTA 4NN1A 1F5TA 1S3JA 4RLFA 3VOXA 3DQVC 3A2KA 4NC7A 4OIOF 1Z3XA 2K9SA 4YFXF 4XRFA 3DU5A 2LP0A 3B81A 1NG7A 3WE3A 4HSTA 1WJAA 2Y69H 1OCZH 5EZHA 3HTIA 1XGOA 4Z6YA 1V3FA 1ZAOA 3IAS2 3Q0VA 2DA7A 4A3CJ 2KISA 2AO9A 3F8NA 2EINH 1MDMA 1U8RA 1J09A 3R0JA 2OERA 2IJLA 3ANGA 3BOQA 3VFZA 2QF7A 4Y4RA 3Q3SA 4XLEA 3EUHC 3WTZA 1FMWA 2AQEA 3KP5A 2QQAA 5E20A 1TQPA 2Y0MA 3LA3A 2WGBA 3IKVA 2K4BA 4NNJA 3WHBA 1ZG3A 2HQNA 5GP9A 2I10A 1QHGA 3BZCA 3H3ZA 4HV6A 4HNVA 2PJRB 5ICFA 4HF1A 4PGGA 3PQJA 1WH7A 1IUYA 3C7JA 5B5EC 3F8CA 4F7ZA 1PP7U 3ZMSA 4KMUX 4C2TA 3W2AA 4KIBA 2ZNZA 2G0EA 1I50J 2P5KA 4L5JA 1FLIA 4A5MA 3CLQA 4IEJA 2O3FA 3SJMA 2L3DA 3S1RJ 2QGUA 4L9VA 2OF7A 2LF8A 2DTZA 2K7LA 5EG0A 3G73A 5L3CA 2HDCA 3H5NA 3Q9VA 2GIZA 5HS7A 3CMAI 2FUG2 4B4CA 3VUQA 1PUEE 2BV6A 4XLAA 1QBJA 4ACIA 3E5XA 4XKBA 1IN6A 3I64A 2DXIA 3A01A 1O57A 5H6RA 5L3DA 3B02A 3WU0A 4M6XA 4CYDA 3G4SI 3DKWA 3LSMA 4GFKA 2H1KA 3TMOA 2E1MB 3FBIB 3N05A 2CH0A 3FBNB 1BA5A 5J6XA 5LHHA 1ONVA 1HBXG 3AFHA 2HTJA 1NK2P 1ZYRF 1VQLI 3HIFA 4NHJA 2BE5F 2IGOA 4AC6A 3CCVI 3BWGA 2YVEA 4GYGA 4MO7A 3RCOA 2CYYA 4FT8A 2L01A 1QU3A 5M3FJ 1H0MA 5GADJ 5KK1A 3J81Z 3ZQHA 4UVAA 2HKOA 3K0LA 1OISA 4M3FA 2EPFA 2R7XA 2DFFA 3LSGA 1ETQA 1DP3A 2ZJ2A 3ABLH 2DA5A 2LY9A 1USSA 1XSVA 3BR0A 1EH8A 3TW7A 4HX7A 2DW4A 2IPQX 3ONQA 3GZ5A 1U9OA 1HW1A 1FWZA 1KA8A 2R5YB 1N78A 2ZKZA 3GEUA 2KRHA 5IPAA 3BY6A 3C3WA 4Q48A 4Y3OA 2WUIA 2WC2A 3R6SA 2Q24A 2QENA 4RA2A 5D8LB 3FXLA 3T1BA 1YW8A 3F6VA 4RGUA 2XPVA 2QKOA 3TL4X 2XC7A 4XN0A 4AWXB 2BHYA 2FMLA 1OYYA 3V8KA 4HKUA 4XORA 3ZMTA 2ZJQF 3CWRA 3OOUA 3KNWA 3BG7A 1BR1A 3TEDA 2JA5J 2HWVA 1SEUA 3OYAA 1G8XA 1JUMA 3DKXA 1XSXA 1TQMA 2XF6A 3SZTA 1W5CC 3A03A 5J4VA 4B3AA 5DD4A 4YFKF 1JKRC 2PMUA 3OOPA 3F8FA 3L1PA 2EZLA 5FFZA 2RN7A 2G3BA 5E3NA 3P7NA 4U88A 4XRSA 3K2AA 3FXUA 1ENHA 4M6VA 3OS0A 2F4IA 3ZRGA 4LB6B 1I5ZA 3CO6C 1ON2A 4HX4A 3K10A 1V5FA 4HG2A 1A5JA 2OUMA 4PDKA 1OR7C 3KZ9A 1X2NA 1Z21A 1N25A 4BU2A 1QZYA 1W7PA 2G7HA 3IH2A 3ERMA 4GXOA 5IT9Z 3L9FA 3PUFA 5CQEA 5EDNA 3RD3A 1B8IB 2LD5A 1K78A 3CJRB 4P5OA 4KWAA 3JW4A 1FP1D 3DXJF 4I76A 5HDGA 3HOVJ 2L7FP 1W5SA 3BG6A 1B72A 4GFLA 5DEQA 4A3JJ 2OQGA 2XF7A 1QRYA 3E3VA 5IP9J 4XRSG 1IRGA 2AXTC 3MKWB 1J9IA 3GMEA 2XROA 3WTXC 2KIUA 1G3WA 5HBUA 3J81K 2UXPA 1P6RA 2LNBA 1P9QC 5JFRA 3MZYA 1MKMA 5IT9K 1T39A 4B47A 3RDIA 1BL0A 4MXMA 2A6HF 2Q8KA 1ZG5A 2LR8A 4OINF 4BEHB 2ZOYA 4DVYP 2OJED 3FM3A 5ILUA 3QAHA 3TP3A 5E1XA 5LHIA 3ML6A 1EF4A 2J5OA 1A04A 4RMNA 2BGCA 3CLOA 1LFBA 2X1CA 3BR6A 3QU6A 4MEYF 3KKDA 3J7ZI 3GLXA 3ABUA 1XDSA 4RB1A 4M72A 3E5QA 4A3LJ 5F64A 2F4OB 2STTA 3GUDA 5TRDA 1RNLA 4I7HA 2FRHA 4HAMA 5F0HA 1HKSA 2XAQA 5BMZA 1ZARA 2K86A 2UXOA 1S72I 2L9NA 4CYCA 2G7SA 5D18A 5BS6A 2HDDA 2MG4A 3HIMA 1GXPA 2EFNA 1W0UA 3BCAA 3RI4A 1FBUA 5E8GA 3A0HC 3S1NJ 2K85A 2CQNA 2IGKA 1RR8C 3C2BA 4CZZA 4EEFG 4P1WA 1XDUA 2VLAA 1XSDA 1G3TA 4IXAA 4FHTA 1SGMA 2MC3A 2O6GE 5J4YA 4MGRA 3CMYA 1LUJB 2XGXA 5KHDA 3EDPA 2CV1A 5KAFC 2O8KA 4AM3A 2QSGX 2YU9J 3EGQA 5KAIC 2HYGD 1YE9A 3LWFA 3IRRA 4PFOA 3I0TA 1POGA 2P6TA 4I01A 1XS9A 1ZKGA 2RNJA 5FO5A 2XGEA 2R7QA 5M5YJ 3ZMVA 1VQOI 1JUPA 1HW2A 5K5OA 3BZKA 2R7SA 1S8NA 3FMRA 2VJ4A 5J8CA 5CLSA 5HAWA 1TW3A 4H4KC 2PJRA 2IA0A 1MMGA 5D19A 1O3QA 3BPXA 3OYLA 2W82A 3KETA 4V2FA 2UUZA 5DM6F 3MKYB 1NH3A 3BJAA 2NP5A 1FOXA 2H27A 3F72A 3L7WA 2GOXB 4EQQA 3I53A 2CGPA 2VBWA 4XNFA 3HDDA 5E3LA 1R49A 4UHTA 2P8TA 4CDGA 1RKWA 4V2GA 5EGOB 2K9MA 4A3BJ 1Z05A 3VP5A 1P4XA 3WTVC 2A07F 2UWMA 3H5AA 3RIRA 2ZFUA 4XL9A 1Z91A 1BIBA 2DA4A 2KL4A 4M6YA 1DPRA 3VYUB 1T38A 2R7FA 4OOIA 3P9TA 4I09A 2CUFA 5JVGF 2ZXWH 5FLXK 3I59A 1FP2A 4DW6A 2CFOA 3I5UA 3K9TA 2MD5A 4MLOA 1T98A 3H1CA 2ME0A 1X1AA 4M3BA 3KZZA 3PSFA 3CF5F 1M1EB 4ME9A 3ZMZA 2W1OA 2IGNA 2KZVA 1IRXA 4UUTA 3TGNA 1V5GA 3DCFA 3JRBA 4CGZA 1YIOA 2X48A 4AC0A 3DPJA 3JREA 1R9TJ 2DPUA 1OYWA 3NXCA 4GFBA 2PFBA 3RQ4A 3QOEA 5EYRA 3VEPA 3HTSB 1RPWA 4KN4X 4LD5A 2LC2A 1ZH5A 4Y33A 3G2BA 4DBQA 1IXSB 1JE8A 1X2MA 3CUQC 1E17A 3FKIJ 2DJNA 1TWHJ 2JMWA 2TCTA 2JSCA 1YLFA 1ETWA 1MNEA 3FRQA
chains in the Genus database with same CATH topology
4A3GJ 2ZOZA 5IYDJ 1ETXA 1WPKA 1ZGWA 1NTCA 3S16J 2NVQJ 1HDPA 1P7IA 4DZPA 3HOUJ 2CQXA 4D7NA 4FTHA 1B72B 1HLVA 2E2HJ 3PPBA 1RESA 4PXIA 2PMZN 4I6ZA 3D1NI 5D1RA 3DEWA 1NK3P 4QSHA 4JX4A 5HODA 2YUSA 2ID6A 1GV2A 3S1QJ 2DA1A 5EFYA 2MSYA 3A01B 2JA8J 2WV1A 1UHSA 3GTPJ 1GDTA 1FTZA 3NI7A 3PASA 2JA7J 2QWTA 4DYRA 3MVPA 3VW1A 2CJJA 2B63J 3C07A 3S5RA 3G7RA 3GTJJ 2QTQA 1I3QJ 4X6AJ 4MFEA 1WGXA 2D5VA 1IDYA 2X9DA 2F07A 1OCPA 4BXXJ 5F0CA 4DZJA 1K83J 1XC5A 2ZCXA 2G7LA 3VW0A 4GCKA 3HEFA 2REKA 4G12A 9ANTA 2R5YA 2ZB9A 4JNNA 1ETYA 1BW5A 1MBKA 2IEKA 4IHYA 4MFDA 2G7GA 5J3LA 4XRMA 4RBOA 2ECBA 5FKMA 3GTKJ 5CW8A 4B1RA 1JTYA 2L9RA 3S1MJ 3BJBA 2E2IJ 2HXOA 2FQ4A 3NARA 4GCLA 4CGRA 4FISA 1JT0A 5FGLA 1RKTA 2NVYJ 2FBQA 3Q0UA 4LOCA 4AYBN 2DA2A 4IHXA 1Y1VJ 2UXUA 3G1LA 2AHQA 4FE4A 4BKXA 2JWTA 2L7ZA 4DYQA 1FTTA 4NN1A 1E3OC 3VOXA 1UMQA 1AU7A 5CXGA 2EQRA 2UXHA 2YVHA 2K9SA 3NRGA 3B81A 2LP0A 3JRFA 1A6IA 2DG7A 5EZHA 3F1BA 3HTIA 5GPCA 3VVZA 1MH4A 2K9QA 3F0CA 3BG9A 4L5EA 2M0CA 1MBHA 3Q0VA 1WCMJ 2DA7A 3GTGJ 4A3CJ 3VOKA 1OFCX 4JX6A 2AO9A 1FJLA 5JLXA 3CQZJ 2OERA 1JKPC 2EH3A 3ANGA 2LLKA 2QF7A 3Q3SA 5K58A 4Y7NJ 2WAQN 2ELKA 4C2MJ 5F0FA 1LE8A 3TW6A 1I6HJ 4JKZA 4NELA 1SANA 2MGQA 2WGBA 3WHBA 5F27A 5GP9A 2I10A 4HNVA 1G2HA 1HDDC 5F1JA 1WH7A 2QOPA 1TWAJ 2ID3A 3BRUA 1D5YA 2XSDC 3BR2A 3E7LA 1Z77A 2FX0A 3LSPA 2UXIA 2NS8A 2GFNA 2IU5A 2N8GA 3PO3J 3FK6A 5F08A 3BR5A 2KDZA 5FKLA 2G0EA 1I50J 3GTLJ 2FD5A 1JT6A 2W48A 4W1UA 4FE7A 4IEJA 5FKKA 3LJLA 1AKHA 3MNLA 3SJMA 3B6AA 3S1RJ 5M5XJ 3O60A 1SFOJ 2CU7A 2OF7A 3BTCA 2DTZA 5EG0A 3AQSA 5K7FA 1IJWC 4D5CA 1APLC 2XDNA 4B4CA 3VUQA 2XB0X 3HTAA 4A3KJ 3IV5A 4CYCB 1MBEA 1WH5A 3M3YJ 5H9TA 2CUEA 2MW8A 4ACIA 1O4XA 1MSEC 2O7TA 2KT0A 3A01A 1ITYA 1FIPA 1YRNB 1FIAA 1VFCA 2R93J 4C3JJ 3FISA 5EG0B 1VI0A 4XICA 5K7HA 4GFKA 4JP0A 1XG1A 2H1KA 1UI6A 4C3IJ 1BA5A 1BJZA 3M4OJ 2ECCA 2NP3A 1NK2P 1B8IA 4AC6A 1ZK8A 1AHDP 3S15J 2E2JJ 3COLA 1ZTRA 1H8AC 1AKHB 2EBIA 2YVEA 4MO7A 4A3EJ 3HBLA 2HOSA 4C3HJ 1TWFJ 5E3MA 4IHWA 2OPTA 2LKXA 2M8GX 5M3FJ 3HOYJ 3ZQHA 4M3FA 1IDZA 5C4YA 2Y9YA 1HOMA 3LSGA 5J1YA 4UUSA 1ETQA 2JN6A 2COBA 1DU0A 1U8BA 3HKZN 3RZDJ 5K7ZA 2DMPA 5FHPA 3G1OA 3OSFA 2DA5A 2LY9A 1HF0A 3HOWJ 2GENA 3BNIA 2IBDA 3BR0A 1CQTA 3TW7A 2L0KA 3RKQA 2Y30A 3HOXJ 1U9OA 3H0GJ 2W53A 3I4MJ 1MBFA 4AUXA 2VKVA 4D7MA 2R5YB 2ME6A 1ZR2A 3GEUA 5IPAA 2WUIA 1IUFA 3GTMJ 2O9LA 2JJ7A 3ZQLA 1Y1WJ 2HOTA 2Q24A 5CXIA 3T6NA 2Y0SN 4A69C 3BTJA 2RHAA 1GT0C 2XPVA 2X6OA 3QQAA 2QKOA 5FLVA 2DMNA 4HKUA 4IHVA 2NVTJ 1JGGA 1IG7A 3OOUA 1MBJA 3CWRA 3KNWA 3B6CA 1P7JA 5FMPA 2XRLA 5FLMJ 3TEDA 2JA5J 3K7AJ 2Y2ZA 4JYKA 3NPIA 4RDUA 1JUMA 2DG8A 3CCYA 4A93J 2FJ1A 1HCRA 1YRNA 1H89C 4GCTA 3A03A 1JJ6C 1QVUA 3JRGA 2DMTA 4B3AA 1ETVA 3S2DJ 1JKRC 1Z0XA 4BY1J 1IV6A 3S14J 4J19A 3MKLA 2CQQA 3BTLA 3L1PA 3VIBA 2EZLA 3ZQCA 2WB1N 1IGNA 5FKOA 2G3BA 5E3NA 4XRSA 3ANPA 3K2AA 2XGDA 1ZQ3P 1ENHA 4YZEA 4M6VA 2HYTA 4XIDA 3LOCA 2R0QC 1K61A 2RASA 4M3DA 5IP6A 2K9NA 3JRAA 2XGCA 2YS9A 3RH2A 1A5JA 1RETA 3HE0A 1WI3A 3KZ9A 1X2NA 1JKOC 4UDSA 4AF5A 3O8HA 5IOYA 4W97A 2VI6A 3IH2A 1VF9A 2NOGA 3JR9A 5EDNA 3KKCA 3RD3A 1B8IB 2LD5A 3JSJA 3GZIA 1ORKA 2QCOA 4KWAA 4I76A 2GBYA 2RAEA 3HOVJ 2L7FP 2NS7A 3Q0WA 1H88C 1QVTA 3IUVA 1B72A 4JX5A 3VVYA 3IH3A 4GFLA 1UI5A 4A3JJ 1QPIA 3IH4A 5J1RA 3HTHA 3HTJA 3S17J 1QRYA 5IP9J 2VUMJ 2M2EA 1OJLA 1W0TA 4XRSG 2IAIA 3BHQA 3LNQA 1LFUP 3SDGA 3FIWA 5HBUA 2UXPA 4L62A 4BY7J 2LK2A 5E3OA 5C4XJ 3RQIA 2E19A 2GUHA 2L7MP 1LE8B 2M34A 2ZCMA 3A02A 1F36A 5EEAA 3LSJA 3O8GA 1X58A 1RR7A 1BL0A 4MXMA 2LR8A 2PBXA 1GVDA 5M3MJ 5FJ8J 2ZOYA 3G56A 3TP3A 1EF4A 3BTIA 3GTOJ 4ABZA 2HQ5A 2QIBA 1LFBA 1FEXA 2HOAA 3TP0A 3PO2J 4X1EA 3BR6A 2R5ZB 3VW2A 5M5WJ 3KKDA 2HI3A 1T33A 1VNDA 3HOZJ 2XPWA 3BG5A 3GBGA 2E1OA 1U9NA 4A3LJ 2CRGA 4QTRA 3VPRA 2ZCNA 3BG3A 3I4NJ 1OCTC 4JL3A 5F0HA 3S2HJ 5J1UA 4FCYA 2H8RA 2UXOA 4S0HB 5C3EJ 4CYCA 2G7SA 5D18A 2HDDA 4Y52J 2MG4A 3HIMA 4A3MJ 1W0UA 3ZQIA 4A3FJ 2Y9ZA 3QPLA 3S1NJ 1DU6A 5F04A 3NNRA 5HSZA 3V6GA 2TRTA 3C2BA 2M9HA 3BR1A 5DAJA 4EEFG 2GM4A 3UKGA 2OI8A 2XPUA 2DA6A 1ETKA 5IYBJ 1GV5A 4M3EA 4DYCA 1ZR4A 1SGMA 1TWGJ 2LTPA 3CMYA 2P81A 2VKEA 1GUUA 3HGYA 4A3IJ 2DN0A 2O8KA 3ON2A 2YU9J 1S7EA 3EGQA 1PUFB 3CRJA 4MIMA 4XK4A 4BBSJ 1POGA 2NVXJ 1IC8A 1ETOA 3G1MA 4QIWN 5JLWA 1XS9A 3ON4A 1ZKGA 4NDLA 2XGEA 1TC3C 2VPRA 2DMQA 4M3GA 3MN2A 5M5YJ 2EZIA 5IYCJ 1BW6A 2DA3A 1JUPA 3E7QA 1Q1VA 2HYJA 5GPAA 5HAWA 3V78A 5D19A 5DS9A 1TWCJ 1MBGA 3W6VA 3QKXA 3SFIA 4V2FA 5EF6A 3BCGA 3CJDA 3QBMA 3ZOBA 3PM1A 3RZOJ 1UG2A 2NP5A 2O7OA 1IRZA 3BR3A 2V57A 5IOZA 2DMUA 3HGGA 3JRHA 3HDDA 5E3LA 1U78A 4UUSB 1JKQC 3FK7A 3WHCA 1RKWA 4V2GA 5EGOB 2PZ9A 3BT9A 5C4JJ 3OIOA 3ZQGA 5BNGA 1JJ8C 3H3VK 4A3BJ 2D6YA 2Y31A 5DTDA 3LWJA 3VP5A 3JRDA 2LFBA 2K40A 3CDLA 2DA4A 5C44J 3P9TA 2CUFA 3JRCA 2R5ZA 1MNMC 3HB9A 3EUPA 2HKUA 2EZHA 4DW6A 3JRIA 4MK6A 5EGOA 5AQCA 2LVSA 2XB5A 1JTXA 4MLOA 2GLOA 1JUSA 2ME0A 4M3BA 3LSRA 2R7ZJ 2R92J 4ME9A 3BQZA 4ICHA 2EZKA 4UUTA 4D5FA 3JRBA 3DCFA 2X48A 4AC0A 1PUFA 2JK3A 4BBRJ 3JREA 3DPJA 1R9TJ 3VVXA 5EZGA 5FKNA 4A3DJ 1T56A 3QPSA 4GFBA 3NXCA 3BQYA 5EYRA 1RPWA 3LHQA 3ZQFA 2JA6J 1X2MA 3OSGA 1MH3A 2HXIA 3HM5A 1F43A 3GTQJ 3FKIJ 5IP7J 2DJNA 2NX4A 3AQTA 1TWHJ 2JMWA 2TCTA 1ETWA 3FRQA 3NAUA 1MSFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G J;  2ZOZ A;  5IYD J;  1ETX A;  1WPK A;  1ZGW A;  1NTC A;  3S16 J;  2NVQ J;  1HDP A;  1P7I A;  4DZP A;  3HOU J;  2CQX A;  4D7N A;  4FTH A;  1B72 B;  1HLV A;  2E2H J;  3PPB A;  1RES A;  4PXI A;  2PMZ N;  4I6Z A;  3D1N I;  5D1R A;  3DEW A;  1NK3 P;  4QSH A;  4JX4 A;  5HOD A;  2YUS A;  2ID6 A;  1GV2 A;  3S1Q J;  2DA1 A;  5EFY A;  2MSY A;  3A01 B;  2JA8 J;  2WV1 A;  1UHS A;  3GTP J;  1GDT A;  1FTZ A;  3NI7 A;  3PAS A;  2JA7 J;  2QWT A;  4DYR A;  3MVP A;  3VW1 A;  2CJJ A;  2B63 J;  3C07 A;  3S5R A;  3G7R A;  3GTJ J;  2QTQ A;  1I3Q J;  4X6A J;  4MFE A;  1WGX A;  2D5V A;  1IDY A;  2X9D A;  2F07 A;  1OCP A;  4BXX J;  5F0C A;  4DZJ A;  1K83 J;  1XC5 A;  2ZCX A;  2G7L A;  3VW0 A;  4GCK A;  3HEF A;  2REK A;  4G12 A;  9ANT A;  2R5Y A;  2ZB9 A;  4JNN A;  1ETY A;  1BW5 A;  1MBK A;  2IEK A;  4IHY A;  4MFD A;  2G7G A;  5J3L A;  4XRM A;  4RBO A;  2ECB A;  5FKM A;  3GTK J;  5CW8 A;  4B1R A;  1JTY A;  2L9R A;  3S1M J;  3BJB A;  2E2I J;  2HXO A;  2FQ4 A;  3NAR A;  4GCL A;  4CGR A;  4FIS A;  1JT0 A;  5FGL A;  1RKT A;  2NVY J;  2FBQ A;  3Q0U A;  4LOC A;  4AYB N;  2DA2 A;  4IHX A;  1Y1V J;  2UXU A;  3G1L A;  2AHQ A;  4FE4 A;  4BKX A;  2JWT A;  2L7Z A;  4DYQ A;  1FTT A;  4NN1 A;  1E3O C;  3VOX A;  1UMQ A;  1AU7 A;  5CXG A;  2EQR A;  2UXH A;  2YVH A;  2K9S A;  3NRG A;  3B81 A;  2LP0 A;  3JRF A;  1A6I A;  2DG7 A;  5EZH A;  3F1B A;  3HTI A;  5GPC A;  3VVZ A;  1MH4 A;  2K9Q A;  3F0C A;  3BG9 A;  4L5E A;  2M0C A;  1MBH A;  3Q0V A;  1WCM J;  2DA7 A;  3GTG J;  4A3C J;  3VOK A;  1OFC X;  4JX6 A;  2AO9 A;  1FJL A;  5JLX A;  3CQZ J;  2OER A;  1JKP C;  2EH3 A;  3ANG A;  2LLK A;  2QF7 A;  3Q3S A;  5K58 A;  4Y7N J;  2WAQ N;  2ELK A;  4C2M J;  5F0F A;  1LE8 A;  3TW6 A;  1I6H J;  4JKZ A;  4NEL A;  1SAN A;  2MGQ A;  2WGB A;  3WHB A;  5F27 A;  5GP9 A;  2I10 A;  4HNV A;  1G2H A;  1HDD C;  5F1J A;  1WH7 A;  2QOP A;  1TWA J;  2ID3 A;  3BRU A;  1D5Y A;  2XSD C;  3BR2 A;  3E7L A;  1Z77 A;  2FX0 A;  3LSP A;  2UXI A;  2NS8 A;  2GFN A;  2IU5 A;  2N8G A;  3PO3 J;  3FK6 A;  5F08 A;  3BR5 A;  2KDZ A;  5FKL A;  2G0E A;  1I50 J;  3GTL J;  2FD5 A;  1JT6 A;  2W48 A;  4W1U A;  4FE7 A;  4IEJ A;  5FKK A;  3LJL A;  1AKH A;  3MNL A;  3SJM A;  3B6A A;  3S1R J;  5M5X J;  3O60 A;  1SFO J;  2CU7 A;  2OF7 A;  3BTC A;  2DTZ A;  5EG0 A;  3AQS A;  5K7F A;  1IJW C;  4D5C A;  1APL C;  2XDN A;  4B4C A;  3VUQ A;  2XB0 X;  3HTA A;  4A3K J;  3IV5 A;  4CYC B;  1MBE A;  1WH5 A;  3M3Y J;  5H9T A;  2CUE A;  2MW8 A;  4ACI A;  1O4X A;  1MSE C;  2O7T A;  2KT0 A;  3A01 A;  1ITY A;  1FIP A;  1YRN B;  1FIA A;  1VFC A;  2R93 J;  4C3J J;  3FIS A;  5EG0 B;  1VI0 A;  4XIC A;  5K7H A;  4GFK A;  4JP0 A;  1XG1 A;  2H1K A;  1UI6 A;  4C3I J;  1BA5 A;  1BJZ A;  3M4O J;  2ECC A;  2NP3 A;  1NK2 P;  1B8I A;  4AC6 A;  1ZK8 A;  1AHD P;  3S15 J;  2E2J J;  3COL A;  1ZTR A;  1H8A C;  1AKH B;  2EBI A;  2YVE A;  4MO7 A;  4A3E J;  3HBL A;  2HOS A;  4C3H J;  1TWF J;  5E3M A;  4IHW A;  2OPT A;  2LKX A;  2M8G X;  5M3F J;  3HOY J;  3ZQH A;  4M3F A;  1IDZ A;  5C4Y A;  2Y9Y A;  1HOM A;  3LSG A;  5J1Y A;  4UUS A;  1ETQ A;  2JN6 A;  2COB A;  1DU0 A;  1U8B A;  3HKZ N;  3RZD J;  5K7Z A;  2DMP A;  5FHP A;  3G1O A;  3OSF A;  2DA5 A;  2LY9 A;  1HF0 A;  3HOW J;  2GEN A;  3BNI A;  2IBD A;  3BR0 A;  1CQT A;  3TW7 A;  2L0K A;  3RKQ A;  2Y30 A;  3HOX J;  1U9O A;  3H0G J;  2W53 A;  3I4M J;  1MBF A;  4AUX A;  2VKV A;  4D7M A;  2R5Y B;  2ME6 A;  1ZR2 A;  3GEU A;  5IPA A;  2WUI A;  1IUF A;  3GTM J;  2O9L A;  2JJ7 A;  3ZQL A;  1Y1W J;  2HOT A;  2Q24 A;  5CXI A;  3T6N A;  2Y0S N;  4A69 C;  3BTJ A;  2RHA A;  1GT0 C;  2XPV A;  2X6O A;  3QQA A;  2QKO A;  5FLV A;  2DMN A;  4HKU A;  4IHV A;  2NVT J;  1JGG A;  1IG7 A;  3OOU A;  1MBJ A;  3CWR A;  3KNW A;  3B6C A;  1P7J A;  5FMP A;  2XRL A;  5FLM J;  3TED A;  2JA5 J;  3K7A J;  2Y2Z A;  4JYK A;  3NPI A;  4RDU A;  1JUM A;  2DG8 A;  3CCY A;  4A93 J;  2FJ1 A;  1HCR A;  1YRN A;  1H89 C;  4GCT A;  3A03 A;  1JJ6 C;  1QVU A;  3JRG A;  2DMT A;  4B3A A;  1ETV A;  3S2D J;  1JKR C;  1Z0X A;  4BY1 J;  1IV6 A;  3S14 J;  4J19 A;  3MKL A;  2CQQ A;  3BTL A;  3L1P A;  3VIB A;  2EZL A;  3ZQC A;  2WB1 N;  1IGN A;  5FKO A;  2G3B A;  5E3N A;  4XRS A;  3ANP A;  3K2A A;  2XGD A;  1ZQ3 P;  1ENH A;  4YZE A;  4M6V A;  2HYT A;  4XID A;  3LOC A;  2R0Q C;  1K61 A;  2RAS A;  4M3D A;  5IP6 A;  2K9N A;  3JRA A;  2XGC A;  2YS9 A;  3RH2 A;  1A5J A;  1RET A;  3HE0 A;  1WI3 A;  3KZ9 A;  1X2N A;  1JKO C;  4UDS A;  4AF5 A;  3O8H A;  5IOY A;  4W97 A;  2VI6 A;  3IH2 A;  1VF9 A;  2NOG A;  3JR9 A;  5EDN A;  3KKC A;  3RD3 A;  1B8I B;  2LD5 A;  3JSJ A;  3GZI A;  1ORK A;  2QCO A;  4KWA A;  4I76 A;  2GBY A;  2RAE A;  3HOV J;  2L7F P;  2NS7 A;  3Q0W A;  1H88 C;  1QVT A;  3IUV A;  1B72 A;  4JX5 A;  3VVY A;  3IH3 A;  4GFL A;  1UI5 A;  4A3J J;  1QPI A;  3IH4 A;  5J1R A;  3HTH A;  3HTJ A;  3S17 J;  1QRY A;  5IP9 J;  2VUM J;  2M2E A;  1OJL A;  1W0T A;  4XRS G;  2IAI A;  3BHQ A;  3LNQ A;  1LFU P;  3SDG A;  3FIW A;  5HBU A;  2UXP A;  4L62 A;  4BY7 J;  2LK2 A;  5E3O A;  5C4X J;  3RQI A;  2E19 A;  2GUH A;  2L7M P;  1LE8 B;  2M34 A;  2ZCM A;  3A02 A;  1F36 A;  5EEA A;  3LSJ A;  3O8G A;  1X58 A;  1RR7 A;  1BL0 A;  4MXM A;  2LR8 A;  2PBX A;  1GVD A;  5M3M J;  5FJ8 J;  2ZOY A;  3G56 A;  3TP3 A;  1EF4 A;  3BTI A;  3GTO J;  4ABZ A;  2HQ5 A;  2QIB A;  1LFB A;  1FEX A;  2HOA A;  3TP0 A;  3PO2 J;  4X1E A;  3BR6 A;  2R5Z B;  3VW2 A;  5M5W J;  3KKD A;  2HI3 A;  1T33 A;  1VND A;  3HOZ J;  2XPW A;  3BG5 A;  3GBG A;  2E1O A;  1U9N A;  4A3L J;  2CRG A;  4QTR A;  3VPR A;  2ZCN A;  3BG3 A;  3I4N J;  1OCT C;  4JL3 A;  5F0H A;  3S2H J;  5J1U A;  4FCY A;  2H8R A;  2UXO A;  4S0H B;  5C3E J;  4CYC A;  2G7S A;  5D18 A;  2HDD A;  4Y52 J;  2MG4 A;  3HIM A;  4A3M J;  1W0U A;  3ZQI A;  4A3F J;  2Y9Z A;  3QPL A;  3S1N J;  1DU6 A;  5F04 A;  3NNR A;  5HSZ A;  3V6G A;  2TRT A;  3C2B A;  2M9H A;  3BR1 A;  5DAJ A;  4EEF G;  2GM4 A;  3UKG A;  2OI8 A;  2XPU A;  2DA6 A;  1ETK A;  5IYB J;  1GV5 A;  4M3E A;  4DYC A;  1ZR4 A;  1SGM A;  1TWG J;  2LTP A;  3CMY A;  2P81 A;  2VKE A;  1GUU A;  3HGY A;  4A3I J;  2DN0 A;  2O8K A;  3ON2 A;  2YU9 J;  1S7E A;  3EGQ A;  1PUF B;  3CRJ A;  4MIM A;  4XK4 A;  4BBS J;  1POG A;  2NVX J;  1IC8 A;  1ETO A;  3G1M A;  4QIW N;  5JLW A;  1XS9 A;  3ON4 A;  1ZKG A;  4NDL A;  2XGE A;  1TC3 C;  2VPR A;  2DMQ A;  4M3G A;  3MN2 A;  5M5Y J;  2EZI A;  5IYC J;  1BW6 A;  2DA3 A;  1JUP A;  3E7Q A;  1Q1V A;  2HYJ A;  5GPA A;  5HAW A;  3V78 A;  5D19 A;  5DS9 A;  1TWC J;  1MBG A;  3W6V A;  3QKX A;  3SFI A;  4V2F A;  5EF6 A;  3BCG A;  3CJD A;  3QBM A;  3ZOB A;  3PM1 A;  3RZO J;  1UG2 A;  2NP5 A;  2O7O A;  1IRZ A;  3BR3 A;  2V57 A;  5IOZ A;  2DMU A;  3HGG A;  3JRH A;  3HDD A;  5E3L A;  1U78 A;  4UUS B;  1JKQ C;  3FK7 A;  3WHC A;  1RKW A;  4V2G A;  5EGO B;  2PZ9 A;  3BT9 A;  5C4J J;  3OIO A;  3ZQG A;  5BNG A;  1JJ8 C;  3H3V K;  4A3B J;  2D6Y A;  2Y31 A;  5DTD A;  3LWJ A;  3VP5 A;  3JRD A;  2LFB A;  2K40 A;  3CDL A;  2DA4 A;  5C44 J;  3P9T A;  2CUF A;  3JRC A;  2R5Z A;  1MNM C;  3HB9 A;  3EUP A;  2HKU A;  2EZH A;  4DW6 A;  3JRI A;  4MK6 A;  5EGO A;  5AQC A;  2LVS A;  2XB5 A;  1JTX A;  4MLO A;  2GLO A;  1JUS A;  2ME0 A;  4M3B A;  3LSR A;  2R7Z J;  2R92 J;  4ME9 A;  3BQZ A;  4ICH A;  2EZK A;  4UUT A;  4D5F A;  3JRB A;  3DCF A;  2X48 A;  4AC0 A;  1PUF A;  2JK3 A;  4BBR J;  3JRE A;  3DPJ A;  1R9T J;  3VVX A;  5EZG A;  5FKN A;  4A3D J;  1T56 A;  3QPS A;  4GFB A;  3NXC A;  3BQY A;  5EYR A;  1RPW A;  3LHQ A;  3ZQF A;  2JA6 J;  1X2M A;  3OSG A;  1MH3 A;  2HXI A;  3HM5 A;  1F43 A;  3GTQ J;  3FKI J;  5IP7 J;  2DJN A;  2NX4 A;  3AQT A;  1TWH J;  2JMW A;  2TCT A;  1ETW A;  3FRQ A;  3NAU A;  1MSF C; 
#chains in the Genus database with same CATH topology
 4A3G J;  5E18 F;  5IYD J;  4YII A;  4HDV A;  3CO7 C;  3I9V 2;  3NQO A;  3S16 J;  1HDP A;  1P7I A;  4ZH4 F;  3WE2 A;  4D7N A;  4TV7 A;  2IA1 A;  2KDO A;  3GF2 A;  1B72 B;  1HLV A;  1XGM A;  2E2H J;  1TBX A;  2L9S A;  4I6Z A;  2FXA A;  3U1K A;  5D1R A;  1ZRF A;  1KQ9 A;  3FXK A;  3COA C;  4WF2 A;  4JX4 A;  1UG0 A;  1FYK A;  2YUS A;  4KNY A;  3IUO A;  2COM A;  4B48 A;  3JCU C;  2MSY A;  2L7K A;  1UHS A;  3NI7 A;  1AA7 A;  4GDF A;  2CJJ A;  1NHA A;  5HDK A;  1HKQ A;  3CUQ A;  2QTQ A;  4EJO A;  1VTN C;  1YS7 A;  3RKY A;  1R5I D;  3CJT B;  1XTA A;  3WU1 B;  2PFV A;  2LSO A;  1ZHF A;  2BVL A;  4MTD A;  1IDY A;  2X9D A;  5LLQ A;  1OCP A;  1RUN A;  5F0C A;  1MW7 A;  2F07 A;  4U7B A;  1K83 J;  5D5X B;  5TGT A;  3F3X A;  1MJ9 A;  2HVR A;  1T0F A;  4HX8 A;  4IL6 C;  4D0P A;  2Q2E B;  9ANT A;  4BQA A;  4JNN A;  4IPA A;  1ETY A;  3KIO A;  1P4W A;  1XMK A;  3ASO H;  1VQ8 I;  3RYR A;  5FKM A;  3CCU I;  1LKX A;  3GYH X;  3DTI A;  3ESW B;  1JTY A;  4LMY A;  4M73 A;  3GEZ A;  3NAR A;  1QA6 A;  1KYZ A;  5D6F A;  4BJ5 C;  2QA4 I;  3PNT A;  2QQB A;  3OIQ A;  3HXL A;  5LGN A;  5FGL A;  1RKT A;  2NVY J;  3QP5 A;  3K2Z A;  1SFU A;  3T5X A;  2X51 A;  4ZDP A;  2DA2 A;  4IHX A;  1B59 A;  3ECH A;  1BJA A;  2GAU A;  1AWC A;  5AIQ A;  1Y0N A;  4G9Y A;  2G9W A;  4DYQ A;  4L0Y B;  2QBY B;  2EFQ A;  1I27 A;  4N4N B;  1FOY A;  1E3O C;  4ZYA A;  1D5V A;  1UMQ A;  1AU7 A;  3KEO A;  2HTS A;  2YVH A;  3HRT A;  3KP3 A;  1J59 A;  1G3Y A;  3EYI A;  4OIQ F;  1FT9 A;  4C2U A;  2A6E F;  3LFU A;  4HLY A;  1O7L A;  2HPI A;  2DG7 A;  3L2U A;  1O3R A;  1ERD A;  3VVZ A;  4CUG A;  5JR3 A;  3PNY A;  3AAF A;  2K9Q A;  3WG7 H;  3BG9 A;  2VC0 A;  2WB1 A;  4BHP A;  3GTG J;  3SFZ A;  2WY8 Q;  2M4K A;  5B3S H;  3CQZ J;  1SD4 A;  2LLK A;  2XAG A;  4IZZ A;  1J5Y A;  3T0Y A;  2QM3 A;  1WZ2 A;  4Y7N J;  2BW3 B;  4I02 A;  2WAQ N;  5F0F A;  1LE8 A;  1G3S A;  2Y0S A;  5F27 A;  4EM0 B;  4EJU A;  2KP6 A;  3LAP A;  4CCJ A;  2DBB A;  1X1B A;  5CKT A;  2QOP A;  1UZC A;  1X1C A;  3IKT A;  4XLN F;  3KLO A;  3HRM A;  3BR2 A;  3CUO A;  3E7L A;  1Z77 A;  3DBL B;  1DGW Y;  3LSP A;  2JT1 A;  2MBF A;  2YVX A;  3PFY A;  2L9V A;  3KYD B;  4RLQ A;  2IU5 A;  1R1T A;  1IN7 A;  3BR5 A;  4HYE A;  2KDZ A;  3I58 A;  3GTL J;  4EV0 A;  2FD5 A;  2W48 A;  4KJZ A;  5DD8 A;  5CVR A;  5ILS A;  3TQN A;  1N77 A;  3MNL A;  2P6S A;  1ZRE A;  2NYX A;  1A31 A;  1SFO J;  2CU7 A;  3AQS A;  5LRR A;  3V4G A;  2CMP A;  3HTA A;  4A3K J;  1MMS A;  1IO2 A;  4CYC B;  1OCC H;  1WH5 A;  2X6Y A;  1UAA A;  4E7H A;  2CUE A;  3KZY A;  2BOL A;  1O4X A;  1MSE C;  2P4W A;  2IRF G;  2O7T A;  4B44 A;  1FIP A;  2M7B A;  3TKY A;  4O5V A;  1YRN B;  1VFC A;  2PMH A;  2YPR A;  1X3U A;  2BBY A;  3S8P A;  3HKZ A;  1XG1 A;  2V7F A;  5ILV A;  1UI6 A;  2O8X A;  2NS0 A;  2LMD A;  2H94 A;  4ON0 A;  5L3F A;  5K1Y A;  3UR3 C;  1WRJ A;  2KIM A;  5HNH A;  4WWC A;  3G3Z A;  3GFM A;  4JOM A;  4ANJ A;  4U0Y A;  4KMF A;  3VWB A;  1Z67 A;  3COL A;  2OC6 A;  1AKH B;  3BJ6 A;  3A0B C;  4ZZD A;  2RQQ A;  2Y75 A;  4G6T B;  4HLX A;  4C3H J;  1XN7 A;  1H9G A;  2LRD A;  3QP6 A;  4A0X A;  2UZK A;  4IHW A;  2OPT A;  3LMM A;  4UXN A;  4NQW B;  2VE9 A;  4IO9 F;  4XOP A;  2PMZ A;  3OV8 A;  2Y9Y A;  2F5V A;  2EFW A;  1HOM A;  1T95 A;  3KYL A;  2JN6 A;  1DU0 A;  3UNG C;  1U8B A;  4V19 K;  2VT2 A;  2DMP A;  5FHP A;  3R0A A;  2A3S A;  3HOW J;  3BNI A;  2IBD A;  1O3S A;  1S7O A;  2BXZ A;  3K4B A;  4F3Q A;  3FHN A;  4DJA A;  2BY3 A;  2Q2E A;  3H0G J;  3GXO A;  4AUX A;  1Y8Q B;  2VKV A;  2VOO A;  3GLL A;  2HZD A;  2O9L A;  2JJ7 A;  3OIP A;  3ZQL A;  1Y1W J;  4MEX F;  2HOT A;  3M7G A;  1QZE A;  1GHC A;  4A69 C;  3BTJ A;  1D1C A;  3OR1 C;  2JVH A;  3QQA A;  3OYJ A;  3VSK A;  5FLV A;  2JRM A;  4LJZ F;  1BC7 C;  1SVO A;  2JSP A;  3KP4 A;  3ZCO A;  3V7R A;  4XKW A;  2EV0 A;  5D5W B;  2XRL A;  1VQ4 I;  2AXL A;  3S2W A;  5J40 A;  3OS2 A;  1UCR A;  4RDU A;  3CCY A;  4MQV A;  2EIK H;  1HCR A;  1YRN A;  2QBY A;  2R7V A;  1FNN A;  3JRG A;  4G7O F;  1TT5 B;  2ACJ A;  1R4N B;  2E60 A;  2Z2S B;  2KJC A;  4BY1 J;  3CF2 A;  3VIB A;  4XOT A;  3K8P C;  3KP6 A;  2DFI A;  4KIT B;  2XGD A;  2O0Y A;  4XID A;  1HC8 A;  1I39 A;  2F48 A;  2MFZ A;  4DIQ A;  4EJW A;  2VKD A;  1K61 A;  1VQK I;  4M3D A;  3JRA A;  2WAF A;  3RH2 A;  4HQM A;  4LB5 A;  2VT3 A;  4HF2 A;  2D2W A;  2D1V A;  2IGM A;  1JKO C;  4L18 B;  4G7H F;  2F4M B;  1FBQ A;  3DBR B;  5IOY A;  1F9N A;  4PJM A;  5GAG J;  3LA2 A;  2EIM H;  3QPH A;  3CDH A;  4RGS A;  3JR9 A;  2VKH A;  5GTH C;  4HF0 A;  3A1Y A;  5LEK A;  1VQ7 I;  1ORK A;  1SFX A;  4XKV A;  2Q1Z B;  2HFH A;  2QCO A;  2GBY A;  1H88 C;  1QVT A;  1K6Y A;  4F55 A;  3IUV A;  1D3Y A;  1YX5 A;  3VVY A;  1IXR C;  1E2X A;  3LFK A;  3DBH B;  2DJI A;  5J1R A;  1V4R A;  3S17 J;  2IW5 A;  2M30 A;  2VUM J;  4OWR B;  2E5Z A;  2IAI A;  3CJN A;  1J7K A;  4BDY A;  2CUJ A;  3LNQ A;  2P5L C;  3FIW A;  4ESB A;  3QRF F;  5E3O A;  5C4X J;  3RQI A;  2E19 A;  2M34 A;  2ZCM A;  2X1E A;  4G94 A;  2M7A A;  3R60 A;  2EIL H;  3K1P A;  3K4J A;  1GXQ A;  4XLH A;  1MZB A;  3CJQ B;  3CUQ B;  4ZC3 A;  3S93 A;  1LDJ A;  4EGZ A;  1RR7 A;  2ZJP F;  2KKO A;  1MMA A;  4AVZ A;  2QWW A;  3G56 A;  2V9V A;  3HG9 A;  4AYB A;  4HNT A;  4WXH A;  1T8I A;  3BTI A;  3I4P A;  2K02 A;  3PNV A;  2XIG A;  4ZTF A;  2QIB A;  2HOA A;  5FGM A;  2RRE A;  2XKO A;  4X1E A;  5ERI A;  4N4O B;  2L5Q A;  3H3U A;  3AL0 C;  4IQ4 A;  1BI3 A;  2QYO A;  2XPW A;  3GBG A;  2OZU A;  4IRG A;  1IN8 A;  3FF5 A;  5L3B A;  2CRG A;  3VPR A;  3L2C A;  3ECO A;  4ETS A;  3BG3 A;  3PFI A;  1G59 A;  4BNC A;  1WVR A;  1Y0U A;  2VQL A;  3S2H J;  4FCY A;  3BLY A;  1LJ9 A;  3QPT A;  4I98 B;  3ERE D;  3ZMD A;  2YX7 A;  5HLT A;  3OY9 A;  3R61 A;  1IXC A;  4AIH A;  4A3M J;  3TOB A;  3HZJ A;  4FAS D;  4R1H A;  5F04 A;  3ULQ B;  3HPG A;  2QVO A;  3FDY A;  2TRT A;  5HSZ A;  3DV8 A;  2UXX A;  2P7V B;  2M9H A;  5FRO A;  5DYM A;  2DA6 A;  4P55 A;  2L4A A;  5IYB J;  1GV5 A;  5E17 F;  4DYC A;  1ZR4 A;  1F1Z A;  1XMA A;  4AD9 A;  2C6Y A;  2LTP A;  3HGY A;  4HV5 A;  4XQF A;  3U21 A;  2WA0 A;  2DN0 A;  3ABM H;  1S7E A;  1PUF B;  4LK0 F;  4EMS A;  5J8F A;  3WTY C;  2JUG A;  1R1V A;  1KZH A;  3T8R A;  4AU7 A;  1IC8 A;  2NVX J;  4OMZ A;  3S3O A;  3E0J B;  1C0W A;  3ON4 A;  1U5T C;  3ABK H;  1TC3 C;  2I5U A;  4XLP F;  4PK4 A;  4CZC A;  5IYC J;  1BOA A;  3CC2 I;  2WWY A;  1JI8 A;  1OPC A;  2VQC A;  2DTR A;  2FE3 A;  2HYJ A;  3R4K A;  4D9J A;  5GPA A;  1E3P A;  4BXU A;  3H35 A;  4YEL A;  5ICC A;  3J7A Y;  4AID A;  3W6V A;  2O5R A;  2BXY A;  3SFI A;  3WOD F;  4YEJ A;  4DOZ A;  3BCG A;  3RZO J;  3VYT B;  2ZC2 A;  1IRZ A;  3BR3 A;  2W4S A;  5K5Q A;  3OWT A;  2V57 A;  3JRH A;  5KVR A;  1U0J A;  1O7F A;  4UUS B;  1JKQ C;  1S7A A;  3FK7 A;  3FMS A;  3DPT A;  3WHC A;  3OYD A;  3ZXS A;  4ZDO A;  1YO5 C;  2PZ9 A;  3BT9 A;  5C4J J;  3KEQ A;  3ZQG A;  2D6Y A;  2K5C A;  2LFB A;  2WY7 Q;  4EAT A;  1NG6 A;  5CVI A;  5AON A;  3DTE A;  2K40 A;  3CDL A;  2FF4 A;  2J5P A;  2W25 A;  1LDK B;  3BDD A;  2DFE A;  2RQP A;  3DLA A;  2R5Z A;  3IP4 B;  3SWH A;  4KFC A;  2EZH A;  5FD6 A;  3CCR I;  4MK6 A;  2EFP A;  5D8K B;  2QKL B;  1CGP A;  3LSR A;  1JGS A;  2R7Z J;  2FBH A;  3F22 A;  2B9S A;  2R92 J;  1WI9 A;  2UXN A;  3WGI A;  4RB0 A;  3OL3 A;  3JSO A;  2EZK A;  4EM1 A;  2XHK A;  2VB6 A;  5DV5 A;  1PUF A;  4BBR J;  3VYS B;  2FSW A;  1JHF A;  1R5G A;  3BQY A;  3KFW X;  2RDP A;  3DLL F;  4A6E A;  4DQ2 A;  3VOE A;  2FU4 A;  1HKT A;  3V7C A;  1XB4 A;  2DDB A;  1OKR A;  1F43 A;  4NBQ A;  5CVV A;  2R7R A;  2ZY9 A;  2ZXJ A;  3NAU A;  2PLY A;  2KJB A;  2DQR A;  2ZOZ A;  1ETX A;  4QLC U;  2UV1 A;  5DCM B;  1NTC A;  3FXJ A;  3HOU J;  1Z3Y A;  4I2O A;  3PPB A;  1RES A;  2W84 A;  1W5T A;  2PMZ N;  4JBA A;  2A2F X;  2CV0 A;  5HVQ C;  1I1S A;  2XF5 A;  5HOD A;  5E79 C;  3ZPL A;  1GV2 A;  2KRC A;  1QO0 D;  4FQG A;  3S3N A;  3NRV A;  3REO A;  4E7I A;  2WV1 A;  3PAS A;  1GDT A;  4BGD A;  2IP2 A;  3CCE I;  2V1N A;  2KPM A;  2V6C A;  4PJ0 C;  5FLX Z;  2JA7 J;  4EGY A;  1W1W E;  2R3S A;  2DFH A;  2H6C A;  3DKY A;  3MZ8 A;  3F21 A;  2O03 A;  1FSE A;  4RM2 A;  4YRV A;  2VQG A;  1I3Q J;  3EQL F;  3VDX A;  1YOV B;  4FX4 A;  1WGX A;  2LKP A;  2LY2 A;  2WAE A;  5CJ9 A;  2D5V A;  1XGN A;  4FET A;  1WSU A;  2X0L A;  3CES A;  1FX7 A;  3ZQQ A;  1BC8 C;  1D1B A;  2DOF A;  3KE2 A;  4GCK A;  1BI0 A;  1W7P B;  1LB2 A;  1T0F C;  1D8K A;  3E5U A;  4I0A A;  3WTU C;  2REK A;  1D0X A;  2EWN A;  2JZY A;  2CS3 A;  1MBK A;  2IEK A;  5CVU A;  4XRM A;  5CW8 A;  1MD0 A;  5F1R A;  1DDN A;  2GXG A;  2LF7 A;  2FOK A;  1B1B A;  1UJ8 A;  4FX0 A;  3TO7 A;  3L2W A;  3DTK A;  5E1Z B;  3TDU C;  1REP C;  1R71 A;  2VJ5 A;  5LHG A;  3VB2 A;  4CGR A;  1XCB A;  3EET A;  3LST A;  3CP8 A;  3GFL A;  4GYI A;  4LOC A;  1SC7 A;  1MMD A;  4MTE A;  3FM5 A;  3HSF A;  2FMY A;  2UXU A;  2DI3 A;  5BPD A;  5J47 A;  2FQ3 A;  2AHQ A;  2XAJ A;  4FE4 A;  4BKX A;  3G6E I;  2L7Z A;  5LFA A;  5DCM A;  4ZTJ A;  1YIT I;  2D1H A;  2LDU A;  1HA8 A;  2D45 A;  2EQR A;  1YX3 A;  2UXH A;  3MAJ A;  2V26 A;  2LY1 A;  2F6C A;  3NRG A;  1HSJ A;  1A6I A;  5EEH A;  4BJ6 C;  2L2O A;  2K9L A;  2OQR A;  4LIT A;  1MH4 A;  1MND A;  3F0C A;  5DUK A;  4P96 A;  4L5E A;  1MBH A;  1WCM J;  3I56 I;  3VOK A;  2IVM A;  3FXR A;  1FJL A;  4BAC A;  5JLX A;  5A2Q K;  2E7X A;  3QYE A;  2Z9O A;  2QQ9 A;  1R23 A;  1MIJ A;  4RAG A;  4JKZ A;  4NEL A;  2Z1D A;  2QQ8 A;  3BRO A;  2MGQ A;  4Q47 A;  3QOD A;  3E6D A;  1YQA A;  2FNA A;  1SMT A;  4BS9 A;  1IW7 F;  1R5H A;  1HDD C;  3E97 A;  2CFX A;  5F1J A;  5IY5 H;  1TWA J;  2BYV E;  2ID3 A;  3EUK L;  4OIP F;  4KT6 A;  1D5Y A;  3ZN0 A;  1E0E A;  2OA4 A;  5JHF A;  1YFH A;  2QSH X;  1XD7 A;  1LNW A;  4CH7 A;  2MLK A;  2RC4 A;  3KCC A;  2N8G A;  3ZN1 A;  4OD4 A;  3FK6 A;  4UNO A;  5F08 A;  2NNN A;  3OYK A;  4CCO A;  2BZT A;  5FKL A;  4WK8 F;  4WIB A;  2YSR A;  4FE7 A;  3FHZ A;  2V9P A;  1T2K A;  1GVJ A;  5FKK A;  5ICE A;  3RTR A;  1AKH A;  3HTU A;  3B6A A;  2BY1 A;  2M1B A;  4A6D A;  4ENJ A;  1KQ0 A;  2EA4 A;  2OAZ A;  1L0O C;  1IRF A;  1S29 A;  5K7F A;  1IJW C;  2M3A A;  4D5C A;  4WX9 A;  1APL C;  2XDN A;  1RI7 A;  3N97 A;  2NOJ B;  3K4N A;  2IS2 A;  3O6B B;  2OCC H;  1V54 H;  5GAE J;  4CHU A;  4HDU A;  5H9T A;  4Y15 A;  5L3E A;  3IAM 2;  2KT0 A;  2WTE A;  2R7U A;  2DYR H;  4NC6 A;  3GFJ A;  5E8I A;  3M1E A;  2R93 J;  4KIC A;  3FIS A;  4YIF A;  1VI0 A;  5EG0 B;  3WTS C;  4IRV A;  4BL0 B;  4JP0 A;  2DT7 B;  2DOA A;  4C3I J;  1FOW A;  2DOD A;  2ECC A;  1SVM A;  4Y13 A;  4RB2 C;  1EH6 A;  3S15 J;  2VJJ A;  2E2J J;  1ZTR A;  3QOP A;  4XBF A;  3SZP A;  1SMY F;  1MDM B;  1GLN A;  1YJ9 I;  3FXM A;  3WGH A;  2HOS A;  3AG2 H;  5D6E A;  5E3M A;  2M8G X;  2QUF A;  3HOY J;  1P92 A;  2M87 A;  2ISY A;  3I55 I;  3MZH A;  1IDZ A;  2F5F A;  5C4Y A;  2R4G A;  2W00 A;  4AVP A;  4LLN A;  5J1Y A;  4ZYD A;  4UUS A;  3I71 A;  2HKX A;  2COB A;  4IX7 A;  2FBK A;  4GGG A;  1W4M A;  2OTL I;  1VQ6 I;  3HKZ N;  5E1W A;  2A69 F;  1R6R A;  2ELJ A;  2DO7 A;  4IRH A;  1G6N A;  2YU3 A;  2CW7 A;  1ULY A;  2VON A;  1KU3 A;  4UVB A;  2RKH A;  4EVI A;  1MBF A;  1LEA A;  2WAD A;  4F91 B;  2ME6 A;  4KIG A;  1TP4 A;  3NWS A;  1OCR H;  5DCF A;  3HOS A;  1B9M A;  5CXI A;  3T6N A;  3IHU A;  1V55 H;  3NWT A;  2AQF A;  2RHA A;  4Z2Y A;  1OR7 A;  4PUS A;  4PJJ A;  1U6G A;  4MHG A;  4LLL A;  4WCG A;  1FC3 A;  4IHV A;  3GZ6 A;  5LGT A;  3DEE A;  1MBJ A;  2QEX I;  3CCJ I;  4XON A;  1A36 A;  2ZSI B;  3G71 I;  2IS1 A;  5FLM J;  1I3A A;  2CWE A;  3W2V A;  1K6O A;  1XGS A;  2EB7 A;  3ELK A;  2Y2Z A;  3WGG A;  3NPI A;  1I6X A;  2RV8 A;  1E3H A;  4GCT A;  2F5C A;  4OAY A;  1WJC A;  1WQ2 A;  3IWZ A;  4GRI A;  1JJ6 C;  1ETV A;  2CQ7 A;  1HST A;  3CTA A;  2MC4 A;  2OU2 A;  3S2D J;  3F8B A;  3OYC A;  1ZG1 A;  3S14 J;  3S3M A;  2CQQ A;  3KP7 A;  3BTL A;  1IGN A;  2WB1 N;  2DDA A;  3Q5F A;  2R0Q C;  2RAS A;  3WG9 A;  2K9N A;  2B0L A;  4BE1 A;  5HNF A;  1FPQ A;  5HS9 A;  2ZJR F;  4LG3 A;  4UDS A;  3O8H A;  1LVK A;  4W97 A;  4KA4 A;  2VI6 A;  1CF7 B;  3PL8 A;  4AF5 A;  1EV7 A;  2G7U A;  2MD0 A;  2XVC A;  4EM2 A;  3KKC A;  1OYI A;  3K70 C;  1OLT A;  3VOD A;  3F6O A;  2PEX A;  2CO5 A;  2RAE A;  2NS7 A;  3Q0W A;  1N75 A;  3K70 D;  1FSH A;  3BZ6 A;  3HSE A;  4JX5 A;  4A0Z A;  4DGW B;  2DLL A;  4ZJZ A;  2L54 A;  1I1G A;  2FEZ A;  4YG2 F;  1HW5 A;  1W7P D;  3IH4 A;  5LD2 C;  1H9T A;  1P2F A;  3HTH A;  1EKE A;  2M5W A;  2K4J A;  3OYB A;  3QWL A;  1W0T A;  3B73 A;  2KLO A;  1DQU A;  2CW0 F;  3BJO A;  3L2V A;  4IQJ A;  4CCM A;  2HOE A;  5HLI A;  1PJR A;  2ELH A;  4N9H A;  4L62 A;  4BY7 J;  2LK2 A;  3CC7 I;  2R7W A;  4AIK A;  1U5T B;  4HPQ A;  3BC8 A;  5ICG A;  2LH9 A;  2KFD A;  3J80 Z;  1LE8 B;  1BBY A;  1X4P A;  3CCS I;  1F36 A;  1MJB A;  1RIO H;  2GQQ A;  2CQK A;  3LSJ A;  1A35 A;  4KN7 X;  1D0Y A;  3O8G A;  1X58 A;  4C2M A;  1WFX A;  3OYH A;  4CCN A;  2PBX A;  5M3M J;  3LSK A;  3CP2 A;  3ISP A;  2DK5 A;  1J0R A;  1K78 B;  4HZF A;  5B1B H;  3SZG A;  1YJN I;  3ZMU A;  3GTO J;  3PSI A;  5K5R A;  3SXY A;  5FB2 A;  3DF8 A;  2Z16 A;  3BPV A;  4LFU A;  1W36 D;  2DOE A;  3TOA A;  1IN5 A;  1B4A A;  3A4C A;  1Z7L A;  4MQ9 F;  2W24 A;  4G6D A;  2R5Z B;  3VW2 A;  2A6T A;  5M5W J;  2HI3 A;  3HOZ J;  3IWF A;  1U9N A;  3BP8 A;  5FD5 A;  4QTR A;  1VQP I;  3F23 A;  2ZCN A;  1TZL A;  5EJC A;  4P9U A;  2GXA A;  4ESF A;  1OCT C;  2FA5 A;  4JL3 A;  3EUA A;  5DM7 F;  2DQL A;  5J1U A;  4RAY A;  2PG4 A;  4S0H B;  2GOM A;  2CV2 A;  4N9I A;  1S5L C;  3TO6 A;  4ZZL A;  5HLH A;  2VOD A;  2Y9Z A;  3V6G A;  1FYL A;  1WHU A;  5HLG A;  3IL2 A;  4G7Z F;  5TIS C;  3BR1 A;  4IHT A;  5DAJ A;  3UKG A;  2MA3 A;  2XPU A;  2OI8 A;  1TQI A;  3GCM A;  2CSO A;  3LSH A;  4L9N A;  1QHH D;  2A68 F;  1XX5 A;  3AG1 H;  1TWG J;  2P0W A;  2VXD A;  3FKJ A;  2P81 A;  2VKE A;  2LRE A;  3QYF A;  4A3I J;  3L2R A;  3NEU A;  1YS6 A;  5BQT A;  2X1D A;  3F8M A;  4MIM A;  4XK4 A;  4BBS J;  4UY8 I;  3H5R A;  1ETO A;  2ZFW A;  1U5T A;  3G1M A;  2LBF A;  1KON A;  5JLW A;  1R4M B;  4O6J A;  4CIC A;  4RM3 A;  3PJR A;  2VE8 A;  4M3G A;  4C9Y A;  1BW6 A;  3E7Q A;  1Q1V A;  5D5V B;  2XAS A;  4YFN F;  1BOB A;  3ZP5 A;  3V42 A;  3OL4 A;  1D8J A;  5HDN A;  2QSF X;  5DS9 A;  4PZJ A;  2OZ6 A;  3LL7 A;  5DUI A;  2LOO A;  3QKX A;  1PP8 F;  1ACI A;  1Z6T A;  4BQO A;  3HUG A;  5EF6 A;  1VQ9 I;  3QBM A;  3PM1 A;  3BCB A;  1UG2 A;  4KIF A;  3VSL A;  2O7O A;  2JUC A;  1LQ1 A;  5IOZ A;  4XM3 A;  3HGG A;  3K4L A;  1U78 A;  3U9G A;  1SFE A;  3OYM A;  3MEX A;  5HS8 A;  3K6G A;  4II3 A;  1SFK A;  3J80 K;  3OR2 C;  3H3V K;  3OIO A;  5BNG A;  1JJ8 C;  2E35 A;  1XPX A;  3M8F A;  3RKX A;  5DTD A;  3DPU A;  1DGR M;  1U2W A;  2A05 A;  2PQ8 A;  1YG2 A;  1PYV A;  1WJ5 A;  2FNP A;  5C44 J;  4R8H A;  4LIV A;  1KGS A;  2XRN A;  4U0V A;  1MNM C;  1ZRC A;  2XAF A;  1VZ0 A;  4D1Q A;  3MMY B;  3TO9 A;  3HJE A;  3D5S C;  3L2Q A;  3JRI A;  5EGO A;  5AQC A;  1QPM A;  2XB5 A;  4IJA A;  3KZI C;  1JTX A;  1ZLK A;  1JUS A;  1EA3 A;  2OBP A;  2R7T A;  2CUZ A;  4BH9 A;  4UB6 C;  2H6B A;  5AIP A;  4OU0 A;  4ICH A;  1O3T A;  2XUB A;  3C2G A;  3CCM I;  1U3E M;  3AKZ A;  2CW8 A;  2JK3 A;  3VVX A;  5FKN A;  4OAZ A;  3MKZ A;  1UB9 A;  2HU9 A;  1Q1H A;  4E7S A;  2ZME A;  2A61 A;  4L9T A;  3ZQF A;  2JA6 J;  1FZP B;  5H2F C;  2FOW A;  4HRI A;  1MH3 A;  2HXI A;  3HM5 A;  3HOT A;  3GTQ J;  5IP7 J;  4B8X A;  2WV0 A;  3W2W A;  3MCZ A;  2P5V A;  4DNC A;  3SYT A;  3D5L A;  1MSF C;  1YW9 A;  1WPK A;  2HPM A;  1ZGW A;  1TTY A;  2FBI A;  2ICW G;  2V1U A;  3LSI A;  3SEQ A;  3E6C C;  4DZP A;  4FTH A;  2KHM A;  2DT6 A;  3HUG B;  1KU7 A;  4EJV A;  4CCK A;  3AG4 H;  4IF4 A;  3CD6 I;  2VL8 A;  3SEZ A;  3HC7 A;  3D1N I;  4LG0 B;  1WJF A;  4BUP A;  1NK3 P;  4QSH A;  4PJN A;  4CXF A;  4O3M A;  3LA7 A;  1BR4 A;  5EFY A;  3A01 B;  3H92 A;  1FTZ A;  1SAU A;  1R00 A;  2QWT A;  4DYR A;  2Z99 A;  1HQC A;  2MH9 A;  1YHQ I;  4EJT A;  2B63 J;  2HQA A;  2KQR A;  2MLG A;  3S5R A;  3GTJ J;  3HRU A;  4X6A J;  4MFE A;  4BEH A;  4KDP A;  3RYP A;  3OYN A;  3O3K A;  3RJP A;  4BXX J;  3E1S A;  4NB5 A;  4LLG F;  3F9K A;  4BQN A;  3D0S A;  2ZCX A;  3L09 A;  2VJI A;  2G7L A;  3VW0 A;  3JAM Z;  3MFK A;  1TL8 A;  4G12 A;  1KU9 A;  2R5Y A;  2ZB9 A;  1SVL A;  3JAM K;  2ISZ A;  1BW5 A;  4M9Z A;  4WXC A;  1OQY A;  4IHY A;  2PBI A;  4RBO A;  3GTK J;  1ZRD A;  4E6K G;  2Z3Y A;  3K1N A;  2M45 A;  4G8X A;  4RGR A;  4H0E A;  3BJB A;  3E6M A;  2EV5 A;  2FQ4 A;  3S32 A;  3SHF A;  3VTI A;  2DK8 A;  2EV6 A;  4QPO A;  2NNY A;  4FIS A;  4GCL A;  1UST A;  5B1A H;  2FBQ A;  2XSJ C;  1FOK A;  3Q0U A;  2QKM B;  3RPU D;  1UEL B;  1Y1V J;  2WAQ A;  4WXD A;  2DCE A;  3G1L A;  3X2Q H;  3MD2 A;  3PQK A;  3FWE A;  1L3L A;  1ZGJ A;  1A6Q A;  2LKS A;  4XN3 A;  2NVU B;  1FTT A;  1QNT A;  2JA2 A;  1LPQ A;  2MAB A;  5KNL A;  3AL0 B;  4IOC F;  5CXG A;  3C2H A;  3K69 A;  4M9X A;  2HVS A;  2V4J C;  1UHW A;  2YR2 A;  6PAX A;  3JRF A;  5CQG A;  3F1B A;  5GPC A;  2P7C B;  4G6Q A;  3NS4 A;  3JSP A;  1IV8 A;  2K3P A;  2M0C A;  3J7A O;  5F6F A;  3QYB A;  1OFC X;  4JX6 A;  2Y48 A;  4PCQ A;  3JTG A;  1JKP C;  2EH3 A;  2VBX A;  1QQI A;  3LQQ A;  2GA2 A;  1RRJ A;  5K58 A;  1S9H A;  1D1A A;  2ELK A;  4C2M J;  2AS5 F;  3TW6 A;  1I6H J;  3MWM A;  1LDD A;  1SAN A;  1T08 B;  4MNU A;  3WTT C;  5D5U B;  2ETH A;  2KZG A;  4AIJ A;  2STW A;  1BI1 A;  1G2H A;  1MJA A;  4JQF A;  1WKM A;  4BAY A;  3BRU A;  5GAH J;  3FMQ A;  2LG4 A;  2XSD C;  2MYS A;  2VIX A;  2FX0 A;  2OTJ I;  2UXI A;  1K4T A;  5EEG A;  2NS8 A;  2PJP A;  2H1L A;  2XAH A;  3V8L A;  2GFN A;  1LVA A;  1QGP A;  3PO3 J;  2E1C A;  2KMU A;  1K79 A;  3HRS A;  2IA2 A;  1JT6 A;  4W1U A;  2O61 A;  1B6A A;  3M8E A;  2BEO A;  2X85 A;  3LJL A;  2HR3 A;  3CC4 I;  5M5X J;  4U87 A;  3OYF A;  2IS4 A;  2JTV A;  2V1X A;  3O60 A;  3BTC A;  1KU2 A;  4E7L A;  2GIV A;  4RAF A;  2HEO A;  2XB0 X;  1UFM A;  2VXZ A;  1ZEL A;  3C18 A;  3IV5 A;  4BDZ A;  1MBE A;  4ZYH A;  3M3Y J;  3DU6 A;  2JRT A;  2MW8 A;  4II2 A;  5JHU A;  4UV8 A;  1J75 A;  2R7O A;  1ITY A;  1FIA A;  3I3L A;  2ESN A;  3FXO A;  4C3J J;  2CG4 A;  5GTI C;  4XIC A;  3K1M A;  5K7H A;  3LQR A;  3PIP F;  1R36 A;  1WWX A;  2E7W A;  4UB8 C;  4M71 A;  1STZ A;  1BJZ A;  2GWR A;  3FZV A;  3M4O J;  2NP3 A;  1KYW A;  1RZ4 A;  5FFX A;  2XV4 S;  2V79 A;  1B8I A;  1R1U A;  5FRN A;  1ZK8 A;  1AHD P;  2E34 A;  2M4G A;  1T6S A;  2EK5 A;  4I0B A;  1H8A C;  1AOY A;  2EBI A;  3DPL C;  2V6E A;  4A3E J;  2HS5 A;  3HBL A;  1TWF J;  1JHH A;  4ASN A;  2LKX A;  3OYG A;  2HQR A;  2HZT A;  2QLZ A;  2ZCW A;  3VYR B;  2LYC A;  1SD5 A;  2OCE A;  2HDW A;  2PN6 A;  1IZ1 A;  3RZD J;  5K7Z A;  3G1O A;  3OSF A;  1HF0 A;  1B9N A;  2GEN A;  1CQT A;  5A2Q Z;  4E7J A;  2L0K A;  1BIA A;  4UVC A;  2Y30 A;  5IT3 A;  3HOX J;  3RKQ A;  1UHM A;  2W53 A;  3I4M J;  4N0B A;  4D7M A;  1ZR2 A;  2IXS A;  1IUF A;  3GTM J;  1PVE A;  1SD7 A;  3P9I A;  4XLF A;  2K3F A;  2Y0S N;  3RPQ A;  3HSR A;  2ZXH A;  1GT0 C;  4BE2 A;  2X6O A;  3P9K A;  4JK1 X;  4OD5 A;  3H0D A;  2DMN A;  2L02 A;  1X3W B;  2NVT J;  1TW2 A;  1JGG A;  4PSX A;  1IG7 A;  3B6C A;  1P7J A;  5FMP A;  2BY0 A;  1W36 C;  2EIJ H;  3K7A J;  4JYK A;  2EJR A;  3IC7 A;  2VBY A;  2DG8 A;  3I59 B;  4A93 J;  2FJ1 A;  2VQH A;  2GA1 A;  3RSN A;  1H89 C;  1QZZ A;  2ZXI A;  3ZGK A;  1DP7 P;  2EFO A;  1IF1 A;  1QVU A;  3V7S A;  2A5Y B;  2DMT A;  4L5I A;  1R7J A;  1FY7 A;  1Z0X A;  1IV6 A;  4F93 B;  4J19 A;  3MKL A;  4LGW A;  4BHB A;  3ZQC A;  5FKO A;  2Z33 A;  1Y6I A;  3ANP A;  4A5N A;  4YZE A;  1ZQ3 P;  4U0W A;  4XLC A;  4ENK A;  5HOO A;  2HYT A;  3LOC A;  3CME I;  2NRA C;  5IP6 A;  1TNS A;  2NAZ A;  2XGC A;  4E70 A;  2YS9 A;  3SQN A;  4BYY A;  1X1P A;  1RET A;  3HE0 A;  1WI3 A;  2HNH A;  2DAO A;  4RB3 C;  2E71 A;  1VF9 A;  2VBZ A;  3EPZ A;  2NOG A;  3M07 A;  4RS8 A;  3H9G A;  4Y17 A;  4BJT A;  2JPC A;  1Y56 A;  4HW0 A;  4RAZ A;  3RKW A;  4UUV A;  2Z5U A;  3JSJ A;  3GZI A;  1D0Z A;  4E4H A;  3U2R A;  1TT0 A;  2GZW A;  4GO1 A;  4LK1 F;  2VC1 A;  3FX3 A;  1HXD A;  3HHH A;  3IH3 A;  1UI5 A;  2H8W A;  4BE0 A;  1QPI A;  4BHC A;  2VN2 A;  3HTJ A;  2VPL A;  1X1D A;  2M2E A;  1OJL A;  2BVM A;  3BHQ A;  4XSZ F;  4B43 A;  3GX4 X;  1RUO A;  1ZLJ A;  1LFU P;  3SDG A;  2DPD A;  5BPI A;  2R7D A;  4HBL A;  2I8D A;  3GWZ A;  4A12 A;  3TBI A;  2GUH A;  5JI6 A;  2XAU A;  2L7M P;  1LEB A;  5H6Q A;  3V8J A;  3A02 A;  3AG3 H;  5JVT A;  5EEA A;  3CCL I;  1IN4 A;  4HQE A;  1K7A A;  3ZQ7 A;  4R79 A;  5D4R A;  4PJL A;  4HNU A;  3H9J A;  3GW2 A;  1GVD A;  5FJ8 J;  2M0M A;  2GXB A;  1FBS A;  2OD5 A;  3KX2 A;  3W3C A;  1X3Z B;  3ROU A;  3SDB A;  4F92 B;  4IVN A;  3W6K B;  1ZGA A;  2A5W A;  1YI2 I;  5H20 A;  1BM9 A;  3HYI A;  4NQW A;  4ABZ A;  1WJB A;  1MGT A;  2HQ5 A;  3DEU A;  2VAS A;  4X0G A;  4C30 A;  1FEX A;  3TP0 A;  4XKC A;  3M1C A;  3CMM A;  4J00 A;  3PO2 J;  2M8E A;  2DT5 A;  4DBR A;  1T33 A;  1VND A;  4KT5 C;  3BG5 A;  3C1D A;  2E1O A;  1Y8R B;  2ZSH B;  4P9F A;  2L4M A;  3P5J A;  1FYM A;  2LBF B;  3Q9S A;  2E1M C;  2KRF A;  3I4N J;  2JVG A;  2JQ7 A;  3ZR8 X;  3CZ6 A;  2H8R A;  2BHZ A;  5C3E J;  4U9L A;  4Y52 J;  3ZQI A;  4A3F J;  1DU6 A;  3QPL A;  3NNR A;  3KPH A;  3OYE A;  2X6W A;  4K2E A;  4E7K A;  3FXQ A;  2GM4 A;  4S05 A;  1ZN2 A;  2NXN B;  4J01 A;  1ETK A;  4PGH A;  4U7D A;  1BN5 A;  1Z7U A;  4M3E A;  4PSW A;  1F4K A;  2B1E A;  3K4C A;  4XR6 A;  4A2U A;  1GUU A;  2IT0 A;  1SAX A;  3ON2 A;  4HA8 A;  3CRJ A;  3WTW C;  2B3W A;  5BOX A;  3N4M A;  2ZNY A;  2E1N A;  2ZME B;  5CPR B;  2E5N A;  4QIW N;  3CDI A;  4NDL A;  2PI0 A;  1Z1D A;  2VPR A;  2DMQ A;  3MN2 A;  2EZI A;  3GO5 A;  2DA3 A;  3K4M A;  5D4S A;  4ZYG A;  1YW7 A;  1MMN A;  3KEY A;  5LEJ A;  1YTY A;  3K4K A;  4S04 A;  3V78 A;  3U1D A;  1YIJ I;  2HYF A;  1RC9 A;  2RGV A;  3DWL E;  2X4H A;  1TWC J;  3EYY A;  1MBG A;  1SD6 A;  3LAJ A;  2V9K A;  1DUX C;  1JXS A;  2EA2 A;  2YX4 A;  3CJD A;  3PUB A;  3ZOB A;  4KIS A;  2FJI 1;  3W6J B;  2ZBK A;  2ZO4 A;  2KIF A;  2DMU A;  2RVC A;  1XCV A;  1TLH B;  4KUM A;  4CA0 A;  1ODD A;  2E36 A;  2OV7 A;  3TDZ C;  2Y31 A;  3LWJ A;  3JRD A;  4I99 C;  3O2P E;  3P9C A;  2MH2 A;  1KQ8 A;  2ESH A;  2X6X A;  3KP2 A;  2V1D A;  5LGU A;  1Z6R A;  4M9S A;  3JRC A;  3GVA A;  3HB9 A;  4B09 A;  4LIU A;  4KYW A;  4OMY A;  1S6L A;  2HKU A;  3EUP A;  5TJJ A;  3H36 A;  4NUB A;  3OMY A;  2LVS A;  3M9A A;  5CVJ A;  4IHS A;  4Q4Z F;  2GLO A;  2XDV A;  4ZDL A;  3H9Q A;  1WJD A;  2KIQ A;  2K27 A;  4E7Z A;  3OYI A;  2W7N A;  4ENN A;  1VQN I;  4Q5S F;  5CYV A;  4CO8 A;  3BQZ A;  4BXF A;  1OMI A;  4CCL A;  1IAW A;  1EJ9 A;  4D5F A;  3DP7 A;  4GCV A;  1VQM I;  3E6B A;  2VOP A;  1X19 A;  1YYV A;  1BI2 A;  5EZG A;  4ITV A;  4A3D J;  4L9J A;  1T56 A;  3QPS A;  1Y39 A;  2DU9 A;  2QZ8 A;  1OCO H;  4YIR X;  4HEA 2;  3LHQ A;  1R58 A;  1K4S A;  3HHG A;  4U9N A;  2JPB A;  3HL2 A;  3OSG A;  5L3G A;  3GFI A;  1V5E A;  4ZYE A;  1J2X A;  3AQT A;  2NX4 A;  2WBM A;  2F2E A;  2IS6 A;  2HGC A;  1ON1 A;  4L0Z B;  3DFG A;  5DDG A;  2NVQ J;  1Z9C A;  3KLN A;  3QU3 A;  2CQX A;  1G4D A;  1TNT A;  2DYS H;  4PXI A;  3DEW A;  4XSX F;  5B66 C;  1CF7 A;  2ZME C;  5ED4 A;  3T8T A;  3WU2 C;  4F52 A;  2ADU A;  2ID6 A;  4ENM A;  1BR2 A;  2HVQ A;  3S1Q J;  2DA1 A;  4IKF A;  3JTH A;  2JA8 J;  1WJE A;  4B3X A;  3GZN B;  2BY2 A;  3GTP J;  2PX9 A;  2W85 A;  4ESJ A;  3KYC B;  3MVP A;  3VW1 A;  2B7E A;  3HPH A;  4LG0 A;  3C07 A;  3MQ0 A;  2Q0O A;  3G7R A;  2XKP A;  2RNG A;  3RPU A;  3M8J A;  1EH7 A;  3J7Y J;  3PIO F;  5KCM A;  3OS1 A;  4PFP A;  1R22 A;  1YJW I;  4DZJ A;  1XC5 A;  4RGX A;  5FRM A;  3HEF A;  3ABT A;  4IOA F;  1PDN C;  4XMY A;  4QWQ A;  3D5R C;  2F5D A;  3IRQ A;  2G7G A;  4MFD A;  1LFP A;  1XMX A;  5J3L A;  5LBQ A;  2ECB A;  3I54 A;  1FMV A;  4B1R A;  1X4O A;  2L9R A;  3S1M J;  4QPQ A;  4BQQ A;  4CSW A;  2E2I J;  2W57 A;  2HXO A;  3EUH A;  2F5E A;  1VQ5 I;  4IRI A;  4UV9 A;  2H09 A;  1JT0 A;  2BW3 A;  4HOB A;  3L00 A;  4AYB N;  3ASN H;  5LRS A;  4M74 A;  4NC8 A;  3CCQ I;  2TDX A;  1DPU A;  1P4A A;  4HSR A;  4OIR F;  4A0Y A;  2JWT A;  4NN1 A;  1F5T A;  1S3J A;  4RLF A;  3VOX A;  3DQV C;  3A2K A;  4NC7 A;  4OIO F;  1Z3X A;  2K9S A;  4YFX F;  4XRF A;  3DU5 A;  2LP0 A;  3B81 A;  1NG7 A;  3WE3 A;  4HST A;  1WJA A;  2Y69 H;  1OCZ H;  5EZH A;  3HTI A;  1XGO A;  4Z6Y A;  1V3F A;  1ZAO A;  3IAS 2;  3Q0V A;  2DA7 A;  4A3C J;  2KIS A;  2AO9 A;  3F8N A;  2EIN H;  1MDM A;  1U8R A;  1J09 A;  3R0J A;  2OER A;  2IJL A;  3ANG A;  3BOQ A;  3VFZ A;  2QF7 A;  4Y4R A;  3Q3S A;  4XLE A;  3EUH C;  3WTZ A;  1FMW A;  2AQE A;  3KP5 A;  2QQA A;  5E20 A;  1TQP A;  2Y0M A;  3LA3 A;  2WGB A;  3IKV A;  2K4B A;  4NNJ A;  3WHB A;  1ZG3 A;  2HQN A;  5GP9 A;  2I10 A;  1QHG A;  3BZC A;  3H3Z A;  4HV6 A;  4HNV A;  2PJR B;  5ICF A;  4HF1 A;  4PGG A;  3PQJ A;  1WH7 A;  1IUY A;  3C7J A;  5B5E C;  3F8C A;  4F7Z A;  1PP7 U;  3ZMS A;  4KMU X;  4C2T A;  3W2A A;  4KIB A;  2ZNZ A;  2G0E A;  1I50 J;  2P5K A;  4L5J A;  1FLI A;  4A5M A;  3CLQ A;  4IEJ A;  2O3F A;  3SJM A;  2L3D A;  3S1R J;  2QGU A;  4L9V A;  2OF7 A;  2LF8 A;  2DTZ A;  2K7L A;  5EG0 A;  3G73 A;  5L3C A;  2HDC A;  3H5N A;  3Q9V A;  2GIZ A;  5HS7 A;  3CMA I;  2FUG 2;  4B4C A;  3VUQ A;  1PUE E;  2BV6 A;  4XLA A;  1QBJ A;  4ACI A;  3E5X A;  4XKB A;  1IN6 A;  3I64 A;  2DXI A;  3A01 A;  1O57 A;  5H6R A;  5L3D A;  3B02 A;  3WU0 A;  4M6X A;  4CYD A;  3G4S I;  3DKW A;  3LSM A;  4GFK A;  2H1K A;  3TMO A;  2E1M B;  3FBI B;  3N05 A;  2CH0 A;  3FBN B;  1BA5 A;  5J6X A;  5LHH A;  1ONV A;  1HBX G;  3AFH A;  2HTJ A;  1NK2 P;  1ZYR F;  1VQL I;  3HIF A;  4NHJ A;  2BE5 F;  2IGO A;  4AC6 A;  3CCV I;  3BWG A;  2YVE A;  4GYG A;  4MO7 A;  3RCO A;  2CYY A;  4FT8 A;  2L01 A;  1QU3 A;  5M3F J;  1H0M A;  5GAD J;  5KK1 A;  3J81 Z;  3ZQH A;  4UVA A;  2HKO A;  3K0L A;  1OIS A;  4M3F A;  2EPF A;  2R7X A;  2DFF A;  3LSG A;  1ETQ A;  1DP3 A;  2ZJ2 A;  3ABL H;  2DA5 A;  2LY9 A;  1USS A;  1XSV A;  3BR0 A;  1EH8 A;  3TW7 A;  4HX7 A;  2DW4 A;  2IPQ X;  3ONQ A;  3GZ5 A;  1U9O A;  1HW1 A;  1FWZ A;  1KA8 A;  2R5Y B;  1N78 A;  2ZKZ A;  3GEU A;  2KRH A;  5IPA A;  3BY6 A;  3C3W A;  4Q48 A;  4Y3O A;  2WUI A;  2WC2 A;  3R6S A;  2Q24 A;  2QEN A;  4RA2 A;  5D8L B;  3FXL A;  3T1B A;  1YW8 A;  3F6V A;  4RGU A;  2XPV A;  2QKO A;  3TL4 X;  2XC7 A;  4XN0 A;  4AWX B;  2BHY A;  2FML A;  1OYY A;  3V8K A;  4HKU A;  4XOR A;  3ZMT A;  2ZJQ F;  3CWR A;  3OOU A;  3KNW A;  3BG7 A;  1BR1 A;  3TED A;  2JA5 J;  2HWV A;  1SEU A;  3OYA A;  1G8X A;  1JUM A;  3DKX A;  1XSX A;  1TQM A;  2XF6 A;  3SZT A;  1W5C C;  3A03 A;  5J4V A;  4B3A A;  5DD4 A;  4YFK F;  1JKR C;  2PMU A;  3OOP A;  3F8F A;  3L1P A;  2EZL A;  5FFZ A;  2RN7 A;  2G3B A;  5E3N A;  3P7N A;  4U88 A;  4XRS A;  3K2A A;  3FXU A;  1ENH A;  4M6V A;  3OS0 A;  2F4I A;  3ZRG A;  4LB6 B;  1I5Z A;  3CO6 C;  1ON2 A;  4HX4 A;  3K10 A;  1V5F A;  4HG2 A;  1A5J A;  2OUM A;  4PDK A;  1OR7 C;  3KZ9 A;  1X2N A;  1Z21 A;  1N25 A;  4BU2 A;  1QZY A;  1W7P A;  2G7H A;  3IH2 A;  3ERM A;  4GXO A;  5IT9 Z;  3L9F A;  3PUF A;  5CQE A;  5EDN A;  3RD3 A;  1B8I B;  2LD5 A;  1K78 A;  3CJR B;  4P5O A;  4KWA A;  3JW4 A;  1FP1 D;  3DXJ F;  4I76 A;  5HDG A;  3HOV J;  2L7F P;  1W5S A;  3BG6 A;  1B72 A;  4GFL A;  5DEQ A;  4A3J J;  2OQG A;  2XF7 A;  1QRY A;  3E3V A;  5IP9 J;  4XRS G;  1IRG A;  2AXT C;  3MKW B;  1J9I A;  3GME A;  2XRO A;  3WTX C;  2KIU A;  1G3W A;  5HBU A;  3J81 K;  2UXP A;  1P6R A;  2LNB A;  1P9Q C;  5JFR A;  3MZY A;  1MKM A;  5IT9 K;  1T39 A;  4B47 A;  3RDI A;  1BL0 A;  4MXM A;  2A6H F;  2Q8K A;  1ZG5 A;  2LR8 A;  4OIN F;  4BEH B;  2ZOY A;  4DVY P;  2OJE D;  3FM3 A;  5ILU A;  3QAH A;  3TP3 A;  5E1X A;  5LHI A;  3ML6 A;  1EF4 A;  2J5O A;  1A04 A;  4RMN A;  2BGC A;  3CLO A;  1LFB A;  2X1C A;  3BR6 A;  3QU6 A;  4MEY F;  3KKD A;  3J7Z I;  3GLX A;  3ABU A;  1XDS A;  4RB1 A;  4M72 A;  3E5Q A;  4A3L J;  5F64 A;  2F4O B;  2STT A;  3GUD A;  5TRD A;  1RNL A;  4I7H A;  2FRH A;  4HAM A;  5F0H A;  1HKS A;  2XAQ A;  5BMZ A;  1ZAR A;  2K86 A;  2UXO A;  1S72 I;  2L9N A;  4CYC A;  2G7S A;  5D18 A;  5BS6 A;  2HDD A;  2MG4 A;  3HIM A;  1GXP A;  2EFN A;  1W0U A;  3BCA A;  3RI4 A;  1FBU A;  5E8G A;  3A0H C;  3S1N J;  2K85 A;  2CQN A;  2IGK A;  1RR8 C;  3C2B A;  4CZZ A;  4EEF G;  4P1W A;  1XDU A;  2VLA A;  1XSD A;  1G3T A;  4IXA A;  4FHT A;  1SGM A;  2MC3 A;  2O6G E;  5J4Y A;  4MGR A;  3CMY A;  1LUJ B;  2XGX A;  5KHD A;  3EDP A;  2CV1 A;  5KAF C;  2O8K A;  4AM3 A;  2QSG X;  2YU9 J;  3EGQ A;  5KAI C;  2HYG D;  1YE9 A;  3LWF A;  3IRR A;  4PFO A;  3I0T A;  1POG A;  2P6T A;  4I01 A;  1XS9 A;  1ZKG A;  2RNJ A;  5FO5 A;  2XGE A;  2R7Q A;  5M5Y J;  3ZMV A;  1VQO I;  1JUP A;  1HW2 A;  5K5O A;  3BZK A;  2R7S A;  1S8N A;  3FMR A;  2VJ4 A;  5J8C A;  5CLS A;  5HAW A;  1TW3 A;  4H4K C;  2PJR A;  2IA0 A;  1MMG A;  5D19 A;  1O3Q A;  3BPX A;  3OYL A;  2W82 A;  3KET A;  4V2F A;  2UUZ A;  5DM6 F;  3MKY B;  1NH3 A;  3BJA A;  2NP5 A;  1FOX A;  2H27 A;  3F72 A;  3L7W A;  2GOX B;  4EQQ A;  3I53 A;  2CGP A;  2VBW A;  4XNF A;  3HDD A;  5E3L A;  1R49 A;  4UHT A;  2P8T A;  4CDG A;  1RKW A;  4V2G A;  5EGO B;  2K9M A;  4A3B J;  1Z05 A;  3VP5 A;  1P4X A;  3WTV C;  2A07 F;  2UWM A;  3H5A A;  3RIR A;  2ZFU A;  4XL9 A;  1Z91 A;  1BIB A;  2DA4 A;  2KL4 A;  4M6Y A;  1DPR A;  3VYU B;  1T38 A;  2R7F A;  4OOI A;  3P9T A;  4I09 A;  2CUF A;  5JVG F;  2ZXW H;  5FLX K;  3I59 A;  1FP2 A;  4DW6 A;  2CFO A;  3I5U A;  3K9T A;  2MD5 A;  4MLO A;  1T98 A;  3H1C A;  2ME0 A;  1X1A A;  4M3B A;  3KZZ A;  3PSF A;  3CF5 F;  1M1E B;  4ME9 A;  3ZMZ A;  2W1O A;  2IGN A;  2KZV A;  1IRX A;  4UUT A;  3TGN A;  1V5G A;  3DCF A;  3JRB A;  4CGZ A;  1YIO A;  2X48 A;  4AC0 A;  3DPJ A;  3JRE A;  1R9T J;  2DPU A;  1OYW A;  3NXC A;  4GFB A;  2PFB A;  3RQ4 A;  3QOE A;  5EYR A;  3VEP A;  3HTS B;  1RPW A;  4KN4 X;  4LD5 A;  2LC2 A;  1ZH5 A;  4Y33 A;  3G2B A;  4DBQ A;  1IXS B;  1JE8 A;  1X2M A;  3CUQ C;  1E17 A;  3FKI J;  2DJN A;  1TWH J;  2JMW A;  2TCT A;  2JSC A;  1YLF A;  1ETW A;  1MNE A;  3FRQ A; 
#chains in the Genus database with same CATH homology
 4A3G J;  2ZOZ A;  5IYD J;  1ETX A;  1WPK A;  1ZGW A;  1NTC A;  3S16 J;  2NVQ J;  1HDP A;  1P7I A;  4DZP A;  3HOU J;  2CQX A;  4D7N A;  4FTH A;  1B72 B;  1HLV A;  2E2H J;  3PPB A;  1RES A;  4PXI A;  2PMZ N;  4I6Z A;  3D1N I;  5D1R A;  3DEW A;  1NK3 P;  4QSH A;  4JX4 A;  5HOD A;  2YUS A;  2ID6 A;  1GV2 A;  3S1Q J;  2DA1 A;  5EFY A;  2MSY A;  3A01 B;  2JA8 J;  2WV1 A;  1UHS A;  3GTP J;  1GDT A;  1FTZ A;  3NI7 A;  3PAS A;  2JA7 J;  2QWT A;  4DYR A;  3MVP A;  3VW1 A;  2CJJ A;  2B63 J;  3C07 A;  3S5R A;  3G7R A;  3GTJ J;  2QTQ A;  1I3Q J;  4X6A J;  4MFE A;  1WGX A;  2D5V A;  1IDY A;  2X9D A;  2F07 A;  1OCP A;  4BXX J;  5F0C A;  4DZJ A;  1K83 J;  1XC5 A;  2ZCX A;  2G7L A;  3VW0 A;  4GCK A;  3HEF A;  2REK A;  4G12 A;  9ANT A;  2R5Y A;  2ZB9 A;  4JNN A;  1ETY A;  1BW5 A;  1MBK A;  2IEK A;  4IHY A;  4MFD A;  2G7G A;  5J3L A;  4XRM A;  4RBO A;  2ECB A;  5FKM A;  3GTK J;  5CW8 A;  4B1R A;  1JTY A;  2L9R A;  3S1M J;  3BJB A;  2E2I J;  2HXO A;  2FQ4 A;  3NAR A;  4GCL A;  4CGR A;  4FIS A;  1JT0 A;  5FGL A;  1RKT A;  2NVY J;  2FBQ A;  3Q0U A;  4LOC A;  4AYB N;  2DA2 A;  4IHX A;  1Y1V J;  2UXU A;  3G1L A;  2AHQ A;  4FE4 A;  4BKX A;  2JWT A;  2L7Z A;  4DYQ A;  1FTT A;  4NN1 A;  1E3O C;  3VOX A;  1UMQ A;  1AU7 A;  5CXG A;  2EQR A;  2UXH A;  2YVH A;  2K9S A;  3NRG A;  3B81 A;  2LP0 A;  3JRF A;  1A6I A;  2DG7 A;  5EZH A;  3F1B A;  3HTI A;  5GPC A;  3VVZ A;  1MH4 A;  2K9Q A;  3F0C A;  3BG9 A;  4L5E A;  2M0C A;  1MBH A;  3Q0V A;  1WCM J;  2DA7 A;  3GTG J;  4A3C J;  3VOK A;  1OFC X;  4JX6 A;  2AO9 A;  1FJL A;  5JLX A;  3CQZ J;  2OER A;  1JKP C;  2EH3 A;  3ANG A;  2LLK A;  2QF7 A;  3Q3S A;  5K58 A;  4Y7N J;  2WAQ N;  2ELK A;  4C2M J;  5F0F A;  1LE8 A;  3TW6 A;  1I6H J;  4JKZ A;  4NEL A;  1SAN A;  2MGQ A;  2WGB A;  3WHB A;  5F27 A;  5GP9 A;  2I10 A;  4HNV A;  1G2H A;  1HDD C;  5F1J A;  1WH7 A;  2QOP A;  1TWA J;  2ID3 A;  3BRU A;  1D5Y A;  2XSD C;  3BR2 A;  3E7L A;  1Z77 A;  2FX0 A;  3LSP A;  2UXI A;  2NS8 A;  2GFN A;  2IU5 A;  2N8G A;  3PO3 J;  3FK6 A;  5F08 A;  3BR5 A;  2KDZ A;  5FKL A;  2G0E A;  1I50 J;  3GTL J;  2FD5 A;  1JT6 A;  2W48 A;  4W1U A;  4FE7 A;  4IEJ A;  5FKK A;  3LJL A;  1AKH A;  3MNL A;  3SJM A;  3B6A A;  3S1R J;  5M5X J;  3O60 A;  1SFO J;  2CU7 A;  2OF7 A;  3BTC A;  2DTZ A;  5EG0 A;  3AQS A;  5K7F A;  1IJW C;  4D5C A;  1APL C;  2XDN A;  4B4C A;  3VUQ A;  2XB0 X;  3HTA A;  4A3K J;  3IV5 A;  4CYC B;  1MBE A;  1WH5 A;  3M3Y J;  5H9T A;  2CUE A;  2MW8 A;  4ACI A;  1O4X A;  1MSE C;  2O7T A;  2KT0 A;  3A01 A;  1ITY A;  1FIP A;  1YRN B;  1FIA A;  1VFC A;  2R93 J;  4C3J J;  3FIS A;  5EG0 B;  1VI0 A;  4XIC A;  5K7H A;  4GFK A;  4JP0 A;  1XG1 A;  2H1K A;  1UI6 A;  4C3I J;  1BA5 A;  1BJZ A;  3M4O J;  2ECC A;  2NP3 A;  1NK2 P;  1B8I A;  4AC6 A;  1ZK8 A;  1AHD P;  3S15 J;  2E2J J;  3COL A;  1ZTR A;  1H8A C;  1AKH B;  2EBI A;  2YVE A;  4MO7 A;  4A3E J;  3HBL A;  2HOS A;  4C3H J;  1TWF J;  5E3M A;  4IHW A;  2OPT A;  2LKX A;  2M8G X;  5M3F J;  3HOY J;  3ZQH A;  4M3F A;  1IDZ A;  5C4Y A;  2Y9Y A;  1HOM A;  3LSG A;  5J1Y A;  4UUS A;  1ETQ A;  2JN6 A;  2COB A;  1DU0 A;  1U8B A;  3HKZ N;  3RZD J;  5K7Z A;  2DMP A;  5FHP A;  3G1O A;  3OSF A;  2DA5 A;  2LY9 A;  1HF0 A;  3HOW J;  2GEN A;  3BNI A;  2IBD A;  3BR0 A;  1CQT A;  3TW7 A;  2L0K A;  3RKQ A;  2Y30 A;  3HOX J;  1U9O A;  3H0G J;  2W53 A;  3I4M J;  1MBF A;  4AUX A;  2VKV A;  4D7M A;  2R5Y B;  2ME6 A;  1ZR2 A;  3GEU A;  5IPA A;  2WUI A;  1IUF A;  3GTM J;  2O9L A;  2JJ7 A;  3ZQL A;  1Y1W J;  2HOT A;  2Q24 A;  5CXI A;  3T6N A;  2Y0S N;  4A69 C;  3BTJ A;  2RHA A;  1GT0 C;  2XPV A;  2X6O A;  3QQA A;  2QKO A;  5FLV A;  2DMN A;  4HKU A;  4IHV A;  2NVT J;  1JGG A;  1IG7 A;  3OOU A;  1MBJ A;  3CWR A;  3KNW A;  3B6C A;  1P7J A;  5FMP A;  2XRL A;  5FLM J;  3TED A;  2JA5 J;  3K7A J;  2Y2Z A;  4JYK A;  3NPI A;  4RDU A;  1JUM A;  2DG8 A;  3CCY A;  4A93 J;  2FJ1 A;  1HCR A;  1YRN A;  1H89 C;  4GCT A;  3A03 A;  1JJ6 C;  1QVU A;  3JRG A;  2DMT A;  4B3A A;  1ETV A;  3S2D J;  1JKR C;  1Z0X A;  4BY1 J;  1IV6 A;  3S14 J;  4J19 A;  3MKL A;  2CQQ A;  3BTL A;  3L1P A;  3VIB A;  2EZL A;  3ZQC A;  2WB1 N;  1IGN A;  5FKO A;  2G3B A;  5E3N A;  4XRS A;  3ANP A;  3K2A A;  2XGD A;  1ZQ3 P;  1ENH A;  4YZE A;  4M6V A;  2HYT A;  4XID A;  3LOC A;  2R0Q C;  1K61 A;  2RAS A;  4M3D A;  5IP6 A;  2K9N A;  3JRA A;  2XGC A;  2YS9 A;  3RH2 A;  1A5J A;  1RET A;  3HE0 A;  1WI3 A;  3KZ9 A;  1X2N A;  1JKO C;  4UDS A;  4AF5 A;  3O8H A;  5IOY A;  4W97 A;  2VI6 A;  3IH2 A;  1VF9 A;  2NOG A;  3JR9 A;  5EDN A;  3KKC A;  3RD3 A;  1B8I B;  2LD5 A;  3JSJ A;  3GZI A;  1ORK A;  2QCO A;  4KWA A;  4I76 A;  2GBY A;  2RAE A;  3HOV J;  2L7F P;  2NS7 A;  3Q0W A;  1H88 C;  1QVT A;  3IUV A;  1B72 A;  4JX5 A;  3VVY A;  3IH3 A;  4GFL A;  1UI5 A;  4A3J J;  1QPI A;  3IH4 A;  5J1R A;  3HTH A;  3HTJ A;  3S17 J;  1QRY A;  5IP9 J;  2VUM J;  2M2E A;  1OJL A;  1W0T A;  4XRS G;  2IAI A;  3BHQ A;  3LNQ A;  1LFU P;  3SDG A;  3FIW A;  5HBU A;  2UXP A;  4L62 A;  4BY7 J;  2LK2 A;  5E3O A;  5C4X J;  3RQI A;  2E19 A;  2GUH A;  2L7M P;  1LE8 B;  2M34 A;  2ZCM A;  3A02 A;  1F36 A;  5EEA A;  3LSJ A;  3O8G A;  1X58 A;  1RR7 A;  1BL0 A;  4MXM A;  2LR8 A;  2PBX A;  1GVD A;  5M3M J;  5FJ8 J;  2ZOY A;  3G56 A;  3TP3 A;  1EF4 A;  3BTI A;  3GTO J;  4ABZ A;  2HQ5 A;  2QIB A;  1LFB A;  1FEX A;  2HOA A;  3TP0 A;  3PO2 J;  4X1E A;  3BR6 A;  2R5Z B;  3VW2 A;  5M5W J;  3KKD A;  2HI3 A;  1T33 A;  1VND A;  3HOZ J;  2XPW A;  3BG5 A;  3GBG A;  2E1O A;  1U9N A;  4A3L J;  2CRG A;  4QTR A;  3VPR A;  2ZCN A;  3BG3 A;  3I4N J;  1OCT C;  4JL3 A;  5F0H A;  3S2H J;  5J1U A;  4FCY A;  2H8R A;  2UXO A;  4S0H B;  5C3E J;  4CYC A;  2G7S A;  5D18 A;  2HDD A;  4Y52 J;  2MG4 A;  3HIM A;  4A3M J;  1W0U A;  3ZQI A;  4A3F J;  2Y9Z A;  3QPL A;  3S1N J;  1DU6 A;  5F04 A;  3NNR A;  5HSZ A;  3V6G A;  2TRT A;  3C2B A;  2M9H A;  3BR1 A;  5DAJ A;  4EEF G;  2GM4 A;  3UKG A;  2OI8 A;  2XPU A;  2DA6 A;  1ETK A;  5IYB J;  1GV5 A;  4M3E A;  4DYC A;  1ZR4 A;  1SGM A;  1TWG J;  2LTP A;  3CMY A;  2P81 A;  2VKE A;  1GUU A;  3HGY A;  4A3I J;  2DN0 A;  2O8K A;  3ON2 A;  2YU9 J;  1S7E A;  3EGQ A;  1PUF B;  3CRJ A;  4MIM A;  4XK4 A;  4BBS J;  1POG A;  2NVX J;  1IC8 A;  1ETO A;  3G1M A;  4QIW N;  5JLW A;  1XS9 A;  3ON4 A;  1ZKG A;  4NDL A;  2XGE A;  1TC3 C;  2VPR A;  2DMQ A;  4M3G A;  3MN2 A;  5M5Y J;  2EZI A;  5IYC J;  1BW6 A;  2DA3 A;  1JUP A;  3E7Q A;  1Q1V A;  2HYJ A;  5GPA A;  5HAW A;  3V78 A;  5D19 A;  5DS9 A;  1TWC J;  1MBG A;  3W6V A;  3QKX A;  3SFI A;  4V2F A;  5EF6 A;  3BCG A;  3CJD A;  3QBM A;  3ZOB A;  3PM1 A;  3RZO J;  1UG2 A;  2NP5 A;  2O7O A;  1IRZ A;  3BR3 A;  2V57 A;  5IOZ A;  2DMU A;  3HGG A;  3JRH A;  3HDD A;  5E3L A;  1U78 A;  4UUS B;  1JKQ C;  3FK7 A;  3WHC A;  1RKW A;  4V2G A;  5EGO B;  2PZ9 A;  3BT9 A;  5C4J J;  3OIO A;  3ZQG A;  5BNG A;  1JJ8 C;  3H3V K;  4A3B J;  2D6Y A;  2Y31 A;  5DTD A;  3LWJ A;  3VP5 A;  3JRD A;  2LFB A;  2K40 A;  3CDL A;  2DA4 A;  5C44 J;  3P9T A;  2CUF A;  3JRC A;  2R5Z A;  1MNM C;  3HB9 A;  3EUP A;  2HKU A;  2EZH A;  4DW6 A;  3JRI A;  4MK6 A;  5EGO A;  5AQC A;  2LVS A;  2XB5 A;  1JTX A;  4MLO A;  2GLO A;  1JUS A;  2ME0 A;  4M3B A;  3LSR A;  2R7Z J;  2R92 J;  4ME9 A;  3BQZ A;  4ICH A;  2EZK A;  4UUT A;  4D5F A;  3JRB A;  3DCF A;  2X48 A;  4AC0 A;  1PUF A;  2JK3 A;  4BBR J;  3JRE A;  3DPJ A;  1R9T J;  3VVX A;  5EZG A;  5FKN A;  4A3D J;  1T56 A;  3QPS A;  4GFB A;  3NXC A;  3BQY A;  5EYR A;  1RPW A;  3LHQ A;  3ZQF A;  2JA6 J;  1X2M A;  3OSG A;  1MH3 A;  2HXI A;  3HM5 A;  1F43 A;  3GTQ J;  3FKI J;  5IP7 J;  2DJN A;  2NX4 A;  3AQT A;  1TWH J;  2JMW A;  2TCT A;  1ETW A;  3FRQ A;  3NAU A;  1MSF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...