3IH4A

Tm1030 crystallized at 277k
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 68
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih4A02
2K9NA 4MFEA 3K2AA 3IH4A 5EGOB 4MFDA 3A01B 3TP0A 2HYJA 4BY7J 4QTRA 3JRFA 3V6GA 3SFIA 1IDYA 2HXIA 3QBMA 3WHCA 3RZDJ 3HKZN 1JTXA 2ELKA 4B4CA 4UDSA 1MH3A 3AQSA 3I4MJ 2DA7A 3BCGA 3GTMJ 2YS9A 4MO7A 4ABZA 3JSJA 2JJ7A 2LR8A 1MH4A 1T33A 5J1YA 4BBSJ 4RBOA 4AC0A 2CU7A 2ZOYA 4GCKA 3HOZJ 2L7MP 1GT0C 2XSDC 5BNGA 2R5YA 1PUFA 1IG7A 5C4YA 2DA3A 5J1RA 5C44J 5EZGA 3ZQIA 3VPRA 5FKOA 2Y9ZA 3COLA 3BR6A 4A69C 1K83J 4A3GJ 1FJLA 3JR9A 3LSRA 4A93J 3S1RJ 1RKTA 2MW8A 5GPCA 3DPJA 3VOXA 4UUSA 1A5JA 2DN0A 5EG0B 2HKUA 1TWAJ 1HCRA 1MBGA 2R5ZB 4A3EJ 5JLXA 3JRGA 2GENA 5FKLA 5C4JJ 3PO2J 3ZQHA 3K7AJ 1ETYA 3NI7A 1K61A 2WUIA 3LSPA 2XPVA 3Q0UA 3BG3A 2VKEA 2LTPA 3NRGA 3BQYA 3MKLA 1GUUA 1VFCA 5EGOA 4J19A 3JRCA 5F0HA 3A01A 1ETXA 3ZQLA 1JJ6C 4CYCB 1I6HJ 4Y7NJ 5K7ZA 3GTKJ 1OFCX 2XGDA 2XDNA 1WPKA 4X1EA 4UUTA 1FIPA 2ID6A 2Q24A 3B6CA 1TWFJ 4S0HB 5M5XJ 2ECBA 2VPRA 5IPAA 3T6NA 2X48A 3BNIA 2JK3A 2M34A 3BR2A 3CQZJ 2H1KA 2Y2ZA 3MN2A 2O8KA 1RPWA 4YZEA 3MNLA 1QRYA 4JX4A 3GTOJ 5E3MA 3RH2A 3HB9A 5DS9A 3OSGA 2M2EA 3P9TA 2R92J 3FIWA 3VOKA 3QKXA 2M9HA 1SGMA 5EG0A 2NS8A 2M8GX 2Y9YA 1LE8A 1X58A 1AU7A 5CXIA 3JRAA 1O4XA 3S2DJ 4GFLA 3H3VK 1WH7A 3S16J 4W97A 4GFKA 3DCFA 1GV5A 5IP7J 2TRTA 4A3MJ 2VUMJ 5D18A 3PM1A 2FQ4A 1FTZA 3V78A 2ECCA 4KWAA 4QSHA 2XPWA 1SANA 3M4OJ 1JT0A 4CYCA 4A3KJ 1H88C 3S1NJ 3BG9A 2R5YB 1PUFB 1HDPA 3G1MA 4HNVA 2R0QC 5AQCA 2JA8J 5HAWA 4BKXA 2NX4A 2O7OA 1F43A 5FMPA 2FD5A 2XGCA 3JRDA 2E2JJ 1X2MA 3HEFA 3QPSA 4G12A 3S14J 4UUSB 9ANTA 2E1OA 2KDZA 1RKWA 2V57A 2LK2A 3HOWJ 1U9NA 1P7IA 4AUXA 4MLOA 4A3DJ 1IGNA 3HOYJ 4C3IJ 2QF7A 1AKHA 3RQIA 4AF5A 3HOUJ 3E7LA 3IUVA 2JWTA 5F0CA 1IJWC 1E3OC 2DA1A 2K9QA 5IYBJ 1IDZA 4MK6A 5HODA 3QQAA 1SFOJ 2REKA 3BR5A 1JKQC 3RZOJ 5FLMJ 4XRMA 1FIAA 5FHPA 5FKNA 4M3BA 4AYBN 3LWJA 2G7SA 3VVYA 4MXMA 3FK6A 1JJ8C 1ZTRA 4D7NA 4FE4A 2LFBA 4EEFG 4D5FA 3CWRA 3G56A 1Q1VA 1ETOA 2E2IJ 2NOGA 2XB5A 3B6AA 2L7FP 3HOXJ 1POGA 2PZ9A 3VP5A 2IU5A 2F07A 3E7QA 2MGQA 4JX5A 2CQXA 2DMPA 2K40A 3FISA 3VUQA 1TWGJ 5E3LA 2NVQJ 4FE7A 1ZR2A 2LKXA 2NVTJ 2NP5A 2QWTA 2CUEA 2HOAA 1Y1WJ 3GEUA 2UXIA 2FBQA 3L1PA 2HOSA 2NS7A 1UI5A 2PBXA 1LE8B 5K7FA 3C2BA 3TP3A 1ENHA 1AHDP 2O9LA 5D1RA 1HLVA 2E19A 3OIOA 3O8GA 5M3MJ 1H89C 1ORKA 5HSZA 3GTJJ 4MIMA 2QCOA 3HM5A 3BT9A 1RETA 2ME6A 1B72B 2WGBA 1CQTA 2UXHA 1U78A 1LFUP 1VNDA 2K9SA 1BJZA 2G0EA 1ZK8A 5DTDA 1XC5A 3HTHA 1XS9A 1QVTA 5IYCJ 2R7ZJ 3VIBA 3D1NI 1MBHA 2EZKA 1BL0A 5E3OA 3TW7A 4L62A 2QOPA 4NN1A 4DZJA 2JA7J 5F04A 1UMQA 1X2NA 4ME9A 4DYRA 4ACIA 2W53A 5FJ8J 4IHWA 2COBA 2DMNA 4BBRJ 1ZKGA 3IV5A 3I4NJ 3ZOBA 2O7TA 2VI6A 2RASA 3C07A 2HXOA 2DMTA 5M3FJ 5FKKA 4B3AA 2ZCMA 1JT6A 3NXCA 1UG2A 2R93J 3JRBA 3OSFA 1AKHB 1BW6A 5C3EJ 3BTJA 1MSFC 3BQZA 2ZCNA 1ETQA 3DEWA 5JLWA 2MSYA 1G2HA 2Y31A 3BTIA 3HDDA 5J3LA 1TC3C 2HOTA 2LP0A 1IRZA 3NNRA 5EEAA 2WV1A 1D5YA 2CQQA 2GUHA 4I6ZA 1DU6A 1OCPA 3NPIA 2FX0A 1HOMA 1W0UA 3HGYA 5IYDJ 4A3FJ 4A3LJ 1WI3A 2P81A 1ZR4A 3TEDA 5FGLA 3BRUA 1B72A 4M3EA 4M3GA 3LNQA 2IEKA 5C4XJ 1JUSA 2ZB9A 2EBIA 1W0TA 3F1BA 4RDUA 2B63J 2I10A 2M0CA 1EF4A 3CJDA 1S7EA 3CMYA 3S2HJ 2YVHA 1NK3P 3M3YJ 2UXPA 4XK4A 3KZ9A 3IH2A 1T56A 4A3JJ 3S1MJ 3HTIA 3QPLA 2Y30A 3W6VA 2E2HJ 5FLVA 2HYTA 2IAIA 4IEJA 2DMUA 4XIDA 3S1QJ 2ZOZA 3UKGA 2DA2A 3A02A 3HIMA 3BR3A 3GBGA 1JUPA 1DU0A 2RHAA 4JKZA 2N8GA 1NTCA 2AO9A 4L5EA 3S5RA 2GM4A 2FJ1A 2KT0A 1RESA 2MG4A 3BR1A 1APLC 1NK2P 3FRQA 4CGRA 1ETKA 1MNMC 5EFYA 2ZCXA 4DW6A 3LSGA 4IHVA 4GCLA 2X6OA 4DZPA 4Y52J 1VI0A 3HOVJ 3CCYA 2EZLA 5CXGA 1P7JA 5M5WJ 3KNWA 4D5CA 2VKVA 3A03A 3GTQJ 3G1OA 2GBYA 1JKOC 2QTQA 3BHQA 1ZQ3P 5EZHA 4A3IJ 2OI8A 4ICHA 5DAJA 2NVXJ 1TWHJ 2AHQA 1GVDA 1MBJA 4XRSG 4C2MJ 4AC6A 5K58A 5IP6A 3WHBA 2W48A 2OF7A 3GZIA 1B8IA 3ZQCA 4JYKA 5EF6A 2TCTA 2NVYJ 1Z77A 3JREA 1OCTC 2H8RA 4QIWN 2UXUA 2ME0A 3KKDA 1H8AC 1ETWA 5FKMA 3PPBA 3BR0A 5K7HA 4A3BJ 3BJBA 3LJLA 4D7MA 3VW2A 2CJJA 4JNNA 2HI3A 2CRGA 2DMQA 1YRNA 3BG5A 1MBEA 2JA6J 1FEXA 2XB0X 3NAUA 3RD3A 4BXXJ 2DTZA 2EZIA 4JX6A 4HKUA 2EH3A 3LOCA 2WB1N 3ANGA 2IBDA 2G3BA 3LHQA 2GFNA 4DYQA 2HQ5A 1ETVA 4V2GA 3PASA 2NP3A 3VVZA 1IV6A 3BTLA 1IC8A 1QPIA 1GDTA 4JL3A 1WGXA 1BA5A 3Q0VA 2UXOA 4DYCA 2L7ZA 3ZQFA 4PXIA 2YU9J 3Q0WA 4A3CJ 4GFBA 4C3JJ 1A6IA 1U9OA 5GPAA 5M5YJ 3SJMA 4NDLA 3FK7A 3S15J 2LVSA 3PO3J 2LD5A 4I76A 4M3DA 2DG7A 5H9TA 4FCYA 2Y0SN 5IOYA 1IUFA 3O60A 3RKQA 2GLOA 2RAEA 3HTAA 3G1LA 5F0FA 3HTJA 5F27A 1JUMA 2D6YA 2LLKA 1JKPC 2G7GA 3FKIJ 3JRIA 2WAQN 3HE0A 5EDNA 2X9DA 3VW1A 2JN6A 1R9TJ 1HDDC 3HGGA 3BTCA 5D19A 1MSEC 3S17J 3VVXA 2LY9A 2XGEA 2PMZN 4LOCA 3ZQGA 2EZHA 1ZGWA 1JKRC 2YUSA 3VW0A 5CW8A 5GP9A 2D5VA 4B1RA 2YVEA 1JTYA 2QIBA 2L0KA 1FTTA 1QVUA 3EGQA 3Q3SA 3CRJA 3GTGJ 4GCTA 5IP9J 3GTPJ 2OPTA 3JRHA 2XPUA 1MBKA 2DA6A 5IOZA 1UI6A 3NARA 2OERA 1BW5A 4NELA 1B8IB 4M6VA 1U8BA 3GTLJ 4XRSA 2R5ZA 2HDDA 3ANPA 1VF9A 3O8HA 4C3HJ 3SDGA 2XRLA 2DA5A 4IHXA 4FTHA 1LFBA 1RR7A 2JMWA 2DG8A 1OJLA 1XG1A 2JA5J 2DJNA 4IHYA 4JP0A 1YRNB 3LSJA 3EUPA 3F0CA 3ON2A 1GV2A 2ID3A 3HBLA 1F36A 1I50J 3B81A 1WCMJ 5F1JA 1Z0XA 3G7RA 4W1UA 3CDLA 4X6AJ 1MBFA 2CUFA 3ON4A 1ITYA 1UHSA 3MVPA 1HF0A 2G7LA 4M3FA 3TW6A 1TWCJ 4V2FA 5J1UA 1WH5A 4FISA 5E3NA 4XICA 5F08A 5EYRA 2L9RA 3AQTA 1Y1VJ 1JGGA 3IH3A 2DA4A 1I3QJ 3OOUA 2EQRA 4BY1J 2QKOA 5HBUA 3KKCA 3H0GJ
chains in the Genus database with same CATH superfamily
1FNNA 2KP6A 5E17F 1N25A 3K2AA 3IH4A 1HKQA 2DT6A 3LSKA 3H5NA 3WTSC 2F5EA 4BU2A 2H6BA 2ZXJA 3CCEI 3SFIA 1IDYA 2QSFX 3QBMA 4E7JA 5H2FC 1FBSA 3LA7A 4M72A 3V7RA 4ENJA 3FZVA 4HA8A 4UDSA 4P96A 1MH3A 2BEOA 3I4MJ 2MA3A 4XQFA 1QHGA 3HUGB 3RKXA 1BIBA 1OISA 4A5MA 2DJIA 5J1YA 1S7OA 4IJAA 2QA4I 4RBOA 2A6TA 1IN6A 1ZG3A 2CU7A 2F4OB 4DOZA 3HOZJ 3LMMA 4N4OB 1MMNA 3DFGA 1HW5A 2F6CA 3M9AA 1IN7A 5C44J 2WAEA 3H5RA 3BCAA 1IXSB 2VJIA 4BEHB 2LY1A 1K83J 4A3GJ 1FJLA 2XHKA 3L2UA 2QQAA 3ZQQA 5LGNA 3LSRA 3L09A 2MW8A 2Z99A 3E5QA 2WV0A 5EG0B 3HOTA 2L4AA 1TWAJ 3MWMA 2ZKZA 3AG2H 2HZDA 5C4JJ 4MTDA 3IUOA 1Z05A 2M7BA 1K61A 2XPVA 3Q0UA 3BG3A 2VKEA 4WF2A 1OYWA 2LTPA 1W5SA 4E7LA 3BQYA 3IWFA 4H4KC 3VYTB 5LHHA 1IF1A 2KMUA 2A61A 4EJUA 5EGOA 5LD2C 3JRCA 3A01A 2GXAA 3FBNB 2R7VA 4HV6A 1LVAA 4RB3C 4B3XA 3QP6A 3FM5A 3ML6A 3CMEI 3CP2A 2XDNA 4WXHA 4ZZLA 4EQQA 1X19A 2HPMA 2LBFB 1FIPA 3DU5A 2BOLA 5B3SH 1TWFJ 1R7JA 2WWYA 5IPAA 1ZAOA 1ON1A 3VYSB 3ERMA 2TDXA 3CQZJ 2L4MA 1Y56A 2H1KA 1TZLA 1V5GA 4UB8C 2WB1A 2PFVA 4YZEA 1DQUA 1XGMA 2BY2A 5J8CA 2DFEA 3RH2A 5LHGA 4DIQA 1B6AA 2M9HA 3FMRA 2VBWA 2NS8A 2M8GX 1LE8A 2ELHA 4LITA 1AU7A 1FOXA 1O4XA 4H0EA 1A04A 2Q0OA 4GFKA 3BDDA 3D5RC 2DPDA 3CD6I 1YW7A 2X0LA 1FTZA 4L18B 4OIRF 4KWAA 2Y0SA 2DQLA 2F4IA 3A0BC 4FASD 5FROA 4CYCA 1H88C 1B59A 3VFZA 3DQVC 2R5YB 3WU2C 4KJZA 4EV0A 2PEXA 5D4RA 4HNVA 3TKYA 2R0QC 4L9JA 3H0DA 3I54A 3OYAA 1B4AA 2WAQA 3O3KA 4CH7A 5FB2A 2EV0A 5DEQA 5FFZA 1KYZA 3L2VA 1QO0D 4UXNA 1KQ8A 5CVUA 1YW8A 3A1YA 4RGUA 2EIJH 3HOWJ 1P7IA 4P5OA 2UV1A 5E1ZB 3HOYJ 3WODF 3RQIA 5BMZA 3JW4A 3COAC 2ZY9A 3E7LA 1Z9CA 2F4MB 2JWTA 1IJWC 3GXOA 5IYBJ 1YIJI 3BR5A 3ULQB 4IQ4A 3V42A 1G3SA 1W5CC 3RZOJ 2X6WA 1A6QA 1HKSA 2G7SA 1D8JA 1VQMI 1UG0A 1ZTRA 5GTIC 1H0MA 1DP7P 3WGIA 2NOGA 3B6AA 1DDNA 2XAHA 1POGA 2PZ9A 5D6FA 2IU5A 2V79A 5FRMA 5H20A 2MGQA 4HYEA 2ZFWA 4XONA 2K40A 3W2WA 3VUQA 4M73A 3LA3A 4UUVA 2IGKA 3OIPA 2NVTJ 2H1LA 2QWTA 2JVHA 2OJED 3F8FA 3GEUA 1BOAA 5DCFA 4YG2F 3CCMI 2Z1DA 2FU4A 2NS7A 2FJI1 4MQ9F 4OAZA 2ZXWH 4XLAA 2PG4A 2VBYA 4ZYEA 5A2QK 3J7AO 2CW8A 4P9UA 1IXCA 1MDMA 1ORKA 2VBZA 1UHMA 1HW1A 4OD5A 2QCOA 4GGGA 4UVBA 2YU3A 3M8JA 2ME6A 4XLPF 2IGMA 3C7JA 1K7AA 2XAUA 3CLOA 1R1VA 2CWEA 5K5OA 1LFUP 4ESFA 1XC5A 3HTHA 1XS9A 1G3TA 3F21A 1EV7A 2L5QA 1SFUA 3OOPA 3VIBA 2EZKA 4U7BA 3HKZA 3TO6A 4L62A 4DZJA 3F22A 2JA7J 1TQMA 1UMQA 1X2NA 2Q1ZB 1JGSA 4PSXA 1LKXA 2W53A 4KIBA 5FJ8J 2K5CA 5CPRB 2OBPA 3BPVA 3I4NJ 3K4KA 5J4YA 2VI6A 5KK1A 4A12A 3HHHA 4B3AA 2ZCMA 1TLHB 1JT6A 2ZSIB 4E4HA 1STZA 2DDAA 2RN7A 3JRBA 3H35A 3N97A 5C3EJ 2HDCA 3CJTB 1R71A 1FBUA 4KN4X 1MMDA 1G2HA 3K1MA 5DD4A 2A6HF 2STWA 3MZYA 2LP0A 4IHSA 1P4WA 4BUPA 4WX9A 2BXYA 3LSTA 4F55A 1XSDA 3CDHA 1Y0NA 1FWZA 1ZN2A 2DOFA 5HLGA 5IYDJ 2BW3A 4WCGA 3PQJA 4EGYA 1WI3A 2FF4A 5CVJA 4M3EA 3JSOA 2P5LC 5C4XJ 4D9JA 1PDNC 4HF2A 4LIVA 2QKLB 3HIFA 3ISPA 4IPAA 1W0TA 2DYRH 3DF8A 4YIIA 2DCEA 3S2HJ 1SVMA 5GADJ 4NHJA 2ICWG 4R8HA 4XK4A 3KZ9A 2Q8KA 4ZJZA 2VQLA 1OCOH 3S1MJ 4F92B 3IL2A 3ECHA 4F52A 3IWZA 3QOPA 2KRHA 2DMUA 2DXIA 3S1QJ 3QYBA 1FP2A 1RC9A 2DA2A 1MJ9A 3BR3A 3GBGA 1DU0A 2L9SA 2M45A 5ICCA 2N8GA 3HL2A 3K69A 2L3DA 2DPUA 1NTCA 1BN5A 1U8RA 4KFCA 4C2UA 2EFPA 4MQVA 5LGUA 4CGRA 2RVCA 3H1CA 1ON2A 4ENNA 2ZCXA 2FSWA 2CS3A 2X6OA 3SEZA 4YFNF 5HDKA 2EZLA 5CXGA 2MC3A 3TO9A 3KLNA 4Y15A 1R49A 3M8EA 3A03A 1EH7A 3K4CA 1JHFA 4RGRA 2QTQA 3BHQA 3K1NA 1ZQ3P 2XAJA 4A3IJ 2CH0A 1E0EA 5JR3A 3PNTA 3R6SA 1V54H 4WIBA 2NVXJ 3WTYC 4II3A 4C2TA 1GVDA 3LAJA 4XRSG 4C2MJ 5K58A 1V5EA 1W7PB 4R1HA 4AIHA 3S3NA 2KIQA 2TCTA 1F1ZA 3JREA 4BHCA 2L9VA 2EFQA 1M1EB 1QZEA 1ZGAA 4QIWN 2UXUA 2EILH 2W82A 1H8AC 1ETWA 4LG0B 1QHHD 3OV8A 5K7HA 4B09A 3BJBA 4EJWA 4JNNA 3F8CA 2DMQA 3CUQB 4KMFA 4BDYA 1LEBA 1YRNA 2P4WA 4XLCA 4RS8A 3OS0A 4BXXJ 2YPRA 2VOOA 2WB1N 3ANGA 2G3BA 3BROA 4V2GA 2FBKA 3E5XA 2OU2A 4AIJA 4M74A 1GDTA 1BC8C 1WGXA 2F2EA 3CJQB 4F7ZA 3OWTA 4IRHA 4DYCA 1SFEA 4RB0A 1WVRA 4GFBA 2CG4A 3MKWB 2PN6A 5AIQA 3AL0C 5M5YJ 1I1SA 2E1MC 4MEXF 1X3ZB 4DBRA 2W1OA 1Z6RA 2JPBA 4I76A 2KFDA 1ZG1A 3FHZA 2V1DA 2YX4A 2Y0SN 3JTGA 2RNGA 1IUFA 1YOVB 2XDVA 3O60A 3RKQA 2GZWA 4F93B 2PJRA 3HTAA 2RGVA 3G1LA 3CCJI 4J00A 4G7ZF 4PJNA 2LLKA 2AQFA 1XMXA 2V1XA 4N0BA 1O3QA 2G7GA 3JRIA 2WAQN 3AG4H 1P2FA 3AG3H 3IKVA 3HSFA 5KAIC 5EDNA 2KISA 3P9IA 4XMYA 2W7NA 3ERED 3OR2C 1YTYA 3W3CA 2LY9A 4ZTFA 2LYCA 1ZGWA 5LGTA 1K4SA 1S3JA 3VOEA 5CW8A 4BQNA 3FM3A 4NC8A 1JTYA 3EETA 2L0KA 2QIBA 3OYCA 2KJCA 2H94A 5D4SA 3IKTA 3GTGJ 4GCTA 3GTPJ 3P9CA 5FD6A 3O2PE 2XPUA 4QWQA 2DA6A 3K6GA 5B1BH 2M1BA 1U8BA 2CV1A 2CQKA 1ODDA 2VOPA 3ZQ7A 3GTLJ 1FZPB 2BXZA 2HPIA 3CZ6A 4EGZA 3WTVC 2LREA 1J0RA 4HAMA 2RNJA 4OINF 2R7WA 3PJRA 4FTHA 2FE3A 1KZHA 2LG4A 2DG8A 1OJLA 3NQOA 5DD8A 1XG1A 2DJNA 3BY6A 4JP0A 1GV2A 1F36A 2W4SA 3SZTA 2DI3A 3G7RA 4IXAA 3SDBA 1U5TB 3T8RA 3WU1B 3GLLA 4KUMA 5CLSA 4XORA 5L3GA 1IV8A 2E1NA 3MVPA 1L0OC 1HC8A 2F5FA 4V2FA 3DTEA 2QQ9A 1UHWA 5TGTA 3ZMVA 5ED4A 1BR2A 1MMSA 3B02A 5F08A 2L9RA 3V8LA 2BVMA 2YSRA 3EUHA 3MZ8A 1IZ1A 1SD6A 1Y1VJ 2KRCA 4MTEA 4AIKA 3IH3A 1JGGA 1VQPI 2ZSHB 2EQRA 2P5KA 4BY1J 2IS6A 2OZ6A 2LMDA 1NG6A 1Y39A 2MC4A 2W24A 2F48A 3H0GJ 3QPTA 3U9GA 2KDOA 2K9NA 2VASA 4MFEA 5EGOB 4AM3A 4MFDA 3A01B 4G7HF 2PI0A 2HYJA 4BY7J 1AWCA 3V6GA 4KITB 3K4LA 4RGSA 4B43A 1TW3A 2MLGA 3RZDJ 2DOAA 3A0HC 4LB6B 3GZNB 3HKZN 1JTXA 2DBBA 2ELKA 4EJOA 5IY5H 3PSIA 3LL7A 2G7UA 3E6BA 4FETA 3TO7A 2PJPA 1UCRA 4ABZA 2JJ7A 1O7FA 2LR8A 2QVOA 4BE1A 1B9NA 2CQNA 4AC0A 1MMAA 5BQTA 1SEUA 4RAGA 1H9TA 3RIRA 4HF1A 2ZOYA 3K4JA 3RJPA 2JSPA 5BNGA 2XSDC 3EUHC 3ELKA 3EYYA 1IG7A 3K0LA 1S9HA 2MD0A 2DA3A 3F8BA 5J1RA 3ZQIA 5HNHA 5FKOA 2XROA 2ACJA 3COLA 3KP6A 2P6SA 3CCUI 1LDDA 1RKTA 2P5VA 1SD7A 3GMEA 4UUSA 3C1DA 1A5JA 3AFHA 2HKUA 1MBGA 5JLXA 5FGMA 5FKLA 1ZARA 1S72I 2Y0MA 4KT5C 4Z2YA 1D1AA 3ZQHA 4HX8A 1MJAA 1YLFA 4OWRB 3NRGA 4AVPA 4RLFA 3H92A 2AS5F 1FOWA 1WWXA 5K5RA 2LF7A 4PJJA 2HQAA 2IXSA 4YRVA 4CYCB 2GQQA 2LDUA 4Y7NJ 3CMAI 3GTKJ 1YS7A 3V7SA 1ZGJA 4XKCA 2G7HA 2V4JC 2WY8Q 2ISZA 3RPUD 3GZ6A 1SC7A 1ZRCA 3PQKA 4M9XA 2BVLA 3I56I 1UELB 4N4NB 2V1NA 4WXDA 3CC4I 2GXBA 2ID6A 1GXQA 4S0HB 5M5XJ 2OV7A 5CQGA 1J9IA 1R5ID 2CV2A 2VPRA 4HRIA 3FXKA 3J80Z 3T6NA 5CVVA 2X48A 2DTRA 2JK3A 1R1UA 2VC0A 1JI8A 4XN0A 2VKHA 1RPWA 5B1AH 2IPQX 1QRYA 4JX4A 3GTOJ 2EIMH 3WG7H 3HB9A 5KCMA 4PK4A 4NNJA 3DBLB 3R60A 2FMLA 1NG7A 1W5TA 2B9SA 2DAOA 1ULYA 3KX2A 5CXIA 2Y9YA 1X58A 5E79C 3NWSA 4GFLA 1WSUA 2VB6A 4JOMA 1X4OA 3GW2A 1SMYF 3LFKA 2GXGA 1ZRDA 4P55A 3M8FA 1PVEA 1ZELA 3VYRB 2VUMJ 4CXFA 4CUGA 5J47A 2FQ4A 2OQRA 3V78A 4XOPA 2KKOA 2EINH 3H9GA 1ZH5A 4RAZA 3M4OJ 4HOBA 1JT0A 3N05A 2NOJB 2IP2A 3BG9A 1PUFB 3HJEA 3G1MA 3WTUC 4U0VA 2E36A 4BKXA 2O7OA 5FMPA 2GOMA 2XGCA 1OCRH 3QPSA 1Z6TA 1R1TA 2O5RA 2KDZA 2ZXIA 5E1WA 1SMTA 4ZDPA 2QF7A 1AKHA 5HOOA 5F0CA 3GZ5A 4GRIA 4YFKF 2IT0A 1IDZA 3EUKL 4LB5A 1I3AA 3QQAA 5HODA 3EYIA 4ASNA 4LK1F 4FQGA 1OPCA 4CO8A 2BGCA 3HRTA 3OL4A 4BAYA 3KEQA 4M3BA 3TOBA 1HKTA 3LWJA 2D1VA 3WU0A 3VVYA 4MXMA 3FK6A 1JJ8C 1V4RA 1O3SA 2OQGA 3CC7I 3HSEA 2YR2A 1TQIA 1FYLA 2PBIA 3HOXJ 2WAFA 2CQ7A 5D5WB 3I3LA 3E3VA 3EUAA 4I09A 4C9YA 4BH9A 3ECOA 3ESWB 1LQ1A 1XB4A 4FX0A 3QP5A 3UNGC 2BYVE 1Z67A 2A68F 4CCMA 4JX5A 4IHTA 1UJ8A 1G3WA 3BZKA 2QKMB 4FE7A 2LNBA 1I5ZA 3F6OA 2K3PA 1HXDA 2FBHA 3LSIA 3ABKH 4ZYDA 1C0WA 3CESA 4IRVA 3DBHB 1YJWI 1K6OA 2HS5A 3LFUA 2WTEA 2MBFA 2X6YA 3L1PA 2VQHA 3BG7A 1UI5A 2PBXA 3ZMSA 3I4PA 2E60A 1NH3A 3C2BA 1DGWY 1ENHA 1HLVA 3OIOA 1Z21A 2QZ8A 2ZC2A 2V26A 3O8GA 3S93A 1WFXA 1UB9A 4Q48A 5BOXA 4BJ6C 2HU9A 2NYXA 2GA2A 1RETA 3TOAA 2XIGA 4E7KA 2XASA 3R0JA 3ZRGA 2A69F 1TT0A 5DTDA 2DFHA 3QRFF 4JQFA 3SEQA 4U7DA 2HVQA 5IYCJ 5DUKA 4HNTA 3LSHA 1BL0A 1FMWA 3KE2A 4HSTA 2HTJA 2FQ3A 2ETHA 5E1XA 2R7UA 1K78A 2EFNA 3M1EA 3RYRA 4ACIA 4BBRJ 3F8MA 1LDJA 1ZKGA 4HEA2 1CF7A 3U21A 3C07A 4BHPA 5M3FJ 1ZLJA 4U0WA 3NXCA 2P7CB 5GAGJ 3HPGA 3BQZA 3OYEA 1ETQA 3DEWA 3Q9SA 1SFXA 3W6JB 3C2HA 1YE9A 3AG1H 5DUIA 1LFPA 3HDDA 4UNOA 2XF5A 5FLXK 3NNRA 2RQQA 1FSHA 2RC4A 4U88A 5K5QA 5EEAA 2CQQA 2GUHA 1DU6A 3SFZA 1OCPA 1W0UA 3ZMUA 4A3LJ 3L9FA 2R3SA 1ZR4A 2PMUA 2H09A 3IRQA 4Y4RA 2HKOA 3LNQA 4IOCF 3S2WA 1EKEA 5D8LB 4XSXF 1FYMA 3F1BA 3MEXA 2I10A 2M0CA 2A07F 3TDZC 2YVHA 1CGPA 3M3YJ 3DV8A 2QYOA 5HDNA 2K4BA 3FMSA 1V5FA 2E1MB 4OMYA 2ZMEA 1YW9A 4WK8F 4ESJA 3V7CA 4NQWA 2HYTA 3G3ZA 5ICEA 2BHYA 3S32A 2A2FX 4L9TA 3I59B 2OD5A 3GX4X 5TJJA 2AO9A 1HW2A 5DV5A 4EVIA 2GM4A 6PAXA 1T98A 2CO5A 1NK2P 3FRQA 3HYIA 3GO5A 1HSTA 2OA4A 2GIVA 3LAPA 5EFYA 1O57A 4G6DA 4IHVA 2IS4A 4GCLA 5KVRA 4DZPA 1VI0A 2HR3A 3T1BA 3HOVJ 5J6XA 5BPIA 2CYYA 2FUG2 3FHNA 2B3WA 4IZZA 2V6EA 1P7JA 3OYBA 1PYVA 2EJRA 3VODA 2L2OA 3K4BA 2F5CA 1Y6IA 4GYGA 2O6GE 4RAFA 5EZHA 2JTVA 1TNTA 2X1CA 2AHQA 2GA1A 3HRUA 1TW2A 1E17A 1RUOA 2LC2A 4ITVA 4XOTA 2A5WA 3WTTC 4AC6A 5IP6A 3KLOA 2M8EA 4GYIA 4CSWA 1A36A 2W48A 4NB5A 3EPZA 3ZQCA 1YITI 2KPMA 2VXZA 2IA2A 1X1PA 2XUBA 2AXTC 4BHBA 3WE3A 1EH6A 3DEEA 3KKDA 4LGWA 5FKMA 1KQ0A 2KJBA 3BR0A 3VSKA 1E2XA 4D7MA 3K10A 4N9HA 2W85A 1RUNA 2EFOA 5ILVA 2JA6J 3NAUA 1XMKA 3TQNA 2EZIA 3C18A 1FX7A 2EH3A 2UXNA 3FMQA 3I9V2 3LOCA 4B44A 3K2ZA 3G6EI 2L02A 4DYQA 3VVZA 3PASA 4JBAA 1QPIA 4XLNF 3SZGA 2M4GA 5EJCA 2KZVA 5LEKA 2OTJI 3KP5A 4Y33A 4ZTJA 3B73A 2IGNA 1R5GA 1YQAA 4NC7A 4AYBA 5J40A 4C3JJ 1KU2A 3OYDA 5DCMA 5GPAA 2O61A 1FT9A 3DKXA 4NDLA 3WG9A 3FDYA 1MMGA 3DPTA 1B1BA 2LVSA 3H9QA 4PJ0C 2LD5A 2FNPA 2MFZA 4OU0A 4M3DA 2BBYA 3CCQI 3L00A 2RAEA 1E3PA 4NC6A 5F0FA 3HTJA 1IXRC 4EM0B 2D6YA 1JKPC 2D2WA 2B0LA 3VSLA 4C30A 3GUDA 3FKIJ 3SHFA 4ZYGA 1W36D 2IS2A 2XKOA 3VW1A 2BHZA 3MCZA 3OL3A 3DLAA 2KIFA 3HGGA 1GVJA 3OY9A 4ESBA 4RB1A 3PUBA 3VVXA 2XGEA 2XGXA 2DK8A 3CUOA 3NRVA 2R7FA 4LOCA 2EZHA 2XVCA 5CVRA 1MKMA 1ZLKA 5GP9A 2D5VA 4B1RA 5JI6A 2HVRA 3KETA 3PFIA 1R58A 2JT1A 3ZMDA 3SZPA 3CRJA 4I0AA 5ERIA 4LIUA 4CCKA 2ZBKA 2OPTA 5IOZA 5L3FA 4NUBA 4DGWB 1UI6A 1B8IB 2ZO4A 3M07A 2LKPA 4M6VA 3FXRA 4O6JA 1AOYA 4O3MA 3KZIC 5FFXA 3ANPA 2XKPA 2LKSA 4KIFA 2DA5A 4BYYA 4IHXA 3VB2A 1XDUA 2IA0A 1V3FA 1LFBA 2H27A 2MABA 1RNLA 3LWFA 3F6VA 2KIUA 4YFXF 1I6XA 1FYKA 3CDIA 3A2KA 4I98B 4IHYA 4YIFA 3GWZA 1T08B 3EUPA 5JVGF 2ESHA 2JSCA 4PJMA 3N4MA 5IT9Z 3E6CC 3C3WA 3ZN1A 4W1UA 3J7YJ 3CDLA 4KYWA 1X1AA 2CUFA 5HS9A 3ON4A 2DU9A 1BR1A 1X3WB 2LBFA 1HF0A 4M3FA 4PFPA 2UXXA 1TWCJ 4KA4A 1RR8C 4FISA 2QWWA 2I5UA 1ZHFA 5EYRA 3GVAA 4HBLA 4HPQA 4HQMA 4LG3A 1J5YA 2H6CA 2KRFA 1W1WE 1A35A 2Y75A 2HWVA 3IAS2 3OOUA 3DWLE 1N78A 3S3OA 2QKOA 4HX4A 3KKCA 3L2WA 1GT0C 1MNEA 3NWTA 2K27A 4KIGA 4B8XA 4QTRA 5EEHA 3RYPA 5BS6A 1LJ9A 2HFHA 1X4PA 5LFAA 4KICA 5LEJA 3IAM2 4B4CA 4PZJA 3AQSA 2LSOA 2DA7A 2QGUA 4A0XA 1KU7A 3GTMJ 2YS9A 2NNYA 4MO7A 1VQNI 4TV7A 3JSJA 2HEOA 2E1CA 2RDPA 2FNAA 1T33A 1LPQA 4HZFA 2EV6A 1EA3A 4CCJA 3L2RA 2L7MP 4U0YA 1X1BA 2YVXA 2R5YA 2ZXHA 1JHHA 2E7WA 2VC1A 4UHTA 4MGRA 4A2UA 4CGZA 3OYLA 3F3XA 2P6TA 1K4TA 1YIOA 1WRJA 4ON0A 3HRMA 1FLIA 2RKHA 1L3LA 3S1RJ 1I27A 4ZDOA 1B9MA 2LOOA 3DPJA 3VOXA 2DN0A 2JA2A 4BQOA 5EEGA 1HCRA 2R5ZB 2FMYA 1MNDA 3PO2J 3K7AJ 2Z3YA 3LSPA 1P92A 3ONQA 1W7PD 3GCMA 2E35A 3G2BA 4PJLA 4G6QA 4QPQA 1GUUA 1VZ0A 3AAFA 4J19A 5F0HA 3DLLF 3ZQLA 4AWXB 2K4JA 4YIRX 4IOAF 5K7ZA 3SQNA 2UZKA 3A4CA 2MYSA 5KNLA 2ZJRF 1DPUA 4AD9A 4X1EA 2COMA 4IX7A 2FOWA 2BV6A 2PLYA 3HRSA 2ECBA 5CQEA 4E70A 3VEPA 3FXQA 3BNIA 2V1UA 2EV5A 3MAJA 2H8WA 1DP3A 3PUFA 2WA0A 4P9FA 2E7XA 3MNLA 5JVTA 2P0WA 3W6KB 5E3MA 5JHUA 3H9JA 2M2EA 3DU6A 5LLQA 3P9TA 3JCUC 3FIWA 1F4KA 3H3UA 1FMVA 2K9MA 4O5VA 1MIJA 3L2QA 3S2DJ 1J59A 1BOBA 3H3VK 4ENMA 1SD4A 1AA7A 3OYGA 5FD5A 4HLXA 1S5LC 1GV5A 4RA2A 3K70D 2A05A 3GFLA 3CMMA 1S8NA 3KEYA 3PM1A 4OIOF 2X4HA 3OMYA 5CKTA 1ZG5A 2ZNZA 2ECCA 3FXOA 2L01A 1S6LA 4QSHA 2XPWA 3GYHX 2V7FA 1SANA 2EIKH 4A3KJ 1K79A 3K1PA 5HLHA 4ZZDA 4EM1A 5LBQA 3J7AY 2ZJ2A 1HDPA 5AQCA 2JA8J 5HAWA 3KZZA 3VYUB 5DM7F 1FPQA 5AIPA 1Y8RB 2O03A 4BQQA 2FD5A 2MH2A 3JRDA 2E2JJ 4G8XA 5ILUA 3HEFA 2DT7B 4XLHA 4DBQA 4G12A 4YEJA 2ADUA 2E1OA 1P6RA 2JUGA 2V57A 3HHGA 2LK2A 4AUXA 5KHDA 4MLOA 2QM3A 4CA0A 3ZGKA 1IGNA 4HDVA 4C3IJ 5D5UB 1QBJA 1WJEA 1LB2A 4AF5A 2YX7A 2LY2A 3KEOA 1X1CA 2K9QA 2REKA 3IRRA 2NAZA 1USSA 2K9LA 2ZJPF 4XR6A 4ENKA 3P5JA 2VE9A 3JSPA 3CCVI 1WJFA 2HNHA 3WGGA 1FIAA 1R4NB 4XRMA 4MNUA 4AYBN 4XRFA 1ZYRF 1UZCA 3OYFA 3KPHA 3K8PC 3BJ6A 4XBFA 4D7NA 4EEFG 3CWRA 1MGTA 1Q1VA 4PCQA 2VJ4A 1ETOA 2VJJA 2XAQA 3G56A 2P7VB 2Q2EA 2XB5A 2L7FP 5H6QA 2JQ7A 3KYLA 1RZ4A 3VP5A 1K78B 4MEYF 2FRHA 2LRDA 4OOIA 3E7QA 3PFYA 3ASOH 4KN7X 2CQXA 3FISA 4RGXA 1TWGJ 1BI0A 4FX4A 2IW5A 3HSRA 4V19K 3WTXC 2HOAA 2BZTA 2MLKA 1KU9A 1RI7A 2M4KA 2HOSA 1QZZA 1LE8B 5K7FA 5JFRA 4D1QA 2A3SA 2R7TA 4PDKA 1R00A 3TP3A 4BXFA 1VQOI 1G6NA 5JHFA 1LNWA 1XX5A 2A5YB 4ZDLA 3BJOA 4RB2C 1H89C 4G9YA 2DYSH 5HSZA 1KQ9A 4RAYA 4MIMA 3E0JB 3CJNA 2R7RA 2GAUA 5D5XB 4Z6YA 3OS2A 2W84A 1LEAA 1BBYA 4PGGA 2UXHA 2Z16A 1MZBA 2K9SA 2G0EA 1ZK8A 4XLFA 1QVTA 5E3OA 3VDXA 3TW7A 1OLTA 3MFKA 4PGHA 5F04A 2V9KA 4DYRA 1TP4A 2RREA 2COBA 2DMNA 3F23A 4I2OA 3FF5A 2RASA 3ZOBA 2O7TA 4HLYA 2HXOA 4UY8I 3LSMA 1UG2A 1F9NA 3M7GA 3OSFA 1BW6A 2W57A 1V55H 2K85A 3I0TA 5JLWA 4L9NA 2HTSA 4LG0A 2MSYA 1BI3A 4ZC3A 3P9KA 2Y31A 3RDIA 1TC3C 5GTHC 2WV1A 3UR3C 1WJBA 4L5IA 1D5YA 1P4XA 4M6XA 3BZ6A 1IRGA 4I6ZA 1OQYA 4XN3A 3NPIA 1TQPA 2EA2A 2FX0A 1HOMA 2VN2A 3F72A 3HGYA 4A3FJ 2W00A 4IKFA 1JXSA 3MMYB 1Z7UA 3TEDA 4GDFA 5FGLA 3D0SA 1HBXG 3BRUA 1B72A 4JK1X 4M3GA 2HZTA 2IEKA 1JUSA 2ZB9A 5DM6F 2EBIA 2QBYA 3CJDA 2CW7A 1VQLI 4RMNA 2UXPA 3CTAA 3R4KA 4XLEA 1IUYA 1T56A 1FOYA 1Z3YA 1WI9A 4OD4A 2W25A 4Y13A 2XV4S 2D1HA 2JRTA 5IT3A 2E2HJ 3W6VA 2NRAC 2VBXA 4G7OF 1FP1D 3EQLF 3A02A 3HIMA 4PFOA 3T5XA 1X1DA 1SAUA 2O8XA 4KT6A 3K4MA 1D0XA 1UFMA 2E71A 3BC8A 4BBSJ 3CO6C 3TBIA 3S5RA 3R61A 2VQGA 2MG4A 1MDMB 1WJCA 3BR1A 3W2VA 2DODA 3FXLA 1MNMC 4BDZA 2XAFA 3LSGA 4DW6A 1SFKA 1FC3A 1BJAA 4DVYP 4I7HA 4XSZF 5E8GA 4A6EA 5M5WJ 3KNWA 4IRGA 1XPXA 4BNCA 1FBQA 3GTQJ 2V6CA 4EMSA 3G1OA 4YELA 2QEXI 1JKOC 1LDKB 5DCMB 1OYIA 1OCZH 2X1DA 3G4SI 4HQEA 4U9LA 2Z5UA 1PP8F 3KP4A 4LD5A 1YX5A 5HS7A 1XD7A 2GWRA 1TWHJ 1WJDA 3HC7A 2D45A 4ZYHA 5GAHJ 3CO7C 1BIAA 4CCNA 1YYVA 1OR7A 3WHBA 1WHUA 2OF7A 3GZIA 3CP8A 4JYKA 2L7KA 5EF6A 1D5VA 1Z77A 2R4GA 1OCTC 1J75A 1IRXA 2EPFA 1LUJB 4XKWA 3QPHA 4HG2A 3PPBA 4BQAA 4LK0F 4Q4ZF 4A3BJ 1A31A 3VW2A 2CJJA 4WXCA 2CGPA 1PJRA 1XMAA 4BE2A 5AONA 1WKMA 3CC2I 3BG5A 3CJRB 3E97A 3RD3A 3TGNA 4C2MA 4Q5SF 4JX6A 1Y8QB 4HKUA 4GCVA 5LHIA 1YHQI 3JAMZ 1UAAA 2BW3B 2GFNA 3LHQA 2XSJC 2IGOA 1U5TA 1U6GA 1O7LA 1XGNA 3BTLA 1IV6A 1IC8A 4XM3A 3J81Z 2KLOA 1WZ2A 4G94A 1YFHA 1TT5B 3L7WA 3U2RA 1BA5A 3Q0VA 2VLAA 2DK5A 1OR7C 2UXOA 3ZQFA 3Q0WA 1S29A 1KYWA 2NNNA 4L0ZB 4ETSA 1A6IA 3MKYB 1U9OA 3KCCA 1IAWA 2VONA 3SJMA 2VKDA 2QQ8A 3OYNA 3K4NA 3KYCB 2DG7A 4FCYA 2XAGA 4M9SA 1J09A 2E34A 5H6RA 3ROUA 1MJBA 4AU7A 2WC2A 2GOXB 2X1EA 2ELJA 4B47A 5HS8A 3LQRA 1U5TC 2HVSA 1XCVA 2X9DA 2ZCWA 3QWLA 1XSXA 1G59A 3RPUA 2Z33A 1BR4A 4XL9A 5D19A 1MSEC 1D1BA 2EFWA 3WGHA 1JKRC 2XRNA 1VQ8I 2YUSA 3VW0A 1YG2A 5J4VA 2YVEA 3EDPA 3ZR8X 4CHUA 1VQ9I 3ABMH 2DOEA 2MH9A 3F9KA 3V4GA 4F91B 2M0MA 1KONA 3Q3SA 3RSNA 2HGCA 3X2QH 1MBKA 1T0FA 3C2GA 4IVNA 3NARA 2AQEA 4NELA 1IN4A 1QA6A 4B48A 2HDDA 3AL0B 1VF9A 3LA2A 4Q47A 1HQCA 2VPLA 2IRFG 3ZCOA 1RR7A 4ZYAA 2JMWA 1R4MB 3QOEA 4DJAA 4BE0A 2JA5J 1YRNB 2HYFA 3LSJA 4QPOA 1SAXA 3F0CA 2K02A 1VQ7I 2QUFA 3ABUA 3MZHA 2ID3A 1ACIA 1I50J 1VQ6I 1R23A 2PMHA 2KZGA 3BG6A 2LF8A 4F3QA 1K6YA 2EWNA 1IN8A 2XF7A 3TL4X 3H3ZA 1UHSA 3E6MA 4P1WA 3TW6A 1PUEE 1T0FC 1R6RA 2DFFA 5LRRA 5L3EA 1T2KA 2P8TA 1WH5A 4G6TB 5L3BA 5E3NA 3D5LA 2X85A 1XN7A 1Y0UA 4S05A 2CFOA 4I99C 2J5PA 2DDBA 1G4DA 2DA4A 5HBUA 2ZMEC 1I3QJ 3KP7A 4XNFA 1KGSA 3HTIA 5D8KB 4CZCA 4LLNA 1XTAA 4AIDA 3TP0A 2VODA 2PJRB 3JRFA 1D1CA 1G8XA 1H9GA 4RM3A 3PIPF 2HXIA 3ZMTA 3WHCA 3J80K 4L5JA 3QYEA 3BCGA 1XGOA 3DPUA 3HPHA 1F5TA 5BPDA 4EJTA 1MH4A 3WE2A 3V8JA 2CV0A 4GCKA 3I64A 3DBRB 1T38A 2JZYA 1PUFA 3OYJA 2QQBA 5C4YA 4HSRA 1LVKA 5EZGA 3VPRA 2BY0A 2Y9ZA 4E7ZA 2MD5A 3PL8A 1JE8A 2HYGD 3BR6A 4A69C 2OUMA 3FXUA 4CCOA 3JR9A 4EM2A 3GF2A 3I58A 5CJ9A 4A93J 5GPCA 2Z9OA 2NVUB 3ZMZA 3OR1C 4A3EJ 2GENA 3JRGA 2Y48A 1ETYA 1WJAA 5E20A 3NI7A 3BLYA 2WUIA 3FXMA 1DPRA 1U0JA 4L9VA 5D5VB 3S8PA 1EH8A 4E7SA 2CUJA 3CF2A 3MKLA 3U1DA 1VFCA 4HNUA 4E6KG 1ETXA 4HW0A 1JJ6C 2G9WA 2CW0F 4ANJA 3BP8A 3Q5FA 1BM9A 1I6HJ 1OFCX 3DP7A 2NXNB 3OYHA 2XGDA 2IJLA 2KHMA 3ASNH 1WPKA 4UUTA 3HUGA 4EATA 3BPXA 2UWMA 2Q24A 3B6CA 1XDSA 5J8FA 4X0GA 5TRDA 1OMIA 3VWBA 2M34A 1I39A 3BR2A 4DQ2A 2Y2ZA 1FOKA 3MN2A 3E5UA 2O8KA 3DEUA 2ISYA 3R0AA 3I53A 3SXYA 3DPLC 1SVOA 2R7QA 4I01A 4BEHA 5GAEJ 2R7OA 5DS9A 3OSGA 1X3UA 4GXOA 4AVZA 4Y17A 2R92J 3VOKA 3QKXA 5LRSA 5B66C 3I55I 1SGMA 5EG0A 4LFUA 3T8TA 3JRAA 1U2WA 1WH7A 2M5WA 2VT2A 4FT8A 4R79A 3S16J 1EJ9A 4W97A 3DCFA 5IP7J 2TRTA 4A3MJ 1NHAA 5D18A 3QU6A 1YX3A 5KAFC 2DT5A 2Q2EB 1SVLA 3BWGA 2KL4A 2PQ8A 2X6XA 2QSHX 2IA1A 2CMPA 3S1NJ 4N9IA 3MQ0A 2DO7A 2RV8A 2BY1A 3M1CA 2NX4A 1F43A 1Z7LA 3JAMK 1ZREA 1X2MA 4OIQF 3W2AA 1YO5C 3S14J 4UUSB 3BJAA 9ANTA 3J81K 2PMZA 1RKWA 1U9NA 3KP2A 1O3RA 3BOQA 4LLLA 4A3DJ 3E1SA 1TNSA 1J2XA 3HOUJ 1D0ZA 4II2A 3IUVA 2M7AA 1E3OC 2DA1A 5HNFA 4MK6A 2M87A 1VTNC 1SFOJ 5L3CA 4KMUX 1BC7C 2WADA 5HVQC 3FKJA 1JKQC 4UVCA 2Z2SB 2KIMA 1VQ5I 2QLZA 5D6EA 5FLMJ 1S7AA 5FHPA 5FKNA 4PSWA 2STTA 4EJVA 2E5ZA 3DTKA 2LFBA 4FE4A 2HOEA 1RIOH 4D5FA 4NBQA 2EK5A 1YJNI 2E2IJ 2O0YA 1E3HA 1T39A 1RRJA 3IHUA 3H36A 3J7ZI 1R36A 1TBXA 3GFJA 3DTIA 2F07A 2HQNA 2IVMA 2QENA 2VL8A 2DMPA 3WTZA 3GEZA 3I71A 5E3LA 2NVQJ 1P4AA 1QPMA 1ZR2A 2EA4A 2LKXA 5CVIA 1QGPA 2NP5A 2CUEA 1Y1WJ 1T6SA 2M3AA 2ZFUA 2UXIA 2FBQA 2KQRA 5TISC 1WJ5A 2DQRA 4XKVA 3I59A 1BI1A 1D0YA 2F5DA 1AHDP 2O9LA 5D1RA 2R7XA 4Y3OA 2E19A 1Z1DA 5DYMA 2XC7A 3U1KA 3F8NA 3HZJA 5M3MJ 1T8IA 2DFIA 3GTJJ 2IS1A 4HX7A 3HM5A 3CF5F 3BT9A 2Y69H 1R22A 2WGBA 1B72B 1CQTA 2JVGA 1U78A 4BGDA 2QBYB 1VNDA 4WWCA 2F5VA 4BJTA 1BJZA 2FEZA 1YJ9I 3DKYA 2L9NA 4IRIA 2R7ZJ 3O6BB 3ABTA 3D1NI 1MBHA 4UV8A 2QOPA 4NN1A 2OCEA 5F6FA 5HLTA 4ME9A 4LJZF 4IHWA 2JUCA 2R7SA 3Q9VA 4RLQA 4A6DA 3HOSA 3IV5A 1TTYA 2J5OA 2DMTA 5FKKA 5HLIA 2R93J 1AKHB 3CLQA 2K7LA 3BTJA 1MSFC 3QYFA 4OIPF 2ZCNA 4OMZA 5L3DA 3RKYA 4HDUA 3OIQA 1YI2I 3BTIA 5J3LA 2HOTA 1IRZA 3ZN0A 2FXAA 3OYKA 1D8KA 3FBIB 2OCCH 2K3FA 1J7KA 3BCBA 1R5HA 5ICGA 3LQQA 4IO9F 1VQKI 5B5EC 2CSOA 3DKWA 2B1EA 4QLCU 5F64A 2WY7Q 3MKZA 2P81A 2CFXA 3PNVA 4I0BA 1PP7U 4IF4A 4A0ZA 3ZP5A 2DW4A 3ZPLA 2FBIA 4MHGA 3PIOF 4U9NA 4HF0A 3SWHA 2GIZA 3V8KA 4RDUA 2B63J 4CYDA 2NS0A 2FOKA 1EF4A 1S7EA 3CMYA 1KU3A 1Z91A 2X51A 1NK3P 3E6DA 1G3YA 4A5NA 3GFMA 3IH2A 4A3JJ 3T0YA 3HTUA 1GHCA 3VTIA 3QPLA 2Y30A 2HKXA 5FO5A 4CICA 1OKRA 1MW7A 4LMYA 4BJ5C 2XF6A 5FLVA 2WBMA 1W36C 2IAIA 4IEJA 4E7HA 4XIDA 2ZOZA 1XCBA 3UKGA 1JUPA 2RHAA 3NEUA 3ABLH 4JKZA 5FRNA 4U87A 4L5EA 2V9PA 1D3YA 2FJ1A 1RESA 2KT0A 1APLC 1YS6A 1GXPA 1ETKA 1IW7F 2CUZA 2JRMA 3CCLI 3QODA 4M6YA 4Y52J 1WQ2A 3FX3A 1I1GA 3CCYA 3G71I 3GLXA 3RI4A 4XKBA 3RQ4A 2K86A 4D5CA 2VKVA 1IN5A 1P9QC 2UUZA 1FSEA 4KNYA 3JTHA 5HDGA 2EB7A 2GBYA 4GO1A 4M9ZA 4IQJA 3CCRI 2OI8A 3HXLA 5FLXZ 3K9TA 4ICHA 5DAJA 5K1YA 1IO2A 1MBJA 1QZYA 1CF7B 4CZZA 3KIOA 2ZNYA 1B8IA 3RKWA 2NVYJ 4BL0B 2H8RA 3QU3A 1FY7A 2ME0A 2O3FA 4RM2A 4FHTA 2B7EA 3CCSI 1QQIA 3LJLA 4M71A 3BZCA 2HI3A 2CRGA 1REPC 3RCOA 2OC6A 4BXUA 3KP3A 1MBEA 4BS9A 1FEXA 2XB0X 2DTZA 3H5AA 1T95A 3L2CA 1GLNA 2V9VA 3OS1A 2IBDA 1W4MA 2HDWA 2HQ5A 1ETVA 4HV5A 2NP3A 1O3TA 4D0PA 3D5SC 1DUXC 2JPCA 4JL3A 2LH9A 3P7NA 1N77A 2L7ZA 4DNCA 4BACA 4PXIA 2YU9J 4A3CJ 2ESNA 2OAZA 1USTA 1ONVA 2ZMEB 5IT9K 5E18F 3FK7A 1N75A 3PSFA 4ZH4F 2FA5A 3S3MA 3S15J 3PO3J 3KZYA 4NQWB 5H9TA 1W7PA 2VQCA 3GFIA 3MD2A 5IOYA 4J01A 4CDGA 4E7IA 2GLOA 2QSGX 2M30A 2OTLI 4UB6C 5F27A 1JUMA 3ZXSA 1OCCH 5ILSA 2PFBA 2BE5F 3HE0A 4LLGF 4L0YB 3G73A 3OYMA 2JN6A 1R9TJ 1HDDC 3HTSB 1U3EM 1Z3XA 4CCLA 1SD5A 3BTCA 3CUQA 3QAHA 3TMOA 3S17J 2PMZN 5ICFA 4KDPA 2HQRA 3I5UA 3ZQGA 4S04A 1QNTA 2AXLA 3DXJF 3RTRA 2E5NA 4A0YA 3OYIA 1QVUA 3RPQA 1ZRFA 1FTTA 3EGQA 3AKZA 1IRFA 2OZUA 2VJ5A 4UVAA 5IP9J 5A2QZ 3JRHA 3KYDB 2OERA 1BW5A 3FXJA 1QU3A 1DGRM 2ZJQF 3PNYA 4XRSA 2R5ZA 3O8HA 2VIXA 1MD0A 4C3HJ 3SDGA 4UV9A 2XRLA 3KFWX 2DLLA 1XGSA 3HG9A 2VXDA 3REOA 3CUQC 1BI2A 1HSJA 4I02A 3ON2A 1HA8A 1OYYA 3IC7A 2VE8A 3HBLA 3B81A 1WCMJ 1KA8A 2VT3A 4K2EA 1VQ4I 5DDGA 5F1JA 1Z0XA 4IL6C 1XSVA 4X6AJ 1MBFA 1ITYA 2R7DA 2PX9A 2G7LA 2L54A 2RQPA 2BY3A 5E8IA 3NS4A 2I8DA 5J1UA 4PUSA 2C6YA 4XICA 2A6EF 4OAYA 1Q1HA 5F1RA 3AQTA 3IP4B 3FWEA 1ERDA 4KISA 1TL8A 3WTWC 3SYTA 5CYVA 3K70C 3TDUC
chains in the Genus database with same CATH topology
2K9NA 4MFEA 3K2AA 3IH4A 5EGOB 4MFDA 3A01B 3TP0A 2HYJA 4BY7J 4QTRA 3JRFA 3V6GA 3SFIA 1IDYA 2HXIA 3QBMA 3WHCA 3RZDJ 3HKZN 1JTXA 2ELKA 4B4CA 4UDSA 1MH3A 3AQSA 3I4MJ 2DA7A 3BCGA 3GTMJ 2YS9A 4MO7A 4ABZA 3JSJA 2JJ7A 2LR8A 1MH4A 1T33A 5J1YA 4BBSJ 4RBOA 4AC0A 2CU7A 2ZOYA 4GCKA 3HOZJ 2L7MP 1GT0C 2XSDC 5BNGA 2R5YA 1PUFA 1IG7A 5C4YA 2DA3A 5J1RA 5C44J 5EZGA 3ZQIA 3VPRA 5FKOA 2Y9ZA 3COLA 3BR6A 4A69C 1K83J 4A3GJ 1FJLA 3JR9A 3LSRA 4A93J 3S1RJ 1RKTA 2MW8A 5GPCA 3DPJA 3VOXA 4UUSA 1A5JA 2DN0A 5EG0B 2HKUA 1TWAJ 1HCRA 1MBGA 2R5ZB 4A3EJ 5JLXA 3JRGA 2GENA 5FKLA 5C4JJ 3PO2J 3ZQHA 3K7AJ 1ETYA 3NI7A 1K61A 2WUIA 3LSPA 2XPVA 3Q0UA 3BG3A 2VKEA 2LTPA 3NRGA 3BQYA 3MKLA 1GUUA 1VFCA 5EGOA 4J19A 3JRCA 5F0HA 3A01A 1ETXA 3ZQLA 1JJ6C 4CYCB 1I6HJ 4Y7NJ 5K7ZA 3GTKJ 1OFCX 2XGDA 2XDNA 1WPKA 4X1EA 4UUTA 1FIPA 2ID6A 2Q24A 3B6CA 1TWFJ 4S0HB 5M5XJ 2ECBA 2VPRA 5IPAA 3T6NA 2X48A 3BNIA 2JK3A 2M34A 3BR2A 3CQZJ 2H1KA 2Y2ZA 3MN2A 2O8KA 1RPWA 4YZEA 3MNLA 1QRYA 4JX4A 3GTOJ 5E3MA 3RH2A 3HB9A 5DS9A 3OSGA 2M2EA 3P9TA 2R92J 3FIWA 3VOKA 3QKXA 2M9HA 1SGMA 5EG0A 2NS8A 2M8GX 2Y9YA 1LE8A 1X58A 1AU7A 5CXIA 3JRAA 1O4XA 3S2DJ 4GFLA 3H3VK 1WH7A 3S16J 4W97A 4GFKA 3DCFA 1GV5A 5IP7J 2TRTA 4A3MJ 2VUMJ 5D18A 3PM1A 2FQ4A 1FTZA 3V78A 2ECCA 4KWAA 4QSHA 2XPWA 1SANA 3M4OJ 1JT0A 4CYCA 4A3KJ 1H88C 3S1NJ 3BG9A 2R5YB 1PUFB 1HDPA 3G1MA 4HNVA 2R0QC 5AQCA 2JA8J 5HAWA 4BKXA 2NX4A 2O7OA 1F43A 5FMPA 2FD5A 2XGCA 3JRDA 2E2JJ 1X2MA 3HEFA 3QPSA 4G12A 3S14J 4UUSB 9ANTA 2E1OA 2KDZA 1RKWA 2V57A 2LK2A 3HOWJ 1U9NA 1P7IA 4AUXA 4MLOA 4A3DJ 1IGNA 3HOYJ 4C3IJ 2QF7A 1AKHA 3RQIA 4AF5A 3HOUJ 3E7LA 3IUVA 2JWTA 5F0CA 1IJWC 1E3OC 2DA1A 2K9QA 5IYBJ 1IDZA 4MK6A 5HODA 3QQAA 1SFOJ 2REKA 3BR5A 1JKQC 3RZOJ 5FLMJ 4XRMA 1FIAA 5FHPA 5FKNA 4M3BA 4AYBN 3LWJA 2G7SA 3VVYA 4MXMA 3FK6A 1JJ8C 1ZTRA 4D7NA 4FE4A 2LFBA 4EEFG 4D5FA 3CWRA 3G56A 1Q1VA 1ETOA 2E2IJ 2NOGA 2XB5A 3B6AA 2L7FP 3HOXJ 1POGA 2PZ9A 3VP5A 2IU5A 2F07A 3E7QA 2MGQA 4JX5A 2CQXA 2DMPA 2K40A 3FISA 3VUQA 1TWGJ 5E3LA 2NVQJ 4FE7A 1ZR2A 2LKXA 2NVTJ 2NP5A 2QWTA 2CUEA 2HOAA 1Y1WJ 3GEUA 2UXIA 2FBQA 3L1PA 2HOSA 2NS7A 1UI5A 2PBXA 1LE8B 5K7FA 3C2BA 3TP3A 1ENHA 1AHDP 2O9LA 5D1RA 1HLVA 2E19A 3OIOA 3O8GA 5M3MJ 1H89C 1ORKA 5HSZA 3GTJJ 4MIMA 2QCOA 3HM5A 3BT9A 1RETA 2ME6A 1B72B 2WGBA 1CQTA 2UXHA 1U78A 1LFUP 1VNDA 2K9SA 1BJZA 2G0EA 1ZK8A 5DTDA 1XC5A 3HTHA 1XS9A 1QVTA 5IYCJ 2R7ZJ 3VIBA 3D1NI 1MBHA 2EZKA 1BL0A 5E3OA 3TW7A 4L62A 2QOPA 4NN1A 4DZJA 2JA7J 5F04A 1UMQA 1X2NA 4ME9A 4DYRA 4ACIA 2W53A 5FJ8J 4IHWA 2COBA 2DMNA 4BBRJ 1ZKGA 3IV5A 3I4NJ 3ZOBA 2O7TA 2VI6A 2RASA 3C07A 2HXOA 2DMTA 5M3FJ 5FKKA 4B3AA 2ZCMA 1JT6A 3NXCA 1UG2A 2R93J 3JRBA 3OSFA 1AKHB 1BW6A 5C3EJ 3BTJA 1MSFC 3BQZA 2ZCNA 1ETQA 3DEWA 5JLWA 2MSYA 1G2HA 2Y31A 3BTIA 3HDDA 5J3LA 1TC3C 2HOTA 2LP0A 1IRZA 3NNRA 5EEAA 2WV1A 1D5YA 2CQQA 2GUHA 4I6ZA 1DU6A 1OCPA 3NPIA 2FX0A 1HOMA 1W0UA 3HGYA 5IYDJ 4A3FJ 4A3LJ 1WI3A 2P81A 1ZR4A 3TEDA 5FGLA 3BRUA 1B72A 4M3EA 4M3GA 3LNQA 2IEKA 5C4XJ 1JUSA 2ZB9A 2EBIA 1W0TA 3F1BA 4RDUA 2B63J 2I10A 2M0CA 1EF4A 3CJDA 1S7EA 3CMYA 3S2HJ 2YVHA 1NK3P 3M3YJ 2UXPA 4XK4A 3KZ9A 3IH2A 1T56A 4A3JJ 3S1MJ 3HTIA 3QPLA 2Y30A 3W6VA 2E2HJ 5FLVA 2HYTA 2IAIA 4IEJA 2DMUA 4XIDA 3S1QJ 2ZOZA 3UKGA 2DA2A 3A02A 3HIMA 3BR3A 3GBGA 1JUPA 1DU0A 2RHAA 4JKZA 2N8GA 1NTCA 2AO9A 4L5EA 3S5RA 2GM4A 2FJ1A 2KT0A 1RESA 2MG4A 3BR1A 1APLC 1NK2P 3FRQA 4CGRA 1ETKA 1MNMC 5EFYA 2ZCXA 4DW6A 3LSGA 4IHVA 4GCLA 2X6OA 4DZPA 4Y52J 1VI0A 3HOVJ 3CCYA 2EZLA 5CXGA 1P7JA 5M5WJ 3KNWA 4D5CA 2VKVA 3A03A 3GTQJ 3G1OA 2GBYA 1JKOC 2QTQA 3BHQA 1ZQ3P 5EZHA 4A3IJ 2OI8A 4ICHA 5DAJA 2NVXJ 1TWHJ 2AHQA 1GVDA 1MBJA 4XRSG 4C2MJ 4AC6A 5K58A 5IP6A 3WHBA 2W48A 2OF7A 3GZIA 1B8IA 3ZQCA 4JYKA 5EF6A 2TCTA 2NVYJ 1Z77A 3JREA 1OCTC 2H8RA 4QIWN 2UXUA 2ME0A 3KKDA 1H8AC 1ETWA 5FKMA 3PPBA 3BR0A 5K7HA 4A3BJ 3BJBA 3LJLA 4D7MA 3VW2A 2CJJA 4JNNA 2HI3A 2CRGA 2DMQA 1YRNA 3BG5A 1MBEA 2JA6J 1FEXA 2XB0X 3NAUA 3RD3A 4BXXJ 2DTZA 2EZIA 4JX6A 4HKUA 2EH3A 3LOCA 2WB1N 3ANGA 2IBDA 2G3BA 3LHQA 2GFNA 4DYQA 2HQ5A 1ETVA 4V2GA 3PASA 2NP3A 3VVZA 1IV6A 3BTLA 1IC8A 1QPIA 1GDTA 4JL3A 1WGXA 1BA5A 3Q0VA 2UXOA 4DYCA 2L7ZA 3ZQFA 4PXIA 2YU9J 3Q0WA 4A3CJ 4GFBA 4C3JJ 1A6IA 1U9OA 5GPAA 5M5YJ 3SJMA 4NDLA 3FK7A 3S15J 2LVSA 3PO3J 2LD5A 4I76A 4M3DA 2DG7A 5H9TA 4FCYA 2Y0SN 5IOYA 1IUFA 3O60A 3RKQA 2GLOA 2RAEA 3HTAA 3G1LA 5F0FA 3HTJA 5F27A 1JUMA 2D6YA 2LLKA 1JKPC 2G7GA 3FKIJ 3JRIA 2WAQN 3HE0A 5EDNA 2X9DA 3VW1A 2JN6A 1R9TJ 1HDDC 3HGGA 3BTCA 5D19A 1MSEC 3S17J 3VVXA 2LY9A 2XGEA 2PMZN 4LOCA 3ZQGA 2EZHA 1ZGWA 1JKRC 2YUSA 3VW0A 5CW8A 5GP9A 2D5VA 4B1RA 2YVEA 1JTYA 2QIBA 2L0KA 1FTTA 1QVUA 3EGQA 3Q3SA 3CRJA 3GTGJ 4GCTA 5IP9J 3GTPJ 2OPTA 3JRHA 2XPUA 1MBKA 2DA6A 5IOZA 1UI6A 3NARA 2OERA 1BW5A 4NELA 1B8IB 4M6VA 1U8BA 3GTLJ 4XRSA 2R5ZA 2HDDA 3ANPA 1VF9A 3O8HA 4C3HJ 3SDGA 2XRLA 2DA5A 4IHXA 4FTHA 1LFBA 1RR7A 2JMWA 2DG8A 1OJLA 1XG1A 2JA5J 2DJNA 4IHYA 4JP0A 1YRNB 3LSJA 3EUPA 3F0CA 3ON2A 1GV2A 2ID3A 3HBLA 1F36A 1I50J 3B81A 1WCMJ 5F1JA 1Z0XA 3G7RA 4W1UA 3CDLA 4X6AJ 1MBFA 2CUFA 3ON4A 1ITYA 1UHSA 3MVPA 1HF0A 2G7LA 4M3FA 3TW6A 1TWCJ 4V2FA 5J1UA 1WH5A 4FISA 5E3NA 4XICA 5F08A 5EYRA 2L9RA 3AQTA 1Y1VJ 1JGGA 3IH3A 2DA4A 1I3QJ 3OOUA 2EQRA 4BY1J 2QKOA 5HBUA 3KKCA 3H0GJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9N A;  4MFE A;  3K2A A;  3IH4 A;  5EGO B;  4MFD A;  3A01 B;  3TP0 A;  2HYJ A;  4BY7 J;  4QTR A;  3JRF A;  3V6G A;  3SFI A;  1IDY A;  2HXI A;  3QBM A;  3WHC A;  3RZD J;  3HKZ N;  1JTX A;  2ELK A;  4B4C A;  4UDS A;  1MH3 A;  3AQS A;  3I4M J;  2DA7 A;  3BCG A;  3GTM J;  2YS9 A;  4MO7 A;  4ABZ A;  3JSJ A;  2JJ7 A;  2LR8 A;  1MH4 A;  1T33 A;  5J1Y A;  4BBS J;  4RBO A;  4AC0 A;  2CU7 A;  2ZOY A;  4GCK A;  3HOZ J;  2L7M P;  1GT0 C;  2XSD C;  5BNG A;  2R5Y A;  1PUF A;  1IG7 A;  5C4Y A;  2DA3 A;  5J1R A;  5C44 J;  5EZG A;  3ZQI A;  3VPR A;  5FKO A;  2Y9Z A;  3COL A;  3BR6 A;  4A69 C;  1K83 J;  4A3G J;  1FJL A;  3JR9 A;  3LSR A;  4A93 J;  3S1R J;  1RKT A;  2MW8 A;  5GPC A;  3DPJ A;  3VOX A;  4UUS A;  1A5J A;  2DN0 A;  5EG0 B;  2HKU A;  1TWA J;  1HCR A;  1MBG A;  2R5Z B;  4A3E J;  5JLX A;  3JRG A;  2GEN A;  5FKL A;  5C4J J;  3PO2 J;  3ZQH A;  3K7A J;  1ETY A;  3NI7 A;  1K61 A;  2WUI A;  3LSP A;  2XPV A;  3Q0U A;  3BG3 A;  2VKE A;  2LTP A;  3NRG A;  3BQY A;  3MKL A;  1GUU A;  1VFC A;  5EGO A;  4J19 A;  3JRC A;  5F0H A;  3A01 A;  1ETX A;  3ZQL A;  1JJ6 C;  4CYC B;  1I6H J;  4Y7N J;  5K7Z A;  3GTK J;  1OFC X;  2XGD A;  2XDN A;  1WPK A;  4X1E A;  4UUT A;  1FIP A;  2ID6 A;  2Q24 A;  3B6C A;  1TWF J;  4S0H B;  5M5X J;  2ECB A;  2VPR A;  5IPA A;  3T6N A;  2X48 A;  3BNI A;  2JK3 A;  2M34 A;  3BR2 A;  3CQZ J;  2H1K A;  2Y2Z A;  3MN2 A;  2O8K A;  1RPW A;  4YZE A;  3MNL A;  1QRY A;  4JX4 A;  3GTO J;  5E3M A;  3RH2 A;  3HB9 A;  5DS9 A;  3OSG A;  2M2E A;  3P9T A;  2R92 J;  3FIW A;  3VOK A;  3QKX A;  2M9H A;  1SGM A;  5EG0 A;  2NS8 A;  2M8G X;  2Y9Y A;  1LE8 A;  1X58 A;  1AU7 A;  5CXI A;  3JRA A;  1O4X A;  3S2D J;  4GFL A;  3H3V K;  1WH7 A;  3S16 J;  4W97 A;  4GFK A;  3DCF A;  1GV5 A;  5IP7 J;  2TRT A;  4A3M J;  2VUM J;  5D18 A;  3PM1 A;  2FQ4 A;  1FTZ A;  3V78 A;  2ECC A;  4KWA A;  4QSH A;  2XPW A;  1SAN A;  3M4O J;  1JT0 A;  4CYC A;  4A3K J;  1H88 C;  3S1N J;  3BG9 A;  2R5Y B;  1PUF B;  1HDP A;  3G1M A;  4HNV A;  2R0Q C;  5AQC A;  2JA8 J;  5HAW A;  4BKX A;  2NX4 A;  2O7O A;  1F43 A;  5FMP A;  2FD5 A;  2XGC A;  3JRD A;  2E2J J;  1X2M A;  3HEF A;  3QPS A;  4G12 A;  3S14 J;  4UUS B;  9ANT A;  2E1O A;  2KDZ A;  1RKW A;  2V57 A;  2LK2 A;  3HOW J;  1U9N A;  1P7I A;  4AUX A;  4MLO A;  4A3D J;  1IGN A;  3HOY J;  4C3I J;  2QF7 A;  1AKH A;  3RQI A;  4AF5 A;  3HOU J;  3E7L A;  3IUV A;  2JWT A;  5F0C A;  1IJW C;  1E3O C;  2DA1 A;  2K9Q A;  5IYB J;  1IDZ A;  4MK6 A;  5HOD A;  3QQA A;  1SFO J;  2REK A;  3BR5 A;  1JKQ C;  3RZO J;  5FLM J;  4XRM A;  1FIA A;  5FHP A;  5FKN A;  4M3B A;  4AYB N;  3LWJ A;  2G7S A;  3VVY A;  4MXM A;  3FK6 A;  1JJ8 C;  1ZTR A;  4D7N A;  4FE4 A;  2LFB A;  4EEF G;  4D5F A;  3CWR A;  3G56 A;  1Q1V A;  1ETO A;  2E2I J;  2NOG A;  2XB5 A;  3B6A A;  2L7F P;  3HOX J;  1POG A;  2PZ9 A;  3VP5 A;  2IU5 A;  2F07 A;  3E7Q A;  2MGQ A;  4JX5 A;  2CQX A;  2DMP A;  2K40 A;  3FIS A;  3VUQ A;  1TWG J;  5E3L A;  2NVQ J;  4FE7 A;  1ZR2 A;  2LKX A;  2NVT J;  2NP5 A;  2QWT A;  2CUE A;  2HOA A;  1Y1W J;  3GEU A;  2UXI A;  2FBQ A;  3L1P A;  2HOS A;  2NS7 A;  1UI5 A;  2PBX A;  1LE8 B;  5K7F A;  3C2B A;  3TP3 A;  1ENH A;  1AHD P;  2O9L A;  5D1R A;  1HLV A;  2E19 A;  3OIO A;  3O8G A;  5M3M J;  1H89 C;  1ORK A;  5HSZ A;  3GTJ J;  4MIM A;  2QCO A;  3HM5 A;  3BT9 A;  1RET A;  2ME6 A;  1B72 B;  2WGB A;  1CQT A;  2UXH A;  1U78 A;  1LFU P;  1VND A;  2K9S A;  1BJZ A;  2G0E A;  1ZK8 A;  5DTD A;  1XC5 A;  3HTH A;  1XS9 A;  1QVT A;  5IYC J;  2R7Z J;  3VIB A;  3D1N I;  1MBH A;  2EZK A;  1BL0 A;  5E3O A;  3TW7 A;  4L62 A;  2QOP A;  4NN1 A;  4DZJ A;  2JA7 J;  5F04 A;  1UMQ A;  1X2N A;  4ME9 A;  4DYR A;  4ACI A;  2W53 A;  5FJ8 J;  4IHW A;  2COB A;  2DMN A;  4BBR J;  1ZKG A;  3IV5 A;  3I4N J;  3ZOB A;  2O7T A;  2VI6 A;  2RAS A;  3C07 A;  2HXO A;  2DMT A;  5M3F J;  5FKK A;  4B3A A;  2ZCM A;  1JT6 A;  3NXC A;  1UG2 A;  2R93 J;  3JRB A;  3OSF A;  1AKH B;  1BW6 A;  5C3E J;  3BTJ A;  1MSF C;  3BQZ A;  2ZCN A;  1ETQ A;  3DEW A;  5JLW A;  2MSY A;  1G2H A;  2Y31 A;  3BTI A;  3HDD A;  5J3L A;  1TC3 C;  2HOT A;  2LP0 A;  1IRZ A;  3NNR A;  5EEA A;  2WV1 A;  1D5Y A;  2CQQ A;  2GUH A;  4I6Z A;  1DU6 A;  1OCP A;  3NPI A;  2FX0 A;  1HOM A;  1W0U A;  3HGY A;  5IYD J;  4A3F J;  4A3L J;  1WI3 A;  2P81 A;  1ZR4 A;  3TED A;  5FGL A;  3BRU A;  1B72 A;  4M3E A;  4M3G A;  3LNQ A;  2IEK A;  5C4X J;  1JUS A;  2ZB9 A;  2EBI A;  1W0T A;  3F1B A;  4RDU A;  2B63 J;  2I10 A;  2M0C A;  1EF4 A;  3CJD A;  1S7E A;  3CMY A;  3S2H J;  2YVH A;  1NK3 P;  3M3Y J;  2UXP A;  4XK4 A;  3KZ9 A;  3IH2 A;  1T56 A;  4A3J J;  3S1M J;  3HTI A;  3QPL A;  2Y30 A;  3W6V A;  2E2H J;  5FLV A;  2HYT A;  2IAI A;  4IEJ A;  2DMU A;  4XID A;  3S1Q J;  2ZOZ A;  3UKG A;  2DA2 A;  3A02 A;  3HIM A;  3BR3 A;  3GBG A;  1JUP A;  1DU0 A;  2RHA A;  4JKZ A;  2N8G A;  1NTC A;  2AO9 A;  4L5E A;  3S5R A;  2GM4 A;  2FJ1 A;  2KT0 A;  1RES A;  2MG4 A;  3BR1 A;  1APL C;  1NK2 P;  3FRQ A;  4CGR A;  1ETK A;  1MNM C;  5EFY A;  2ZCX A;  4DW6 A;  3LSG A;  4IHV A;  4GCL A;  2X6O A;  4DZP A;  4Y52 J;  1VI0 A;  3HOV J;  3CCY A;  2EZL A;  5CXG A;  1P7J A;  5M5W J;  3KNW A;  4D5C A;  2VKV A;  3A03 A;  3GTQ J;  3G1O A;  2GBY A;  1JKO C;  2QTQ A;  3BHQ A;  1ZQ3 P;  5EZH A;  4A3I J;  2OI8 A;  4ICH A;  5DAJ A;  2NVX J;  1TWH J;  2AHQ A;  1GVD A;  1MBJ A;  4XRS G;  4C2M J;  4AC6 A;  5K58 A;  5IP6 A;  3WHB A;  2W48 A;  2OF7 A;  3GZI A;  1B8I A;  3ZQC A;  4JYK A;  5EF6 A;  2TCT A;  2NVY J;  1Z77 A;  3JRE A;  1OCT C;  2H8R A;  4QIW N;  2UXU A;  2ME0 A;  3KKD A;  1H8A C;  1ETW A;  5FKM A;  3PPB A;  3BR0 A;  5K7H A;  4A3B J;  3BJB A;  3LJL A;  4D7M A;  3VW2 A;  2CJJ A;  4JNN A;  2HI3 A;  2CRG A;  2DMQ A;  1YRN A;  3BG5 A;  1MBE A;  2JA6 J;  1FEX A;  2XB0 X;  3NAU A;  3RD3 A;  4BXX J;  2DTZ A;  2EZI A;  4JX6 A;  4HKU A;  2EH3 A;  3LOC A;  2WB1 N;  3ANG A;  2IBD A;  2G3B A;  3LHQ A;  2GFN A;  4DYQ A;  2HQ5 A;  1ETV A;  4V2G A;  3PAS A;  2NP3 A;  3VVZ A;  1IV6 A;  3BTL A;  1IC8 A;  1QPI A;  1GDT A;  4JL3 A;  1WGX A;  1BA5 A;  3Q0V A;  2UXO A;  4DYC A;  2L7Z A;  3ZQF A;  4PXI A;  2YU9 J;  3Q0W A;  4A3C J;  4GFB A;  4C3J J;  1A6I A;  1U9O A;  5GPA A;  5M5Y J;  3SJM A;  4NDL A;  3FK7 A;  3S15 J;  2LVS A;  3PO3 J;  2LD5 A;  4I76 A;  4M3D A;  2DG7 A;  5H9T A;  4FCY A;  2Y0S N;  5IOY A;  1IUF A;  3O60 A;  3RKQ A;  2GLO A;  2RAE A;  3HTA A;  3G1L A;  5F0F A;  3HTJ A;  5F27 A;  1JUM A;  2D6Y A;  2LLK A;  1JKP C;  2G7G A;  3FKI J;  3JRI A;  2WAQ N;  3HE0 A;  5EDN A;  2X9D A;  3VW1 A;  2JN6 A;  1R9T J;  1HDD C;  3HGG A;  3BTC A;  5D19 A;  1MSE C;  3S17 J;  3VVX A;  2LY9 A;  2XGE A;  2PMZ N;  4LOC A;  3ZQG A;  2EZH A;  1ZGW A;  1JKR C;  2YUS A;  3VW0 A;  5CW8 A;  5GP9 A;  2D5V A;  4B1R A;  2YVE A;  1JTY A;  2QIB A;  2L0K A;  1FTT A;  1QVU A;  3EGQ A;  3Q3S A;  3CRJ A;  3GTG J;  4GCT A;  5IP9 J;  3GTP J;  2OPT A;  3JRH A;  2XPU A;  1MBK A;  2DA6 A;  5IOZ A;  1UI6 A;  3NAR A;  2OER A;  1BW5 A;  4NEL A;  1B8I B;  4M6V A;  1U8B A;  3GTL J;  4XRS A;  2R5Z A;  2HDD A;  3ANP A;  1VF9 A;  3O8H A;  4C3H J;  3SDG A;  2XRL A;  2DA5 A;  4IHX A;  4FTH A;  1LFB A;  1RR7 A;  2JMW A;  2DG8 A;  1OJL A;  1XG1 A;  2JA5 J;  2DJN A;  4IHY A;  4JP0 A;  1YRN B;  3LSJ A;  3EUP A;  3F0C A;  3ON2 A;  1GV2 A;  2ID3 A;  3HBL A;  1F36 A;  1I50 J;  3B81 A;  1WCM J;  5F1J A;  1Z0X A;  3G7R A;  4W1U A;  3CDL A;  4X6A J;  1MBF A;  2CUF A;  3ON4 A;  1ITY A;  1UHS A;  3MVP A;  1HF0 A;  2G7L A;  4M3F A;  3TW6 A;  1TWC J;  4V2F A;  5J1U A;  1WH5 A;  4FIS A;  5E3N A;  4XIC A;  5F08 A;  5EYR A;  2L9R A;  3AQT A;  1Y1V J;  1JGG A;  3IH3 A;  2DA4 A;  1I3Q J;  3OOU A;  2EQR A;  4BY1 J;  2QKO A;  5HBU A;  3KKC A;  3H0G J; 
#chains in the Genus database with same CATH topology
 1FNN A;  2KP6 A;  5E17 F;  1N25 A;  3K2A A;  3IH4 A;  1HKQ A;  2DT6 A;  3LSK A;  3H5N A;  3WTS C;  2F5E A;  4BU2 A;  2H6B A;  2ZXJ A;  3CCE I;  3SFI A;  1IDY A;  2QSF X;  3QBM A;  4E7J A;  5H2F C;  1FBS A;  3LA7 A;  4M72 A;  3V7R A;  4ENJ A;  3FZV A;  4HA8 A;  4UDS A;  4P96 A;  1MH3 A;  2BEO A;  3I4M J;  2MA3 A;  4XQF A;  1QHG A;  3HUG B;  3RKX A;  1BIB A;  1OIS A;  4A5M A;  2DJI A;  5J1Y A;  1S7O A;  4IJA A;  2QA4 I;  4RBO A;  2A6T A;  1IN6 A;  1ZG3 A;  2CU7 A;  2F4O B;  4DOZ A;  3HOZ J;  3LMM A;  4N4O B;  1MMN A;  3DFG A;  1HW5 A;  2F6C A;  3M9A A;  1IN7 A;  5C44 J;  2WAE A;  3H5R A;  3BCA A;  1IXS B;  2VJI A;  4BEH B;  2LY1 A;  1K83 J;  4A3G J;  1FJL A;  2XHK A;  3L2U A;  2QQA A;  3ZQQ A;  5LGN A;  3LSR A;  3L09 A;  2MW8 A;  2Z99 A;  3E5Q A;  2WV0 A;  5EG0 B;  3HOT A;  2L4A A;  1TWA J;  3MWM A;  2ZKZ A;  3AG2 H;  2HZD A;  5C4J J;  4MTD A;  3IUO A;  1Z05 A;  2M7B A;  1K61 A;  2XPV A;  3Q0U A;  3BG3 A;  2VKE A;  4WF2 A;  1OYW A;  2LTP A;  1W5S A;  4E7L A;  3BQY A;  3IWF A;  4H4K C;  3VYT B;  5LHH A;  1IF1 A;  2KMU A;  2A61 A;  4EJU A;  5EGO A;  5LD2 C;  3JRC A;  3A01 A;  2GXA A;  3FBN B;  2R7V A;  4HV6 A;  1LVA A;  4RB3 C;  4B3X A;  3QP6 A;  3FM5 A;  3ML6 A;  3CME I;  3CP2 A;  2XDN A;  4WXH A;  4ZZL A;  4EQQ A;  1X19 A;  2HPM A;  2LBF B;  1FIP A;  3DU5 A;  2BOL A;  5B3S H;  1TWF J;  1R7J A;  2WWY A;  5IPA A;  1ZAO A;  1ON1 A;  3VYS B;  3ERM A;  2TDX A;  3CQZ J;  2L4M A;  1Y56 A;  2H1K A;  1TZL A;  1V5G A;  4UB8 C;  2WB1 A;  2PFV A;  4YZE A;  1DQU A;  1XGM A;  2BY2 A;  5J8C A;  2DFE A;  3RH2 A;  5LHG A;  4DIQ A;  1B6A A;  2M9H A;  3FMR A;  2VBW A;  2NS8 A;  2M8G X;  1LE8 A;  2ELH A;  4LIT A;  1AU7 A;  1FOX A;  1O4X A;  4H0E A;  1A04 A;  2Q0O A;  4GFK A;  3BDD A;  3D5R C;  2DPD A;  3CD6 I;  1YW7 A;  2X0L A;  1FTZ A;  4L18 B;  4OIR F;  4KWA A;  2Y0S A;  2DQL A;  2F4I A;  3A0B C;  4FAS D;  5FRO A;  4CYC A;  1H88 C;  1B59 A;  3VFZ A;  3DQV C;  2R5Y B;  3WU2 C;  4KJZ A;  4EV0 A;  2PEX A;  5D4R A;  4HNV A;  3TKY A;  2R0Q C;  4L9J A;  3H0D A;  3I54 A;  3OYA A;  1B4A A;  2WAQ A;  3O3K A;  4CH7 A;  5FB2 A;  2EV0 A;  5DEQ A;  5FFZ A;  1KYZ A;  3L2V A;  1QO0 D;  4UXN A;  1KQ8 A;  5CVU A;  1YW8 A;  3A1Y A;  4RGU A;  2EIJ H;  3HOW J;  1P7I A;  4P5O A;  2UV1 A;  5E1Z B;  3HOY J;  3WOD F;  3RQI A;  5BMZ A;  3JW4 A;  3COA C;  2ZY9 A;  3E7L A;  1Z9C A;  2F4M B;  2JWT A;  1IJW C;  3GXO A;  5IYB J;  1YIJ I;  3BR5 A;  3ULQ B;  4IQ4 A;  3V42 A;  1G3S A;  1W5C C;  3RZO J;  2X6W A;  1A6Q A;  1HKS A;  2G7S A;  1D8J A;  1VQM I;  1UG0 A;  1ZTR A;  5GTI C;  1H0M A;  1DP7 P;  3WGI A;  2NOG A;  3B6A A;  1DDN A;  2XAH A;  1POG A;  2PZ9 A;  5D6F A;  2IU5 A;  2V79 A;  5FRM A;  5H20 A;  2MGQ A;  4HYE A;  2ZFW A;  4XON A;  2K40 A;  3W2W A;  3VUQ A;  4M73 A;  3LA3 A;  4UUV A;  2IGK A;  3OIP A;  2NVT J;  2H1L A;  2QWT A;  2JVH A;  2OJE D;  3F8F A;  3GEU A;  1BOA A;  5DCF A;  4YG2 F;  3CCM I;  2Z1D A;  2FU4 A;  2NS7 A;  2FJI 1;  4MQ9 F;  4OAZ A;  2ZXW H;  4XLA A;  2PG4 A;  2VBY A;  4ZYE A;  5A2Q K;  3J7A O;  2CW8 A;  4P9U A;  1IXC A;  1MDM A;  1ORK A;  2VBZ A;  1UHM A;  1HW1 A;  4OD5 A;  2QCO A;  4GGG A;  4UVB A;  2YU3 A;  3M8J A;  2ME6 A;  4XLP F;  2IGM A;  3C7J A;  1K7A A;  2XAU A;  3CLO A;  1R1V A;  2CWE A;  5K5O A;  1LFU P;  4ESF A;  1XC5 A;  3HTH A;  1XS9 A;  1G3T A;  3F21 A;  1EV7 A;  2L5Q A;  1SFU A;  3OOP A;  3VIB A;  2EZK A;  4U7B A;  3HKZ A;  3TO6 A;  4L62 A;  4DZJ A;  3F22 A;  2JA7 J;  1TQM A;  1UMQ A;  1X2N A;  2Q1Z B;  1JGS A;  4PSX A;  1LKX A;  2W53 A;  4KIB A;  5FJ8 J;  2K5C A;  5CPR B;  2OBP A;  3BPV A;  3I4N J;  3K4K A;  5J4Y A;  2VI6 A;  5KK1 A;  4A12 A;  3HHH A;  4B3A A;  2ZCM A;  1TLH B;  1JT6 A;  2ZSI B;  4E4H A;  1STZ A;  2DDA A;  2RN7 A;  3JRB A;  3H35 A;  3N97 A;  5C3E J;  2HDC A;  3CJT B;  1R71 A;  1FBU A;  4KN4 X;  1MMD A;  1G2H A;  3K1M A;  5DD4 A;  2A6H F;  2STW A;  3MZY A;  2LP0 A;  4IHS A;  1P4W A;  4BUP A;  4WX9 A;  2BXY A;  3LST A;  4F55 A;  1XSD A;  3CDH A;  1Y0N A;  1FWZ A;  1ZN2 A;  2DOF A;  5HLG A;  5IYD J;  2BW3 A;  4WCG A;  3PQJ A;  4EGY A;  1WI3 A;  2FF4 A;  5CVJ A;  4M3E A;  3JSO A;  2P5L C;  5C4X J;  4D9J A;  1PDN C;  4HF2 A;  4LIV A;  2QKL B;  3HIF A;  3ISP A;  4IPA A;  1W0T A;  2DYR H;  3DF8 A;  4YII A;  2DCE A;  3S2H J;  1SVM A;  5GAD J;  4NHJ A;  2ICW G;  4R8H A;  4XK4 A;  3KZ9 A;  2Q8K A;  4ZJZ A;  2VQL A;  1OCO H;  3S1M J;  4F92 B;  3IL2 A;  3ECH A;  4F52 A;  3IWZ A;  3QOP A;  2KRH A;  2DMU A;  2DXI A;  3S1Q J;  3QYB A;  1FP2 A;  1RC9 A;  2DA2 A;  1MJ9 A;  3BR3 A;  3GBG A;  1DU0 A;  2L9S A;  2M45 A;  5ICC A;  2N8G A;  3HL2 A;  3K69 A;  2L3D A;  2DPU A;  1NTC A;  1BN5 A;  1U8R A;  4KFC A;  4C2U A;  2EFP A;  4MQV A;  5LGU A;  4CGR A;  2RVC A;  3H1C A;  1ON2 A;  4ENN A;  2ZCX A;  2FSW A;  2CS3 A;  2X6O A;  3SEZ A;  4YFN F;  5HDK A;  2EZL A;  5CXG A;  2MC3 A;  3TO9 A;  3KLN A;  4Y15 A;  1R49 A;  3M8E A;  3A03 A;  1EH7 A;  3K4C A;  1JHF A;  4RGR A;  2QTQ A;  3BHQ A;  3K1N A;  1ZQ3 P;  2XAJ A;  4A3I J;  2CH0 A;  1E0E A;  5JR3 A;  3PNT A;  3R6S A;  1V54 H;  4WIB A;  2NVX J;  3WTY C;  4II3 A;  4C2T A;  1GVD A;  3LAJ A;  4XRS G;  4C2M J;  5K58 A;  1V5E A;  1W7P B;  4R1H A;  4AIH A;  3S3N A;  2KIQ A;  2TCT A;  1F1Z A;  3JRE A;  4BHC A;  2L9V A;  2EFQ A;  1M1E B;  1QZE A;  1ZGA A;  4QIW N;  2UXU A;  2EIL H;  2W82 A;  1H8A C;  1ETW A;  4LG0 B;  1QHH D;  3OV8 A;  5K7H A;  4B09 A;  3BJB A;  4EJW A;  4JNN A;  3F8C A;  2DMQ A;  3CUQ B;  4KMF A;  4BDY A;  1LEB A;  1YRN A;  2P4W A;  4XLC A;  4RS8 A;  3OS0 A;  4BXX J;  2YPR A;  2VOO A;  2WB1 N;  3ANG A;  2G3B A;  3BRO A;  4V2G A;  2FBK A;  3E5X A;  2OU2 A;  4AIJ A;  4M74 A;  1GDT A;  1BC8 C;  1WGX A;  2F2E A;  3CJQ B;  4F7Z A;  3OWT A;  4IRH A;  4DYC A;  1SFE A;  4RB0 A;  1WVR A;  4GFB A;  2CG4 A;  3MKW B;  2PN6 A;  5AIQ A;  3AL0 C;  5M5Y J;  1I1S A;  2E1M C;  4MEX F;  1X3Z B;  4DBR A;  2W1O A;  1Z6R A;  2JPB A;  4I76 A;  2KFD A;  1ZG1 A;  3FHZ A;  2V1D A;  2YX4 A;  2Y0S N;  3JTG A;  2RNG A;  1IUF A;  1YOV B;  2XDV A;  3O60 A;  3RKQ A;  2GZW A;  4F93 B;  2PJR A;  3HTA A;  2RGV A;  3G1L A;  3CCJ I;  4J00 A;  4G7Z F;  4PJN A;  2LLK A;  2AQF A;  1XMX A;  2V1X A;  4N0B A;  1O3Q A;  2G7G A;  3JRI A;  2WAQ N;  3AG4 H;  1P2F A;  3AG3 H;  3IKV A;  3HSF A;  5KAI C;  5EDN A;  2KIS A;  3P9I A;  4XMY A;  2W7N A;  3ERE D;  3OR2 C;  1YTY A;  3W3C A;  2LY9 A;  4ZTF A;  2LYC A;  1ZGW A;  5LGT A;  1K4S A;  1S3J A;  3VOE A;  5CW8 A;  4BQN A;  3FM3 A;  4NC8 A;  1JTY A;  3EET A;  2L0K A;  2QIB A;  3OYC A;  2KJC A;  2H94 A;  5D4S A;  3IKT A;  3GTG J;  4GCT A;  3GTP J;  3P9C A;  5FD6 A;  3O2P E;  2XPU A;  4QWQ A;  2DA6 A;  3K6G A;  5B1B H;  2M1B A;  1U8B A;  2CV1 A;  2CQK A;  1ODD A;  2VOP A;  3ZQ7 A;  3GTL J;  1FZP B;  2BXZ A;  2HPI A;  3CZ6 A;  4EGZ A;  3WTV C;  2LRE A;  1J0R A;  4HAM A;  2RNJ A;  4OIN F;  2R7W A;  3PJR A;  4FTH A;  2FE3 A;  1KZH A;  2LG4 A;  2DG8 A;  1OJL A;  3NQO A;  5DD8 A;  1XG1 A;  2DJN A;  3BY6 A;  4JP0 A;  1GV2 A;  1F36 A;  2W4S A;  3SZT A;  2DI3 A;  3G7R A;  4IXA A;  3SDB A;  1U5T B;  3T8R A;  3WU1 B;  3GLL A;  4KUM A;  5CLS A;  4XOR A;  5L3G A;  1IV8 A;  2E1N A;  3MVP A;  1L0O C;  1HC8 A;  2F5F A;  4V2F A;  3DTE A;  2QQ9 A;  1UHW A;  5TGT A;  3ZMV A;  5ED4 A;  1BR2 A;  1MMS A;  3B02 A;  5F08 A;  2L9R A;  3V8L A;  2BVM A;  2YSR A;  3EUH A;  3MZ8 A;  1IZ1 A;  1SD6 A;  1Y1V J;  2KRC A;  4MTE A;  4AIK A;  3IH3 A;  1JGG A;  1VQP I;  2ZSH B;  2EQR A;  2P5K A;  4BY1 J;  2IS6 A;  2OZ6 A;  2LMD A;  1NG6 A;  1Y39 A;  2MC4 A;  2W24 A;  2F48 A;  3H0G J;  3QPT A;  3U9G A;  2KDO A;  2K9N A;  2VAS A;  4MFE A;  5EGO B;  4AM3 A;  4MFD A;  3A01 B;  4G7H F;  2PI0 A;  2HYJ A;  4BY7 J;  1AWC A;  3V6G A;  4KIT B;  3K4L A;  4RGS A;  4B43 A;  1TW3 A;  2MLG A;  3RZD J;  2DOA A;  3A0H C;  4LB6 B;  3GZN B;  3HKZ N;  1JTX A;  2DBB A;  2ELK A;  4EJO A;  5IY5 H;  3PSI A;  3LL7 A;  2G7U A;  3E6B A;  4FET A;  3TO7 A;  2PJP A;  1UCR A;  4ABZ A;  2JJ7 A;  1O7F A;  2LR8 A;  2QVO A;  4BE1 A;  1B9N A;  2CQN A;  4AC0 A;  1MMA A;  5BQT A;  1SEU A;  4RAG A;  1H9T A;  3RIR A;  4HF1 A;  2ZOY A;  3K4J A;  3RJP A;  2JSP A;  5BNG A;  2XSD C;  3EUH C;  3ELK A;  3EYY A;  1IG7 A;  3K0L A;  1S9H A;  2MD0 A;  2DA3 A;  3F8B A;  5J1R A;  3ZQI A;  5HNH A;  5FKO A;  2XRO A;  2ACJ A;  3COL A;  3KP6 A;  2P6S A;  3CCU I;  1LDD A;  1RKT A;  2P5V A;  1SD7 A;  3GME A;  4UUS A;  3C1D A;  1A5J A;  3AFH A;  2HKU A;  1MBG A;  5JLX A;  5FGM A;  5FKL A;  1ZAR A;  1S72 I;  2Y0M A;  4KT5 C;  4Z2Y A;  1D1A A;  3ZQH A;  4HX8 A;  1MJA A;  1YLF A;  4OWR B;  3NRG A;  4AVP A;  4RLF A;  3H92 A;  2AS5 F;  1FOW A;  1WWX A;  5K5R A;  2LF7 A;  4PJJ A;  2HQA A;  2IXS A;  4YRV A;  4CYC B;  2GQQ A;  2LDU A;  4Y7N J;  3CMA I;  3GTK J;  1YS7 A;  3V7S A;  1ZGJ A;  4XKC A;  2G7H A;  2V4J C;  2WY8 Q;  2ISZ A;  3RPU D;  3GZ6 A;  1SC7 A;  1ZRC A;  3PQK A;  4M9X A;  2BVL A;  3I56 I;  1UEL B;  4N4N B;  2V1N A;  4WXD A;  3CC4 I;  2GXB A;  2ID6 A;  1GXQ A;  4S0H B;  5M5X J;  2OV7 A;  5CQG A;  1J9I A;  1R5I D;  2CV2 A;  2VPR A;  4HRI A;  3FXK A;  3J80 Z;  3T6N A;  5CVV A;  2X48 A;  2DTR A;  2JK3 A;  1R1U A;  2VC0 A;  1JI8 A;  4XN0 A;  2VKH A;  1RPW A;  5B1A H;  2IPQ X;  1QRY A;  4JX4 A;  3GTO J;  2EIM H;  3WG7 H;  3HB9 A;  5KCM A;  4PK4 A;  4NNJ A;  3DBL B;  3R60 A;  2FML A;  1NG7 A;  1W5T A;  2B9S A;  2DAO A;  1ULY A;  3KX2 A;  5CXI A;  2Y9Y A;  1X58 A;  5E79 C;  3NWS A;  4GFL A;  1WSU A;  2VB6 A;  4JOM A;  1X4O A;  3GW2 A;  1SMY F;  3LFK A;  2GXG A;  1ZRD A;  4P55 A;  3M8F A;  1PVE A;  1ZEL A;  3VYR B;  2VUM J;  4CXF A;  4CUG A;  5J47 A;  2FQ4 A;  2OQR A;  3V78 A;  4XOP A;  2KKO A;  2EIN H;  3H9G A;  1ZH5 A;  4RAZ A;  3M4O J;  4HOB A;  1JT0 A;  3N05 A;  2NOJ B;  2IP2 A;  3BG9 A;  1PUF B;  3HJE A;  3G1M A;  3WTU C;  4U0V A;  2E36 A;  4BKX A;  2O7O A;  5FMP A;  2GOM A;  2XGC A;  1OCR H;  3QPS A;  1Z6T A;  1R1T A;  2O5R A;  2KDZ A;  2ZXI A;  5E1W A;  1SMT A;  4ZDP A;  2QF7 A;  1AKH A;  5HOO A;  5F0C A;  3GZ5 A;  4GRI A;  4YFK F;  2IT0 A;  1IDZ A;  3EUK L;  4LB5 A;  1I3A A;  3QQA A;  5HOD A;  3EYI A;  4ASN A;  4LK1 F;  4FQG A;  1OPC A;  4CO8 A;  2BGC A;  3HRT A;  3OL4 A;  4BAY A;  3KEQ A;  4M3B A;  3TOB A;  1HKT A;  3LWJ A;  2D1V A;  3WU0 A;  3VVY A;  4MXM A;  3FK6 A;  1JJ8 C;  1V4R A;  1O3S A;  2OQG A;  3CC7 I;  3HSE A;  2YR2 A;  1TQI A;  1FYL A;  2PBI A;  3HOX J;  2WAF A;  2CQ7 A;  5D5W B;  3I3L A;  3E3V A;  3EUA A;  4I09 A;  4C9Y A;  4BH9 A;  3ECO A;  3ESW B;  1LQ1 A;  1XB4 A;  4FX0 A;  3QP5 A;  3UNG C;  2BYV E;  1Z67 A;  2A68 F;  4CCM A;  4JX5 A;  4IHT A;  1UJ8 A;  1G3W A;  3BZK A;  2QKM B;  4FE7 A;  2LNB A;  1I5Z A;  3F6O A;  2K3P A;  1HXD A;  2FBH A;  3LSI A;  3ABK H;  4ZYD A;  1C0W A;  3CES A;  4IRV A;  3DBH B;  1YJW I;  1K6O A;  2HS5 A;  3LFU A;  2WTE A;  2MBF A;  2X6Y A;  3L1P A;  2VQH A;  3BG7 A;  1UI5 A;  2PBX A;  3ZMS A;  3I4P A;  2E60 A;  1NH3 A;  3C2B A;  1DGW Y;  1ENH A;  1HLV A;  3OIO A;  1Z21 A;  2QZ8 A;  2ZC2 A;  2V26 A;  3O8G A;  3S93 A;  1WFX A;  1UB9 A;  4Q48 A;  5BOX A;  4BJ6 C;  2HU9 A;  2NYX A;  2GA2 A;  1RET A;  3TOA A;  2XIG A;  4E7K A;  2XAS A;  3R0J A;  3ZRG A;  2A69 F;  1TT0 A;  5DTD A;  2DFH A;  3QRF F;  4JQF A;  3SEQ A;  4U7D A;  2HVQ A;  5IYC J;  5DUK A;  4HNT A;  3LSH A;  1BL0 A;  1FMW A;  3KE2 A;  4HST A;  2HTJ A;  2FQ3 A;  2ETH A;  5E1X A;  2R7U A;  1K78 A;  2EFN A;  3M1E A;  3RYR A;  4ACI A;  4BBR J;  3F8M A;  1LDJ A;  1ZKG A;  4HEA 2;  1CF7 A;  3U21 A;  3C07 A;  4BHP A;  5M3F J;  1ZLJ A;  4U0W A;  3NXC A;  2P7C B;  5GAG J;  3HPG A;  3BQZ A;  3OYE A;  1ETQ A;  3DEW A;  3Q9S A;  1SFX A;  3W6J B;  3C2H A;  1YE9 A;  3AG1 H;  5DUI A;  1LFP A;  3HDD A;  4UNO A;  2XF5 A;  5FLX K;  3NNR A;  2RQQ A;  1FSH A;  2RC4 A;  4U88 A;  5K5Q A;  5EEA A;  2CQQ A;  2GUH A;  1DU6 A;  3SFZ A;  1OCP A;  1W0U A;  3ZMU A;  4A3L J;  3L9F A;  2R3S A;  1ZR4 A;  2PMU A;  2H09 A;  3IRQ A;  4Y4R A;  2HKO A;  3LNQ A;  4IOC F;  3S2W A;  1EKE A;  5D8L B;  4XSX F;  1FYM A;  3F1B A;  3MEX A;  2I10 A;  2M0C A;  2A07 F;  3TDZ C;  2YVH A;  1CGP A;  3M3Y J;  3DV8 A;  2QYO A;  5HDN A;  2K4B A;  3FMS A;  1V5F A;  2E1M B;  4OMY A;  2ZME A;  1YW9 A;  4WK8 F;  4ESJ A;  3V7C A;  4NQW A;  2HYT A;  3G3Z A;  5ICE A;  2BHY A;  3S32 A;  2A2F X;  4L9T A;  3I59 B;  2OD5 A;  3GX4 X;  5TJJ A;  2AO9 A;  1HW2 A;  5DV5 A;  4EVI A;  2GM4 A;  6PAX A;  1T98 A;  2CO5 A;  1NK2 P;  3FRQ A;  3HYI A;  3GO5 A;  1HST A;  2OA4 A;  2GIV A;  3LAP A;  5EFY A;  1O57 A;  4G6D A;  4IHV A;  2IS4 A;  4GCL A;  5KVR A;  4DZP A;  1VI0 A;  2HR3 A;  3T1B A;  3HOV J;  5J6X A;  5BPI A;  2CYY A;  2FUG 2;  3FHN A;  2B3W A;  4IZZ A;  2V6E A;  1P7J A;  3OYB A;  1PYV A;  2EJR A;  3VOD A;  2L2O A;  3K4B A;  2F5C A;  1Y6I A;  4GYG A;  2O6G E;  4RAF A;  5EZH A;  2JTV A;  1TNT A;  2X1C A;  2AHQ A;  2GA1 A;  3HRU A;  1TW2 A;  1E17 A;  1RUO A;  2LC2 A;  4ITV A;  4XOT A;  2A5W A;  3WTT C;  4AC6 A;  5IP6 A;  3KLO A;  2M8E A;  4GYI A;  4CSW A;  1A36 A;  2W48 A;  4NB5 A;  3EPZ A;  3ZQC A;  1YIT I;  2KPM A;  2VXZ A;  2IA2 A;  1X1P A;  2XUB A;  2AXT C;  4BHB A;  3WE3 A;  1EH6 A;  3DEE A;  3KKD A;  4LGW A;  5FKM A;  1KQ0 A;  2KJB A;  3BR0 A;  3VSK A;  1E2X A;  4D7M A;  3K10 A;  4N9H A;  2W85 A;  1RUN A;  2EFO A;  5ILV A;  2JA6 J;  3NAU A;  1XMK A;  3TQN A;  2EZI A;  3C18 A;  1FX7 A;  2EH3 A;  2UXN A;  3FMQ A;  3I9V 2;  3LOC A;  4B44 A;  3K2Z A;  3G6E I;  2L02 A;  4DYQ A;  3VVZ A;  3PAS A;  4JBA A;  1QPI A;  4XLN F;  3SZG A;  2M4G A;  5EJC A;  2KZV A;  5LEK A;  2OTJ I;  3KP5 A;  4Y33 A;  4ZTJ A;  3B73 A;  2IGN A;  1R5G A;  1YQA A;  4NC7 A;  4AYB A;  5J40 A;  4C3J J;  1KU2 A;  3OYD A;  5DCM A;  5GPA A;  2O61 A;  1FT9 A;  3DKX A;  4NDL A;  3WG9 A;  3FDY A;  1MMG A;  3DPT A;  1B1B A;  2LVS A;  3H9Q A;  4PJ0 C;  2LD5 A;  2FNP A;  2MFZ A;  4OU0 A;  4M3D A;  2BBY A;  3CCQ I;  3L00 A;  2RAE A;  1E3P A;  4NC6 A;  5F0F A;  3HTJ A;  1IXR C;  4EM0 B;  2D6Y A;  1JKP C;  2D2W A;  2B0L A;  3VSL A;  4C30 A;  3GUD A;  3FKI J;  3SHF A;  4ZYG A;  1W36 D;  2IS2 A;  2XKO A;  3VW1 A;  2BHZ A;  3MCZ A;  3OL3 A;  3DLA A;  2KIF A;  3HGG A;  1GVJ A;  3OY9 A;  4ESB A;  4RB1 A;  3PUB A;  3VVX A;  2XGE A;  2XGX A;  2DK8 A;  3CUO A;  3NRV A;  2R7F A;  4LOC A;  2EZH A;  2XVC A;  5CVR A;  1MKM A;  1ZLK A;  5GP9 A;  2D5V A;  4B1R A;  5JI6 A;  2HVR A;  3KET A;  3PFI A;  1R58 A;  2JT1 A;  3ZMD A;  3SZP A;  3CRJ A;  4I0A A;  5ERI A;  4LIU A;  4CCK A;  2ZBK A;  2OPT A;  5IOZ A;  5L3F A;  4NUB A;  4DGW B;  1UI6 A;  1B8I B;  2ZO4 A;  3M07 A;  2LKP A;  4M6V A;  3FXR A;  4O6J A;  1AOY A;  4O3M A;  3KZI C;  5FFX A;  3ANP A;  2XKP A;  2LKS A;  4KIF A;  2DA5 A;  4BYY A;  4IHX A;  3VB2 A;  1XDU A;  2IA0 A;  1V3F A;  1LFB A;  2H27 A;  2MAB A;  1RNL A;  3LWF A;  3F6V A;  2KIU A;  4YFX F;  1I6X A;  1FYK A;  3CDI A;  3A2K A;  4I98 B;  4IHY A;  4YIF A;  3GWZ A;  1T08 B;  3EUP A;  5JVG F;  2ESH A;  2JSC A;  4PJM A;  3N4M A;  5IT9 Z;  3E6C C;  3C3W A;  3ZN1 A;  4W1U A;  3J7Y J;  3CDL A;  4KYW A;  1X1A A;  2CUF A;  5HS9 A;  3ON4 A;  2DU9 A;  1BR1 A;  1X3W B;  2LBF A;  1HF0 A;  4M3F A;  4PFP A;  2UXX A;  1TWC J;  4KA4 A;  1RR8 C;  4FIS A;  2QWW A;  2I5U A;  1ZHF A;  5EYR A;  3GVA A;  4HBL A;  4HPQ A;  4HQM A;  4LG3 A;  1J5Y A;  2H6C A;  2KRF A;  1W1W E;  1A35 A;  2Y75 A;  2HWV A;  3IAS 2;  3OOU A;  3DWL E;  1N78 A;  3S3O A;  2QKO A;  4HX4 A;  3KKC A;  3L2W A;  1GT0 C;  1MNE A;  3NWT A;  2K27 A;  4KIG A;  4B8X A;  4QTR A;  5EEH A;  3RYP A;  5BS6 A;  1LJ9 A;  2HFH A;  1X4P A;  5LFA A;  4KIC A;  5LEJ A;  3IAM 2;  4B4C A;  4PZJ A;  3AQS A;  2LSO A;  2DA7 A;  2QGU A;  4A0X A;  1KU7 A;  3GTM J;  2YS9 A;  2NNY A;  4MO7 A;  1VQN I;  4TV7 A;  3JSJ A;  2HEO A;  2E1C A;  2RDP A;  2FNA A;  1T33 A;  1LPQ A;  4HZF A;  2EV6 A;  1EA3 A;  4CCJ A;  3L2R A;  2L7M P;  4U0Y A;  1X1B A;  2YVX A;  2R5Y A;  2ZXH A;  1JHH A;  2E7W A;  2VC1 A;  4UHT A;  4MGR A;  4A2U A;  4CGZ A;  3OYL A;  3F3X A;  2P6T A;  1K4T A;  1YIO A;  1WRJ A;  4ON0 A;  3HRM A;  1FLI A;  2RKH A;  1L3L A;  3S1R J;  1I27 A;  4ZDO A;  1B9M A;  2LOO A;  3DPJ A;  3VOX A;  2DN0 A;  2JA2 A;  4BQO A;  5EEG A;  1HCR A;  2R5Z B;  2FMY A;  1MND A;  3PO2 J;  3K7A J;  2Z3Y A;  3LSP A;  1P92 A;  3ONQ A;  1W7P D;  3GCM A;  2E35 A;  3G2B A;  4PJL A;  4G6Q A;  4QPQ A;  1GUU A;  1VZ0 A;  3AAF A;  4J19 A;  5F0H A;  3DLL F;  3ZQL A;  4AWX B;  2K4J A;  4YIR X;  4IOA F;  5K7Z A;  3SQN A;  2UZK A;  3A4C A;  2MYS A;  5KNL A;  2ZJR F;  1DPU A;  4AD9 A;  4X1E A;  2COM A;  4IX7 A;  2FOW A;  2BV6 A;  2PLY A;  3HRS A;  2ECB A;  5CQE A;  4E70 A;  3VEP A;  3FXQ A;  3BNI A;  2V1U A;  2EV5 A;  3MAJ A;  2H8W A;  1DP3 A;  3PUF A;  2WA0 A;  4P9F A;  2E7X A;  3MNL A;  5JVT A;  2P0W A;  3W6K B;  5E3M A;  5JHU A;  3H9J A;  2M2E A;  3DU6 A;  5LLQ A;  3P9T A;  3JCU C;  3FIW A;  1F4K A;  3H3U A;  1FMV A;  2K9M A;  4O5V A;  1MIJ A;  3L2Q A;  3S2D J;  1J59 A;  1BOB A;  3H3V K;  4ENM A;  1SD4 A;  1AA7 A;  3OYG A;  5FD5 A;  4HLX A;  1S5L C;  1GV5 A;  4RA2 A;  3K70 D;  2A05 A;  3GFL A;  3CMM A;  1S8N A;  3KEY A;  3PM1 A;  4OIO F;  2X4H A;  3OMY A;  5CKT A;  1ZG5 A;  2ZNZ A;  2ECC A;  3FXO A;  2L01 A;  1S6L A;  4QSH A;  2XPW A;  3GYH X;  2V7F A;  1SAN A;  2EIK H;  4A3K J;  1K79 A;  3K1P A;  5HLH A;  4ZZD A;  4EM1 A;  5LBQ A;  3J7A Y;  2ZJ2 A;  1HDP A;  5AQC A;  2JA8 J;  5HAW A;  3KZZ A;  3VYU B;  5DM7 F;  1FPQ A;  5AIP A;  1Y8R B;  2O03 A;  4BQQ A;  2FD5 A;  2MH2 A;  3JRD A;  2E2J J;  4G8X A;  5ILU A;  3HEF A;  2DT7 B;  4XLH A;  4DBQ A;  4G12 A;  4YEJ A;  2ADU A;  2E1O A;  1P6R A;  2JUG A;  2V57 A;  3HHG A;  2LK2 A;  4AUX A;  5KHD A;  4MLO A;  2QM3 A;  4CA0 A;  3ZGK A;  1IGN A;  4HDV A;  4C3I J;  5D5U B;  1QBJ A;  1WJE A;  1LB2 A;  4AF5 A;  2YX7 A;  2LY2 A;  3KEO A;  1X1C A;  2K9Q A;  2REK A;  3IRR A;  2NAZ A;  1USS A;  2K9L A;  2ZJP F;  4XR6 A;  4ENK A;  3P5J A;  2VE9 A;  3JSP A;  3CCV I;  1WJF A;  2HNH A;  3WGG A;  1FIA A;  1R4N B;  4XRM A;  4MNU A;  4AYB N;  4XRF A;  1ZYR F;  1UZC A;  3OYF A;  3KPH A;  3K8P C;  3BJ6 A;  4XBF A;  4D7N A;  4EEF G;  3CWR A;  1MGT A;  1Q1V A;  4PCQ A;  2VJ4 A;  1ETO A;  2VJJ A;  2XAQ A;  3G56 A;  2P7V B;  2Q2E A;  2XB5 A;  2L7F P;  5H6Q A;  2JQ7 A;  3KYL A;  1RZ4 A;  3VP5 A;  1K78 B;  4MEY F;  2FRH A;  2LRD A;  4OOI A;  3E7Q A;  3PFY A;  3ASO H;  4KN7 X;  2CQX A;  3FIS A;  4RGX A;  1TWG J;  1BI0 A;  4FX4 A;  2IW5 A;  3HSR A;  4V19 K;  3WTX C;  2HOA A;  2BZT A;  2MLK A;  1KU9 A;  1RI7 A;  2M4K A;  2HOS A;  1QZZ A;  1LE8 B;  5K7F A;  5JFR A;  4D1Q A;  2A3S A;  2R7T A;  4PDK A;  1R00 A;  3TP3 A;  4BXF A;  1VQO I;  1G6N A;  5JHF A;  1LNW A;  1XX5 A;  2A5Y B;  4ZDL A;  3BJO A;  4RB2 C;  1H89 C;  4G9Y A;  2DYS H;  5HSZ A;  1KQ9 A;  4RAY A;  4MIM A;  3E0J B;  3CJN A;  2R7R A;  2GAU A;  5D5X B;  4Z6Y A;  3OS2 A;  2W84 A;  1LEA A;  1BBY A;  4PGG A;  2UXH A;  2Z16 A;  1MZB A;  2K9S A;  2G0E A;  1ZK8 A;  4XLF A;  1QVT A;  5E3O A;  3VDX A;  3TW7 A;  1OLT A;  3MFK A;  4PGH A;  5F04 A;  2V9K A;  4DYR A;  1TP4 A;  2RRE A;  2COB A;  2DMN A;  3F23 A;  4I2O A;  3FF5 A;  2RAS A;  3ZOB A;  2O7T A;  4HLY A;  2HXO A;  4UY8 I;  3LSM A;  1UG2 A;  1F9N A;  3M7G A;  3OSF A;  1BW6 A;  2W57 A;  1V55 H;  2K85 A;  3I0T A;  5JLW A;  4L9N A;  2HTS A;  4LG0 A;  2MSY A;  1BI3 A;  4ZC3 A;  3P9K A;  2Y31 A;  3RDI A;  1TC3 C;  5GTH C;  2WV1 A;  3UR3 C;  1WJB A;  4L5I A;  1D5Y A;  1P4X A;  4M6X A;  3BZ6 A;  1IRG A;  4I6Z A;  1OQY A;  4XN3 A;  3NPI A;  1TQP A;  2EA2 A;  2FX0 A;  1HOM A;  2VN2 A;  3F72 A;  3HGY A;  4A3F J;  2W00 A;  4IKF A;  1JXS A;  3MMY B;  1Z7U A;  3TED A;  4GDF A;  5FGL A;  3D0S A;  1HBX G;  3BRU A;  1B72 A;  4JK1 X;  4M3G A;  2HZT A;  2IEK A;  1JUS A;  2ZB9 A;  5DM6 F;  2EBI A;  2QBY A;  3CJD A;  2CW7 A;  1VQL I;  4RMN A;  2UXP A;  3CTA A;  3R4K A;  4XLE A;  1IUY A;  1T56 A;  1FOY A;  1Z3Y A;  1WI9 A;  4OD4 A;  2W25 A;  4Y13 A;  2XV4 S;  2D1H A;  2JRT A;  5IT3 A;  2E2H J;  3W6V A;  2NRA C;  2VBX A;  4G7O F;  1FP1 D;  3EQL F;  3A02 A;  3HIM A;  4PFO A;  3T5X A;  1X1D A;  1SAU A;  2O8X A;  4KT6 A;  3K4M A;  1D0X A;  1UFM A;  2E71 A;  3BC8 A;  4BBS J;  3CO6 C;  3TBI A;  3S5R A;  3R61 A;  2VQG A;  2MG4 A;  1MDM B;  1WJC A;  3BR1 A;  3W2V A;  2DOD A;  3FXL A;  1MNM C;  4BDZ A;  2XAF A;  3LSG A;  4DW6 A;  1SFK A;  1FC3 A;  1BJA A;  4DVY P;  4I7H A;  4XSZ F;  5E8G A;  4A6E A;  5M5W J;  3KNW A;  4IRG A;  1XPX A;  4BNC A;  1FBQ A;  3GTQ J;  2V6C A;  4EMS A;  3G1O A;  4YEL A;  2QEX I;  1JKO C;  1LDK B;  5DCM B;  1OYI A;  1OCZ H;  2X1D A;  3G4S I;  4HQE A;  4U9L A;  2Z5U A;  1PP8 F;  3KP4 A;  4LD5 A;  1YX5 A;  5HS7 A;  1XD7 A;  2GWR A;  1TWH J;  1WJD A;  3HC7 A;  2D45 A;  4ZYH A;  5GAH J;  3CO7 C;  1BIA A;  4CCN A;  1YYV A;  1OR7 A;  3WHB A;  1WHU A;  2OF7 A;  3GZI A;  3CP8 A;  4JYK A;  2L7K A;  5EF6 A;  1D5V A;  1Z77 A;  2R4G A;  1OCT C;  1J75 A;  1IRX A;  2EPF A;  1LUJ B;  4XKW A;  3QPH A;  4HG2 A;  3PPB A;  4BQA A;  4LK0 F;  4Q4Z F;  4A3B J;  1A31 A;  3VW2 A;  2CJJ A;  4WXC A;  2CGP A;  1PJR A;  1XMA A;  4BE2 A;  5AON A;  1WKM A;  3CC2 I;  3BG5 A;  3CJR B;  3E97 A;  3RD3 A;  3TGN A;  4C2M A;  4Q5S F;  4JX6 A;  1Y8Q B;  4HKU A;  4GCV A;  5LHI A;  1YHQ I;  3JAM Z;  1UAA A;  2BW3 B;  2GFN A;  3LHQ A;  2XSJ C;  2IGO A;  1U5T A;  1U6G A;  1O7L A;  1XGN A;  3BTL A;  1IV6 A;  1IC8 A;  4XM3 A;  3J81 Z;  2KLO A;  1WZ2 A;  4G94 A;  1YFH A;  1TT5 B;  3L7W A;  3U2R A;  1BA5 A;  3Q0V A;  2VLA A;  2DK5 A;  1OR7 C;  2UXO A;  3ZQF A;  3Q0W A;  1S29 A;  1KYW A;  2NNN A;  4L0Z B;  4ETS A;  1A6I A;  3MKY B;  1U9O A;  3KCC A;  1IAW A;  2VON A;  3SJM A;  2VKD A;  2QQ8 A;  3OYN A;  3K4N A;  3KYC B;  2DG7 A;  4FCY A;  2XAG A;  4M9S A;  1J09 A;  2E34 A;  5H6R A;  3ROU A;  1MJB A;  4AU7 A;  2WC2 A;  2GOX B;  2X1E A;  2ELJ A;  4B47 A;  5HS8 A;  3LQR A;  1U5T C;  2HVS A;  1XCV A;  2X9D A;  2ZCW A;  3QWL A;  1XSX A;  1G59 A;  3RPU A;  2Z33 A;  1BR4 A;  4XL9 A;  5D19 A;  1MSE C;  1D1B A;  2EFW A;  3WGH A;  1JKR C;  2XRN A;  1VQ8 I;  2YUS A;  3VW0 A;  1YG2 A;  5J4V A;  2YVE A;  3EDP A;  3ZR8 X;  4CHU A;  1VQ9 I;  3ABM H;  2DOE A;  2MH9 A;  3F9K A;  3V4G A;  4F91 B;  2M0M A;  1KON A;  3Q3S A;  3RSN A;  2HGC A;  3X2Q H;  1MBK A;  1T0F A;  3C2G A;  4IVN A;  3NAR A;  2AQE A;  4NEL A;  1IN4 A;  1QA6 A;  4B48 A;  2HDD A;  3AL0 B;  1VF9 A;  3LA2 A;  4Q47 A;  1HQC A;  2VPL A;  2IRF G;  3ZCO A;  1RR7 A;  4ZYA A;  2JMW A;  1R4M B;  3QOE A;  4DJA A;  4BE0 A;  2JA5 J;  1YRN B;  2HYF A;  3LSJ A;  4QPO A;  1SAX A;  3F0C A;  2K02 A;  1VQ7 I;  2QUF A;  3ABU A;  3MZH A;  2ID3 A;  1ACI A;  1I50 J;  1VQ6 I;  1R23 A;  2PMH A;  2KZG A;  3BG6 A;  2LF8 A;  4F3Q A;  1K6Y A;  2EWN A;  1IN8 A;  2XF7 A;  3TL4 X;  3H3Z A;  1UHS A;  3E6M A;  4P1W A;  3TW6 A;  1PUE E;  1T0F C;  1R6R A;  2DFF A;  5LRR A;  5L3E A;  1T2K A;  2P8T A;  1WH5 A;  4G6T B;  5L3B A;  5E3N A;  3D5L A;  2X85 A;  1XN7 A;  1Y0U A;  4S05 A;  2CFO A;  4I99 C;  2J5P A;  2DDB A;  1G4D A;  2DA4 A;  5HBU A;  2ZME C;  1I3Q J;  3KP7 A;  4XNF A;  1KGS A;  3HTI A;  5D8K B;  4CZC A;  4LLN A;  1XTA A;  4AID A;  3TP0 A;  2VOD A;  2PJR B;  3JRF A;  1D1C A;  1G8X A;  1H9G A;  4RM3 A;  3PIP F;  2HXI A;  3ZMT A;  3WHC A;  3J80 K;  4L5J A;  3QYE A;  3BCG A;  1XGO A;  3DPU A;  3HPH A;  1F5T A;  5BPD A;  4EJT A;  1MH4 A;  3WE2 A;  3V8J A;  2CV0 A;  4GCK A;  3I64 A;  3DBR B;  1T38 A;  2JZY A;  1PUF A;  3OYJ A;  2QQB A;  5C4Y A;  4HSR A;  1LVK A;  5EZG A;  3VPR A;  2BY0 A;  2Y9Z A;  4E7Z A;  2MD5 A;  3PL8 A;  1JE8 A;  2HYG D;  3BR6 A;  4A69 C;  2OUM A;  3FXU A;  4CCO A;  3JR9 A;  4EM2 A;  3GF2 A;  3I58 A;  5CJ9 A;  4A93 J;  5GPC A;  2Z9O A;  2NVU B;  3ZMZ A;  3OR1 C;  4A3E J;  2GEN A;  3JRG A;  2Y48 A;  1ETY A;  1WJA A;  5E20 A;  3NI7 A;  3BLY A;  2WUI A;  3FXM A;  1DPR A;  1U0J A;  4L9V A;  5D5V B;  3S8P A;  1EH8 A;  4E7S A;  2CUJ A;  3CF2 A;  3MKL A;  3U1D A;  1VFC A;  4HNU A;  4E6K G;  1ETX A;  4HW0 A;  1JJ6 C;  2G9W A;  2CW0 F;  4ANJ A;  3BP8 A;  3Q5F A;  1BM9 A;  1I6H J;  1OFC X;  3DP7 A;  2NXN B;  3OYH A;  2XGD A;  2IJL A;  2KHM A;  3ASN H;  1WPK A;  4UUT A;  3HUG A;  4EAT A;  3BPX A;  2UWM A;  2Q24 A;  3B6C A;  1XDS A;  5J8F A;  4X0G A;  5TRD A;  1OMI A;  3VWB A;  2M34 A;  1I39 A;  3BR2 A;  4DQ2 A;  2Y2Z A;  1FOK A;  3MN2 A;  3E5U A;  2O8K A;  3DEU A;  2ISY A;  3R0A A;  3I53 A;  3SXY A;  3DPL C;  1SVO A;  2R7Q A;  4I01 A;  4BEH A;  5GAE J;  2R7O A;  5DS9 A;  3OSG A;  1X3U A;  4GXO A;  4AVZ A;  4Y17 A;  2R92 J;  3VOK A;  3QKX A;  5LRS A;  5B66 C;  3I55 I;  1SGM A;  5EG0 A;  4LFU A;  3T8T A;  3JRA A;  1U2W A;  1WH7 A;  2M5W A;  2VT2 A;  4FT8 A;  4R79 A;  3S16 J;  1EJ9 A;  4W97 A;  3DCF A;  5IP7 J;  2TRT A;  4A3M J;  1NHA A;  5D18 A;  3QU6 A;  1YX3 A;  5KAF C;  2DT5 A;  2Q2E B;  1SVL A;  3BWG A;  2KL4 A;  2PQ8 A;  2X6X A;  2QSH X;  2IA1 A;  2CMP A;  3S1N J;  4N9I A;  3MQ0 A;  2DO7 A;  2RV8 A;  2BY1 A;  3M1C A;  2NX4 A;  1F43 A;  1Z7L A;  3JAM K;  1ZRE A;  1X2M A;  4OIQ F;  3W2A A;  1YO5 C;  3S14 J;  4UUS B;  3BJA A;  9ANT A;  3J81 K;  2PMZ A;  1RKW A;  1U9N A;  3KP2 A;  1O3R A;  3BOQ A;  4LLL A;  4A3D J;  3E1S A;  1TNS A;  1J2X A;  3HOU J;  1D0Z A;  4II2 A;  3IUV A;  2M7A A;  1E3O C;  2DA1 A;  5HNF A;  4MK6 A;  2M87 A;  1VTN C;  1SFO J;  5L3C A;  4KMU X;  1BC7 C;  2WAD A;  5HVQ C;  3FKJ A;  1JKQ C;  4UVC A;  2Z2S B;  2KIM A;  1VQ5 I;  2QLZ A;  5D6E A;  5FLM J;  1S7A A;  5FHP A;  5FKN A;  4PSW A;  2STT A;  4EJV A;  2E5Z A;  3DTK A;  2LFB A;  4FE4 A;  2HOE A;  1RIO H;  4D5F A;  4NBQ A;  2EK5 A;  1YJN I;  2E2I J;  2O0Y A;  1E3H A;  1T39 A;  1RRJ A;  3IHU A;  3H36 A;  3J7Z I;  1R36 A;  1TBX A;  3GFJ A;  3DTI A;  2F07 A;  2HQN A;  2IVM A;  2QEN A;  2VL8 A;  2DMP A;  3WTZ A;  3GEZ A;  3I71 A;  5E3L A;  2NVQ J;  1P4A A;  1QPM A;  1ZR2 A;  2EA4 A;  2LKX A;  5CVI A;  1QGP A;  2NP5 A;  2CUE A;  1Y1W J;  1T6S A;  2M3A A;  2ZFU A;  2UXI A;  2FBQ A;  2KQR A;  5TIS C;  1WJ5 A;  2DQR A;  4XKV A;  3I59 A;  1BI1 A;  1D0Y A;  2F5D A;  1AHD P;  2O9L A;  5D1R A;  2R7X A;  4Y3O A;  2E19 A;  1Z1D A;  5DYM A;  2XC7 A;  3U1K A;  3F8N A;  3HZJ A;  5M3M J;  1T8I A;  2DFI A;  3GTJ J;  2IS1 A;  4HX7 A;  3HM5 A;  3CF5 F;  3BT9 A;  2Y69 H;  1R22 A;  2WGB A;  1B72 B;  1CQT A;  2JVG A;  1U78 A;  4BGD A;  2QBY B;  1VND A;  4WWC A;  2F5V A;  4BJT A;  1BJZ A;  2FEZ A;  1YJ9 I;  3DKY A;  2L9N A;  4IRI A;  2R7Z J;  3O6B B;  3ABT A;  3D1N I;  1MBH A;  4UV8 A;  2QOP A;  4NN1 A;  2OCE A;  5F6F A;  5HLT A;  4ME9 A;  4LJZ F;  4IHW A;  2JUC A;  2R7S A;  3Q9V A;  4RLQ A;  4A6D A;  3HOS A;  3IV5 A;  1TTY A;  2J5O A;  2DMT A;  5FKK A;  5HLI A;  2R93 J;  1AKH B;  3CLQ A;  2K7L A;  3BTJ A;  1MSF C;  3QYF A;  4OIP F;  2ZCN A;  4OMZ A;  5L3D A;  3RKY A;  4HDU A;  3OIQ A;  1YI2 I;  3BTI A;  5J3L A;  2HOT A;  1IRZ A;  3ZN0 A;  2FXA A;  3OYK A;  1D8K A;  3FBI B;  2OCC H;  2K3F A;  1J7K A;  3BCB A;  1R5H A;  5ICG A;  3LQQ A;  4IO9 F;  1VQK I;  5B5E C;  2CSO A;  3DKW A;  2B1E A;  4QLC U;  5F64 A;  2WY7 Q;  3MKZ A;  2P81 A;  2CFX A;  3PNV A;  4I0B A;  1PP7 U;  4IF4 A;  4A0Z A;  3ZP5 A;  2DW4 A;  3ZPL A;  2FBI A;  4MHG A;  3PIO F;  4U9N A;  4HF0 A;  3SWH A;  2GIZ A;  3V8K A;  4RDU A;  2B63 J;  4CYD A;  2NS0 A;  2FOK A;  1EF4 A;  1S7E A;  3CMY A;  1KU3 A;  1Z91 A;  2X51 A;  1NK3 P;  3E6D A;  1G3Y A;  4A5N A;  3GFM A;  3IH2 A;  4A3J J;  3T0Y A;  3HTU A;  1GHC A;  3VTI A;  3QPL A;  2Y30 A;  2HKX A;  5FO5 A;  4CIC A;  1OKR A;  1MW7 A;  4LMY A;  4BJ5 C;  2XF6 A;  5FLV A;  2WBM A;  1W36 C;  2IAI A;  4IEJ A;  4E7H A;  4XID A;  2ZOZ A;  1XCB A;  3UKG A;  1JUP A;  2RHA A;  3NEU A;  3ABL H;  4JKZ A;  5FRN A;  4U87 A;  4L5E A;  2V9P A;  1D3Y A;  2FJ1 A;  1RES A;  2KT0 A;  1APL C;  1YS6 A;  1GXP A;  1ETK A;  1IW7 F;  2CUZ A;  2JRM A;  3CCL I;  3QOD A;  4M6Y A;  4Y52 J;  1WQ2 A;  3FX3 A;  1I1G A;  3CCY A;  3G71 I;  3GLX A;  3RI4 A;  4XKB A;  3RQ4 A;  2K86 A;  4D5C A;  2VKV A;  1IN5 A;  1P9Q C;  2UUZ A;  1FSE A;  4KNY A;  3JTH A;  5HDG A;  2EB7 A;  2GBY A;  4GO1 A;  4M9Z A;  4IQJ A;  3CCR I;  2OI8 A;  3HXL A;  5FLX Z;  3K9T A;  4ICH A;  5DAJ A;  5K1Y A;  1IO2 A;  1MBJ A;  1QZY A;  1CF7 B;  4CZZ A;  3KIO A;  2ZNY A;  1B8I A;  3RKW A;  2NVY J;  4BL0 B;  2H8R A;  3QU3 A;  1FY7 A;  2ME0 A;  2O3F A;  4RM2 A;  4FHT A;  2B7E A;  3CCS I;  1QQI A;  3LJL A;  4M71 A;  3BZC A;  2HI3 A;  2CRG A;  1REP C;  3RCO A;  2OC6 A;  4BXU A;  3KP3 A;  1MBE A;  4BS9 A;  1FEX A;  2XB0 X;  2DTZ A;  3H5A A;  1T95 A;  3L2C A;  1GLN A;  2V9V A;  3OS1 A;  2IBD A;  1W4M A;  2HDW A;  2HQ5 A;  1ETV A;  4HV5 A;  2NP3 A;  1O3T A;  4D0P A;  3D5S C;  1DUX C;  2JPC A;  4JL3 A;  2LH9 A;  3P7N A;  1N77 A;  2L7Z A;  4DNC A;  4BAC A;  4PXI A;  2YU9 J;  4A3C J;  2ESN A;  2OAZ A;  1UST A;  1ONV A;  2ZME B;  5IT9 K;  5E18 F;  3FK7 A;  1N75 A;  3PSF A;  4ZH4 F;  2FA5 A;  3S3M A;  3S15 J;  3PO3 J;  3KZY A;  4NQW B;  5H9T A;  1W7P A;  2VQC A;  3GFI A;  3MD2 A;  5IOY A;  4J01 A;  4CDG A;  4E7I A;  2GLO A;  2QSG X;  2M30 A;  2OTL I;  4UB6 C;  5F27 A;  1JUM A;  3ZXS A;  1OCC H;  5ILS A;  2PFB A;  2BE5 F;  3HE0 A;  4LLG F;  4L0Y B;  3G73 A;  3OYM A;  2JN6 A;  1R9T J;  1HDD C;  3HTS B;  1U3E M;  1Z3X A;  4CCL A;  1SD5 A;  3BTC A;  3CUQ A;  3QAH A;  3TMO A;  3S17 J;  2PMZ N;  5ICF A;  4KDP A;  2HQR A;  3I5U A;  3ZQG A;  4S04 A;  1QNT A;  2AXL A;  3DXJ F;  3RTR A;  2E5N A;  4A0Y A;  3OYI A;  1QVU A;  3RPQ A;  1ZRF A;  1FTT A;  3EGQ A;  3AKZ A;  1IRF A;  2OZU A;  2VJ5 A;  4UVA A;  5IP9 J;  5A2Q Z;  3JRH A;  3KYD B;  2OER A;  1BW5 A;  3FXJ A;  1QU3 A;  1DGR M;  2ZJQ F;  3PNY A;  4XRS A;  2R5Z A;  3O8H A;  2VIX A;  1MD0 A;  4C3H J;  3SDG A;  4UV9 A;  2XRL A;  3KFW X;  2DLL A;  1XGS A;  3HG9 A;  2VXD A;  3REO A;  3CUQ C;  1BI2 A;  1HSJ A;  4I02 A;  3ON2 A;  1HA8 A;  1OYY A;  3IC7 A;  2VE8 A;  3HBL A;  3B81 A;  1WCM J;  1KA8 A;  2VT3 A;  4K2E A;  1VQ4 I;  5DDG A;  5F1J A;  1Z0X A;  4IL6 C;  1XSV A;  4X6A J;  1MBF A;  1ITY A;  2R7D A;  2PX9 A;  2G7L A;  2L54 A;  2RQP A;  2BY3 A;  5E8I A;  3NS4 A;  2I8D A;  5J1U A;  4PUS A;  2C6Y A;  4XIC A;  2A6E F;  4OAY A;  1Q1H A;  5F1R A;  3AQT A;  3IP4 B;  3FWE A;  1ERD A;  4KIS A;  1TL8 A;  3WTW C;  3SYT A;  5CYV A;  3K70 C;  3TDU C; 
#chains in the Genus database with same CATH homology
 2K9N A;  4MFE A;  3K2A A;  3IH4 A;  5EGO B;  4MFD A;  3A01 B;  3TP0 A;  2HYJ A;  4BY7 J;  4QTR A;  3JRF A;  3V6G A;  3SFI A;  1IDY A;  2HXI A;  3QBM A;  3WHC A;  3RZD J;  3HKZ N;  1JTX A;  2ELK A;  4B4C A;  4UDS A;  1MH3 A;  3AQS A;  3I4M J;  2DA7 A;  3BCG A;  3GTM J;  2YS9 A;  4MO7 A;  4ABZ A;  3JSJ A;  2JJ7 A;  2LR8 A;  1MH4 A;  1T33 A;  5J1Y A;  4BBS J;  4RBO A;  4AC0 A;  2CU7 A;  2ZOY A;  4GCK A;  3HOZ J;  2L7M P;  1GT0 C;  2XSD C;  5BNG A;  2R5Y A;  1PUF A;  1IG7 A;  5C4Y A;  2DA3 A;  5J1R A;  5C44 J;  5EZG A;  3ZQI A;  3VPR A;  5FKO A;  2Y9Z A;  3COL A;  3BR6 A;  4A69 C;  1K83 J;  4A3G J;  1FJL A;  3JR9 A;  3LSR A;  4A93 J;  3S1R J;  1RKT A;  2MW8 A;  5GPC A;  3DPJ A;  3VOX A;  4UUS A;  1A5J A;  2DN0 A;  5EG0 B;  2HKU A;  1TWA J;  1HCR A;  1MBG A;  2R5Z B;  4A3E J;  5JLX A;  3JRG A;  2GEN A;  5FKL A;  5C4J J;  3PO2 J;  3ZQH A;  3K7A J;  1ETY A;  3NI7 A;  1K61 A;  2WUI A;  3LSP A;  2XPV A;  3Q0U A;  3BG3 A;  2VKE A;  2LTP A;  3NRG A;  3BQY A;  3MKL A;  1GUU A;  1VFC A;  5EGO A;  4J19 A;  3JRC A;  5F0H A;  3A01 A;  1ETX A;  3ZQL A;  1JJ6 C;  4CYC B;  1I6H J;  4Y7N J;  5K7Z A;  3GTK J;  1OFC X;  2XGD A;  2XDN A;  1WPK A;  4X1E A;  4UUT A;  1FIP A;  2ID6 A;  2Q24 A;  3B6C A;  1TWF J;  4S0H B;  5M5X J;  2ECB A;  2VPR A;  5IPA A;  3T6N A;  2X48 A;  3BNI A;  2JK3 A;  2M34 A;  3BR2 A;  3CQZ J;  2H1K A;  2Y2Z A;  3MN2 A;  2O8K A;  1RPW A;  4YZE A;  3MNL A;  1QRY A;  4JX4 A;  3GTO J;  5E3M A;  3RH2 A;  3HB9 A;  5DS9 A;  3OSG A;  2M2E A;  3P9T A;  2R92 J;  3FIW A;  3VOK A;  3QKX A;  2M9H A;  1SGM A;  5EG0 A;  2NS8 A;  2M8G X;  2Y9Y A;  1LE8 A;  1X58 A;  1AU7 A;  5CXI A;  3JRA A;  1O4X A;  3S2D J;  4GFL A;  3H3V K;  1WH7 A;  3S16 J;  4W97 A;  4GFK A;  3DCF A;  1GV5 A;  5IP7 J;  2TRT A;  4A3M J;  2VUM J;  5D18 A;  3PM1 A;  2FQ4 A;  1FTZ A;  3V78 A;  2ECC A;  4KWA A;  4QSH A;  2XPW A;  1SAN A;  3M4O J;  1JT0 A;  4CYC A;  4A3K J;  1H88 C;  3S1N J;  3BG9 A;  2R5Y B;  1PUF B;  1HDP A;  3G1M A;  4HNV A;  2R0Q C;  5AQC A;  2JA8 J;  5HAW A;  4BKX A;  2NX4 A;  2O7O A;  1F43 A;  5FMP A;  2FD5 A;  2XGC A;  3JRD A;  2E2J J;  1X2M A;  3HEF A;  3QPS A;  4G12 A;  3S14 J;  4UUS B;  9ANT A;  2E1O A;  2KDZ A;  1RKW A;  2V57 A;  2LK2 A;  3HOW J;  1U9N A;  1P7I A;  4AUX A;  4MLO A;  4A3D J;  1IGN A;  3HOY J;  4C3I J;  2QF7 A;  1AKH A;  3RQI A;  4AF5 A;  3HOU J;  3E7L A;  3IUV A;  2JWT A;  5F0C A;  1IJW C;  1E3O C;  2DA1 A;  2K9Q A;  5IYB J;  1IDZ A;  4MK6 A;  5HOD A;  3QQA A;  1SFO J;  2REK A;  3BR5 A;  1JKQ C;  3RZO J;  5FLM J;  4XRM A;  1FIA A;  5FHP A;  5FKN A;  4M3B A;  4AYB N;  3LWJ A;  2G7S A;  3VVY A;  4MXM A;  3FK6 A;  1JJ8 C;  1ZTR A;  4D7N A;  4FE4 A;  2LFB A;  4EEF G;  4D5F A;  3CWR A;  3G56 A;  1Q1V A;  1ETO A;  2E2I J;  2NOG A;  2XB5 A;  3B6A A;  2L7F P;  3HOX J;  1POG A;  2PZ9 A;  3VP5 A;  2IU5 A;  2F07 A;  3E7Q A;  2MGQ A;  4JX5 A;  2CQX A;  2DMP A;  2K40 A;  3FIS A;  3VUQ A;  1TWG J;  5E3L A;  2NVQ J;  4FE7 A;  1ZR2 A;  2LKX A;  2NVT J;  2NP5 A;  2QWT A;  2CUE A;  2HOA A;  1Y1W J;  3GEU A;  2UXI A;  2FBQ A;  3L1P A;  2HOS A;  2NS7 A;  1UI5 A;  2PBX A;  1LE8 B;  5K7F A;  3C2B A;  3TP3 A;  1ENH A;  1AHD P;  2O9L A;  5D1R A;  1HLV A;  2E19 A;  3OIO A;  3O8G A;  5M3M J;  1H89 C;  1ORK A;  5HSZ A;  3GTJ J;  4MIM A;  2QCO A;  3HM5 A;  3BT9 A;  1RET A;  2ME6 A;  1B72 B;  2WGB A;  1CQT A;  2UXH A;  1U78 A;  1LFU P;  1VND A;  2K9S A;  1BJZ A;  2G0E A;  1ZK8 A;  5DTD A;  1XC5 A;  3HTH A;  1XS9 A;  1QVT A;  5IYC J;  2R7Z J;  3VIB A;  3D1N I;  1MBH A;  2EZK A;  1BL0 A;  5E3O A;  3TW7 A;  4L62 A;  2QOP A;  4NN1 A;  4DZJ A;  2JA7 J;  5F04 A;  1UMQ A;  1X2N A;  4ME9 A;  4DYR A;  4ACI A;  2W53 A;  5FJ8 J;  4IHW A;  2COB A;  2DMN A;  4BBR J;  1ZKG A;  3IV5 A;  3I4N J;  3ZOB A;  2O7T A;  2VI6 A;  2RAS A;  3C07 A;  2HXO A;  2DMT A;  5M3F J;  5FKK A;  4B3A A;  2ZCM A;  1JT6 A;  3NXC A;  1UG2 A;  2R93 J;  3JRB A;  3OSF A;  1AKH B;  1BW6 A;  5C3E J;  3BTJ A;  1MSF C;  3BQZ A;  2ZCN A;  1ETQ A;  3DEW A;  5JLW A;  2MSY A;  1G2H A;  2Y31 A;  3BTI A;  3HDD A;  5J3L A;  1TC3 C;  2HOT A;  2LP0 A;  1IRZ A;  3NNR A;  5EEA A;  2WV1 A;  1D5Y A;  2CQQ A;  2GUH A;  4I6Z A;  1DU6 A;  1OCP A;  3NPI A;  2FX0 A;  1HOM A;  1W0U A;  3HGY A;  5IYD J;  4A3F J;  4A3L J;  1WI3 A;  2P81 A;  1ZR4 A;  3TED A;  5FGL A;  3BRU A;  1B72 A;  4M3E A;  4M3G A;  3LNQ A;  2IEK A;  5C4X J;  1JUS A;  2ZB9 A;  2EBI A;  1W0T A;  3F1B A;  4RDU A;  2B63 J;  2I10 A;  2M0C A;  1EF4 A;  3CJD A;  1S7E A;  3CMY A;  3S2H J;  2YVH A;  1NK3 P;  3M3Y J;  2UXP A;  4XK4 A;  3KZ9 A;  3IH2 A;  1T56 A;  4A3J J;  3S1M J;  3HTI A;  3QPL A;  2Y30 A;  3W6V A;  2E2H J;  5FLV A;  2HYT A;  2IAI A;  4IEJ A;  2DMU A;  4XID A;  3S1Q J;  2ZOZ A;  3UKG A;  2DA2 A;  3A02 A;  3HIM A;  3BR3 A;  3GBG A;  1JUP A;  1DU0 A;  2RHA A;  4JKZ A;  2N8G A;  1NTC A;  2AO9 A;  4L5E A;  3S5R A;  2GM4 A;  2FJ1 A;  2KT0 A;  1RES A;  2MG4 A;  3BR1 A;  1APL C;  1NK2 P;  3FRQ A;  4CGR A;  1ETK A;  1MNM C;  5EFY A;  2ZCX A;  4DW6 A;  3LSG A;  4IHV A;  4GCL A;  2X6O A;  4DZP A;  4Y52 J;  1VI0 A;  3HOV J;  3CCY A;  2EZL A;  5CXG A;  1P7J A;  5M5W J;  3KNW A;  4D5C A;  2VKV A;  3A03 A;  3GTQ J;  3G1O A;  2GBY A;  1JKO C;  2QTQ A;  3BHQ A;  1ZQ3 P;  5EZH A;  4A3I J;  2OI8 A;  4ICH A;  5DAJ A;  2NVX J;  1TWH J;  2AHQ A;  1GVD A;  1MBJ A;  4XRS G;  4C2M J;  4AC6 A;  5K58 A;  5IP6 A;  3WHB A;  2W48 A;  2OF7 A;  3GZI A;  1B8I A;  3ZQC A;  4JYK A;  5EF6 A;  2TCT A;  2NVY J;  1Z77 A;  3JRE A;  1OCT C;  2H8R A;  4QIW N;  2UXU A;  2ME0 A;  3KKD A;  1H8A C;  1ETW A;  5FKM A;  3PPB A;  3BR0 A;  5K7H A;  4A3B J;  3BJB A;  3LJL A;  4D7M A;  3VW2 A;  2CJJ A;  4JNN A;  2HI3 A;  2CRG A;  2DMQ A;  1YRN A;  3BG5 A;  1MBE A;  2JA6 J;  1FEX A;  2XB0 X;  3NAU A;  3RD3 A;  4BXX J;  2DTZ A;  2EZI A;  4JX6 A;  4HKU A;  2EH3 A;  3LOC A;  2WB1 N;  3ANG A;  2IBD A;  2G3B A;  3LHQ A;  2GFN A;  4DYQ A;  2HQ5 A;  1ETV A;  4V2G A;  3PAS A;  2NP3 A;  3VVZ A;  1IV6 A;  3BTL A;  1IC8 A;  1QPI A;  1GDT A;  4JL3 A;  1WGX A;  1BA5 A;  3Q0V A;  2UXO A;  4DYC A;  2L7Z A;  3ZQF A;  4PXI A;  2YU9 J;  3Q0W A;  4A3C J;  4GFB A;  4C3J J;  1A6I A;  1U9O A;  5GPA A;  5M5Y J;  3SJM A;  4NDL A;  3FK7 A;  3S15 J;  2LVS A;  3PO3 J;  2LD5 A;  4I76 A;  4M3D A;  2DG7 A;  5H9T A;  4FCY A;  2Y0S N;  5IOY A;  1IUF A;  3O60 A;  3RKQ A;  2GLO A;  2RAE A;  3HTA A;  3G1L A;  5F0F A;  3HTJ A;  5F27 A;  1JUM A;  2D6Y A;  2LLK A;  1JKP C;  2G7G A;  3FKI J;  3JRI A;  2WAQ N;  3HE0 A;  5EDN A;  2X9D A;  3VW1 A;  2JN6 A;  1R9T J;  1HDD C;  3HGG A;  3BTC A;  5D19 A;  1MSE C;  3S17 J;  3VVX A;  2LY9 A;  2XGE A;  2PMZ N;  4LOC A;  3ZQG A;  2EZH A;  1ZGW A;  1JKR C;  2YUS A;  3VW0 A;  5CW8 A;  5GP9 A;  2D5V A;  4B1R A;  2YVE A;  1JTY A;  2QIB A;  2L0K A;  1FTT A;  1QVU A;  3EGQ A;  3Q3S A;  3CRJ A;  3GTG J;  4GCT A;  5IP9 J;  3GTP J;  2OPT A;  3JRH A;  2XPU A;  1MBK A;  2DA6 A;  5IOZ A;  1UI6 A;  3NAR A;  2OER A;  1BW5 A;  4NEL A;  1B8I B;  4M6V A;  1U8B A;  3GTL J;  4XRS A;  2R5Z A;  2HDD A;  3ANP A;  1VF9 A;  3O8H A;  4C3H J;  3SDG A;  2XRL A;  2DA5 A;  4IHX A;  4FTH A;  1LFB A;  1RR7 A;  2JMW A;  2DG8 A;  1OJL A;  1XG1 A;  2JA5 J;  2DJN A;  4IHY A;  4JP0 A;  1YRN B;  3LSJ A;  3EUP A;  3F0C A;  3ON2 A;  1GV2 A;  2ID3 A;  3HBL A;  1F36 A;  1I50 J;  3B81 A;  1WCM J;  5F1J A;  1Z0X A;  3G7R A;  4W1U A;  3CDL A;  4X6A J;  1MBF A;  2CUF A;  3ON4 A;  1ITY A;  1UHS A;  3MVP A;  1HF0 A;  2G7L A;  4M3F A;  3TW6 A;  1TWC J;  4V2F A;  5J1U A;  1WH5 A;  4FIS A;  5E3N A;  4XIC A;  5F08 A;  5EYR A;  2L9R A;  3AQT A;  1Y1V J;  1JGG A;  3IH3 A;  2DA4 A;  1I3Q J;  3OOU A;  2EQR A;  4BY1 J;  2QKO A;  5HBU A;  3KKC A;  3H0G J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...