5CXIA

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-23,24-bisnorchol-4-en-22-oyl-coa (4-bnc-coa)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
181
structure length
180
Chain Sequence
QRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 72
structure length 180
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxiA00
5C4YA 3CRJA 3QKXA 3B6AA 2ZOYA 3O8GA 4GFLA 1ORKA 5AQCA 4XK4A 3GZIA 5F27A 3S5RA 2ZCNA 4I6ZA 2GUHA 3VW0A 3BTIA 3VPRA 1T56A 2QKOA 3BT9A 3BR3A 3G1MA 3T6NA 3WHBA 3RD3A 2WUIA 1U9NA 3PM1A 2G7SA 1QVTA 2GBYA 3BHQA 2WGBA 3Q0VA 3F1BA 3O60A 2PZ9A 2ID6A 2PBXA 3V6GA 3FK7A 3LHQA 3FRQA 3NRGA 5GPCA 3ON4A 3ON2A 3COLA 3HTIA 2ID3A 3WHCA 2YVEA 3HTAA 3KZ9A 1RPWA 5F0CA 5HBUA 2DG7A 3QPLA 3QQAA 5D18A 2XPUA 3NPIA 4B1RA 4JL3A 4D7NA 4GCKA 2QOPA 2XPWA 5IPAA 2XPVA 1UI6A 2VPRA 5FKNA 3RH2A 4W97A 3BR5A 2FD5A 1ZK8A 3IH4A 3BQYA 3LSJA 3Q3SA 3MVPA 2NS8A 3BTJA 2OI8A 1UI5A 2HQ5A 4AC0A 3G7RA 3JSJA 4AF5A 3KKCA 1JT0A 3VOXA 3CJDA 5EZHA 4M3DA 2ZOZA 3ZQLA 3HTJA 3HGGA 5EFYA 3G56A 4M3GA 3KKDA 3HIMA 2GFNA 2FQ4A 4MK6A 4G12A 3CWRA 5FMPA 3AQTA 3ZQHA 2Y2ZA 4V2GA 2QIBA 5D1RA 4JYKA 5K7ZA 2IAIA 2EH3A 3VVZA 3BR0A 3B81A 3VW2A 5K7HA 2TRTA 4AC6A 5IOYA 5J1UA 3CCYA 2O7TA 2X6OA 1JUSA 4D5CA 5GP9A 3VIBA 3DCFA 2ZCMA 2REKA 1RKTA 2NX4A 2UXPA 2TCTA 3LOCA 3EGQA 3ANGA 3BNIA 3BQZA 3G1OA 3LSRA 2UXOA 2VKVA 2XGCA 5K7FA 2ZB9A 2QTQA 3TP3A 1T33A 3Q0UA 2YVHA 2HXIA 3BR1A 3TP0A 3G1LA 4DW6A 3FK6A 2DTZA 5GPAA 2W53A 2UXIA 3ZQIA 3KNWA 4MXMA 3MNLA 4NELA 4ACIA 2OERA 2Q24A 3LJLA 3VW1A 1ZKGA 3NNRA 4GCTA 2XDNA 2RHAA 3SDGA 3O8HA 3FIWA 2IU5A 3F0CA 4ICHA 2JK3A 4W1UA 4M3EA 1QVUA 3PASA 2IBDA 4ME9A 3GEUA 3QPSA 3VOKA 3ANPA 4PXIA 5FKMA 2XRLA 5FHPA 2RAEA 1BJZA 2FJ1A 1VI0A 5J1YA 3DPJA 1Z77A 4KWAA 5IOZA 2Y30A 5FKOA 1A6IA 1JUMA 2HXOA 5HSZA 1JT6A 2JJ7A 3VVYA 2O7OA 2NP3A 1U9OA 3BR6A 4D5FA 1JUPA 4MO7A 2G3BA 3BCGA 4ABZA 4HKUA 4D7MA 4GCLA 2ZCXA 3VVXA 4UDSA 3VP5A 4V2FA 5D19A 3NXCA 4CGRA 2RASA 2NP5A 3V78A 2HYTA 5HAWA 2WV1A 5F08A 3ZQGA 2IEKA 4I76A 4AUXA 4YZEA 4JKZA 3QBMA 2D6YA 4L62A 5F1JA 3PPBA 1JTXA 3IUVA 2HKUA 3LSPA 2XGEA 4JNNA 2XB5A 2G7GA 2QCOA 4NN1A 5J1RA 2I10A 2F07A 5CXGA 3IH3A 5F0FA 2OPTA 3ZQFA 5F0HA 5CXIA 2VKEA 5EYRA 2G7LA 2GENA 3SFIA 3HE0A 5FKLA 4B3AA 3NI7A 1QPIA 5FKKA 3BRUA 2UXHA 5IP6A 3P9TA 2XGDA 3EUPA 1Z0XA 2X9DA 3CDLA 3BR2A 5F04A 4GFKA 3BTLA 4M3BA 3AQSA 2FBQA 5EZGA 2HYJA 2DG8A 1JTYA 3VUQA 2NS7A 2QWTA 3C2BA 3C07A 2UXUA 2FX0A 1SGMA 3HGYA 5FGLA 3DEWA 3BJBA 5H9TA 3LWJA 2OF7A 4X1EA 3Q0WA 5CW8A 3B6CA 5DAJA 3HTHA 5J3LA 2G0EA 4M3FA 1RKWA 2V57A 2Y31A 3E7QA 3IH2A 5K58A 3BTCA
chains in the Genus database with same CATH superfamily
5CQGA 5C4YA 3CRJA 3QKXA 3B6AA 2ZOYA 3O8GA 2R7QA 4GFLA 1ORKA 5AQCA 4XK4A 3GZIA 5F27A 4DVYP 3S5RA 2ZCNA 4I6ZA 2GUHA 3VW0A 3BTIA 3VPRA 1T56A 2QKOA 3BT9A 3BR3A 3G1MA 3T6NA 2R7VA 3WHBA 3RD3A 2WUIA 1U9NA 3PM1A 2G7SA 1QVTA 3SWHA 2GBYA 3BHQA 2WGBA 2ZY9A 3Q0VA 3F1BA 3NS4A 3O60A 2R7XA 2ID6A 2PZ9A 2PBXA 3V6GA 2A2FX 3FK7A 3LHQA 3FRQA 3NRGA 5GPCA 3ON4A 3ON2A 3COLA 3HTIA 2ID3A 3WHCA 2YVEA 3HTAA 3KZ9A 1RPWA 5F0CA 5HBUA 2DG7A 3QPLA 3QQAA 5D18A 2B3WA 2XPUA 3NPIA 4B1RA 4JL3A 4D7NA 4GCKA 2QOPA 2XPWA 5IPAA 2XPVA 1UI6A 2VPRA 5FKNA 3RH2A 4W97A 3BR5A 2FD5A 1ZK8A 3IH4A 3BQYA 3LSJA 3Q3SA 3MVPA 2NS8A 3BTJA 2OI8A 1UI5A 2HQ5A 4AC0A 3G7RA 3JSJA 4AF5A 3KKCA 1JT0A 3VOXA 3CJDA 5EZHA 4M3DA 2ZOZA 3ZQLA 3HTJA 3HGGA 5EFYA 3G56A 4M3GA 3KKDA 2R7RA 3HIMA 2GFNA 2FQ4A 4MK6A 4G12A 3CWRA 5FMPA 3AQTA 3ZQHA 2Y2ZA 4V2GA 2FJI1 2QIBA 5D1RA 4JYKA 5K7ZA 2IAIA 2EH3A 3VVZA 3BR0A 3B81A 3VW2A 5K7HA 2TRTA 4AC6A 5IOYA 5J1UA 3CCYA 2O7TA 2X6OA 1JUSA 4D5CA 5GP9A 3VIBA 3DCFA 2ZCMA 2REKA 1RKTA 2NX4A 2UXPA 2TCTA 3LOCA 3EGQA 2R7SA 3ANGA 3BNIA 3BQZA 3G1OA 4IRVA 3LSRA 2UXOA 2VKVA 2XGCA 5K7FA 2ZB9A 2QTQA 4OD5A 3TP3A 1T33A 3Q0UA 2YVHA 2HXIA 3BR1A 3DU5A 3TP0A 3G1LA 4DW6A 3FK6A 2DTZA 5GPAA 2W53A 2UXIA 3ZQIA 3KNWA 4MXMA 3MNLA 4NELA 4ACIA 2OERA 2Q24A 3LJLA 3VW1A 2PFVA 1ZKGA 3NNRA 4GCTA 2XDNA 2RHAA 3SDGA 3O8HA 3FIWA 4WIBA 2IU5A 3F0CA 4ICHA 4C2MA 2JK3A 4W1UA 2B1EA 3KYLA 4M3EA 1QVUA 2R7TA 3PASA 2IBDA 4ME9A 3GEUA 3QPSA 3VOKA 3ANPA 4PXIA 5FKMA 2XRLA 5FHPA 2RAEA 1BJZA 2FJ1A 1VI0A 2YVXA 5J1YA 3DPJA 1Z77A 4KWAA 5IOZA 2Y30A 5FKOA 1A6IA 1JUMA 2HXOA 5HSZA 1JT6A 2JJ7A 3VVYA 2O7OA 2NP3A 1U9OA 3BR6A 4D5FA 1JUPA 4MO7A 2G3BA 3BCGA 4ABZA 4HKUA 4D7MA 4GCLA 2ZCXA 3VVXA 4UDSA 3VP5A 4V2FA 5D19A 3NXCA 4CGRA 2R7UA 2RASA 2NP5A 3V78A 2HYTA 5HAWA 2WV1A 5F08A 3ZQGA 2IEKA 4I76A 4AUXA 4YZEA 4JKZA 3QBMA 3VTIA 3DU6A 2D6YA 4L62A 5F1JA 2R7OA 4U9NA 3PPBA 1JTXA 3IUVA 2HKUA 3LSPA 2XGEA 4JNNA 2XB5A 2G7GA 2QCOA 4NN1A 5J1RA 2I10A 2F07A 5CXGA 3IH3A 5F0FA 2OPTA 3ZQFA 5F0HA 5CXIA 2VKEA 5EYRA 2G7LA 4OD4A 2GENA 3SFIA 3HE0A 3K8PC 5FKLA 4B3AA 3NI7A 1QPIA 5FKKA 3BRUA 2UXHA 5IP6A 3P9TA 2XGDA 3EUPA 1Z0XA 2X9DA 3CDLA 3BR2A 5F04A 4GFKA 3BTLA 4M3BA 3AQSA 2FBQA 5EZGA 2HYJA 2R7WA 2DG8A 4U9LA 1JTYA 3C2BA 2NS7A 2QWTA 3VUQA 3C07A 2UXUA 2FX0A 1SGMA 3HGYA 5FGLA 3DEWA 3BJBA 5H9TA 3LWJA 2OF7A 4X1EA 3Q0WA 5CW8A 3B6CA 5DAJA 3HTHA 5J3LA 2G0EA 4M3FA 1RKWA 2V57A 2Y31A 3E7QA 3IH2A 3FHNA 5K58A 3BTCA
chains in the Genus database with same CATH topology
5C4YA 3CRJA 3QKXA 3B6AA 2ZOYA 3O8GA 4GFLA 1ORKA 5AQCA 4XK4A 3GZIA 5F27A 3S5RA 2ZCNA 4I6ZA 2GUHA 3VW0A 3BTIA 3VPRA 1T56A 2QKOA 3BT9A 3BR3A 3G1MA 3T6NA 3WHBA 3RD3A 2WUIA 1U9NA 3PM1A 2G7SA 1QVTA 2GBYA 3BHQA 2WGBA 3Q0VA 3F1BA 3O60A 2PZ9A 2ID6A 2PBXA 3V6GA 3FK7A 3LHQA 3FRQA 3NRGA 5GPCA 3ON4A 3ON2A 3COLA 3HTIA 2ID3A 3WHCA 2YVEA 3HTAA 3KZ9A 1RPWA 5F0CA 5HBUA 2DG7A 3QPLA 3QQAA 5D18A 2XPUA 3NPIA 4B1RA 4JL3A 4D7NA 4GCKA 2QOPA 2XPWA 5IPAA 2XPVA 1UI6A 2VPRA 5FKNA 3RH2A 4W97A 3BR5A 2FD5A 1ZK8A 3IH4A 3BQYA 3LSJA 3Q3SA 3MVPA 2NS8A 3BTJA 2OI8A 1UI5A 2HQ5A 4AC0A 3G7RA 3JSJA 4AF5A 3KKCA 1JT0A 3VOXA 3CJDA 5EZHA 4M3DA 2ZOZA 3ZQLA 3HTJA 3HGGA 5EFYA 3G56A 4M3GA 3KKDA 3HIMA 2GFNA 2FQ4A 4MK6A 4G12A 3CWRA 5FMPA 3AQTA 3ZQHA 2Y2ZA 4V2GA 2QIBA 5D1RA 4JYKA 5K7ZA 2IAIA 2EH3A 3VVZA 3BR0A 3B81A 3VW2A 5K7HA 2TRTA 4AC6A 5IOYA 5J1UA 3CCYA 2O7TA 2X6OA 1JUSA 4D5CA 5GP9A 3VIBA 3DCFA 2ZCMA 2REKA 1RKTA 2NX4A 2UXPA 2TCTA 3LOCA 3EGQA 3ANGA 3BNIA 3BQZA 3G1OA 3LSRA 2UXOA 2VKVA 2XGCA 5K7FA 2ZB9A 2QTQA 3TP3A 1T33A 3Q0UA 2YVHA 2HXIA 3BR1A 3TP0A 3G1LA 4DW6A 3FK6A 2DTZA 5GPAA 2W53A 2UXIA 3ZQIA 3KNWA 4MXMA 3MNLA 4NELA 4ACIA 2OERA 2Q24A 3LJLA 3VW1A 1ZKGA 3NNRA 4GCTA 2XDNA 2RHAA 3SDGA 3O8HA 3FIWA 2IU5A 3F0CA 4ICHA 2JK3A 4W1UA 4M3EA 1QVUA 3PASA 2IBDA 4ME9A 3GEUA 3QPSA 3VOKA 3ANPA 4PXIA 5FKMA 2XRLA 5FHPA 2RAEA 1BJZA 2FJ1A 1VI0A 5J1YA 3DPJA 1Z77A 4KWAA 5IOZA 2Y30A 5FKOA 1A6IA 1JUMA 2HXOA 5HSZA 1JT6A 2JJ7A 3VVYA 2O7OA 2NP3A 1U9OA 3BR6A 4D5FA 1JUPA 4MO7A 2G3BA 3BCGA 4ABZA 4HKUA 4D7MA 4GCLA 2ZCXA 3VVXA 4UDSA 3VP5A 4V2FA 5D19A 3NXCA 4CGRA 2RASA 2NP5A 3V78A 2HYTA 5HAWA 2WV1A 5F08A 3ZQGA 2IEKA 4I76A 4AUXA 4YZEA 4JKZA 3QBMA 2D6YA 4L62A 5F1JA 3PPBA 1JTXA 3IUVA 2HKUA 3LSPA 2XGEA 4JNNA 2XB5A 2G7GA 2QCOA 4NN1A 5J1RA 2I10A 2F07A 5CXGA 3IH3A 5F0FA 2OPTA 3ZQFA 5F0HA 5CXIA 2VKEA 5EYRA 2G7LA 2GENA 3SFIA 3HE0A 5FKLA 4B3AA 3NI7A 1QPIA 5FKKA 3BRUA 2UXHA 5IP6A 3P9TA 2XGDA 3EUPA 1Z0XA 2X9DA 3CDLA 3BR2A 5F04A 4GFKA 3BTLA 4M3BA 3AQSA 2FBQA 5EZGA 2HYJA 2DG8A 1JTYA 3VUQA 2NS7A 2QWTA 3C2BA 3C07A 2UXUA 2FX0A 1SGMA 3HGYA 5FGLA 3DEWA 3BJBA 5H9TA 3LWJA 2OF7A 4X1EA 3Q0WA 5CW8A 3B6CA 5DAJA 3HTHA 5J3LA 2G0EA 4M3FA 1RKWA 2V57A 2Y31A 3E7QA 3IH2A 5K58A 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Y A;  3CRJ A;  3QKX A;  3B6A A;  2ZOY A;  3O8G A;  4GFL A;  1ORK A;  5AQC A;  4XK4 A;  3GZI A;  5F27 A;  3S5R A;  2ZCN A;  4I6Z A;  2GUH A;  3VW0 A;  3BTI A;  3VPR A;  1T56 A;  2QKO A;  3BT9 A;  3BR3 A;  3G1M A;  3T6N A;  3WHB A;  3RD3 A;  2WUI A;  1U9N A;  3PM1 A;  2G7S A;  1QVT A;  2GBY A;  3BHQ A;  2WGB A;  3Q0V A;  3F1B A;  3O60 A;  2PZ9 A;  2ID6 A;  2PBX A;  3V6G A;  3FK7 A;  3LHQ A;  3FRQ A;  3NRG A;  5GPC A;  3ON4 A;  3ON2 A;  3COL A;  3HTI A;  2ID3 A;  3WHC A;  2YVE A;  3HTA A;  3KZ9 A;  1RPW A;  5F0C A;  5HBU A;  2DG7 A;  3QPL A;  3QQA A;  5D18 A;  2XPU A;  3NPI A;  4B1R A;  4JL3 A;  4D7N A;  4GCK A;  2QOP A;  2XPW A;  5IPA A;  2XPV A;  1UI6 A;  2VPR A;  5FKN A;  3RH2 A;  4W97 A;  3BR5 A;  2FD5 A;  1ZK8 A;  3IH4 A;  3BQY A;  3LSJ A;  3Q3S A;  3MVP A;  2NS8 A;  3BTJ A;  2OI8 A;  1UI5 A;  2HQ5 A;  4AC0 A;  3G7R A;  3JSJ A;  4AF5 A;  3KKC A;  1JT0 A;  3VOX A;  3CJD A;  5EZH A;  4M3D A;  2ZOZ A;  3ZQL A;  3HTJ A;  3HGG A;  5EFY A;  3G56 A;  4M3G A;  3KKD A;  3HIM A;  2GFN A;  2FQ4 A;  4MK6 A;  4G12 A;  3CWR A;  5FMP A;  3AQT A;  3ZQH A;  2Y2Z A;  4V2G A;  2QIB A;  5D1R A;  4JYK A;  5K7Z A;  2IAI A;  2EH3 A;  3VVZ A;  3BR0 A;  3B81 A;  3VW2 A;  5K7H A;  2TRT A;  4AC6 A;  5IOY A;  5J1U A;  3CCY A;  2O7T A;  2X6O A;  1JUS A;  4D5C A;  5GP9 A;  3VIB A;  3DCF A;  2ZCM A;  2REK A;  1RKT A;  2NX4 A;  2UXP A;  2TCT A;  3LOC A;  3EGQ A;  3ANG A;  3BNI A;  3BQZ A;  3G1O A;  3LSR A;  2UXO A;  2VKV A;  2XGC A;  5K7F A;  2ZB9 A;  2QTQ A;  3TP3 A;  1T33 A;  3Q0U A;  2YVH A;  2HXI A;  3BR1 A;  3TP0 A;  3G1L A;  4DW6 A;  3FK6 A;  2DTZ A;  5GPA A;  2W53 A;  2UXI A;  3ZQI A;  3KNW A;  4MXM A;  3MNL A;  4NEL A;  4ACI A;  2OER A;  2Q24 A;  3LJL A;  3VW1 A;  1ZKG A;  3NNR A;  4GCT A;  2XDN A;  2RHA A;  3SDG A;  3O8H A;  3FIW A;  2IU5 A;  3F0C A;  4ICH A;  2JK3 A;  4W1U A;  4M3E A;  1QVU A;  3PAS A;  2IBD A;  4ME9 A;  3GEU A;  3QPS A;  3VOK A;  3ANP A;  4PXI A;  5FKM A;  2XRL A;  5FHP A;  2RAE A;  1BJZ A;  2FJ1 A;  1VI0 A;  5J1Y A;  3DPJ A;  1Z77 A;  4KWA A;  5IOZ A;  2Y30 A;  5FKO A;  1A6I A;  1JUM A;  2HXO A;  5HSZ A;  1JT6 A;  2JJ7 A;  3VVY A;  2O7O A;  2NP3 A;  1U9O A;  3BR6 A;  4D5F A;  1JUP A;  4MO7 A;  2G3B A;  3BCG A;  4ABZ A;  4HKU A;  4D7M A;  4GCL A;  2ZCX A;  3VVX A;  4UDS A;  3VP5 A;  4V2F A;  5D19 A;  3NXC A;  4CGR A;  2RAS A;  2NP5 A;  3V78 A;  2HYT A;  5HAW A;  2WV1 A;  5F08 A;  3ZQG A;  2IEK A;  4I76 A;  4AUX A;  4YZE A;  4JKZ A;  3QBM A;  2D6Y A;  4L62 A;  5F1J A;  3PPB A;  1JTX A;  3IUV A;  2HKU A;  3LSP A;  2XGE A;  4JNN A;  2XB5 A;  2G7G A;  2QCO A;  4NN1 A;  5J1R A;  2I10 A;  2F07 A;  5CXG A;  3IH3 A;  5F0F A;  2OPT A;  3ZQF A;  5F0H A;  5CXI A;  2VKE A;  5EYR A;  2G7L A;  2GEN A;  3SFI A;  3HE0 A;  5FKL A;  4B3A A;  3NI7 A;  1QPI A;  5FKK A;  3BRU A;  2UXH A;  5IP6 A;  3P9T A;  2XGD A;  3EUP A;  1Z0X A;  2X9D A;  3CDL A;  3BR2 A;  5F04 A;  4GFK A;  3BTL A;  4M3B A;  3AQS A;  2FBQ A;  5EZG A;  2HYJ A;  2DG8 A;  1JTY A;  3VUQ A;  2NS7 A;  2QWT A;  3C2B A;  3C07 A;  2UXU A;  2FX0 A;  1SGM A;  3HGY A;  5FGL A;  3DEW A;  3BJB A;  5H9T A;  3LWJ A;  2OF7 A;  4X1E A;  3Q0W A;  5CW8 A;  3B6C A;  5DAJ A;  3HTH A;  5J3L A;  2G0E A;  4M3F A;  1RKW A;  2V57 A;  2Y31 A;  3E7Q A;  3IH2 A;  5K58 A;  3BTC A; 
#chains in the Genus database with same CATH topology
 5CQG A;  5C4Y A;  3CRJ A;  3QKX A;  3B6A A;  2ZOY A;  3O8G A;  2R7Q A;  4GFL A;  1ORK A;  5AQC A;  4XK4 A;  3GZI A;  5F27 A;  4DVY P;  3S5R A;  2ZCN A;  4I6Z A;  2GUH A;  3VW0 A;  3BTI A;  3VPR A;  1T56 A;  2QKO A;  3BT9 A;  3BR3 A;  3G1M A;  3T6N A;  2R7V A;  3WHB A;  3RD3 A;  2WUI A;  1U9N A;  3PM1 A;  2G7S A;  1QVT A;  3SWH A;  2GBY A;  3BHQ A;  2WGB A;  2ZY9 A;  3Q0V A;  3F1B A;  3NS4 A;  3O60 A;  2R7X A;  2ID6 A;  2PZ9 A;  2PBX A;  3V6G A;  2A2F X;  3FK7 A;  3LHQ A;  3FRQ A;  3NRG A;  5GPC A;  3ON4 A;  3ON2 A;  3COL A;  3HTI A;  2ID3 A;  3WHC A;  2YVE A;  3HTA A;  3KZ9 A;  1RPW A;  5F0C A;  5HBU A;  2DG7 A;  3QPL A;  3QQA A;  5D18 A;  2B3W A;  2XPU A;  3NPI A;  4B1R A;  4JL3 A;  4D7N A;  4GCK A;  2QOP A;  2XPW A;  5IPA A;  2XPV A;  1UI6 A;  2VPR A;  5FKN A;  3RH2 A;  4W97 A;  3BR5 A;  2FD5 A;  1ZK8 A;  3IH4 A;  3BQY A;  3LSJ A;  3Q3S A;  3MVP A;  2NS8 A;  3BTJ A;  2OI8 A;  1UI5 A;  2HQ5 A;  4AC0 A;  3G7R A;  3JSJ A;  4AF5 A;  3KKC A;  1JT0 A;  3VOX A;  3CJD A;  5EZH A;  4M3D A;  2ZOZ A;  3ZQL A;  3HTJ A;  3HGG A;  5EFY A;  3G56 A;  4M3G A;  3KKD A;  2R7R A;  3HIM A;  2GFN A;  2FQ4 A;  4MK6 A;  4G12 A;  3CWR A;  5FMP A;  3AQT A;  3ZQH A;  2Y2Z A;  4V2G A;  2FJI 1;  2QIB A;  5D1R A;  4JYK A;  5K7Z A;  2IAI A;  2EH3 A;  3VVZ A;  3BR0 A;  3B81 A;  3VW2 A;  5K7H A;  2TRT A;  4AC6 A;  5IOY A;  5J1U A;  3CCY A;  2O7T A;  2X6O A;  1JUS A;  4D5C A;  5GP9 A;  3VIB A;  3DCF A;  2ZCM A;  2REK A;  1RKT A;  2NX4 A;  2UXP A;  2TCT A;  3LOC A;  3EGQ A;  2R7S A;  3ANG A;  3BNI A;  3BQZ A;  3G1O A;  4IRV A;  3LSR A;  2UXO A;  2VKV A;  2XGC A;  5K7F A;  2ZB9 A;  2QTQ A;  4OD5 A;  3TP3 A;  1T33 A;  3Q0U A;  2YVH A;  2HXI A;  3BR1 A;  3DU5 A;  3TP0 A;  3G1L A;  4DW6 A;  3FK6 A;  2DTZ A;  5GPA A;  2W53 A;  2UXI A;  3ZQI A;  3KNW A;  4MXM A;  3MNL A;  4NEL A;  4ACI A;  2OER A;  2Q24 A;  3LJL A;  3VW1 A;  2PFV A;  1ZKG A;  3NNR A;  4GCT A;  2XDN A;  2RHA A;  3SDG A;  3O8H A;  3FIW A;  4WIB A;  2IU5 A;  3F0C A;  4ICH A;  4C2M A;  2JK3 A;  4W1U A;  2B1E A;  3KYL A;  4M3E A;  1QVU A;  2R7T A;  3PAS A;  2IBD A;  4ME9 A;  3GEU A;  3QPS A;  3VOK A;  3ANP A;  4PXI A;  5FKM A;  2XRL A;  5FHP A;  2RAE A;  1BJZ A;  2FJ1 A;  1VI0 A;  2YVX A;  5J1Y A;  3DPJ A;  1Z77 A;  4KWA A;  5IOZ A;  2Y30 A;  5FKO A;  1A6I A;  1JUM A;  2HXO A;  5HSZ A;  1JT6 A;  2JJ7 A;  3VVY A;  2O7O A;  2NP3 A;  1U9O A;  3BR6 A;  4D5F A;  1JUP A;  4MO7 A;  2G3B A;  3BCG A;  4ABZ A;  4HKU A;  4D7M A;  4GCL A;  2ZCX A;  3VVX A;  4UDS A;  3VP5 A;  4V2F A;  5D19 A;  3NXC A;  4CGR A;  2R7U A;  2RAS A;  2NP5 A;  3V78 A;  2HYT A;  5HAW A;  2WV1 A;  5F08 A;  3ZQG A;  2IEK A;  4I76 A;  4AUX A;  4YZE A;  4JKZ A;  3QBM A;  3VTI A;  3DU6 A;  2D6Y A;  4L62 A;  5F1J A;  2R7O A;  4U9N A;  3PPB A;  1JTX A;  3IUV A;  2HKU A;  3LSP A;  2XGE A;  4JNN A;  2XB5 A;  2G7G A;  2QCO A;  4NN1 A;  5J1R A;  2I10 A;  2F07 A;  5CXG A;  3IH3 A;  5F0F A;  2OPT A;  3ZQF A;  5F0H A;  5CXI A;  2VKE A;  5EYR A;  2G7L A;  4OD4 A;  2GEN A;  3SFI A;  3HE0 A;  3K8P C;  5FKL A;  4B3A A;  3NI7 A;  1QPI A;  5FKK A;  3BRU A;  2UXH A;  5IP6 A;  3P9T A;  2XGD A;  3EUP A;  1Z0X A;  2X9D A;  3CDL A;  3BR2 A;  5F04 A;  4GFK A;  3BTL A;  4M3B A;  3AQS A;  2FBQ A;  5EZG A;  2HYJ A;  2R7W A;  2DG8 A;  4U9L A;  1JTY A;  3C2B A;  2NS7 A;  2QWT A;  3VUQ A;  3C07 A;  2UXU A;  2FX0 A;  1SGM A;  3HGY A;  5FGL A;  3DEW A;  3BJB A;  5H9T A;  3LWJ A;  2OF7 A;  4X1E A;  3Q0W A;  5CW8 A;  3B6C A;  5DAJ A;  3HTH A;  5J3L A;  2G0E A;  4M3F A;  1RKW A;  2V57 A;  2Y31 A;  3E7Q A;  3IH2 A;  3FHN A;  5K58 A;  3BTC A; 
#chains in the Genus database with same CATH homology
 5C4Y A;  3CRJ A;  3QKX A;  3B6A A;  2ZOY A;  3O8G A;  4GFL A;  1ORK A;  5AQC A;  4XK4 A;  3GZI A;  5F27 A;  3S5R A;  2ZCN A;  4I6Z A;  2GUH A;  3VW0 A;  3BTI A;  3VPR A;  1T56 A;  2QKO A;  3BT9 A;  3BR3 A;  3G1M A;  3T6N A;  3WHB A;  3RD3 A;  2WUI A;  1U9N A;  3PM1 A;  2G7S A;  1QVT A;  2GBY A;  3BHQ A;  2WGB A;  3Q0V A;  3F1B A;  3O60 A;  2PZ9 A;  2ID6 A;  2PBX A;  3V6G A;  3FK7 A;  3LHQ A;  3FRQ A;  3NRG A;  5GPC A;  3ON4 A;  3ON2 A;  3COL A;  3HTI A;  2ID3 A;  3WHC A;  2YVE A;  3HTA A;  3KZ9 A;  1RPW A;  5F0C A;  5HBU A;  2DG7 A;  3QPL A;  3QQA A;  5D18 A;  2XPU A;  3NPI A;  4B1R A;  4JL3 A;  4D7N A;  4GCK A;  2QOP A;  2XPW A;  5IPA A;  2XPV A;  1UI6 A;  2VPR A;  5FKN A;  3RH2 A;  4W97 A;  3BR5 A;  2FD5 A;  1ZK8 A;  3IH4 A;  3BQY A;  3LSJ A;  3Q3S A;  3MVP A;  2NS8 A;  3BTJ A;  2OI8 A;  1UI5 A;  2HQ5 A;  4AC0 A;  3G7R A;  3JSJ A;  4AF5 A;  3KKC A;  1JT0 A;  3VOX A;  3CJD A;  5EZH A;  4M3D A;  2ZOZ A;  3ZQL A;  3HTJ A;  3HGG A;  5EFY A;  3G56 A;  4M3G A;  3KKD A;  3HIM A;  2GFN A;  2FQ4 A;  4MK6 A;  4G12 A;  3CWR A;  5FMP A;  3AQT A;  3ZQH A;  2Y2Z A;  4V2G A;  2QIB A;  5D1R A;  4JYK A;  5K7Z A;  2IAI A;  2EH3 A;  3VVZ A;  3BR0 A;  3B81 A;  3VW2 A;  5K7H A;  2TRT A;  4AC6 A;  5IOY A;  5J1U A;  3CCY A;  2O7T A;  2X6O A;  1JUS A;  4D5C A;  5GP9 A;  3VIB A;  3DCF A;  2ZCM A;  2REK A;  1RKT A;  2NX4 A;  2UXP A;  2TCT A;  3LOC A;  3EGQ A;  3ANG A;  3BNI A;  3BQZ A;  3G1O A;  3LSR A;  2UXO A;  2VKV A;  2XGC A;  5K7F A;  2ZB9 A;  2QTQ A;  3TP3 A;  1T33 A;  3Q0U A;  2YVH A;  2HXI A;  3BR1 A;  3TP0 A;  3G1L A;  4DW6 A;  3FK6 A;  2DTZ A;  5GPA A;  2W53 A;  2UXI A;  3ZQI A;  3KNW A;  4MXM A;  3MNL A;  4NEL A;  4ACI A;  2OER A;  2Q24 A;  3LJL A;  3VW1 A;  1ZKG A;  3NNR A;  4GCT A;  2XDN A;  2RHA A;  3SDG A;  3O8H A;  3FIW A;  2IU5 A;  3F0C A;  4ICH A;  2JK3 A;  4W1U A;  4M3E A;  1QVU A;  3PAS A;  2IBD A;  4ME9 A;  3GEU A;  3QPS A;  3VOK A;  3ANP A;  4PXI A;  5FKM A;  2XRL A;  5FHP A;  2RAE A;  1BJZ A;  2FJ1 A;  1VI0 A;  5J1Y A;  3DPJ A;  1Z77 A;  4KWA A;  5IOZ A;  2Y30 A;  5FKO A;  1A6I A;  1JUM A;  2HXO A;  5HSZ A;  1JT6 A;  2JJ7 A;  3VVY A;  2O7O A;  2NP3 A;  1U9O A;  3BR6 A;  4D5F A;  1JUP A;  4MO7 A;  2G3B A;  3BCG A;  4ABZ A;  4HKU A;  4D7M A;  4GCL A;  2ZCX A;  3VVX A;  4UDS A;  3VP5 A;  4V2F A;  5D19 A;  3NXC A;  4CGR A;  2RAS A;  2NP5 A;  3V78 A;  2HYT A;  5HAW A;  2WV1 A;  5F08 A;  3ZQG A;  2IEK A;  4I76 A;  4AUX A;  4YZE A;  4JKZ A;  3QBM A;  2D6Y A;  4L62 A;  5F1J A;  3PPB A;  1JTX A;  3IUV A;  2HKU A;  3LSP A;  2XGE A;  4JNN A;  2XB5 A;  2G7G A;  2QCO A;  4NN1 A;  5J1R A;  2I10 A;  2F07 A;  5CXG A;  3IH3 A;  5F0F A;  2OPT A;  3ZQF A;  5F0H A;  5CXI A;  2VKE A;  5EYR A;  2G7L A;  2GEN A;  3SFI A;  3HE0 A;  5FKL A;  4B3A A;  3NI7 A;  1QPI A;  5FKK A;  3BRU A;  2UXH A;  5IP6 A;  3P9T A;  2XGD A;  3EUP A;  1Z0X A;  2X9D A;  3CDL A;  3BR2 A;  5F04 A;  4GFK A;  3BTL A;  4M3B A;  3AQS A;  2FBQ A;  5EZG A;  2HYJ A;  2DG8 A;  1JTY A;  3VUQ A;  2NS7 A;  2QWT A;  3C2B A;  3C07 A;  2UXU A;  2FX0 A;  1SGM A;  3HGY A;  5FGL A;  3DEW A;  3BJB A;  5H9T A;  3LWJ A;  2OF7 A;  4X1E A;  3Q0W A;  5CW8 A;  3B6C A;  5DAJ A;  3HTH A;  5J3L A;  2G0E A;  4M3F A;  1RKW A;  2V57 A;  2Y31 A;  3E7Q A;  3IH2 A;  5K58 A;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...