5CXIA

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-23,24-bisnorchol-4-en-22-oyl-coa (4-bnc-coa)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
181
structure length
180
Chain Sequence
QRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR
total genus 72
structure length 180
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxiA00
3B6CA 2F07A 5D1RA 3HE0A 3NPIA 4AF5A 3VVZA 3BCGA 3ZQIA 4B1RA 5J1RA 2VKEA 3NI7A 3FK7A 2JK3A 5J1YA 4W97A 4M3EA 4D7MA 1U9OA 5IOZA 2YVHA 3BTLA 2ZCMA 5F1JA 3BR3A 2OF7A 3HTJA 3LHQA 3ANPA 3CCYA 3BTIA 3KKCA 3G7RA 1U9NA 4UDSA 2YVEA 2GFNA 1Z0XA 3HIMA 2XDNA 3F0CA 3CJDA 4NELA 2FQ4A 2IU5A 3NXCA 3KKDA 4MK6A 3QPSA 5FGLA 4PXIA 5GP9A 2GENA 5D19A 4D5CA 5F04A 3VW0A 5K7HA 5K7ZA 3LOCA 5EFYA 4ME9A 3PPBA 3G56A 1QPIA 3BR1A 3HTIA 4G12A 5F0FA 3AQSA 3MNLA 2RAEA 5CXGA 1QVTA 3TP3A 2DG7A 3CWRA 3BNIA 3ZQFA 3HTHA 3QPLA 1JTXA 5HAWA 4V2GA 2QKOA 3VOXA 2X9DA 4GCTA 4GFKA 3BQYA 3IUVA 2EH3A 3COLA 2TRTA 1ZKGA 3V6GA 3BR2A 5FKOA 3FIWA 5H9TA 2ID3A 3LWJA 2G3BA 2PBXA 2Y2ZA 4D5FA 4MO7A 5FKNA 5FKLA 2NS7A 4HKUA 3NNRA 3RD3A 3ON2A 5FMPA 2IAIA 4XK4A 2XB5A 4M3FA 5IP6A 3QBMA 4ACIA 3G1MA 2HYJA 1UI5A 3C2BA 3TP0A 2NP5A 2PZ9A 3ANGA 2QWTA 3VPRA 4GCLA 2XGCA 3LSJA 4W1UA 3ZQGA 1JT0A 4I6ZA 3O8GA 4X1EA 4ICHA 1RPWA 2G7GA 4GCKA 4M3BA 3EUPA 3DPJA 2FBQA 3VOKA 1BJZA 2GUHA 3DEWA 5FKKA 2WGBA 3LSPA 3MVPA 3ZQHA 2HYTA 5HBUA 2V57A 2QIBA 4NN1A 2X6OA 3BR5A 2Y31A 2WV1A 3VVYA 2D6YA 3HGYA 3FK6A 3G1LA 1JT6A 3PM1A 4MXMA 2WUIA 5EZGA 4YZEA 4AC0A 1QVUA 4JNNA 2GBYA 3WHBA 1RKTA 3FRQA 3O60A 5K7FA 5HSZA 5FKMA 3T6NA 2W53A 3VUQA 3P9TA 3KNWA 4JYKA 1JUPA 5F0CA 3BT9A 3DCFA 3AQTA 4L62A 2G7LA 2UXIA 1A6IA 2G7SA 3ZQLA 4AC6A 2UXOA 2ZOYA 2JJ7A 3B6AA 2UXPA 2I10A 3BJBA 3RH2A 2VKVA 4D7NA 3C07A 2HQ5A 2NP3A 3JSJA 2OPTA 4I76A 2OERA 3V78A 3B81A 2QOPA 3S5RA 2IEKA 5D18A 5CW8A 2O7OA 2ZOZA 3BRUA 3F1BA 3Q0VA 2ZCNA 2HXOA 1JUMA 3SFIA 5EYRA 2NX4A 1VI0A 2UXHA 5C4YA 5DAJA 2TCTA 4M3GA 3IH2A 3VVXA 4JKZA 3VW1A 3KZ9A 3CDLA 3HGGA 5F0HA 2FD5A 5F08A 3Q0UA 3QQAA 2DTZA 2O7TA 2REKA 5J3LA 5J1UA 2ZB9A 2FJ1A 3SDGA 2OI8A 3NRGA 2NS8A 3LJLA 2VPRA 3BHQA 3ON4A 2RHAA 1ORKA 3IH4A 1Z77A 3BTCA 3E7QA 2Y30A 5CXIA 2HKUA 3GEUA 3CRJA 2HXIA 3Q0WA 2XPVA 1T33A 2XRLA 4B3AA 2ID6A 3WHCA 4GFLA 2Q24A 5GPCA 4V2FA 1UI6A 2XGDA 4KWAA 5FHPA 5F27A 5IOYA 2G0EA 5GPAA 5IPAA 2XGEA 2ZCXA 4AUXA 1RKWA 3LSRA 1JTYA 1SGMA 2QCOA 2QTQA 3BR6A 3IH3A 2UXUA 5EZHA 3O8HA 4CGRA 3VIBA 4DW6A 5AQCA 5K58A 3QKXA 2DG8A 3BTJA 2XPWA 3G1OA 3GZIA 4ABZA 4JL3A 3PASA 2RASA 3BQZA 3HTAA 3Q3SA 2IBDA 3VP5A 2FX0A 4M3DA 3BR0A 1ZK8A 1JUSA 3EGQA 2XPUA 3VW2A 1T56A
chains in the Genus database with same CATH superfamily
3B6CA 3NS4A 2F07A 5D1RA 3HE0A 3NPIA 4AF5A 3VVZA 2R7SA 3BCGA 3ZQIA 4B1RA 5J1RA 2VKEA 3NI7A 3FK7A 2JK3A 5J1YA 4W97A 4M3EA 4U9NA 2PFVA 4D7MA 3DU6A 1U9OA 5IOZA 2YVHA 3BTLA 2ZCMA 5F1JA 3BR3A 2OF7A 3HTJA 3LHQA 3ANPA 3CCYA 3BTIA 3KKCA 3G7RA 1U9NA 4UDSA 2YVEA 4DVYP 2R7WA 2GFNA 1Z0XA 3HIMA 2XDNA 3F0CA 3CJDA 2R7VA 4NELA 2FQ4A 2IU5A 3NXCA 3KKDA 4MK6A 3QPSA 5FGLA 3FHNA 4PXIA 5GP9A 2GENA 5D19A 4D5CA 5F04A 3VW0A 5K7HA 5K7ZA 3LOCA 5EFYA 4ME9A 3PPBA 3G56A 1QPIA 3BR1A 3HTIA 4G12A 5F0FA 3AQSA 3K8PC 3MNLA 2RAEA 5CXGA 1QVTA 3TP3A 2DG7A 4C2MA 3CWRA 3BNIA 3ZQFA 3HTHA 3QPLA 1JTXA 5HAWA 4V2GA 2QKOA 3VOXA 2X9DA 4GCTA 4GFKA 3BQYA 3IUVA 2EH3A 3COLA 2TRTA 1ZKGA 3V6GA 3BR2A 5FKOA 3FIWA 5H9TA 2ID3A 3LWJA 2G3BA 2PBXA 2Y2ZA 4D5FA 4MO7A 5FKNA 5FKLA 2A2FX 2NS7A 4HKUA 3SWHA 3NNRA 3RD3A 3ON2A 5FMPA 2R7XA 2IAIA 4XK4A 2XB5A 4M3FA 5IP6A 2ZY9A 3QBMA 4ACIA 3G1MA 2HYJA 1UI5A 3C2BA 2B3WA 2R7OA 3TP0A 2NP5A 2PZ9A 3ANGA 2QWTA 3VPRA 4GCLA 2XGCA 3LSJA 4W1UA 3ZQGA 1JT0A 4I6ZA 3O8GA 4X1EA 4ICHA 1RPWA 2G7GA 4IRVA 4GCKA 4M3BA 3EUPA 3DPJA 2FBQA 3VOKA 1BJZA 2GUHA 2B1EA 3DEWA 5FKKA 2WGBA 3LSPA 2R7QA 3MVPA 3ZQHA 2HYTA 5HBUA 2V57A 2QIBA 4NN1A 2X6OA 3BR5A 2Y31A 2WV1A 3VVYA 2D6YA 3HGYA 3FK6A 3G1LA 1JT6A 3PM1A 4MXMA 2R7UA 2WUIA 5EZGA 4YZEA 4AC0A 1QVUA 4JNNA 2GBYA 3WHBA 1RKTA 3FRQA 3O60A 5K7FA 5HSZA 5FKMA 3T6NA 2W53A 3VUQA 3P9TA 3KNWA 4JYKA 1JUPA 5F0CA 3BT9A 3DCFA 3AQTA 4L62A 2G7LA 2UXIA 1A6IA 2G7SA 3ZQLA 4AC6A 2UXOA 2ZOYA 2JJ7A 3B6AA 2UXPA 2I10A 3BJBA 3RH2A 2VKVA 4D7NA 3C07A 2HQ5A 2NP3A 3JSJA 2OPTA 4I76A 2OERA 3V78A 3B81A 5CQGA 2QOPA 3S5RA 2IEKA 5D18A 5CW8A 2O7OA 2ZOZA 3BRUA 3F1BA 3Q0VA 2ZCNA 2HXOA 1JUMA 3SFIA 5EYRA 2NX4A 1VI0A 2UXHA 5C4YA 5DAJA 3KYLA 4WIBA 2TCTA 4M3GA 3IH2A 3VVXA 4JKZA 3VW1A 4OD4A 3KZ9A 3CDLA 3HGGA 5F0HA 2FD5A 5F08A 3Q0UA 3DU5A 2DTZA 3QQAA 2O7TA 2REKA 5J3LA 5J1UA 2ZB9A 2FJ1A 3SDGA 2FJI1 2OI8A 3NRGA 2NS8A 3LJLA 2VPRA 4U9LA 3BHQA 3ON4A 2RHAA 1ORKA 2R7RA 3IH4A 1Z77A 3BTCA 3E7QA 2Y30A 5CXIA 2HKUA 3GEUA 2YVXA 3CRJA 2HXIA 3Q0WA 2XPVA 1T33A 2XRLA 4B3AA 2ID6A 3WHCA 4GFLA 2Q24A 5GPCA 4V2FA 1UI6A 2XGDA 4KWAA 5FHPA 5F27A 5IOYA 2G0EA 5GPAA 5IPAA 2XGEA 2ZCXA 4AUXA 1RKWA 3LSRA 1JTYA 1SGMA 2QCOA 2QTQA 3BR6A 3VTIA 3IH3A 2UXUA 5EZHA 3O8HA 4CGRA 3VIBA 4DW6A 5AQCA 5K58A 3QKXA 2DG8A 4OD5A 3BTJA 2XPWA 3G1OA 3GZIA 4ABZA 4JL3A 3PASA 2RASA 3BQZA 3HTAA 3Q3SA 3VP5A 2IBDA 2FX0A 4M3DA 2R7TA 3BR0A 1ZK8A 1JUSA 3EGQA 2XPUA 3VW2A 1T56A
chains in the Genus database with same CATH topology
3B6CA 2F07A 5D1RA 3HE0A 3NPIA 4AF5A 3VVZA 3BCGA 3ZQIA 4B1RA 5J1RA 2VKEA 3NI7A 3FK7A 2JK3A 5J1YA 4W97A 4M3EA 4D7MA 1U9OA 5IOZA 2YVHA 3BTLA 2ZCMA 5F1JA 3BR3A 2OF7A 3HTJA 3LHQA 3ANPA 3CCYA 3BTIA 3KKCA 3G7RA 1U9NA 4UDSA 2YVEA 2GFNA 1Z0XA 3HIMA 2XDNA 3F0CA 3CJDA 4NELA 2FQ4A 2IU5A 3NXCA 3KKDA 4MK6A 3QPSA 5FGLA 4PXIA 5GP9A 2GENA 5D19A 4D5CA 5F04A 3VW0A 5K7HA 5K7ZA 3LOCA 5EFYA 4ME9A 3PPBA 3G56A 1QPIA 3BR1A 3HTIA 4G12A 5F0FA 3AQSA 3MNLA 2RAEA 5CXGA 1QVTA 3TP3A 2DG7A 3CWRA 3BNIA 3ZQFA 3HTHA 3QPLA 1JTXA 5HAWA 4V2GA 2QKOA 3VOXA 2X9DA 4GCTA 4GFKA 3BQYA 3IUVA 2EH3A 3COLA 2TRTA 1ZKGA 3V6GA 3BR2A 5FKOA 3FIWA 5H9TA 2ID3A 3LWJA 2G3BA 2PBXA 2Y2ZA 4D5FA 4MO7A 5FKNA 5FKLA 2NS7A 4HKUA 3NNRA 3RD3A 3ON2A 5FMPA 2IAIA 4XK4A 2XB5A 4M3FA 5IP6A 3QBMA 4ACIA 3G1MA 2HYJA 1UI5A 3C2BA 3TP0A 2NP5A 2PZ9A 3ANGA 2QWTA 3VPRA 4GCLA 2XGCA 3LSJA 4W1UA 3ZQGA 1JT0A 4I6ZA 3O8GA 4X1EA 4ICHA 1RPWA 2G7GA 4GCKA 4M3BA 3EUPA 3DPJA 2FBQA 3VOKA 1BJZA 2GUHA 3DEWA 5FKKA 2WGBA 3LSPA 3MVPA 3ZQHA 2HYTA 5HBUA 2V57A 2QIBA 4NN1A 2X6OA 3BR5A 2Y31A 2WV1A 3VVYA 2D6YA 3HGYA 3FK6A 3G1LA 1JT6A 3PM1A 4MXMA 2WUIA 5EZGA 4YZEA 4AC0A 1QVUA 4JNNA 2GBYA 3WHBA 1RKTA 3FRQA 3O60A 5K7FA 5HSZA 5FKMA 3T6NA 2W53A 3VUQA 3P9TA 3KNWA 4JYKA 1JUPA 5F0CA 3BT9A 3DCFA 3AQTA 4L62A 2G7LA 2UXIA 1A6IA 2G7SA 3ZQLA 4AC6A 2UXOA 2ZOYA 2JJ7A 3B6AA 2UXPA 2I10A 3BJBA 3RH2A 2VKVA 4D7NA 3C07A 2HQ5A 2NP3A 3JSJA 2OPTA 4I76A 2OERA 3V78A 3B81A 2QOPA 3S5RA 2IEKA 5D18A 5CW8A 2O7OA 2ZOZA 3BRUA 3F1BA 3Q0VA 2ZCNA 2HXOA 1JUMA 3SFIA 5EYRA 2NX4A 1VI0A 2UXHA 5C4YA 5DAJA 2TCTA 4M3GA 3IH2A 3VVXA 4JKZA 3VW1A 3KZ9A 3CDLA 3HGGA 5F0HA 2FD5A 5F08A 3Q0UA 3QQAA 2DTZA 2O7TA 2REKA 5J3LA 5J1UA 2ZB9A 2FJ1A 3SDGA 2OI8A 3NRGA 2NS8A 3LJLA 2VPRA 3BHQA 3ON4A 2RHAA 1ORKA 3IH4A 1Z77A 3BTCA 3E7QA 2Y30A 5CXIA 2HKUA 3GEUA 3CRJA 2HXIA 3Q0WA 2XPVA 1T33A 2XRLA 4B3AA 2ID6A 3WHCA 4GFLA 2Q24A 5GPCA 4V2FA 1UI6A 2XGDA 4KWAA 5FHPA 5F27A 5IOYA 2G0EA 5GPAA 5IPAA 2XGEA 2ZCXA 4AUXA 1RKWA 3LSRA 1JTYA 1SGMA 2QCOA 2QTQA 3BR6A 3IH3A 2UXUA 5EZHA 3O8HA 4CGRA 3VIBA 4DW6A 5AQCA 5K58A 3QKXA 2DG8A 3BTJA 2XPWA 3G1OA 3GZIA 4ABZA 4JL3A 3PASA 2RASA 3BQZA 3HTAA 3Q3SA 2IBDA 3VP5A 2FX0A 4M3DA 3BR0A 1ZK8A 1JUSA 3EGQA 2XPUA 3VW2A 1T56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6C A;  2F07 A;  5D1R A;  3HE0 A;  3NPI A;  4AF5 A;  3VVZ A;  3BCG A;  3ZQI A;  4B1R A;  5J1R A;  2VKE A;  3NI7 A;  3FK7 A;  2JK3 A;  5J1Y A;  4W97 A;  4M3E A;  4D7M A;  1U9O A;  5IOZ A;  2YVH A;  3BTL A;  2ZCM A;  5F1J A;  3BR3 A;  2OF7 A;  3HTJ A;  3LHQ A;  3ANP A;  3CCY A;  3BTI A;  3KKC A;  3G7R A;  1U9N A;  4UDS A;  2YVE A;  2GFN A;  1Z0X A;  3HIM A;  2XDN A;  3F0C A;  3CJD A;  4NEL A;  2FQ4 A;  2IU5 A;  3NXC A;  3KKD A;  4MK6 A;  3QPS A;  5FGL A;  4PXI A;  5GP9 A;  2GEN A;  5D19 A;  4D5C A;  5F04 A;  3VW0 A;  5K7H A;  5K7Z A;  3LOC A;  5EFY A;  4ME9 A;  3PPB A;  3G56 A;  1QPI A;  3BR1 A;  3HTI A;  4G12 A;  5F0F A;  3AQS A;  3MNL A;  2RAE A;  5CXG A;  1QVT A;  3TP3 A;  2DG7 A;  3CWR A;  3BNI A;  3ZQF A;  3HTH A;  3QPL A;  1JTX A;  5HAW A;  4V2G A;  2QKO A;  3VOX A;  2X9D A;  4GCT A;  4GFK A;  3BQY A;  3IUV A;  2EH3 A;  3COL A;  2TRT A;  1ZKG A;  3V6G A;  3BR2 A;  5FKO A;  3FIW A;  5H9T A;  2ID3 A;  3LWJ A;  2G3B A;  2PBX A;  2Y2Z A;  4D5F A;  4MO7 A;  5FKN A;  5FKL A;  2NS7 A;  4HKU A;  3NNR A;  3RD3 A;  3ON2 A;  5FMP A;  2IAI A;  4XK4 A;  2XB5 A;  4M3F A;  5IP6 A;  3QBM A;  4ACI A;  3G1M A;  2HYJ A;  1UI5 A;  3C2B A;  3TP0 A;  2NP5 A;  2PZ9 A;  3ANG A;  2QWT A;  3VPR A;  4GCL A;  2XGC A;  3LSJ A;  4W1U A;  3ZQG A;  1JT0 A;  4I6Z A;  3O8G A;  4X1E A;  4ICH A;  1RPW A;  2G7G A;  4GCK A;  4M3B A;  3EUP A;  3DPJ A;  2FBQ A;  3VOK A;  1BJZ A;  2GUH A;  3DEW A;  5FKK A;  2WGB A;  3LSP A;  3MVP A;  3ZQH A;  2HYT A;  5HBU A;  2V57 A;  2QIB A;  4NN1 A;  2X6O A;  3BR5 A;  2Y31 A;  2WV1 A;  3VVY A;  2D6Y A;  3HGY A;  3FK6 A;  3G1L A;  1JT6 A;  3PM1 A;  4MXM A;  2WUI A;  5EZG A;  4YZE A;  4AC0 A;  1QVU A;  4JNN A;  2GBY A;  3WHB A;  1RKT A;  3FRQ A;  3O60 A;  5K7F A;  5HSZ A;  5FKM A;  3T6N A;  2W53 A;  3VUQ A;  3P9T A;  3KNW A;  4JYK A;  1JUP A;  5F0C A;  3BT9 A;  3DCF A;  3AQT A;  4L62 A;  2G7L A;  2UXI A;  1A6I A;  2G7S A;  3ZQL A;  4AC6 A;  2UXO A;  2ZOY A;  2JJ7 A;  3B6A A;  2UXP A;  2I10 A;  3BJB A;  3RH2 A;  2VKV A;  4D7N A;  3C07 A;  2HQ5 A;  2NP3 A;  3JSJ A;  2OPT A;  4I76 A;  2OER A;  3V78 A;  3B81 A;  2QOP A;  3S5R A;  2IEK A;  5D18 A;  5CW8 A;  2O7O A;  2ZOZ A;  3BRU A;  3F1B A;  3Q0V A;  2ZCN A;  2HXO A;  1JUM A;  3SFI A;  5EYR A;  2NX4 A;  1VI0 A;  2UXH A;  5C4Y A;  5DAJ A;  2TCT A;  4M3G A;  3IH2 A;  3VVX A;  4JKZ A;  3VW1 A;  3KZ9 A;  3CDL A;  3HGG A;  5F0H A;  2FD5 A;  5F08 A;  3Q0U A;  3QQA A;  2DTZ A;  2O7T A;  2REK A;  5J3L A;  5J1U A;  2ZB9 A;  2FJ1 A;  3SDG A;  2OI8 A;  3NRG A;  2NS8 A;  3LJL A;  2VPR A;  3BHQ A;  3ON4 A;  2RHA A;  1ORK A;  3IH4 A;  1Z77 A;  3BTC A;  3E7Q A;  2Y30 A;  5CXI A;  2HKU A;  3GEU A;  3CRJ A;  2HXI A;  3Q0W A;  2XPV A;  1T33 A;  2XRL A;  4B3A A;  2ID6 A;  3WHC A;  4GFL A;  2Q24 A;  5GPC A;  4V2F A;  1UI6 A;  2XGD A;  4KWA A;  5FHP A;  5F27 A;  5IOY A;  2G0E A;  5GPA A;  5IPA A;  2XGE A;  2ZCX A;  4AUX A;  1RKW A;  3LSR A;  1JTY A;  1SGM A;  2QCO A;  2QTQ A;  3BR6 A;  3IH3 A;  2UXU A;  5EZH A;  3O8H A;  4CGR A;  3VIB A;  4DW6 A;  5AQC A;  5K58 A;  3QKX A;  2DG8 A;  3BTJ A;  2XPW A;  3G1O A;  3GZI A;  4ABZ A;  4JL3 A;  3PAS A;  2RAS A;  3BQZ A;  3HTA A;  3Q3S A;  2IBD A;  3VP5 A;  2FX0 A;  4M3D A;  3BR0 A;  1ZK8 A;  1JUS A;  3EGQ A;  2XPU A;  3VW2 A;  1T56 A; 
#chains in the Genus database with same CATH topology
 3B6C A;  3NS4 A;  2F07 A;  5D1R A;  3HE0 A;  3NPI A;  4AF5 A;  3VVZ A;  2R7S A;  3BCG A;  3ZQI A;  4B1R A;  5J1R A;  2VKE A;  3NI7 A;  3FK7 A;  2JK3 A;  5J1Y A;  4W97 A;  4M3E A;  4U9N A;  2PFV A;  4D7M A;  3DU6 A;  1U9O A;  5IOZ A;  2YVH A;  3BTL A;  2ZCM A;  5F1J A;  3BR3 A;  2OF7 A;  3HTJ A;  3LHQ A;  3ANP A;  3CCY A;  3BTI A;  3KKC A;  3G7R A;  1U9N A;  4UDS A;  2YVE A;  4DVY P;  2R7W A;  2GFN A;  1Z0X A;  3HIM A;  2XDN A;  3F0C A;  3CJD A;  2R7V A;  4NEL A;  2FQ4 A;  2IU5 A;  3NXC A;  3KKD A;  4MK6 A;  3QPS A;  5FGL A;  3FHN A;  4PXI A;  5GP9 A;  2GEN A;  5D19 A;  4D5C A;  5F04 A;  3VW0 A;  5K7H A;  5K7Z A;  3LOC A;  5EFY A;  4ME9 A;  3PPB A;  3G56 A;  1QPI A;  3BR1 A;  3HTI A;  4G12 A;  5F0F A;  3AQS A;  3K8P C;  3MNL A;  2RAE A;  5CXG A;  1QVT A;  3TP3 A;  2DG7 A;  4C2M A;  3CWR A;  3BNI A;  3ZQF A;  3HTH A;  3QPL A;  1JTX A;  5HAW A;  4V2G A;  2QKO A;  3VOX A;  2X9D A;  4GCT A;  4GFK A;  3BQY A;  3IUV A;  2EH3 A;  3COL A;  2TRT A;  1ZKG A;  3V6G A;  3BR2 A;  5FKO A;  3FIW A;  5H9T A;  2ID3 A;  3LWJ A;  2G3B A;  2PBX A;  2Y2Z A;  4D5F A;  4MO7 A;  5FKN A;  5FKL A;  2A2F X;  2NS7 A;  4HKU A;  3SWH A;  3NNR A;  3RD3 A;  3ON2 A;  5FMP A;  2R7X A;  2IAI A;  4XK4 A;  2XB5 A;  4M3F A;  5IP6 A;  2ZY9 A;  3QBM A;  4ACI A;  3G1M A;  2HYJ A;  1UI5 A;  3C2B A;  2B3W A;  2R7O A;  3TP0 A;  2NP5 A;  2PZ9 A;  3ANG A;  2QWT A;  3VPR A;  4GCL A;  2XGC A;  3LSJ A;  4W1U A;  3ZQG A;  1JT0 A;  4I6Z A;  3O8G A;  4X1E A;  4ICH A;  1RPW A;  2G7G A;  4IRV A;  4GCK A;  4M3B A;  3EUP A;  3DPJ A;  2FBQ A;  3VOK A;  1BJZ A;  2GUH A;  2B1E A;  3DEW A;  5FKK A;  2WGB A;  3LSP A;  2R7Q A;  3MVP A;  3ZQH A;  2HYT A;  5HBU A;  2V57 A;  2QIB A;  4NN1 A;  2X6O A;  3BR5 A;  2Y31 A;  2WV1 A;  3VVY A;  2D6Y A;  3HGY A;  3FK6 A;  3G1L A;  1JT6 A;  3PM1 A;  4MXM A;  2R7U A;  2WUI A;  5EZG A;  4YZE A;  4AC0 A;  1QVU A;  4JNN A;  2GBY A;  3WHB A;  1RKT A;  3FRQ A;  3O60 A;  5K7F A;  5HSZ A;  5FKM A;  3T6N A;  2W53 A;  3VUQ A;  3P9T A;  3KNW A;  4JYK A;  1JUP A;  5F0C A;  3BT9 A;  3DCF A;  3AQT A;  4L62 A;  2G7L A;  2UXI A;  1A6I A;  2G7S A;  3ZQL A;  4AC6 A;  2UXO A;  2ZOY A;  2JJ7 A;  3B6A A;  2UXP A;  2I10 A;  3BJB A;  3RH2 A;  2VKV A;  4D7N A;  3C07 A;  2HQ5 A;  2NP3 A;  3JSJ A;  2OPT A;  4I76 A;  2OER A;  3V78 A;  3B81 A;  5CQG A;  2QOP A;  3S5R A;  2IEK A;  5D18 A;  5CW8 A;  2O7O A;  2ZOZ A;  3BRU A;  3F1B A;  3Q0V A;  2ZCN A;  2HXO A;  1JUM A;  3SFI A;  5EYR A;  2NX4 A;  1VI0 A;  2UXH A;  5C4Y A;  5DAJ A;  3KYL A;  4WIB A;  2TCT A;  4M3G A;  3IH2 A;  3VVX A;  4JKZ A;  3VW1 A;  4OD4 A;  3KZ9 A;  3CDL A;  3HGG A;  5F0H A;  2FD5 A;  5F08 A;  3Q0U A;  3DU5 A;  2DTZ A;  3QQA A;  2O7T A;  2REK A;  5J3L A;  5J1U A;  2ZB9 A;  2FJ1 A;  3SDG A;  2FJI 1;  2OI8 A;  3NRG A;  2NS8 A;  3LJL A;  2VPR A;  4U9L A;  3BHQ A;  3ON4 A;  2RHA A;  1ORK A;  2R7R A;  3IH4 A;  1Z77 A;  3BTC A;  3E7Q A;  2Y30 A;  5CXI A;  2HKU A;  3GEU A;  2YVX A;  3CRJ A;  2HXI A;  3Q0W A;  2XPV A;  1T33 A;  2XRL A;  4B3A A;  2ID6 A;  3WHC A;  4GFL A;  2Q24 A;  5GPC A;  4V2F A;  1UI6 A;  2XGD A;  4KWA A;  5FHP A;  5F27 A;  5IOY A;  2G0E A;  5GPA A;  5IPA A;  2XGE A;  2ZCX A;  4AUX A;  1RKW A;  3LSR A;  1JTY A;  1SGM A;  2QCO A;  2QTQ A;  3BR6 A;  3VTI A;  3IH3 A;  2UXU A;  5EZH A;  3O8H A;  4CGR A;  3VIB A;  4DW6 A;  5AQC A;  5K58 A;  3QKX A;  2DG8 A;  4OD5 A;  3BTJ A;  2XPW A;  3G1O A;  3GZI A;  4ABZ A;  4JL3 A;  3PAS A;  2RAS A;  3BQZ A;  3HTA A;  3Q3S A;  3VP5 A;  2IBD A;  2FX0 A;  4M3D A;  2R7T A;  3BR0 A;  1ZK8 A;  1JUS A;  3EGQ A;  2XPU A;  3VW2 A;  1T56 A; 
#chains in the Genus database with same CATH homology
 3B6C A;  2F07 A;  5D1R A;  3HE0 A;  3NPI A;  4AF5 A;  3VVZ A;  3BCG A;  3ZQI A;  4B1R A;  5J1R A;  2VKE A;  3NI7 A;  3FK7 A;  2JK3 A;  5J1Y A;  4W97 A;  4M3E A;  4D7M A;  1U9O A;  5IOZ A;  2YVH A;  3BTL A;  2ZCM A;  5F1J A;  3BR3 A;  2OF7 A;  3HTJ A;  3LHQ A;  3ANP A;  3CCY A;  3BTI A;  3KKC A;  3G7R A;  1U9N A;  4UDS A;  2YVE A;  2GFN A;  1Z0X A;  3HIM A;  2XDN A;  3F0C A;  3CJD A;  4NEL A;  2FQ4 A;  2IU5 A;  3NXC A;  3KKD A;  4MK6 A;  3QPS A;  5FGL A;  4PXI A;  5GP9 A;  2GEN A;  5D19 A;  4D5C A;  5F04 A;  3VW0 A;  5K7H A;  5K7Z A;  3LOC A;  5EFY A;  4ME9 A;  3PPB A;  3G56 A;  1QPI A;  3BR1 A;  3HTI A;  4G12 A;  5F0F A;  3AQS A;  3MNL A;  2RAE A;  5CXG A;  1QVT A;  3TP3 A;  2DG7 A;  3CWR A;  3BNI A;  3ZQF A;  3HTH A;  3QPL A;  1JTX A;  5HAW A;  4V2G A;  2QKO A;  3VOX A;  2X9D A;  4GCT A;  4GFK A;  3BQY A;  3IUV A;  2EH3 A;  3COL A;  2TRT A;  1ZKG A;  3V6G A;  3BR2 A;  5FKO A;  3FIW A;  5H9T A;  2ID3 A;  3LWJ A;  2G3B A;  2PBX A;  2Y2Z A;  4D5F A;  4MO7 A;  5FKN A;  5FKL A;  2NS7 A;  4HKU A;  3NNR A;  3RD3 A;  3ON2 A;  5FMP A;  2IAI A;  4XK4 A;  2XB5 A;  4M3F A;  5IP6 A;  3QBM A;  4ACI A;  3G1M A;  2HYJ A;  1UI5 A;  3C2B A;  3TP0 A;  2NP5 A;  2PZ9 A;  3ANG A;  2QWT A;  3VPR A;  4GCL A;  2XGC A;  3LSJ A;  4W1U A;  3ZQG A;  1JT0 A;  4I6Z A;  3O8G A;  4X1E A;  4ICH A;  1RPW A;  2G7G A;  4GCK A;  4M3B A;  3EUP A;  3DPJ A;  2FBQ A;  3VOK A;  1BJZ A;  2GUH A;  3DEW A;  5FKK A;  2WGB A;  3LSP A;  3MVP A;  3ZQH A;  2HYT A;  5HBU A;  2V57 A;  2QIB A;  4NN1 A;  2X6O A;  3BR5 A;  2Y31 A;  2WV1 A;  3VVY A;  2D6Y A;  3HGY A;  3FK6 A;  3G1L A;  1JT6 A;  3PM1 A;  4MXM A;  2WUI A;  5EZG A;  4YZE A;  4AC0 A;  1QVU A;  4JNN A;  2GBY A;  3WHB A;  1RKT A;  3FRQ A;  3O60 A;  5K7F A;  5HSZ A;  5FKM A;  3T6N A;  2W53 A;  3VUQ A;  3P9T A;  3KNW A;  4JYK A;  1JUP A;  5F0C A;  3BT9 A;  3DCF A;  3AQT A;  4L62 A;  2G7L A;  2UXI A;  1A6I A;  2G7S A;  3ZQL A;  4AC6 A;  2UXO A;  2ZOY A;  2JJ7 A;  3B6A A;  2UXP A;  2I10 A;  3BJB A;  3RH2 A;  2VKV A;  4D7N A;  3C07 A;  2HQ5 A;  2NP3 A;  3JSJ A;  2OPT A;  4I76 A;  2OER A;  3V78 A;  3B81 A;  2QOP A;  3S5R A;  2IEK A;  5D18 A;  5CW8 A;  2O7O A;  2ZOZ A;  3BRU A;  3F1B A;  3Q0V A;  2ZCN A;  2HXO A;  1JUM A;  3SFI A;  5EYR A;  2NX4 A;  1VI0 A;  2UXH A;  5C4Y A;  5DAJ A;  2TCT A;  4M3G A;  3IH2 A;  3VVX A;  4JKZ A;  3VW1 A;  3KZ9 A;  3CDL A;  3HGG A;  5F0H A;  2FD5 A;  5F08 A;  3Q0U A;  3QQA A;  2DTZ A;  2O7T A;  2REK A;  5J3L A;  5J1U A;  2ZB9 A;  2FJ1 A;  3SDG A;  2OI8 A;  3NRG A;  2NS8 A;  3LJL A;  2VPR A;  3BHQ A;  3ON4 A;  2RHA A;  1ORK A;  3IH4 A;  1Z77 A;  3BTC A;  3E7Q A;  2Y30 A;  5CXI A;  2HKU A;  3GEU A;  3CRJ A;  2HXI A;  3Q0W A;  2XPV A;  1T33 A;  2XRL A;  4B3A A;  2ID6 A;  3WHC A;  4GFL A;  2Q24 A;  5GPC A;  4V2F A;  1UI6 A;  2XGD A;  4KWA A;  5FHP A;  5F27 A;  5IOY A;  2G0E A;  5GPA A;  5IPA A;  2XGE A;  2ZCX A;  4AUX A;  1RKW A;  3LSR A;  1JTY A;  1SGM A;  2QCO A;  2QTQ A;  3BR6 A;  3IH3 A;  2UXU A;  5EZH A;  3O8H A;  4CGR A;  3VIB A;  4DW6 A;  5AQC A;  5K58 A;  3QKX A;  2DG8 A;  3BTJ A;  2XPW A;  3G1O A;  3GZI A;  4ABZ A;  4JL3 A;  3PAS A;  2RAS A;  3BQZ A;  3HTA A;  3Q3S A;  2IBD A;  3VP5 A;  2FX0 A;  4M3D A;  3BR0 A;  1ZK8 A;  1JUS A;  3EGQ A;  2XPU A;  3VW2 A;  1T56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...