5CXIA

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-23,24-bisnorchol-4-en-22-oyl-coa (4-bnc-coa)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
181
structure length
180
Chain Sequence
QRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 72
structure length 180
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxiA00
3G1OA 3DCFA 3F1BA 3BNIA 2IAIA 5F0CA 2RAEA 2Y2ZA 3FIWA 3SDGA 1ORKA 3VOXA 2FQ4A 3QPSA 4DW6A 5D18A 5IPAA 3ANGA 5F0FA 3VIBA 3VVYA 2EH3A 1SGMA 3VVZA 4JL3A 3V78A 3RD3A 4I6ZA 1UI6A 2TCTA 2Q24A 3ANPA 5FKOA 3VVXA 2RASA 5FGLA 3FRQA 2G0EA 2ID6A 4L62A 3RH2A 1ZK8A 5J3LA 4AF5A 2DTZA 2XPVA 2NP5A 3TP0A 3O8GA 2D6YA 5F1JA 3TP3A 5J1YA 5F04A 3PM1A 4D7NA 2XB5A 2JK3A 1UI5A 4M3FA 3Q3SA 2XPUA 3HGYA 5FKLA 3HE0A 3KZ9A 2G3BA 3AQTA 3MNLA 5H9TA 3LOCA 4AUXA 4HKUA 4GFLA 4V2GA 3ZQLA 2UXUA 1QVTA 3HTIA 2IEKA 2F07A 3B6CA 4MXMA 2O7TA 3VPRA 4JYKA 3AQSA 4GCKA 2VKEA 4ICHA 1BJZA 3CRJA 1RKTA 3DPJA 2OPTA 1JT6A 3BRUA 2RHAA 2XRLA 3CJDA 2GENA 4XK4A 3KNWA 5FHPA 3ZQHA 3VW0A 3NI7A 2YVHA 3VUQA 4I76A 3G56A 1JTXA 4D7MA 3P9TA 3BTLA 3HTHA 3VP5A 3NNRA 5K58A 2ZOYA 2PZ9A 3CCYA 3S5RA 2ID3A 4W97A 5GP9A 1Z77A 3ZQFA 2ZOZA 4M3DA 5EZGA 1JUPA 2G7LA 2NX4A 1VI0A 3CDLA 4M3GA 5FKMA 2GBYA 2PBXA 5HSZA 3QBMA 3LSJA 2YVEA 3JSJA 4X1EA 1RPWA 3KKDA 2DG8A 2XPWA 3DEWA 2GUHA 1T56A 5K7HA 3PPBA 1U9OA 2G7GA 2OF7A 2OERA 1JT0A 4AC6A 5HAWA 4CGRA 2DG7A 3FK6A 3NXCA 2UXOA 3B6AA 5AQCA 2XGEA 2GFNA 2V57A 5IP6A 4AC0A 3O60A 3FK7A 3HTJA 5FMPA 2QTQA 2HQ5A 1JUSA 2HYJA 3BTIA 2XDNA 3BTJA 1T33A 1JUMA 2O7OA 3BR2A 2X9DA 4G12A 3BHQA 3G7RA 2IBDA 3HIMA 4GCLA 3G1MA 3EGQA 5F08A 5J1UA 5CW8A 2WV1A 2NS7A 4NN1A 4JKZA 4W1UA 2W53A 3BCGA 2UXIA 3C07A 4D5CA 3NRGA 5D19A 4MK6A 3HTAA 3Q0VA 2QOPA 3VOKA 1ZKGA 4ABZA 2FBQA 3G1LA 2ZCNA 5EZHA 2HXOA 3BR1A 2XGDA 5FKKA 5F27A 2HXIA 3QPLA 2Y31A 3ZQGA 4ACIA 2QWTA 3LWJA 3E7QA 4M3BA 3IH2A 4B1RA 4MO7A 3HGGA 2VKVA 5IOZA 2I10A 2FJ1A 5EFYA 3ON2A 2X6OA 3ZQIA 3BJBA 4ME9A 3IH3A 3BR5A 3EUPA 2Y30A 2FX0A 4NELA 1RKWA 5GPCA 5C4YA 5K7FA 2ZB9A 2FD5A 3IUVA 3QQAA 3COLA 4YZEA 3V6GA 4GFKA 1A6IA 3BT9A 2HKUA 2WGBA 3MVPA 2JJ7A 3BQYA 4B3AA 3LSPA 2HYTA 2NS8A 3LSRA 1U9NA 3KKCA 5CXGA 2WUIA 3O8HA 4V2FA 2UXHA 2IU5A 2UXPA 1QPIA 5FKNA 3GEUA 5D1RA 2XGCA 4JNNA 5IOYA 3BR0A 4GCTA 2REKA 4PXIA 5K7ZA 2QIBA 3VW1A 2QKOA 3T6NA 3B81A 5EYRA 3BR3A 3IH4A 1JTYA 4UDSA 2ZCMA 4D5FA 5CXIA 2OI8A 3SFIA 2ZCXA 4M3EA 3Q0UA 3CWRA 3VW2A 2G7SA 3QKXA 5F0HA 5J1RA 3BTCA 3ON4A 3WHBA 3WHCA 1QVUA 5GPAA 1Z0XA 3C2BA 5HBUA 3LJLA 5DAJA 3PASA 2TRTA 3NPIA 3BR6A 3BQZA 2NP3A 3GZIA 2VPRA 3F0CA 3Q0WA 2QCOA 3LHQA 4KWAA
chains in the Genus database with same CATH superfamily
3G1OA 3DCFA 3F1BA 4OD4A 3BNIA 2IAIA 5F0CA 2RAEA 2Y2ZA 3FIWA 3SDGA 1ORKA 3VOXA 2FQ4A 2B1EA 3QPSA 4DW6A 5D18A 5IPAA 3ANGA 5F0FA 3DU6A 3VIBA 3VVYA 2EH3A 1SGMA 3VVZA 4JL3A 3V78A 3RD3A 4I6ZA 1UI6A 2TCTA 2Q24A 3ANPA 5FKOA 3VVXA 2RASA 5FGLA 3FRQA 2G0EA 2ID6A 4L62A 3RH2A 2A2FX 1ZK8A 5J3LA 4AF5A 2DTZA 2XPVA 2NP5A 3TP0A 3O8GA 2D6YA 5F1JA 3TP3A 5J1YA 5F04A 3PM1A 3DU5A 4D7NA 2XB5A 2JK3A 1UI5A 4M3FA 3Q3SA 2XPUA 3HGYA 5FKLA 3HE0A 3KZ9A 2G3BA 3AQTA 3MNLA 2FJI1 5H9TA 3LOCA 4AUXA 4HKUA 4GFLA 4V2GA 3ZQLA 2UXUA 1QVTA 3HTIA 2IEKA 2R7OA 2F07A 3B6CA 4MXMA 2O7TA 3VPRA 4JYKA 3AQSA 4GCKA 2VKEA 4ICHA 1BJZA 3CRJA 1RKTA 3DPJA 2OPTA 1JT6A 3BRUA 2RHAA 2XRLA 2YVXA 3CJDA 2GENA 4XK4A 2R7WA 3KNWA 5FHPA 3ZQHA 3VW0A 3NI7A 2YVHA 3VUQA 2R7VA 4I76A 3G56A 1JTXA 4D7MA 3P9TA 3BTLA 3HTHA 3VP5A 3NNRA 5K58A 2ZOYA 2PZ9A 3CCYA 3S5RA 2ID3A 4W97A 5GP9A 1Z77A 3ZQFA 2ZOZA 4M3DA 5EZGA 1JUPA 2R7UA 2G7LA 2NX4A 1VI0A 3CDLA 5FKMA 4M3GA 2GBYA 2PBXA 5HSZA 3QBMA 3LSJA 2YVEA 3JSJA 4X1EA 1RPWA 3KKDA 2DG8A 2XPWA 3DEWA 2GUHA 1T56A 5K7HA 3PPBA 1U9OA 2G7GA 2OF7A 2OERA 1JT0A 4AC6A 5HAWA 4CGRA 2DG7A 3FK6A 3NXCA 2UXOA 3B6AA 5AQCA 2XGEA 2GFNA 2V57A 5IP6A 4AC0A 3O60A 3FK7A 3HTJA 5FMPA 2QTQA 2HQ5A 1JUSA 2HYJA 4U9LA 3BTIA 2XDNA 3BTJA 1T33A 1JUMA 2PFVA 2O7OA 3BR2A 2X9DA 4G12A 3BHQA 3G7RA 2IBDA 3HIMA 3FHNA 4GCLA 3G1MA 3EGQA 5F08A 4U9NA 5J1UA 5CW8A 2WV1A 2NS7A 4NN1A 4JKZA 4W1UA 2W53A 3BCGA 2UXIA 3C07A 4D5CA 2R7XA 3NRGA 5D19A 4MK6A 3HTAA 3Q0VA 3NS4A 4DVYP 2QOPA 3VOKA 1ZKGA 4ABZA 2FBQA 3G1LA 2ZCNA 5EZHA 2HXOA 3BR1A 2XGDA 5FKKA 5F27A 2HXIA 3QPLA 2Y31A 3ZQGA 4ACIA 2QWTA 3LWJA 3E7QA 4M3BA 3IH2A 4B1RA 4MO7A 3HGGA 2VKVA 5IOZA 2I10A 2FJ1A 5EFYA 3ON2A 2X6OA 3ZQIA 3BJBA 4ME9A 3IH3A 3BR5A 3VTIA 3EUPA 2Y30A 2FX0A 4NELA 1RKWA 4IRVA 5GPCA 5C4YA 5K7FA 2ZB9A 2FD5A 3IUVA 3QQAA 3COLA 3SWHA 4YZEA 4GFKA 3V6GA 1A6IA 3BT9A 2HKUA 2WGBA 3MVPA 2JJ7A 3BQYA 4B3AA 3LSPA 2HYTA 2NS8A 3LSRA 1U9NA 3KKCA 5CXGA 2WUIA 3O8HA 4V2FA 2R7TA 2UXHA 2IU5A 2UXPA 1QPIA 5FKNA 3GEUA 5D1RA 2XGCA 4JNNA 5IOYA 3BR0A 4GCTA 4WIBA 2REKA 4PXIA 2R7SA 5K7ZA 2QIBA 3VW1A 2R7QA 2QKOA 3T6NA 2B3WA 3B81A 5EYRA 3BR3A 2ZY9A 3IH4A 1JTYA 4UDSA 2ZCMA 4D5FA 5CXIA 2OI8A 3SFIA 3K8PC 2ZCXA 4M3EA 3Q0UA 3CWRA 3VW2A 4C2MA 2G7SA 3QKXA 5F0HA 5J1RA 3BTCA 3ON4A 3WHBA 3WHCA 3KYLA 1QVUA 5GPAA 1Z0XA 3C2BA 5HBUA 3LJLA 5DAJA 3PASA 2TRTA 3NPIA 3BR6A 3BQZA 4OD5A 2R7RA 2NP3A 3GZIA 2VPRA 3F0CA 3Q0WA 2QCOA 3LHQA 5CQGA 4KWAA
chains in the Genus database with same CATH topology
3G1OA 3DCFA 3F1BA 3BNIA 2IAIA 5F0CA 2RAEA 2Y2ZA 3FIWA 3SDGA 1ORKA 3VOXA 2FQ4A 3QPSA 4DW6A 5D18A 5IPAA 3ANGA 5F0FA 3VIBA 3VVYA 2EH3A 1SGMA 3VVZA 4JL3A 3V78A 3RD3A 4I6ZA 1UI6A 2TCTA 2Q24A 3ANPA 5FKOA 3VVXA 2RASA 5FGLA 3FRQA 2G0EA 2ID6A 4L62A 3RH2A 1ZK8A 5J3LA 4AF5A 2DTZA 2XPVA 2NP5A 3TP0A 3O8GA 2D6YA 5F1JA 3TP3A 5J1YA 5F04A 3PM1A 4D7NA 2XB5A 2JK3A 1UI5A 4M3FA 3Q3SA 2XPUA 3HGYA 5FKLA 3HE0A 3KZ9A 2G3BA 3AQTA 3MNLA 5H9TA 3LOCA 4AUXA 4HKUA 4GFLA 4V2GA 3ZQLA 2UXUA 1QVTA 3HTIA 2IEKA 2F07A 3B6CA 4MXMA 2O7TA 3VPRA 4JYKA 3AQSA 4GCKA 2VKEA 4ICHA 1BJZA 3CRJA 1RKTA 3DPJA 2OPTA 1JT6A 3BRUA 2RHAA 2XRLA 3CJDA 2GENA 4XK4A 3KNWA 5FHPA 3ZQHA 3VW0A 3NI7A 2YVHA 3VUQA 4I76A 3G56A 1JTXA 4D7MA 3P9TA 3BTLA 3HTHA 3VP5A 3NNRA 5K58A 2ZOYA 2PZ9A 3CCYA 3S5RA 2ID3A 4W97A 5GP9A 1Z77A 3ZQFA 2ZOZA 4M3DA 5EZGA 1JUPA 2G7LA 2NX4A 1VI0A 3CDLA 4M3GA 5FKMA 2GBYA 2PBXA 5HSZA 3QBMA 3LSJA 2YVEA 3JSJA 4X1EA 1RPWA 3KKDA 2DG8A 2XPWA 3DEWA 2GUHA 1T56A 5K7HA 3PPBA 1U9OA 2G7GA 2OF7A 2OERA 1JT0A 4AC6A 5HAWA 4CGRA 2DG7A 3FK6A 3NXCA 2UXOA 3B6AA 5AQCA 2XGEA 2GFNA 2V57A 5IP6A 4AC0A 3O60A 3FK7A 3HTJA 5FMPA 2QTQA 2HQ5A 1JUSA 2HYJA 3BTIA 2XDNA 3BTJA 1T33A 1JUMA 2O7OA 3BR2A 2X9DA 4G12A 3BHQA 3G7RA 2IBDA 3HIMA 4GCLA 3G1MA 3EGQA 5F08A 5J1UA 5CW8A 2WV1A 2NS7A 4NN1A 4JKZA 4W1UA 2W53A 3BCGA 2UXIA 3C07A 4D5CA 3NRGA 5D19A 4MK6A 3HTAA 3Q0VA 2QOPA 3VOKA 1ZKGA 4ABZA 2FBQA 3G1LA 2ZCNA 5EZHA 2HXOA 3BR1A 2XGDA 5FKKA 5F27A 2HXIA 3QPLA 2Y31A 3ZQGA 4ACIA 2QWTA 3LWJA 3E7QA 4M3BA 3IH2A 4B1RA 4MO7A 3HGGA 2VKVA 5IOZA 2I10A 2FJ1A 5EFYA 3ON2A 2X6OA 3ZQIA 3BJBA 4ME9A 3IH3A 3BR5A 3EUPA 2Y30A 2FX0A 4NELA 1RKWA 5GPCA 5C4YA 5K7FA 2ZB9A 2FD5A 3IUVA 3QQAA 3COLA 4YZEA 3V6GA 4GFKA 1A6IA 3BT9A 2HKUA 2WGBA 3MVPA 2JJ7A 3BQYA 4B3AA 3LSPA 2HYTA 2NS8A 3LSRA 1U9NA 3KKCA 5CXGA 2WUIA 3O8HA 4V2FA 2UXHA 2IU5A 2UXPA 1QPIA 5FKNA 3GEUA 5D1RA 2XGCA 4JNNA 5IOYA 3BR0A 4GCTA 2REKA 4PXIA 5K7ZA 2QIBA 3VW1A 2QKOA 3T6NA 3B81A 5EYRA 3BR3A 3IH4A 1JTYA 4UDSA 2ZCMA 4D5FA 5CXIA 2OI8A 3SFIA 2ZCXA 4M3EA 3Q0UA 3CWRA 3VW2A 2G7SA 3QKXA 5F0HA 5J1RA 3BTCA 3ON4A 3WHBA 3WHCA 1QVUA 5GPAA 1Z0XA 3C2BA 5HBUA 3LJLA 5DAJA 3PASA 2TRTA 3NPIA 3BR6A 3BQZA 2NP3A 3GZIA 2VPRA 3F0CA 3Q0WA 2QCOA 3LHQA 4KWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1O A;  3DCF A;  3F1B A;  3BNI A;  2IAI A;  5F0C A;  2RAE A;  2Y2Z A;  3FIW A;  3SDG A;  1ORK A;  3VOX A;  2FQ4 A;  3QPS A;  4DW6 A;  5D18 A;  5IPA A;  3ANG A;  5F0F A;  3VIB A;  3VVY A;  2EH3 A;  1SGM A;  3VVZ A;  4JL3 A;  3V78 A;  3RD3 A;  4I6Z A;  1UI6 A;  2TCT A;  2Q24 A;  3ANP A;  5FKO A;  3VVX A;  2RAS A;  5FGL A;  3FRQ A;  2G0E A;  2ID6 A;  4L62 A;  3RH2 A;  1ZK8 A;  5J3L A;  4AF5 A;  2DTZ A;  2XPV A;  2NP5 A;  3TP0 A;  3O8G A;  2D6Y A;  5F1J A;  3TP3 A;  5J1Y A;  5F04 A;  3PM1 A;  4D7N A;  2XB5 A;  2JK3 A;  1UI5 A;  4M3F A;  3Q3S A;  2XPU A;  3HGY A;  5FKL A;  3HE0 A;  3KZ9 A;  2G3B A;  3AQT A;  3MNL A;  5H9T A;  3LOC A;  4AUX A;  4HKU A;  4GFL A;  4V2G A;  3ZQL A;  2UXU A;  1QVT A;  3HTI A;  2IEK A;  2F07 A;  3B6C A;  4MXM A;  2O7T A;  3VPR A;  4JYK A;  3AQS A;  4GCK A;  2VKE A;  4ICH A;  1BJZ A;  3CRJ A;  1RKT A;  3DPJ A;  2OPT A;  1JT6 A;  3BRU A;  2RHA A;  2XRL A;  3CJD A;  2GEN A;  4XK4 A;  3KNW A;  5FHP A;  3ZQH A;  3VW0 A;  3NI7 A;  2YVH A;  3VUQ A;  4I76 A;  3G56 A;  1JTX A;  4D7M A;  3P9T A;  3BTL A;  3HTH A;  3VP5 A;  3NNR A;  5K58 A;  2ZOY A;  2PZ9 A;  3CCY A;  3S5R A;  2ID3 A;  4W97 A;  5GP9 A;  1Z77 A;  3ZQF A;  2ZOZ A;  4M3D A;  5EZG A;  1JUP A;  2G7L A;  2NX4 A;  1VI0 A;  3CDL A;  4M3G A;  5FKM A;  2GBY A;  2PBX A;  5HSZ A;  3QBM A;  3LSJ A;  2YVE A;  3JSJ A;  4X1E A;  1RPW A;  3KKD A;  2DG8 A;  2XPW A;  3DEW A;  2GUH A;  1T56 A;  5K7H A;  3PPB A;  1U9O A;  2G7G A;  2OF7 A;  2OER A;  1JT0 A;  4AC6 A;  5HAW A;  4CGR A;  2DG7 A;  3FK6 A;  3NXC A;  2UXO A;  3B6A A;  5AQC A;  2XGE A;  2GFN A;  2V57 A;  5IP6 A;  4AC0 A;  3O60 A;  3FK7 A;  3HTJ A;  5FMP A;  2QTQ A;  2HQ5 A;  1JUS A;  2HYJ A;  3BTI A;  2XDN A;  3BTJ A;  1T33 A;  1JUM A;  2O7O A;  3BR2 A;  2X9D A;  4G12 A;  3BHQ A;  3G7R A;  2IBD A;  3HIM A;  4GCL A;  3G1M A;  3EGQ A;  5F08 A;  5J1U A;  5CW8 A;  2WV1 A;  2NS7 A;  4NN1 A;  4JKZ A;  4W1U A;  2W53 A;  3BCG A;  2UXI A;  3C07 A;  4D5C A;  3NRG A;  5D19 A;  4MK6 A;  3HTA A;  3Q0V A;  2QOP A;  3VOK A;  1ZKG A;  4ABZ A;  2FBQ A;  3G1L A;  2ZCN A;  5EZH A;  2HXO A;  3BR1 A;  2XGD A;  5FKK A;  5F27 A;  2HXI A;  3QPL A;  2Y31 A;  3ZQG A;  4ACI A;  2QWT A;  3LWJ A;  3E7Q A;  4M3B A;  3IH2 A;  4B1R A;  4MO7 A;  3HGG A;  2VKV A;  5IOZ A;  2I10 A;  2FJ1 A;  5EFY A;  3ON2 A;  2X6O A;  3ZQI A;  3BJB A;  4ME9 A;  3IH3 A;  3BR5 A;  3EUP A;  2Y30 A;  2FX0 A;  4NEL A;  1RKW A;  5GPC A;  5C4Y A;  5K7F A;  2ZB9 A;  2FD5 A;  3IUV A;  3QQA A;  3COL A;  4YZE A;  3V6G A;  4GFK A;  1A6I A;  3BT9 A;  2HKU A;  2WGB A;  3MVP A;  2JJ7 A;  3BQY A;  4B3A A;  3LSP A;  2HYT A;  2NS8 A;  3LSR A;  1U9N A;  3KKC A;  5CXG A;  2WUI A;  3O8H A;  4V2F A;  2UXH A;  2IU5 A;  2UXP A;  1QPI A;  5FKN A;  3GEU A;  5D1R A;  2XGC A;  4JNN A;  5IOY A;  3BR0 A;  4GCT A;  2REK A;  4PXI A;  5K7Z A;  2QIB A;  3VW1 A;  2QKO A;  3T6N A;  3B81 A;  5EYR A;  3BR3 A;  3IH4 A;  1JTY A;  4UDS A;  2ZCM A;  4D5F A;  5CXI A;  2OI8 A;  3SFI A;  2ZCX A;  4M3E A;  3Q0U A;  3CWR A;  3VW2 A;  2G7S A;  3QKX A;  5F0H A;  5J1R A;  3BTC A;  3ON4 A;  3WHB A;  3WHC A;  1QVU A;  5GPA A;  1Z0X A;  3C2B A;  5HBU A;  3LJL A;  5DAJ A;  3PAS A;  2TRT A;  3NPI A;  3BR6 A;  3BQZ A;  2NP3 A;  3GZI A;  2VPR A;  3F0C A;  3Q0W A;  2QCO A;  3LHQ A;  4KWA A; 
#chains in the Genus database with same CATH topology
 3G1O A;  3DCF A;  3F1B A;  4OD4 A;  3BNI A;  2IAI A;  5F0C A;  2RAE A;  2Y2Z A;  3FIW A;  3SDG A;  1ORK A;  3VOX A;  2FQ4 A;  2B1E A;  3QPS A;  4DW6 A;  5D18 A;  5IPA A;  3ANG A;  5F0F A;  3DU6 A;  3VIB A;  3VVY A;  2EH3 A;  1SGM A;  3VVZ A;  4JL3 A;  3V78 A;  3RD3 A;  4I6Z A;  1UI6 A;  2TCT A;  2Q24 A;  3ANP A;  5FKO A;  3VVX A;  2RAS A;  5FGL A;  3FRQ A;  2G0E A;  2ID6 A;  4L62 A;  3RH2 A;  2A2F X;  1ZK8 A;  5J3L A;  4AF5 A;  2DTZ A;  2XPV A;  2NP5 A;  3TP0 A;  3O8G A;  2D6Y A;  5F1J A;  3TP3 A;  5J1Y A;  5F04 A;  3PM1 A;  3DU5 A;  4D7N A;  2XB5 A;  2JK3 A;  1UI5 A;  4M3F A;  3Q3S A;  2XPU A;  3HGY A;  5FKL A;  3HE0 A;  3KZ9 A;  2G3B A;  3AQT A;  3MNL A;  2FJI 1;  5H9T A;  3LOC A;  4AUX A;  4HKU A;  4GFL A;  4V2G A;  3ZQL A;  2UXU A;  1QVT A;  3HTI A;  2IEK A;  2R7O A;  2F07 A;  3B6C A;  4MXM A;  2O7T A;  3VPR A;  4JYK A;  3AQS A;  4GCK A;  2VKE A;  4ICH A;  1BJZ A;  3CRJ A;  1RKT A;  3DPJ A;  2OPT A;  1JT6 A;  3BRU A;  2RHA A;  2XRL A;  2YVX A;  3CJD A;  2GEN A;  4XK4 A;  2R7W A;  3KNW A;  5FHP A;  3ZQH A;  3VW0 A;  3NI7 A;  2YVH A;  3VUQ A;  2R7V A;  4I76 A;  3G56 A;  1JTX A;  4D7M A;  3P9T A;  3BTL A;  3HTH A;  3VP5 A;  3NNR A;  5K58 A;  2ZOY A;  2PZ9 A;  3CCY A;  3S5R A;  2ID3 A;  4W97 A;  5GP9 A;  1Z77 A;  3ZQF A;  2ZOZ A;  4M3D A;  5EZG A;  1JUP A;  2R7U A;  2G7L A;  2NX4 A;  1VI0 A;  3CDL A;  5FKM A;  4M3G A;  2GBY A;  2PBX A;  5HSZ A;  3QBM A;  3LSJ A;  2YVE A;  3JSJ A;  4X1E A;  1RPW A;  3KKD A;  2DG8 A;  2XPW A;  3DEW A;  2GUH A;  1T56 A;  5K7H A;  3PPB A;  1U9O A;  2G7G A;  2OF7 A;  2OER A;  1JT0 A;  4AC6 A;  5HAW A;  4CGR A;  2DG7 A;  3FK6 A;  3NXC A;  2UXO A;  3B6A A;  5AQC A;  2XGE A;  2GFN A;  2V57 A;  5IP6 A;  4AC0 A;  3O60 A;  3FK7 A;  3HTJ A;  5FMP A;  2QTQ A;  2HQ5 A;  1JUS A;  2HYJ A;  4U9L A;  3BTI A;  2XDN A;  3BTJ A;  1T33 A;  1JUM A;  2PFV A;  2O7O A;  3BR2 A;  2X9D A;  4G12 A;  3BHQ A;  3G7R A;  2IBD A;  3HIM A;  3FHN A;  4GCL A;  3G1M A;  3EGQ A;  5F08 A;  4U9N A;  5J1U A;  5CW8 A;  2WV1 A;  2NS7 A;  4NN1 A;  4JKZ A;  4W1U A;  2W53 A;  3BCG A;  2UXI A;  3C07 A;  4D5C A;  2R7X A;  3NRG A;  5D19 A;  4MK6 A;  3HTA A;  3Q0V A;  3NS4 A;  4DVY P;  2QOP A;  3VOK A;  1ZKG A;  4ABZ A;  2FBQ A;  3G1L A;  2ZCN A;  5EZH A;  2HXO A;  3BR1 A;  2XGD A;  5FKK A;  5F27 A;  2HXI A;  3QPL A;  2Y31 A;  3ZQG A;  4ACI A;  2QWT A;  3LWJ A;  3E7Q A;  4M3B A;  3IH2 A;  4B1R A;  4MO7 A;  3HGG A;  2VKV A;  5IOZ A;  2I10 A;  2FJ1 A;  5EFY A;  3ON2 A;  2X6O A;  3ZQI A;  3BJB A;  4ME9 A;  3IH3 A;  3BR5 A;  3VTI A;  3EUP A;  2Y30 A;  2FX0 A;  4NEL A;  1RKW A;  4IRV A;  5GPC A;  5C4Y A;  5K7F A;  2ZB9 A;  2FD5 A;  3IUV A;  3QQA A;  3COL A;  3SWH A;  4YZE A;  4GFK A;  3V6G A;  1A6I A;  3BT9 A;  2HKU A;  2WGB A;  3MVP A;  2JJ7 A;  3BQY A;  4B3A A;  3LSP A;  2HYT A;  2NS8 A;  3LSR A;  1U9N A;  3KKC A;  5CXG A;  2WUI A;  3O8H A;  4V2F A;  2R7T A;  2UXH A;  2IU5 A;  2UXP A;  1QPI A;  5FKN A;  3GEU A;  5D1R A;  2XGC A;  4JNN A;  5IOY A;  3BR0 A;  4GCT A;  4WIB A;  2REK A;  4PXI A;  2R7S A;  5K7Z A;  2QIB A;  3VW1 A;  2R7Q A;  2QKO A;  3T6N A;  2B3W A;  3B81 A;  5EYR A;  3BR3 A;  2ZY9 A;  3IH4 A;  1JTY A;  4UDS A;  2ZCM A;  4D5F A;  5CXI A;  2OI8 A;  3SFI A;  3K8P C;  2ZCX A;  4M3E A;  3Q0U A;  3CWR A;  3VW2 A;  4C2M A;  2G7S A;  3QKX A;  5F0H A;  5J1R A;  3BTC A;  3ON4 A;  3WHB A;  3WHC A;  3KYL A;  1QVU A;  5GPA A;  1Z0X A;  3C2B A;  5HBU A;  3LJL A;  5DAJ A;  3PAS A;  2TRT A;  3NPI A;  3BR6 A;  3BQZ A;  4OD5 A;  2R7R A;  2NP3 A;  3GZI A;  2VPR A;  3F0C A;  3Q0W A;  2QCO A;  3LHQ A;  5CQG A;  4KWA A; 
#chains in the Genus database with same CATH homology
 3G1O A;  3DCF A;  3F1B A;  3BNI A;  2IAI A;  5F0C A;  2RAE A;  2Y2Z A;  3FIW A;  3SDG A;  1ORK A;  3VOX A;  2FQ4 A;  3QPS A;  4DW6 A;  5D18 A;  5IPA A;  3ANG A;  5F0F A;  3VIB A;  3VVY A;  2EH3 A;  1SGM A;  3VVZ A;  4JL3 A;  3V78 A;  3RD3 A;  4I6Z A;  1UI6 A;  2TCT A;  2Q24 A;  3ANP A;  5FKO A;  3VVX A;  2RAS A;  5FGL A;  3FRQ A;  2G0E A;  2ID6 A;  4L62 A;  3RH2 A;  1ZK8 A;  5J3L A;  4AF5 A;  2DTZ A;  2XPV A;  2NP5 A;  3TP0 A;  3O8G A;  2D6Y A;  5F1J A;  3TP3 A;  5J1Y A;  5F04 A;  3PM1 A;  4D7N A;  2XB5 A;  2JK3 A;  1UI5 A;  4M3F A;  3Q3S A;  2XPU A;  3HGY A;  5FKL A;  3HE0 A;  3KZ9 A;  2G3B A;  3AQT A;  3MNL A;  5H9T A;  3LOC A;  4AUX A;  4HKU A;  4GFL A;  4V2G A;  3ZQL A;  2UXU A;  1QVT A;  3HTI A;  2IEK A;  2F07 A;  3B6C A;  4MXM A;  2O7T A;  3VPR A;  4JYK A;  3AQS A;  4GCK A;  2VKE A;  4ICH A;  1BJZ A;  3CRJ A;  1RKT A;  3DPJ A;  2OPT A;  1JT6 A;  3BRU A;  2RHA A;  2XRL A;  3CJD A;  2GEN A;  4XK4 A;  3KNW A;  5FHP A;  3ZQH A;  3VW0 A;  3NI7 A;  2YVH A;  3VUQ A;  4I76 A;  3G56 A;  1JTX A;  4D7M A;  3P9T A;  3BTL A;  3HTH A;  3VP5 A;  3NNR A;  5K58 A;  2ZOY A;  2PZ9 A;  3CCY A;  3S5R A;  2ID3 A;  4W97 A;  5GP9 A;  1Z77 A;  3ZQF A;  2ZOZ A;  4M3D A;  5EZG A;  1JUP A;  2G7L A;  2NX4 A;  1VI0 A;  3CDL A;  4M3G A;  5FKM A;  2GBY A;  2PBX A;  5HSZ A;  3QBM A;  3LSJ A;  2YVE A;  3JSJ A;  4X1E A;  1RPW A;  3KKD A;  2DG8 A;  2XPW A;  3DEW A;  2GUH A;  1T56 A;  5K7H A;  3PPB A;  1U9O A;  2G7G A;  2OF7 A;  2OER A;  1JT0 A;  4AC6 A;  5HAW A;  4CGR A;  2DG7 A;  3FK6 A;  3NXC A;  2UXO A;  3B6A A;  5AQC A;  2XGE A;  2GFN A;  2V57 A;  5IP6 A;  4AC0 A;  3O60 A;  3FK7 A;  3HTJ A;  5FMP A;  2QTQ A;  2HQ5 A;  1JUS A;  2HYJ A;  3BTI A;  2XDN A;  3BTJ A;  1T33 A;  1JUM A;  2O7O A;  3BR2 A;  2X9D A;  4G12 A;  3BHQ A;  3G7R A;  2IBD A;  3HIM A;  4GCL A;  3G1M A;  3EGQ A;  5F08 A;  5J1U A;  5CW8 A;  2WV1 A;  2NS7 A;  4NN1 A;  4JKZ A;  4W1U A;  2W53 A;  3BCG A;  2UXI A;  3C07 A;  4D5C A;  3NRG A;  5D19 A;  4MK6 A;  3HTA A;  3Q0V A;  2QOP A;  3VOK A;  1ZKG A;  4ABZ A;  2FBQ A;  3G1L A;  2ZCN A;  5EZH A;  2HXO A;  3BR1 A;  2XGD A;  5FKK A;  5F27 A;  2HXI A;  3QPL A;  2Y31 A;  3ZQG A;  4ACI A;  2QWT A;  3LWJ A;  3E7Q A;  4M3B A;  3IH2 A;  4B1R A;  4MO7 A;  3HGG A;  2VKV A;  5IOZ A;  2I10 A;  2FJ1 A;  5EFY A;  3ON2 A;  2X6O A;  3ZQI A;  3BJB A;  4ME9 A;  3IH3 A;  3BR5 A;  3EUP A;  2Y30 A;  2FX0 A;  4NEL A;  1RKW A;  5GPC A;  5C4Y A;  5K7F A;  2ZB9 A;  2FD5 A;  3IUV A;  3QQA A;  3COL A;  4YZE A;  3V6G A;  4GFK A;  1A6I A;  3BT9 A;  2HKU A;  2WGB A;  3MVP A;  2JJ7 A;  3BQY A;  4B3A A;  3LSP A;  2HYT A;  2NS8 A;  3LSR A;  1U9N A;  3KKC A;  5CXG A;  2WUI A;  3O8H A;  4V2F A;  2UXH A;  2IU5 A;  2UXP A;  1QPI A;  5FKN A;  3GEU A;  5D1R A;  2XGC A;  4JNN A;  5IOY A;  3BR0 A;  4GCT A;  2REK A;  4PXI A;  5K7Z A;  2QIB A;  3VW1 A;  2QKO A;  3T6N A;  3B81 A;  5EYR A;  3BR3 A;  3IH4 A;  1JTY A;  4UDS A;  2ZCM A;  4D5F A;  5CXI A;  2OI8 A;  3SFI A;  2ZCX A;  4M3E A;  3Q0U A;  3CWR A;  3VW2 A;  2G7S A;  3QKX A;  5F0H A;  5J1R A;  3BTC A;  3ON4 A;  3WHB A;  3WHC A;  1QVU A;  5GPA A;  1Z0X A;  3C2B A;  5HBU A;  3LJL A;  5DAJ A;  3PAS A;  2TRT A;  3NPI A;  3BR6 A;  3BQZ A;  2NP3 A;  3GZI A;  2VPR A;  3F0C A;  3Q0W A;  2QCO A;  3LHQ A;  4KWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...