5CXIA

Crystal structure of mycobacterium tuberculosis kstr in complex with 3-oxo-23,24-bisnorchol-4-en-22-oyl-coa (4-bnc-coa)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
181
structure length
180
Chain Sequence
QRERRKRILDATMAIASKGGYEAVQMRAVADRADVAVGTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAAGATPFQRLNFMVGKLNRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMANGEPTEDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Transcriptional Repressor KstR in Complex with CoA Thioester Cholesterol Metabolites Sheds Light on the Regulation of Cholesterol Catabolism in Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
molecule keywords HTH-type transcriptional repressor KstR
total genus 72
structure length 180
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17925 TetR_C_20 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5cxiA00
5AQCA 5FKMA 3P9TA 3G1OA 2JJ7A 2GUHA 3HTIA 3T6NA 1QVUA 1ZK8A 3RD3A 2DG8A 5IOYA 3WHBA 3LSRA 3HTHA 4JNNA 3BR5A 2WV1A 2ZCMA 2XGDA 4I76A 4KWAA 4M3GA 5GPCA 4ME9A 2XPWA 2QWTA 5IOZA 4AC0A 4M3BA 3PPBA 2W53A 2JK3A 2NS7A 4GCTA 5FKLA 5CXGA 5D18A 4GCLA 2Y31A 3ZQIA 5J1YA 3BQYA 2TRTA 2G0EA 4XK4A 3ON4A 1JTXA 3EUPA 3IH4A 5F1JA 2VKEA 3VUQA 2IBDA 3KNWA 3QPLA 4NELA 2OERA 5J3LA 2XB5A 1U9OA 5C4YA 3DEWA 4AC6A 3NPIA 3VPRA 4GFLA 4D7MA 3C2BA 3G1LA 5FKOA 2OI8A 3VOKA 3SDGA 1Z0XA 3BCGA 1RKWA 3C07A 3VOXA 3CWRA 1BJZA 2I10A 5K58A 3AQTA 1A6IA 1QVTA 2XPUA 3SFIA 3BRUA 4V2GA 3LHQA 2FQ4A 2NP5A 2D6YA 3EGQA 2OPTA 4B3AA 3V6GA 5EYRA 2YVHA 4AUXA 2ZOZA 4MK6A 2HXOA 5FHPA 2EH3A 4D7NA 3G56A 2HXIA 3VP5A 5GPAA 2F07A 3HTAA 2RASA 2IU5A 1T33A 2IAIA 5H9TA 2XDNA 5F0FA 1JT6A 1UI6A 4D5FA 2GBYA 3ZQHA 4CGRA 1RPWA 4MO7A 2UXHA 3BTIA 4AF5A 3CCYA 3HE0A 3O60A 3ZQFA 3BR0A 3HTJA 4JKZA 1U9NA 4M3FA 2DTZA 2UXPA 3TP3A 4DW6A 1SGMA 3FK7A 2VPRA 3VIBA 2FX0A 2XPVA 3NXCA 4W1UA 3IH2A 4ICHA 2X9DA 2PBXA 5D1RA 3VW0A 5F08A 2GFNA 3Q0VA 3S5RA 3KKCA 2HKUA 3PM1A 5K7ZA 3JSJA 3HGGA 2QKOA 3E7QA 4B1RA 2DG7A 3G1MA 4NN1A 5FKKA 3QBMA 2UXOA 5FKNA 3PASA 3B6AA 4MXMA 1Z77A 2UXUA 3IH3A 2YVEA 5EZHA 1RKTA 4M3EA 1JUMA 4M3DA 5CXIA 1JUSA 2QIBA 2NP3A 2Y2ZA 3QKXA 3QPSA 2Q24A 3IUVA 3FIWA 3ANPA 4UDSA 3AQSA 2HYJA 2UXIA 3BTCA 4YZEA 4JYKA 1JTYA 2WUIA 3LSPA 2NS8A 3BTLA 2O7TA 2FBQA 3BTJA 3VW1A 3BHQA 2RAEA 3GZIA 2X6OA 3ZQLA 3GEUA 2IEKA 2O7OA 2OF7A 1ZKGA 2ZCNA 3F0CA 4PXIA 3G7RA 3LOCA 3NI7A 5IP6A 1QPIA 3NNRA 2QTQA 2TCTA 2VKVA 3HIMA 5GP9A 2WGBA 5J1UA 3MNLA 3BR1A 3VW2A 2PZ9A 5DAJA 3CRJA 5J1RA 3CDLA 5HBUA 2ID6A 2REKA 3Q0UA 3VVXA 3F1BA 2HYTA 1UI5A 3KKDA 5EZGA 4JL3A 5K7HA 2GENA 4L62A 3COLA 2QOPA 5FMPA 1VI0A 4V2FA 5F04A 2QCOA 5EFYA 3B6CA 3MVPA 2RHAA 5CW8A 3CJDA 4GFKA 4I6ZA 3BR2A 1JUPA 2FJ1A 3VVZA 3NRGA 3O8GA 3RH2A 4D5CA 3Q0WA 4ABZA 2V57A 3WHCA 2XRLA 3B81A 5F27A 3QQAA 4X1EA 3V78A 3BR6A 2HQ5A 5F0HA 5K7FA 2XGEA 3LJLA 4HKUA 3BNIA 4ACIA 3BQZA 1JT0A 3VVYA 2ID3A 2ZB9A 2G7SA 2XGCA 5F0CA 3KZ9A 3ANGA 3ON2A 3O8HA 3Q3SA 4GCKA 3BT9A 5HSZA 3FK6A 2NX4A 2G7LA 2FD5A 3LWJA 3BJBA 4G12A 3LSJA 3BR3A 2G3BA 4W97A 5FGLA 3FRQA 2ZOYA 3ZQGA 3DPJA 5IPAA 3DCFA 2ZCXA 3TP0A 1ORKA 1T56A 3HGYA 5D19A 2Y30A 5HAWA 2G7GA
chains in the Genus database with same CATH superfamily
2B1EA 5AQCA 5FKMA 3P9TA 3G1OA 2JJ7A 2GUHA 3HTIA 2R7TA 3T6NA 1QVUA 1ZK8A 3RD3A 2DG8A 5IOYA 3WHBA 3LSRA 3HTHA 4JNNA 3BR5A 2WV1A 2R7VA 2ZCMA 3DU5A 2XGDA 4I76A 4KWAA 4M3GA 5GPCA 4ME9A 2XPWA 2QWTA 5IOZA 4AC0A 4M3BA 3PPBA 2W53A 2JK3A 2NS7A 4GCTA 5FKLA 2R7XA 5CXGA 5D18A 4GCLA 2Y31A 3ZQIA 4OD4A 5J1YA 3BQYA 3K8PC 2TRTA 2ZY9A 4IRVA 2G0EA 4XK4A 3ON4A 1JTXA 3EUPA 3IH4A 5F1JA 2VKEA 3VUQA 2IBDA 3KNWA 3QPLA 4NELA 2OERA 5J3LA 2XB5A 1U9OA 5C4YA 3DEWA 4AC6A 3NPIA 4C2MA 3VPRA 3SWHA 2B3WA 4GFLA 4D7MA 3C2BA 3G1LA 5FKOA 2OI8A 3VOKA 4DVYP 3SDGA 1Z0XA 3BCGA 1RKWA 3C07A 3VOXA 3CWRA 1BJZA 2I10A 5K58A 3AQTA 1A6IA 1QVTA 2XPUA 3SFIA 3BRUA 4V2GA 3LHQA 2FQ4A 2NP5A 2D6YA 3EGQA 2OPTA 4B3AA 3V6GA 5EYRA 4AUXA 2YVHA 2R7RA 2ZOZA 2PFVA 4MK6A 2HXOA 5FHPA 2EH3A 4D7NA 3G56A 2HXIA 3VP5A 5GPAA 2F07A 3HTAA 2IU5A 2RASA 1T33A 2IAIA 5H9TA 2XDNA 5F0FA 3FHNA 3VTIA 1JT6A 1UI6A 4D5FA 2GBYA 3ZQHA 4CGRA 1RPWA 4MO7A 2UXHA 3BTIA 4AF5A 4U9LA 3CCYA 3HE0A 2A2FX 2R7SA 3O60A 3ZQFA 3BR0A 3HTJA 4JKZA 1U9NA 4M3FA 2DTZA 2UXPA 3TP3A 4DW6A 1SGMA 3FK7A 2VPRA 3VIBA 2FX0A 2XPVA 3NXCA 4W1UA 3IH2A 4ICHA 2FJI1 2X9DA 2PBXA 5D1RA 3VW0A 5F08A 2GFNA 3Q0VA 3S5RA 3KKCA 2HKUA 3PM1A 5K7ZA 3JSJA 3HGGA 2YVXA 2QKOA 3E7QA 4B1RA 2DG7A 3G1MA 4NN1A 5FKKA 3QBMA 2UXOA 5FKNA 3PASA 3B6AA 3KYLA 4MXMA 1Z77A 2UXUA 3IH3A 2YVEA 5EZHA 1RKTA 4M3EA 1JUMA 4M3DA 5CXIA 1JUSA 2QIBA 2R7UA 2NP3A 2Y2ZA 3QKXA 3QPSA 2Q24A 3IUVA 3FIWA 3ANPA 4UDSA 3AQSA 2HYJA 2UXIA 3BTCA 4YZEA 4JYKA 1JTYA 2WUIA 3LSPA 2NS8A 3BTLA 2O7TA 2FBQA 3BTJA 3VW1A 3BHQA 2RAEA 3GZIA 2X6OA 3ZQLA 3GEUA 2IEKA 2O7OA 2OF7A 1ZKGA 2ZCNA 3F0CA 4PXIA 3G7RA 3LOCA 3NI7A 5IP6A 1QPIA 3NNRA 4OD5A 2QTQA 2TCTA 2VKVA 3HIMA 5GP9A 2WGBA 5J1UA 3MNLA 3BR1A 3VW2A 2PZ9A 5DAJA 3CRJA 5J1RA 3CDLA 5HBUA 2ID6A 2REKA 3Q0UA 3VVXA 3F1BA 2HYTA 1UI5A 3KKDA 2R7QA 5EZGA 4JL3A 5K7HA 2GENA 4L62A 3COLA 2QOPA 5FMPA 3NS4A 1VI0A 4V2FA 5F04A 2QCOA 5EFYA 2R7WA 3B6CA 4WIBA 3MVPA 2RHAA 5CW8A 3CJDA 4GFKA 4I6ZA 3BR2A 1JUPA 2FJ1A 3VVZA 3NRGA 3O8GA 3RH2A 4D5CA 3Q0WA 4ABZA 2V57A 4U9NA 3WHCA 2XRLA 3B81A 5F27A 3QQAA 4X1EA 3V78A 3BR6A 2HQ5A 5F0HA 5K7FA 2XGEA 2R7OA 3LJLA 4HKUA 3BNIA 4ACIA 3BQZA 1JT0A 3VVYA 2ID3A 3DU6A 5CQGA 2ZB9A 2G7SA 2XGCA 5F0CA 3KZ9A 3ANGA 3ON2A 3O8HA 3Q3SA 4GCKA 3BT9A 5HSZA 3FK6A 2NX4A 2G7LA 2FD5A 3LWJA 3BJBA 4G12A 3LSJA 3BR3A 2G3BA 4W97A 5FGLA 3FRQA 2ZOYA 3ZQGA 3DPJA 5IPAA 3DCFA 2ZCXA 3TP0A 1ORKA 1T56A 3HGYA 5D19A 2Y30A 5HAWA 2G7GA
chains in the Genus database with same CATH topology
5AQCA 5FKMA 3P9TA 3G1OA 2JJ7A 2GUHA 3HTIA 3T6NA 1QVUA 1ZK8A 3RD3A 2DG8A 5IOYA 3WHBA 3LSRA 3HTHA 4JNNA 3BR5A 2WV1A 2ZCMA 2XGDA 4I76A 4KWAA 4M3GA 5GPCA 4ME9A 2XPWA 2QWTA 5IOZA 4AC0A 4M3BA 3PPBA 2W53A 2JK3A 2NS7A 4GCTA 5FKLA 5CXGA 5D18A 4GCLA 2Y31A 3ZQIA 5J1YA 3BQYA 2TRTA 2G0EA 4XK4A 3ON4A 1JTXA 3EUPA 3IH4A 5F1JA 2VKEA 3VUQA 2IBDA 3KNWA 3QPLA 4NELA 2OERA 5J3LA 2XB5A 1U9OA 5C4YA 3DEWA 4AC6A 3NPIA 3VPRA 4GFLA 4D7MA 3C2BA 3G1LA 5FKOA 2OI8A 3VOKA 3SDGA 1Z0XA 3BCGA 1RKWA 3C07A 3VOXA 3CWRA 1BJZA 2I10A 5K58A 3AQTA 1A6IA 1QVTA 2XPUA 3SFIA 3BRUA 4V2GA 3LHQA 2FQ4A 2NP5A 2D6YA 3EGQA 2OPTA 4B3AA 3V6GA 5EYRA 2YVHA 4AUXA 2ZOZA 4MK6A 2HXOA 5FHPA 2EH3A 4D7NA 3G56A 2HXIA 3VP5A 5GPAA 2F07A 3HTAA 2RASA 2IU5A 1T33A 2IAIA 5H9TA 2XDNA 5F0FA 1JT6A 1UI6A 4D5FA 2GBYA 3ZQHA 4CGRA 1RPWA 4MO7A 2UXHA 3BTIA 4AF5A 3CCYA 3HE0A 3O60A 3ZQFA 3BR0A 3HTJA 4JKZA 1U9NA 4M3FA 2DTZA 2UXPA 3TP3A 4DW6A 1SGMA 3FK7A 2VPRA 3VIBA 2FX0A 2XPVA 3NXCA 4W1UA 3IH2A 4ICHA 2X9DA 2PBXA 5D1RA 3VW0A 5F08A 2GFNA 3Q0VA 3S5RA 3KKCA 2HKUA 3PM1A 5K7ZA 3JSJA 3HGGA 2QKOA 3E7QA 4B1RA 2DG7A 3G1MA 4NN1A 5FKKA 3QBMA 2UXOA 5FKNA 3PASA 3B6AA 4MXMA 1Z77A 2UXUA 3IH3A 2YVEA 5EZHA 1RKTA 4M3EA 1JUMA 4M3DA 5CXIA 1JUSA 2QIBA 2NP3A 2Y2ZA 3QKXA 3QPSA 2Q24A 3IUVA 3FIWA 3ANPA 4UDSA 3AQSA 2HYJA 2UXIA 3BTCA 4YZEA 4JYKA 1JTYA 2WUIA 3LSPA 2NS8A 3BTLA 2O7TA 2FBQA 3BTJA 3VW1A 3BHQA 2RAEA 3GZIA 2X6OA 3ZQLA 3GEUA 2IEKA 2O7OA 2OF7A 1ZKGA 2ZCNA 3F0CA 4PXIA 3G7RA 3LOCA 3NI7A 5IP6A 1QPIA 3NNRA 2QTQA 2TCTA 2VKVA 3HIMA 5GP9A 2WGBA 5J1UA 3MNLA 3BR1A 3VW2A 2PZ9A 5DAJA 3CRJA 5J1RA 3CDLA 5HBUA 2ID6A 2REKA 3Q0UA 3VVXA 3F1BA 2HYTA 1UI5A 3KKDA 5EZGA 4JL3A 5K7HA 2GENA 4L62A 3COLA 2QOPA 5FMPA 1VI0A 4V2FA 5F04A 2QCOA 5EFYA 3B6CA 3MVPA 2RHAA 5CW8A 3CJDA 4GFKA 4I6ZA 3BR2A 1JUPA 2FJ1A 3VVZA 3NRGA 3O8GA 3RH2A 4D5CA 3Q0WA 4ABZA 2V57A 3WHCA 2XRLA 3B81A 5F27A 3QQAA 4X1EA 3V78A 3BR6A 2HQ5A 5F0HA 5K7FA 2XGEA 3LJLA 4HKUA 3BNIA 4ACIA 3BQZA 1JT0A 3VVYA 2ID3A 2ZB9A 2G7SA 2XGCA 5F0CA 3KZ9A 3ANGA 3ON2A 3O8HA 3Q3SA 4GCKA 3BT9A 5HSZA 3FK6A 2NX4A 2G7LA 2FD5A 3LWJA 3BJBA 4G12A 3LSJA 3BR3A 2G3BA 4W97A 5FGLA 3FRQA 2ZOYA 3ZQGA 3DPJA 5IPAA 3DCFA 2ZCXA 3TP0A 1ORKA 1T56A 3HGYA 5D19A 2Y30A 5HAWA 2G7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQC A;  5FKM A;  3P9T A;  3G1O A;  2JJ7 A;  2GUH A;  3HTI A;  3T6N A;  1QVU A;  1ZK8 A;  3RD3 A;  2DG8 A;  5IOY A;  3WHB A;  3LSR A;  3HTH A;  4JNN A;  3BR5 A;  2WV1 A;  2ZCM A;  2XGD A;  4I76 A;  4KWA A;  4M3G A;  5GPC A;  4ME9 A;  2XPW A;  2QWT A;  5IOZ A;  4AC0 A;  4M3B A;  3PPB A;  2W53 A;  2JK3 A;  2NS7 A;  4GCT A;  5FKL A;  5CXG A;  5D18 A;  4GCL A;  2Y31 A;  3ZQI A;  5J1Y A;  3BQY A;  2TRT A;  2G0E A;  4XK4 A;  3ON4 A;  1JTX A;  3EUP A;  3IH4 A;  5F1J A;  2VKE A;  3VUQ A;  2IBD A;  3KNW A;  3QPL A;  4NEL A;  2OER A;  5J3L A;  2XB5 A;  1U9O A;  5C4Y A;  3DEW A;  4AC6 A;  3NPI A;  3VPR A;  4GFL A;  4D7M A;  3C2B A;  3G1L A;  5FKO A;  2OI8 A;  3VOK A;  3SDG A;  1Z0X A;  3BCG A;  1RKW A;  3C07 A;  3VOX A;  3CWR A;  1BJZ A;  2I10 A;  5K58 A;  3AQT A;  1A6I A;  1QVT A;  2XPU A;  3SFI A;  3BRU A;  4V2G A;  3LHQ A;  2FQ4 A;  2NP5 A;  2D6Y A;  3EGQ A;  2OPT A;  4B3A A;  3V6G A;  5EYR A;  2YVH A;  4AUX A;  2ZOZ A;  4MK6 A;  2HXO A;  5FHP A;  2EH3 A;  4D7N A;  3G56 A;  2HXI A;  3VP5 A;  5GPA A;  2F07 A;  3HTA A;  2RAS A;  2IU5 A;  1T33 A;  2IAI A;  5H9T A;  2XDN A;  5F0F A;  1JT6 A;  1UI6 A;  4D5F A;  2GBY A;  3ZQH A;  4CGR A;  1RPW A;  4MO7 A;  2UXH A;  3BTI A;  4AF5 A;  3CCY A;  3HE0 A;  3O60 A;  3ZQF A;  3BR0 A;  3HTJ A;  4JKZ A;  1U9N A;  4M3F A;  2DTZ A;  2UXP A;  3TP3 A;  4DW6 A;  1SGM A;  3FK7 A;  2VPR A;  3VIB A;  2FX0 A;  2XPV A;  3NXC A;  4W1U A;  3IH2 A;  4ICH A;  2X9D A;  2PBX A;  5D1R A;  3VW0 A;  5F08 A;  2GFN A;  3Q0V A;  3S5R A;  3KKC A;  2HKU A;  3PM1 A;  5K7Z A;  3JSJ A;  3HGG A;  2QKO A;  3E7Q A;  4B1R A;  2DG7 A;  3G1M A;  4NN1 A;  5FKK A;  3QBM A;  2UXO A;  5FKN A;  3PAS A;  3B6A A;  4MXM A;  1Z77 A;  2UXU A;  3IH3 A;  2YVE A;  5EZH A;  1RKT A;  4M3E A;  1JUM A;  4M3D A;  5CXI A;  1JUS A;  2QIB A;  2NP3 A;  2Y2Z A;  3QKX A;  3QPS A;  2Q24 A;  3IUV A;  3FIW A;  3ANP A;  4UDS A;  3AQS A;  2HYJ A;  2UXI A;  3BTC A;  4YZE A;  4JYK A;  1JTY A;  2WUI A;  3LSP A;  2NS8 A;  3BTL A;  2O7T A;  2FBQ A;  3BTJ A;  3VW1 A;  3BHQ A;  2RAE A;  3GZI A;  2X6O A;  3ZQL A;  3GEU A;  2IEK A;  2O7O A;  2OF7 A;  1ZKG A;  2ZCN A;  3F0C A;  4PXI A;  3G7R A;  3LOC A;  3NI7 A;  5IP6 A;  1QPI A;  3NNR A;  2QTQ A;  2TCT A;  2VKV A;  3HIM A;  5GP9 A;  2WGB A;  5J1U A;  3MNL A;  3BR1 A;  3VW2 A;  2PZ9 A;  5DAJ A;  3CRJ A;  5J1R A;  3CDL A;  5HBU A;  2ID6 A;  2REK A;  3Q0U A;  3VVX A;  3F1B A;  2HYT A;  1UI5 A;  3KKD A;  5EZG A;  4JL3 A;  5K7H A;  2GEN A;  4L62 A;  3COL A;  2QOP A;  5FMP A;  1VI0 A;  4V2F A;  5F04 A;  2QCO A;  5EFY A;  3B6C A;  3MVP A;  2RHA A;  5CW8 A;  3CJD A;  4GFK A;  4I6Z A;  3BR2 A;  1JUP A;  2FJ1 A;  3VVZ A;  3NRG A;  3O8G A;  3RH2 A;  4D5C A;  3Q0W A;  4ABZ A;  2V57 A;  3WHC A;  2XRL A;  3B81 A;  5F27 A;  3QQA A;  4X1E A;  3V78 A;  3BR6 A;  2HQ5 A;  5F0H A;  5K7F A;  2XGE A;  3LJL A;  4HKU A;  3BNI A;  4ACI A;  3BQZ A;  1JT0 A;  3VVY A;  2ID3 A;  2ZB9 A;  2G7S A;  2XGC A;  5F0C A;  3KZ9 A;  3ANG A;  3ON2 A;  3O8H A;  3Q3S A;  4GCK A;  3BT9 A;  5HSZ A;  3FK6 A;  2NX4 A;  2G7L A;  2FD5 A;  3LWJ A;  3BJB A;  4G12 A;  3LSJ A;  3BR3 A;  2G3B A;  4W97 A;  5FGL A;  3FRQ A;  2ZOY A;  3ZQG A;  3DPJ A;  5IPA A;  3DCF A;  2ZCX A;  3TP0 A;  1ORK A;  1T56 A;  3HGY A;  5D19 A;  2Y30 A;  5HAW A;  2G7G A; 
#chains in the Genus database with same CATH topology
 2B1E A;  5AQC A;  5FKM A;  3P9T A;  3G1O A;  2JJ7 A;  2GUH A;  3HTI A;  2R7T A;  3T6N A;  1QVU A;  1ZK8 A;  3RD3 A;  2DG8 A;  5IOY A;  3WHB A;  3LSR A;  3HTH A;  4JNN A;  3BR5 A;  2WV1 A;  2R7V A;  2ZCM A;  3DU5 A;  2XGD A;  4I76 A;  4KWA A;  4M3G A;  5GPC A;  4ME9 A;  2XPW A;  2QWT A;  5IOZ A;  4AC0 A;  4M3B A;  3PPB A;  2W53 A;  2JK3 A;  2NS7 A;  4GCT A;  5FKL A;  2R7X A;  5CXG A;  5D18 A;  4GCL A;  2Y31 A;  3ZQI A;  4OD4 A;  5J1Y A;  3BQY A;  3K8P C;  2TRT A;  2ZY9 A;  4IRV A;  2G0E A;  4XK4 A;  3ON4 A;  1JTX A;  3EUP A;  3IH4 A;  5F1J A;  2VKE A;  3VUQ A;  2IBD A;  3KNW A;  3QPL A;  4NEL A;  2OER A;  5J3L A;  2XB5 A;  1U9O A;  5C4Y A;  3DEW A;  4AC6 A;  3NPI A;  4C2M A;  3VPR A;  3SWH A;  2B3W A;  4GFL A;  4D7M A;  3C2B A;  3G1L A;  5FKO A;  2OI8 A;  3VOK A;  4DVY P;  3SDG A;  1Z0X A;  3BCG A;  1RKW A;  3C07 A;  3VOX A;  3CWR A;  1BJZ A;  2I10 A;  5K58 A;  3AQT A;  1A6I A;  1QVT A;  2XPU A;  3SFI A;  3BRU A;  4V2G A;  3LHQ A;  2FQ4 A;  2NP5 A;  2D6Y A;  3EGQ A;  2OPT A;  4B3A A;  3V6G A;  5EYR A;  4AUX A;  2YVH A;  2R7R A;  2ZOZ A;  2PFV A;  4MK6 A;  2HXO A;  5FHP A;  2EH3 A;  4D7N A;  3G56 A;  2HXI A;  3VP5 A;  5GPA A;  2F07 A;  3HTA A;  2IU5 A;  2RAS A;  1T33 A;  2IAI A;  5H9T A;  2XDN A;  5F0F A;  3FHN A;  3VTI A;  1JT6 A;  1UI6 A;  4D5F A;  2GBY A;  3ZQH A;  4CGR A;  1RPW A;  4MO7 A;  2UXH A;  3BTI A;  4AF5 A;  4U9L A;  3CCY A;  3HE0 A;  2A2F X;  2R7S A;  3O60 A;  3ZQF A;  3BR0 A;  3HTJ A;  4JKZ A;  1U9N A;  4M3F A;  2DTZ A;  2UXP A;  3TP3 A;  4DW6 A;  1SGM A;  3FK7 A;  2VPR A;  3VIB A;  2FX0 A;  2XPV A;  3NXC A;  4W1U A;  3IH2 A;  4ICH A;  2FJI 1;  2X9D A;  2PBX A;  5D1R A;  3VW0 A;  5F08 A;  2GFN A;  3Q0V A;  3S5R A;  3KKC A;  2HKU A;  3PM1 A;  5K7Z A;  3JSJ A;  3HGG A;  2YVX A;  2QKO A;  3E7Q A;  4B1R A;  2DG7 A;  3G1M A;  4NN1 A;  5FKK A;  3QBM A;  2UXO A;  5FKN A;  3PAS A;  3B6A A;  3KYL A;  4MXM A;  1Z77 A;  2UXU A;  3IH3 A;  2YVE A;  5EZH A;  1RKT A;  4M3E A;  1JUM A;  4M3D A;  5CXI A;  1JUS A;  2QIB A;  2R7U A;  2NP3 A;  2Y2Z A;  3QKX A;  3QPS A;  2Q24 A;  3IUV A;  3FIW A;  3ANP A;  4UDS A;  3AQS A;  2HYJ A;  2UXI A;  3BTC A;  4YZE A;  4JYK A;  1JTY A;  2WUI A;  3LSP A;  2NS8 A;  3BTL A;  2O7T A;  2FBQ A;  3BTJ A;  3VW1 A;  3BHQ A;  2RAE A;  3GZI A;  2X6O A;  3ZQL A;  3GEU A;  2IEK A;  2O7O A;  2OF7 A;  1ZKG A;  2ZCN A;  3F0C A;  4PXI A;  3G7R A;  3LOC A;  3NI7 A;  5IP6 A;  1QPI A;  3NNR A;  4OD5 A;  2QTQ A;  2TCT A;  2VKV A;  3HIM A;  5GP9 A;  2WGB A;  5J1U A;  3MNL A;  3BR1 A;  3VW2 A;  2PZ9 A;  5DAJ A;  3CRJ A;  5J1R A;  3CDL A;  5HBU A;  2ID6 A;  2REK A;  3Q0U A;  3VVX A;  3F1B A;  2HYT A;  1UI5 A;  3KKD A;  2R7Q A;  5EZG A;  4JL3 A;  5K7H A;  2GEN A;  4L62 A;  3COL A;  2QOP A;  5FMP A;  3NS4 A;  1VI0 A;  4V2F A;  5F04 A;  2QCO A;  5EFY A;  2R7W A;  3B6C A;  4WIB A;  3MVP A;  2RHA A;  5CW8 A;  3CJD A;  4GFK A;  4I6Z A;  3BR2 A;  1JUP A;  2FJ1 A;  3VVZ A;  3NRG A;  3O8G A;  3RH2 A;  4D5C A;  3Q0W A;  4ABZ A;  2V57 A;  4U9N A;  3WHC A;  2XRL A;  3B81 A;  5F27 A;  3QQA A;  4X1E A;  3V78 A;  3BR6 A;  2HQ5 A;  5F0H A;  5K7F A;  2XGE A;  2R7O A;  3LJL A;  4HKU A;  3BNI A;  4ACI A;  3BQZ A;  1JT0 A;  3VVY A;  2ID3 A;  3DU6 A;  5CQG A;  2ZB9 A;  2G7S A;  2XGC A;  5F0C A;  3KZ9 A;  3ANG A;  3ON2 A;  3O8H A;  3Q3S A;  4GCK A;  3BT9 A;  5HSZ A;  3FK6 A;  2NX4 A;  2G7L A;  2FD5 A;  3LWJ A;  3BJB A;  4G12 A;  3LSJ A;  3BR3 A;  2G3B A;  4W97 A;  5FGL A;  3FRQ A;  2ZOY A;  3ZQG A;  3DPJ A;  5IPA A;  3DCF A;  2ZCX A;  3TP0 A;  1ORK A;  1T56 A;  3HGY A;  5D19 A;  2Y30 A;  5HAW A;  2G7G A; 
#chains in the Genus database with same CATH homology
 5AQC A;  5FKM A;  3P9T A;  3G1O A;  2JJ7 A;  2GUH A;  3HTI A;  3T6N A;  1QVU A;  1ZK8 A;  3RD3 A;  2DG8 A;  5IOY A;  3WHB A;  3LSR A;  3HTH A;  4JNN A;  3BR5 A;  2WV1 A;  2ZCM A;  2XGD A;  4I76 A;  4KWA A;  4M3G A;  5GPC A;  4ME9 A;  2XPW A;  2QWT A;  5IOZ A;  4AC0 A;  4M3B A;  3PPB A;  2W53 A;  2JK3 A;  2NS7 A;  4GCT A;  5FKL A;  5CXG A;  5D18 A;  4GCL A;  2Y31 A;  3ZQI A;  5J1Y A;  3BQY A;  2TRT A;  2G0E A;  4XK4 A;  3ON4 A;  1JTX A;  3EUP A;  3IH4 A;  5F1J A;  2VKE A;  3VUQ A;  2IBD A;  3KNW A;  3QPL A;  4NEL A;  2OER A;  5J3L A;  2XB5 A;  1U9O A;  5C4Y A;  3DEW A;  4AC6 A;  3NPI A;  3VPR A;  4GFL A;  4D7M A;  3C2B A;  3G1L A;  5FKO A;  2OI8 A;  3VOK A;  3SDG A;  1Z0X A;  3BCG A;  1RKW A;  3C07 A;  3VOX A;  3CWR A;  1BJZ A;  2I10 A;  5K58 A;  3AQT A;  1A6I A;  1QVT A;  2XPU A;  3SFI A;  3BRU A;  4V2G A;  3LHQ A;  2FQ4 A;  2NP5 A;  2D6Y A;  3EGQ A;  2OPT A;  4B3A A;  3V6G A;  5EYR A;  2YVH A;  4AUX A;  2ZOZ A;  4MK6 A;  2HXO A;  5FHP A;  2EH3 A;  4D7N A;  3G56 A;  2HXI A;  3VP5 A;  5GPA A;  2F07 A;  3HTA A;  2RAS A;  2IU5 A;  1T33 A;  2IAI A;  5H9T A;  2XDN A;  5F0F A;  1JT6 A;  1UI6 A;  4D5F A;  2GBY A;  3ZQH A;  4CGR A;  1RPW A;  4MO7 A;  2UXH A;  3BTI A;  4AF5 A;  3CCY A;  3HE0 A;  3O60 A;  3ZQF A;  3BR0 A;  3HTJ A;  4JKZ A;  1U9N A;  4M3F A;  2DTZ A;  2UXP A;  3TP3 A;  4DW6 A;  1SGM A;  3FK7 A;  2VPR A;  3VIB A;  2FX0 A;  2XPV A;  3NXC A;  4W1U A;  3IH2 A;  4ICH A;  2X9D A;  2PBX A;  5D1R A;  3VW0 A;  5F08 A;  2GFN A;  3Q0V A;  3S5R A;  3KKC A;  2HKU A;  3PM1 A;  5K7Z A;  3JSJ A;  3HGG A;  2QKO A;  3E7Q A;  4B1R A;  2DG7 A;  3G1M A;  4NN1 A;  5FKK A;  3QBM A;  2UXO A;  5FKN A;  3PAS A;  3B6A A;  4MXM A;  1Z77 A;  2UXU A;  3IH3 A;  2YVE A;  5EZH A;  1RKT A;  4M3E A;  1JUM A;  4M3D A;  5CXI A;  1JUS A;  2QIB A;  2NP3 A;  2Y2Z A;  3QKX A;  3QPS A;  2Q24 A;  3IUV A;  3FIW A;  3ANP A;  4UDS A;  3AQS A;  2HYJ A;  2UXI A;  3BTC A;  4YZE A;  4JYK A;  1JTY A;  2WUI A;  3LSP A;  2NS8 A;  3BTL A;  2O7T A;  2FBQ A;  3BTJ A;  3VW1 A;  3BHQ A;  2RAE A;  3GZI A;  2X6O A;  3ZQL A;  3GEU A;  2IEK A;  2O7O A;  2OF7 A;  1ZKG A;  2ZCN A;  3F0C A;  4PXI A;  3G7R A;  3LOC A;  3NI7 A;  5IP6 A;  1QPI A;  3NNR A;  2QTQ A;  2TCT A;  2VKV A;  3HIM A;  5GP9 A;  2WGB A;  5J1U A;  3MNL A;  3BR1 A;  3VW2 A;  2PZ9 A;  5DAJ A;  3CRJ A;  5J1R A;  3CDL A;  5HBU A;  2ID6 A;  2REK A;  3Q0U A;  3VVX A;  3F1B A;  2HYT A;  1UI5 A;  3KKD A;  5EZG A;  4JL3 A;  5K7H A;  2GEN A;  4L62 A;  3COL A;  2QOP A;  5FMP A;  1VI0 A;  4V2F A;  5F04 A;  2QCO A;  5EFY A;  3B6C A;  3MVP A;  2RHA A;  5CW8 A;  3CJD A;  4GFK A;  4I6Z A;  3BR2 A;  1JUP A;  2FJ1 A;  3VVZ A;  3NRG A;  3O8G A;  3RH2 A;  4D5C A;  3Q0W A;  4ABZ A;  2V57 A;  3WHC A;  2XRL A;  3B81 A;  5F27 A;  3QQA A;  4X1E A;  3V78 A;  3BR6 A;  2HQ5 A;  5F0H A;  5K7F A;  2XGE A;  3LJL A;  4HKU A;  3BNI A;  4ACI A;  3BQZ A;  1JT0 A;  3VVY A;  2ID3 A;  2ZB9 A;  2G7S A;  2XGC A;  5F0C A;  3KZ9 A;  3ANG A;  3ON2 A;  3O8H A;  3Q3S A;  4GCK A;  3BT9 A;  5HSZ A;  3FK6 A;  2NX4 A;  2G7L A;  2FD5 A;  3LWJ A;  3BJB A;  4G12 A;  3LSJ A;  3BR3 A;  2G3B A;  4W97 A;  5FGL A;  3FRQ A;  2ZOY A;  3ZQG A;  3DPJ A;  5IPA A;  3DCF A;  2ZCX A;  3TP0 A;  1ORK A;  1T56 A;  3HGY A;  5D19 A;  2Y30 A;  5HAW A;  2G7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...