4I6ZA

Crystal structure of the transcriptional regulator tm1030 with 24bp dna oligonucleotide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
b'MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the transcriptional regulator TM1030 with 24bp DNA oligonucleotide
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator/dna
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4i6zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4i6zA02
1X58A 4JX4A 4C2MJ 5F08A 1LE8A 1QRYA 4UUTA 3IUVA 2K9NA 3VW1A 4D5FA 3ZQGA 3VIBA 3BR6A 2VKVA 3AQTA 5IYBJ 1MBKA 2FX0A 4A3GJ 2R5YA 3CJDA 3BTLA 3RZOJ 2P81A 1MH4A 5IPAA 2M8GX 2ZB9A 1JUPA 5J1YA 3TP3A 4XICA 3BR1A 2DA1A 3VVZA 3TW6A 4NDLA 3LJLA 5H9TA 1R9TJ 2TRTA 3BR3A 4UUSB 2X48A 2QF7A 1BL0A 1ETQA 2FBQA 3G1LA 4M6VA 3HGGA 1APLC 3GTLJ 2LD5A 4FCYA 4IEJA 3UKGA 5D18A 3A02A 2WAQN 4X6AJ 3G7RA 3KNWA 3DCFA 4A93J 2EZHA 2DJNA 3S1QJ 1POGA 3PM1A 5FKKA 3BJBA 3VP5A 4C3IJ 3COLA 2F07A 3M3YJ 2UXUA 2YS9A 2R5ZB 2ZCMA 5EZHA 5E3LA 3HTJA 5AQCA 1LFBA 5JLXA 5HAWA 2B63J 1X2MA 3OIOA 4I76A 1FTTA 1ETYA 4JX6A 5GPCA 3S5RA 3MKLA 1ZR2A 1AU7A 2PBXA 3HOWJ 5HSZA 4AUXA 2QKOA 3CWRA 4BKXA 5EZGA 2ZCNA 2O9LA 2G7SA 3GZIA 5FHPA 4D7NA 1F43A 3HBLA 3K2AA 3HEFA 2HYTA 3VOXA 2XGCA 4XRSG 2NVTJ 1ZQ3P 2JN6A 3HE0A 5J1UA 3NXCA 1FIPA 3PO3J 3BHQA 2DA4A 3OSFA 3B81A 3ZQIA 5E3MA 2FD5A 3NARA 3HM5A 4MK6A 1IC8A 2HI3A 3BTCA 1DU6A 2ELKA 3CRJA 4CYCB 2K9SA 1RESA 3D1NI 1HF0A 1XS9A 4A3LJ 2LK2A 1IDYA 4IHXA 3S2DJ 1JUSA 2R7ZJ 2E2HJ 5GPAA 4IHVA 4M3EA 3KKDA 3V6GA 3FISA 2G3BA 2R0QC 3LSJA 5D19A 2EZIA 2L7ZA 3GTKJ 1TWFJ 3JRCA 1W0UA 2UXPA 3DPJA 1WI3A 5F1JA 4A3EJ 2V57A 1JTYA 1ZK8A 2IEKA 3WHBA 2E2IJ 4W1UA 4XRSA 4YZEA 1LE8B 2QCOA 1IJWC 3HOUJ 3ZQFA 3GEUA 3TW7A 5HODA 2Y2ZA 1IDZA 3KKCA 2R5YB 2QOPA 1Y1VJ 2DA2A 4V2GA 2ZOZA 3QPLA 1IG7A 1U78A 4XRMA 2HKUA 2EZKA 4BY7J 5HBUA 2VKEA 1JT0A 1MSEC 3HB9A 3NPIA 2YVEA 3ON4A 1F36A 2LFBA 2JK3A 2NVYJ 2DG7A 3SDGA 3FK6A 2CRGA 2GBYA 3MN2A 3VVXA 3B6AA 4C3HJ 2ECCA 3BG9A 3T6NA 2R92J 1JKRC 2NVQJ 3LSRA 3S1RJ 2GFNA 4L5EA 2HYJA 1OCPA 5F0FA 2XSDC 1MBFA 1WH7A 3AQSA 5K7FA 3BG5A 1HCRA 3PPBA 1SANA 5IOZA 1DU0A 2AO9A 3JR9A 2REKA 5CXGA 2O7OA 1GV5A 3BTIA 5F0CA 5BNGA 1B8IA 4IHYA 4MLOA 5IYDJ 5M5YJ 2UXIA 3VOKA 1ZTRA 1TWCJ 3IH2A 5EG0A 2WB1N 5K7ZA 4I6ZA 4L62A 2JJ7A 3GBGA 4MFDA 2LR8A 4DZJA 2NX4A 1JUMA 1MSFC 1GVDA 3G1OA 1I6HJ 4JYKA 3CMYA 3S16J 4DZPA 5FLMJ 1RPWA 1UG2A 3JRAA 4X1EA 2EH3A 3O60A 1U9NA 4HKUA 1TC3C 5GP9A 3IH3A 3FIWA 3K7AJ 3QPSA 5DAJA 4Y7NJ 1BA5A 4W97A 1IGNA 4ME9A 1ZR4A 2YUSA 3BG3A 2GENA 4B4CA 2DTZA 4JP0A 2DA5A 3S1NJ 1HOMA 5E3OA 4JL3A 2CUFA 2HDDA 3HOXJ 3BR2A 3RQIA 1ORKA 5FMPA 2GM4A 3HIMA 4AF5A 2K40A 2CU7A 2L9RA 2XGEA 1A5JA 3BR0A 3MVPA 3HGYA 1H8AC 3FRQA 4ABZA 2DMNA 2K9QA 3MNLA 5F04A 3GTMJ 3RH2A 2ME0A 3H3VK 4ACIA 1LFUP 3ZQHA 2W48A 1H89C 1ZGWA 1U9OA 3GTQJ 3EUPA 5K58A 1JKOC 3BTJA 3CDLA 2ECBA 2VUMJ 3LHQA 4V2FA 1MBJA 1VI0A 3JRIA 5EEAA 1E3OC 3Q3SA 2IAIA 3Q0VA 4D7MA 2IBDA 1MNMC 3HTAA 1WCMJ 2EBIA 2JWTA 3E7LA 4GCKA 5M5WJ 2LKXA 1JTXA 2CJJA 5K7HA 4JX5A 3SFIA 3RKQA 1CQTA 3ZQLA 2HOTA 5FKLA 2LY9A 4A3BJ 2E19A 3Q0UA 3S14J 2XGDA 5JLWA 1JJ6C 1BW5A 4GCTA 1OFCX 2XB5A 1Y1WJ 2XPVA 1TWHJ 4KWAA 3QQAA 2M0CA 1GV2A 5C44J 2VI6A 1B8IB 1ETKA 2JA8J 1QPIA 2IU5A 1UHSA 2QTQA 4NELA 3BQZA 5J1RA 3HTHA 2HXIA 1O4XA 1K83J 5M5XJ 5EG0B 1I50J 2MW8A 1GDTA 3A01A 2H8RA 4Y52J 3KZ9A 1WH5A 2COBA 1FEXA 1ETOA 2LVSA 5FGLA 2DMQA 2MGQA 1UI6A 4CGRA 1FJLA 2JA7J 3S1MJ 5EGOA 4HNVA 2NS7A 4QTRA 2YVHA 4A3KJ 2O8KA 1S7EA 1RKWA 1RKTA 5C4XJ 2XPUA 4PXIA 4FISA 5FKOA 3BR5A 2ID3A 3EGQA 3BT9A 2XDNA 4M3GA 2L0KA 2DMTA 2M34A 1BW6A 2O7TA 2UXHA 3OSGA 2L7FP 1P7IA 5EYRA 1G2HA 3W6VA 3JRDA 9ANTA 4A3CJ 3QKXA 3JREA 3ON2A 1HDDC 2PZ9A 2Q24A 2DA3A 2X9DA 1OJLA 4A3MJ 1IRZA 3DEWA 2E1OA 2OERA 3E7QA 4GFBA 2NP5A 5E3NA 4MFEA 2DA7A 4DYQA 2RASA 5FKNA 2R93J 3VW2A 4BY1J 3FKIJ 5DTDA 2ZCXA 3G1MA 1XC5A 4DYRA 1AKHA 2DG8A 2OF7A 3GTJJ 4NN1A 3HOYJ 4A3FJ 3Q0WA 1SGMA 2ME6A 1BJZA 1ETWA 1YRNA 4A3IJ 1HDPA 3HOVJ 2XPWA 3IV5A 3HKZN 4DYCA 5FLVA 1IUFA 4MIMA 5DS9A 4IHWA 1NK3P 4GFLA 1X2NA 3NRGA 2HOSA 1K61A 3LSPA 1RETA 2D5VA 1QVUA 2G7GA 2MG4A 3LSGA 1UMQA 2X6OA 4QIWN 4JNNA 2WUIA 5FJ8J 3RD3A 3A03A 5EFYA 1GUUA 3SJMA 3TP0A 4AC6A 5D1RA 2TCTA 2Y30A 4B1RA 1TWAJ 1PUFA 4BBSJ 5M3FJ 1ITYA 4BBRJ 4JKZA 4MO7A 1QVTA 5EDNA 1VNDA 3O8HA 2KDZA 2VPRA 4G12A 1I3QJ 1NK2P 1JKQC 2I10A 3I4NJ 5IP9J 2KT0A 4XIDA 2CQQA 2WV1A 3CCYA 4C3JJ 1MBHA 2ID6A 2LP0A 2LTPA 4AC0A 3BQYA 3WHCA 5F27A 5IP6A 4UDSA 2Y9ZA 1TWGJ 2DMUA 3JRBA 2M2EA 3A01B 2DMPA 1A6IA 4FE4A 4J19A 1JKPC 4AYBN 3F0CA 5IOYA 4XK4A 3JRFA 3H0GJ 1B72A 2FQ4A 5EGOB 3S2HJ 2ZOYA 5M3MJ 4ICHA 3OOUA 4A69C 3NI7A 4D5CA 3JRGA 3CQZJ 3PASA 2EQRA 2DN0A 2G7LA 2OPTA 3BCGA 3ANGA 1ENHA 1D5YA 2RHAA 2L7MP 2H1KA 4FTHA 3M4OJ 1WGXA 1Z77A 3F1BA 5F0HA 1NTCA 2DA6A 2UXOA 3IH4A 1FIAA 5C3EJ 4UUSA 1WPKA 4B3AA 3O8GA 2NOGA 4M3DA 3P9TA 4MXMA 3BRUA 1H88C 2W53A 4A3DJ 2M9HA 1UI5A 2JA6J 3BNIA 1P7JA 1T56A 3G56A 1VF9A 2QWTA 4M3FA 2XB0X 4A3JJ 3GTGJ 2CQXA 2G0EA 2MSYA 3NNRA 3JSJA 5EF6A 3V78A 1T33A 3JRHA 1ETVA 1AKHB 3HDDA 1SFOJ 3B6CA 2R5ZA 1Z0XA 5CXIA 3PO2J 3ZOBA 3HTIA 1YRNB 3S15J 2YU9J 2WGBA 2XRLA 1AHDP 2D6YA 2Y31A 2QIBA 4GFKA 3TEDA 2AHQA 2RAEA 3LNQA 3FK7A 2FJ1A 2E2JJ 3VW0A 2Y0SN 2GUHA 3HOZJ 1MBGA 3VUQA 4S0HB 4QSHA 1GT0C 2OI8A 2EZLA 3S17J 2NP3A 2CUEA 3GTOJ 1VFCA 2PMZN 1PUFB 3ANPA 2LLKA 1JJ8C 3LOCA 1JT6A 1MH3A 1ZKGA 2HQ5A 5IP7J 1ETXA 3RZDJ 1W0TA 4RDUA 3I4MJ 4RBOA 4CYCA 2GLOA 4BXXJ 3QBMA 1EF4A 1FTZA 5CW8A 1Q1VA 2NVXJ 3GTPJ 2HOAA 1MBEA 3C07A 1XG1A 4DW6A 2JA5J 2JMWA 4EEFG 5FKMA 1JGGA 1U8BA 1OCTC 2NS8A 3NAUA 3VPRA 2N8GA 3ZQCA 3VVYA 5C4YA 3L1PA 5J3LA 4GCLA 3LWJA 1IV6A 2Y9YA 5C4JJ 1HLVA 5IYCJ 4FE7A 4LOCA 1RR7A 1B72B 4M3BA 2HXOA 3C2BA
chains in the Genus database with same CATH superfamily
4Y4RA 4C2MJ 3OIPA 3JTHA 4LG0B 2VPLA 4UUTA 3IUVA 4KJZA 3VIBA 3BR6A 4KITB 5IYBJ 2R5YA 2Z3YA 4XLPF 3GFJA 2M8GX 5J1YA 2WA0A 3WGHA 4YELA 1BR2A 1R4NB 3BR1A 3DF8A 2Y75A 2HKXA 5HNFA 1X1CA 5H9TA 3BR3A 4GRIA 4Q5SF 1OCRH 4R8HA 4UUSB 2QF7A 1ETQA 3LSMA 4BDYA 2JZYA 3K70D 3J81K 4XLNF 2QA4I 1BOBA 3GTLJ 3ZMVA 1ULYA 3MFKA 1V55H 1WFXA 4IEJA 3NQOA 5D18A 2H09A 3KEYA 4I01A 1ZG5A 1Q1HA 3G7RA 2F5CA 2F2EA 2GZWA 2M4GA 3BLYA 2CS3A 4G7ZF 1TT5B 3PM1A 5FKKA 1HC8A 4WK8F 2F07A 3W6JB 4ZYEA 4X0GA 2KIMA 3HRSA 2VJ5A 2VBYA 4CCMA 4IRGA 1ETYA 4JX6A 1ERDA 4B09A 1XGMA 2G9WA 1AU7A 4LG0A 1ON1A 1H0MA 4AYBA 4CGZA 3CDHA 4AUXA 3S3NA 3W6KB 3MWMA 2ZCNA 4D7NA 2WC2A 2ZXHA 4CSWA 5LLQA 1YJWI 3QP6A 1VQMI 2WBMA 2W85A 1R1UA 2HYTA 2XGCA 4XRSG 1MMAA 2JN6A 2E71A 1S6LA 2FBHA 5ERIA 1ZG3A 5CQEA 2Q2EB 2M4KA 2ELKA 4IRIA 1RESA 1J2XA 2P7VB 3BWGA 4IHXA 5GPAA 4YRVA 3RKXA 3LSTA 1KQ0A 2EFQA 3V6GA 1IV8A 3MKWB 3COAC 3FM5A 2R0QC 4KN4X 2EZIA 2XUBA 3GTKJ 2IA2A 4XOPA 3LQQA 3DPJA 1O7LA 2GA2A 5F1JA 4HF2A 3KP3A 4B44A 3KEQA 2RGVA 3DKWA 3WHBA 2E2IJ 3EUHA 3KP6A 4KICA 4YZEA 4M9XA 4E7ZA 3PL8A 2BW3B 2BV6A 3S3OA 3GEUA 3RDIA 5HODA 2Y2ZA 1ZLJA 3PJRA 2LC2A 2OC6A 2VKDA 3VEPA 3RI4A 2C6YA 4V2GA 1XDSA 3QPLA 3L2WA 1BI3A 4CCOA 2EZKA 4GYIA 4JK1X 3LL7A 4G7HF 3EPZA 2VKEA 1MSEC 2ACJA 4L9VA 1YE9A 3HB9A 2DOEA 2XDVA 3NPIA 1F36A 2DG7A 2JK3A 4O5VA 1U3EM 5DD4A 4TV7A 3BJAA 1FY7A 4Z6YA 4I7HA 5L3FA 2P7CB 1A6QA 2FE3A 4L5EA 3V8KA 1OCPA 4KIGA 4HF1A 1WVRA 5HS8A 1DU0A 2AO9A 3IHUA 3JR9A 1V4RA 1DP7P 2REKA 1GV5A 3OYCA 2K4JA 5F0CA 5BNGA 4EQQA 1Y39A 2WTEA 4LG3A 2VKHA 4BGDA 3H9QA 5HNHA 4IHSA 1G6NA 3E97A 3JSOA 3LWFA 4HDUA 2BZTA 2KLOA 4N0BA 5K7ZA 1SAXA 2A05A 1XSVA 3GBGA 1Y0NA 2NX4A 1MSFC 1GVDA 5J6XA 3K1MA 3F23A 2O61A 1LNWA 1RPWA 2HU9A 1UG2A 4LIVA 4RAYA 3CD6I 5DD8A 2KJCA 5L3DA 4CZZA 1FYMA 3KCCA 5LHIA 2MLGA 3IH3A 1T2KA 3QYFA 4IRVA 2MABA 1W5SA 1DQUA 1LEAA 2DJIA 2PI0A 2QBYA 1QNTA 2YUSA 4MGRA 2GENA 3F8MA 2DTZA 4JP0A 2WAQA 3A2KA 2M87A 5E3OA 3SDBA 2CUFA 3BR2A 1ORKA 2NNYA 2GM4A 1IN4A 2QQAA 1B9MA 2RNGA 2K40A 2CU7A 3GCMA 1K78B 5LRSA 1XGSA 5EEGA 4KT6A 3MZHA 2X4HA 4NC6A 5DYMA 4B48A 3MNLA 1Z7UA 3I9V2 2HQRA 3GZNB 1VQLI 3VYUB 4OIOF 1ODDA 4BUPA 3ZQHA 4CUGA 3WG9A 4WIBA 3DP7A 3VSKA 1SFUA 2HVRA 4DIQA 3CJNA 1PVEA 2ECBA 2P8TA 4OINF 2EIKH 3IP4B 1UHMA 5E1XA 3TL4X 4Q4ZF 5IT9Z 3SEZA 4V2FA 3TO7A 1F1ZA 1VI0A 5J4YA 3JRIA 5DM7F 2LY2A 2RQPA 2IBDA 1MDMB 2ZCWA 5A2QZ 4XN3A 1IZ1A 1JTXA 4FT8A 3HC7A 4PSXA 4F3QA 2CJJA 5K7HA 1FP2A 4XLAA 1O3RA 2F5DA 4J01A 2JT1A 2IGNA 2GOXB 3BG6A 2E19A 5GAEJ 4S04A 3S14J 5JLWA 3W2WA 1Y8RB 4WF2A 2F48A 1TWHJ 3OMYA 4KWAA 4P5OA 5E18F 3M8FA 1ETKA 2FSWA 2E5ZA 4FETA 2JA8J 3M8EA 1CGPA 5LHGA 3BQZA 1KGSA 1QZEA 1K83J 3ZP5A 2R7OA 1B6AA 4AVPA 3BZ6A 1RRJA 1ETOA 3MKZA 5FGLA 4G6QA 2J5PA 3KZIC 3I4PA 1FJLA 5EGOA 2NS7A 1NG7A 4GDFA 4WWCA 3N97A 2UWMA 4PFPA 4CH7A 5FKOA 1BIBA 2XAGA 3EGQA 1A35A 2OZ6A 2BY2A 5DCMB 3RTRA 2R7UA 2K7LA 4MEYF 4XLFA 4YFKF 2L7FP 1G2HA 3QPHA 4XBFA 1X3ZB 9ANTA 4A3CJ 3DLAA 3AKZA 3BPVA 3U1DA 2DA3A 2X9DA 1XX5A 2MD5A 3DEWA 3WU1B 2DOAA 1Y6IA 2E1OA 4XR6A 2OERA 4G94A 3WTTC 4GFBA 1UJ8A 1IN5A 5GAGJ 4C2TA 4DYQA 1RI7A 4M71A 2VC0A 3FM3A 2R93J 1RR8C 3FKIJ 1D8JA 1F9NA 3KP7A 1K7AA 2K5CA 2ZCXA 2OF7A 3LA2A 4XLEA 2DO7A 4A3FJ 4II2A 3Q0WA 4KFCA 1SGMA 1ETWA 1YRNA 3H0DA 2V6CA 2XPWA 4OAYA 4RLQA 1YS7A 1UZCA 4IHWA 2CO5A 1L3LA 4KIFA 1IN7A 3WU2C 4CZCA 1CF7A 1X2NA 3NRGA 2XKOA 4ON0A 2HOSA 3UNGC 1K79A 1YJNI 2VIXA 2IT0A 1LQ1A 4KT5C 3LSGA 4IOAF 4LGWA 1JGSA 3EDPA 1DPRA 2KRFA 1L0OC 4HSRA 4C9YA 5LGTA 5FJ8J 4MTDA 1IRXA 3SJMA 2H6BA 1XGNA 3V7RA 5D1RA 5E17F 2OBPA 2ZO4A 5M3FJ 1ITYA 2JSPA 2DBBA 4U0YA 2MH2A 3M8JA 2MD0A 4MO7A 3C7JA 5EDNA 2VPRA 3FZVA 4XSXF 4DBQA 2Q0OA 4BYYA 3G4SI 2I10A 4HG2A 1XB4A 2KT0A 4G7OF 2VQLA 2WV1A 1J0RA 1MBHA 3RKWA 5IP6A 5F27A 2JPBA 4HX7A 3VYRB 2ELJA 2JPCA 1I1GA 2XVCA 2OCCH 3SZGA 4AYBN 3F0CA 2XSJC 3S2HJ 3VYSB 2NOJB 4A69C 3OYNA 3JRGA 4G6TB 3CQZJ 3CO7C 2EQRA 2DQLA 5DEQA 2CMPA 3OYGA 4BNCA 1G4DA 5ED4A 2LBFA 1X1DA 4UY8I 3I53A 3BCGA 4ESJA 2RHAA 3I55I 3E6BA 4FTHA 1S3JA 5F0HA 1RC9A 3R0AA 4ITVA 3U2RA 2XV4S 1FIAA 1UCRA 1TBXA 2QQ9A 4M3DA 3P9TA 2CFOA 1KA8A 2PFBA 5CVRA 2R7SA 4A3DJ 2M9HA 3DKXA 2CG4A 3KZZA 2QWTA 5L3EA 4E7HA 1PJRA 2XAJA 2IS4A 2MSYA 2W25A 2AS5F 4BEHA 1UFMA 3JSJA 2ZFWA 3E0JB 2NYXA 3V42A 2KZVA 4EJWA 3E6DA 1AKHB 3RPUD 3HDDA 4L9TA 3PIOF 2R5ZA 3HSRA 4O6JA 2EB7A 5CXIA 4B43A 2YU9J 1AHDP 1SMTA 1ZN2A 4XLCA 2QGUA 2Y31A 2QIBA 2A6EF 1WJFA 4HV6A 4HLYA 4EATA 4NNJA 3KLOA 2MBFA 2RAEA 3MD2A 3LNQA 2PLYA 3FK7A 2FJ1A 1HSJA 2Y48A 3K10A 3ZMUA 3KP4A 4I99C 4DJAA 2FBKA 4R79A 3VUQA 2FUG2 4F7ZA 2OI8A 2KRHA 2EZLA 1SC7A 2CUEA 3GFLA 3K6GA 3DWLE 1YHQI 4HX8A 1QZZA 3F21A 3I59A 2XHKA 3HTUA 3OR2C 3RZDJ 1S7OA 3F8FA 1LPQA 3CCJI 2IS6A 1FTZA 1Q1VA 2IJLA 2BBYA 2HOAA 4ANJA 3C07A 3I56I 1FMWA 2JA5J 2NS8A 4HRIA 2OQRA 5HLTA 3VVYA 3L09A 1A04A 3L1PA 3D5LA 3LWJA 1TQMA 2Y9YA 5C4JJ 5HDGA 5FFXA 3ABUA 1XN7A 1ZGAA 3Q9VA 4FE7A 3WE2A 3WTVC 2FNPA 1RR7A 2VXDA 3NS4A 2OQGA 3C2BA 1XMXA 2WADA 1X58A 3WU0A 3HKZA 5F08A 1LE8A 5DUIA 1OR7C 5L3GA 1D3YA 2LDUA 3ZQGA 2VKVA 3QWLA 2YSRA 5K5OA 3T5XA 3VTIA 1LDKB 3IWZA 5D5UB 4ZDPA 2LF8A 4XICA 2PJRA 1R23A 2IRFG 1PYVA 4L0YB 2K86A 2F6CA 1R58A 2FBQA 1VQPI 3G1LA 1BR1A 3HGGA 4XSZF 1T8IA 4KYWA 2GWRA 4FCYA 3UKGA 5BPDA 2WAQN 4II3A 1Z21A 3ROUA 2HVQA 2CH0A 3HUGB 3L2QA 2QEXI 1IUYA 1POGA 3CUQA 5IT9K 2WWYA 4PFOA 2HKOA 3HZJA 2A2FX 5E3LA 2Z33A 2ZXIA 4A6EA 5JLXA 1BI1A 2KIUA 5HAWA 2KIFA 2XAFA 2B63J 1TQIA 3V8JA 2EINH 2PMHA 2F5VA 2VLAA 5A2QK 3MKLA 1N25A 3PUFA 3HOWJ 3GX4X 1Z67A 3LFKA 5EZGA 3OYDA 2O9LA 2G7SA 2DI3A 5FHPA 3LSKA 1RIOH 4EGYA 1SD7A 1XDUA 3HEFA 1ZQ3P 1VQ7I 4HPQA 1MKMA 3NXCA 1FIPA 2DT5A 3BHQA 2DA4A 2MLKA 2HEOA 2D1HA 3OSFA 3B81A 1EJ9A 2RVCA 1DU6A 3BTCA 4CYCB 3D1NI 1HF0A 3ZPLA 2A69F 1XS9A 2X1EA 4GYGA 4A3LJ 2LK2A 4A6DA 4G9YA 1VQ4I 1OCOH 4RS8A 4OD5A 2R7ZJ 2E2HJ 3FXQA 4LK0F 1X3UA 2IS1A 3KKDA 3D5RC 1ZREA 2G3BA 3LSJA 3TMOA 1LVKA 4BL0B 4L5IA 2Q8KA 3SQNA 3QOEA 2R7XA 1Y8QB 2DT7B 2QCOA 3IRRA 3ZCOA 2UXNA 3TW7A 4MQ9F 2R5YB 3ESWB 3F6VA 4F91B 4PJ0C 3M9AA 4C30A 2GXBA 4E70A 2DA2A 4IZZA 2QVOA 4DQ2A 1U78A 4XRMA 3HHHA 3CLOA 4RAGA 4U7BA 2P5LC 2H27A 2XF5A 3OYHA 3QYBA 1BIAA 2DT6A 3HL2A 1JT0A 4ZTJA 5EEHA 3EUAA 2HGCA 2PMZA 1DGWY 3ON4A 5J8FA 3SDGA 3FK6A 4OMZA 4HF0A 5TRDA 2DOFA 3DTEA 2A6HF 3GF2A 1ZHFA 3EYYA 4JQFA 5FLXZ 3BG9A 3OS2A 3T6NA 2NVQJ 1BM9A 3S1RJ 2GFNA 3ELKA 4IQJA 5F0FA 3P9IA 4A0YA 1D0ZA 4S05A 1Z9CA 5K7FA 2V4JC 3H5RA 4UHTA 3BG5A 1VQ6I 3PPBA 1SANA 1QHGA 4HAMA 1V5EA 2VASA 4ETSA 3CJRB 3ZR8X 2HYFA 4IHYA 1B8IA 4NQWA 2XKPA 2VN2A 1REPC 1SEUA 2DFHA 1ZTRA 2W82A 1TWCJ 3CC2I 4N9IA 2CV1A 1USSA 4WXCA 2B3WA 3F9KA 4XMYA 5D8KB 4L62A 1BR4A 1TT0A 1SFXA 1QHHD 4Y17A 2OAZA 3GZ5A 3ZN1A 1LDJA 1HXDA 4BHPA 1HQCA 4JYKA 3GW2A 4YFXF 4K2EA 1MMNA 3SHFA 3E5XA 4X1EA 4ESBA 2EH3A 1EH7A 2A5WA 4E7LA 4PGHA 3GMEA 4HKUA 4A5NA 3CF2A 3QPSA 5B3SH 3DBLB 2A5YB 3UR3C 2PMUA 4BJ6C 4HBLA 2MFZA 5BOXA 1IGNA 4U7DA 4M6XA 4JL3A 5CKTA 1O7FA 5L3BA 3L7WA 3WTXC 1D0YA 2VOPA 2R7VA 4CCLA 3HIMA 2LNBA 4D0PA 3CCVI 1OCCH 2XGEA 3I58A 1R5ID 1I3AA 2D2WA 5J4VA 2VODA 4ZC3A 2FBIA 3BR0A 3U21A 3V8LA 3BPXA 1KU9A 2V1UA 1O3QA 1TLHB 4U87A 4ZH4F 2LF7A 5J8CA 1KZHA 3RH2A 2RC4A 1PUEE 5HLGA 5GADJ 2W1OA 4XKVA 1F4KA 2QENA 3AG3H 5F64A 1E3HA 3SWHA 3A0HC 5AIPA 2OTLI 3R60A 3LQRA 2KZGA 1ZGWA 1TL8A 5K58A 3BTJA 3V7SA 2L9SA 2ISZA 4I09A 4RB3C 2R7QA 3DQVC 3RPQA 3OYMA 4PDKA 5EEAA 3HTAA 2EV0A 4D7MA 1S9HA 5FO5A 4EJUA 2JWTA 3EUHC 5FB2A 3IAS2 1IRFA 2OD5A 3GXOA 3VWBA 2ZJ2A 2CQNA 3VOEA 2OZUA 3H36A 3O6BB 4JX5A 3RKQA 4H4KC 4PZJA 2XGDA 1JJ6C 2BXYA 2HNHA 4R1HA 2EFWA 4GCTA 2X6WA 2QUFA 2DCEA 2XB5A 1Y1WJ 2STTA 3OYIA 2CQ7A 3QOPA 1GV2A 3WTSC 3VSLA 4OIRF 1QPIA 2IU5A 2QTQA 2HWVA 1V5GA 5J1RA 2EK5A 2IA0A 1O4XA 4M74A 2J5OA 1R36A 2VE8A 1I50J 3CCLI 1GDTA 3A01A 1R5HA 1SMYF 2JA7J 4BE2A 1FBSA 4HNVA 2R4GA 1WJAA 3E6CC 1LVAA 4E7KA 1WJDA 2IW5A 1S7EA 5C4XJ 4PXIA 2DPUA 4FISA 1ZAOA 3F72A 3BR5A 2ID3A 2L54A 1GVJA 2M45A 3BT9A 3I54A 4XN0A 4M3GA 2BXZA 1FOXA 3RPUA 1R7JA 3OYKA 5E79C 1E17A 3K4BA 2QBYB 4BH9A 1P7IA 2I8DA 5EYRA 5K1YA 5KAFC 1K4TA 1ZRDA 3JREA 1J7KA 2PZ9A 3FWEA 2XIGA 3ZQQA 2GIZA 2Q24A 4A3MJ 2KQRA 2K9LA 1LJ9A 1UG0A 2EV6A 3E7QA 1X1AA 3DV8A 5FD5A 3S8PA 4U9NA 1WJCA 4MFEA 2DYSH 1FOWA 4IVNA 4MTEA 3ZMTA 4BY1J 1D0XA 2Z16A 4HSTA 2X85A 1NHAA 4DYRA 2DG8A 1MGTA 1P9QC 2RREA 2BYVE 3GTJJ 1P4XA 2K3FA 1Z1DA 4LMYA 4IO9F 2ME6A 5DV5A 4A3IJ 3HOVJ 2BE5F 2WB1A 4ZTFA 3IV5A 3HKZN 4DYCA 3L2CA 3TBIA 4MIMA 5KK1A 4BE0A 3FBIB 4NB5A 1KQ9A 4XORA 5FRMA 1B59A 4LB6B 1K61A 2ESHA 2L01A 2NXNB 2O3FA 1RETA 2YX7A 3I0TA 3LA3A 2COMA 2KPMA 2D5VA 2MG4A 4H0EA 1UMQA 3N4MA 3BG7A 3MZYA 3A03A 3HOTA 1GUUA 5JHFA 1FC3A 3TP0A 1D1AA 2TCTA 3ZXSA 2LKSA 2E34A 4BBSJ 3DTKA 4RB0A 4BBRJ 4JKZA 1KYZA 1Z3YA 2QSGX 3DEUA 1MJ9A 3O8HA 2KDZA 1FNNA 4F93B 2AQEA 4G12A 1YLFA 2E5NA 2ICWG 1NK2P 3BCBA 2BY0A 4MNUA 4UB8C 4ZJZA 3R61A 3I4NJ 4LJZF 2NVUB 1WHUA 1SVMA 4C3JJ 2ZSHB 2AXTC 2EIMH 5CVIA 4AC0A 3BQYA 4UDSA 4BHCA 4YIIA 1TWGJ 2H8WA 3OS0A 3JRBA 1HA8A 4RGRA 4FE4A 2DU9A 4RB2C 5BMZA 4WCGA 1RUNA 5IOYA 4XK4A 4ICHA 5EGOB 4KMUX 4HX4A 2RQQA 4CO8A 5KVRA 4E7IA 4EJTA 2IA1A 2A07F 3ML6A 2DN0A 3HRTA 3CMAI 4RAFA 1MNEA 3H9GA 1ENHA 5JVGF 1D5YA 4IF4A 2LRDA 2ZNYA 3PSFA 3M4OJ 4HNUA 1WGXA 2X1DA 3F1BA 3LSIA 5KNLA 3L2VA 4I2OA 1R71A 3F8CA 3IKTA 1WPKA 1QU3A 4L18B 2FRHA 2UUZA 3QP5A 1O3TA 1O3SA 4D9JA 3AL0B 5KAIC 2JUCA 3BNIA 1G3TA 3RSNA 2A61A 1ZRCA 3ASOH 3GTGJ 4A3JJ 2CQXA 1B9NA 5EF6A 1T33A 1F5TA 1SFEA 4E6KG 3J80Z 4FX4A 3FMSA 4IRHA 1VQNI 1SFOJ 2WY8Q 3B6CA 4NHJA 2UV1A 2TDXA 2BOLA 1W7PD 3PO2J 1YRNB 2WGBA 2LMDA 2F4MB 3DTIA 1K6YA 3MCZA 1W36C 5H6QA 3SEQA 5JI6A 1EV7A 1Z91A 2VBXA 1CF7B 2AHQA 4YEJA 3TQNA 1BN5A 3PNVA 4EVIA 5FLXK 3AL0C 2HQNA 1MBGA 4M9ZA 4RMNA 3BC8A 2VL8A 1GT0C 2HDCA 4HW0A 4B8XA 3JW4A 3S17J 2NP3A 4RM2A 3GTOJ 1TZLA 2BVLA 1VFCA 2LYCA 5IT3A 2FQ3A 2P5VA 5LEJA 2PMZN 1MMGA 3FXRA 1ZGJA 1JJ8C 4XLHA 1HW1A 3K4JA 1Z3XA 5E1ZB 3KYCB 2HQ5A 2NS0A 5IP7J 1WJBA 1ONVA 3DBHB 1MD0A 3FXMA 3F8NA 4RDUA 4AIKA 1MMDA 5TGTA 4BXXJ 3LMMA 4BDZA 4DW6A 2M8EA 5DM6F 2JMWA 4EEFG 1JGGA 1OCTC 4BHBA 2P4WA 1QPMA 5LBQA 4BE1A 4CHUA 4HOBA 1U6GA 1T95A 3HTSB 3QAHA 1LB2A 1QZYA 2L9VA 2QLZA 4LOCA 5LEKA 1I1SA 2HXOA 4BAYA 4L5JA 2F5FA 2LD5A 1X3WB 1UAAA 4JX4A 2AQFA 1WQ2A 5TJJA 1QRYA 4D1QA 2K9NA 2VT2A 3VW1A 4D5FA 4UV8A 1MBKA 2FX0A 4EV0A 2LBFB 4A3GJ 1JI8A 3CJDA 1HBXG 2P81A 3H5NA 5IPAA 2XROA 3LAJA 3ABLH 1J09A 4LK1F 3TP3A 2DA1A 3VVZA 3KP5A 3CJQB 4NDLA 3CZ6A 3TW6A 3LJLA 1R9TJ 3S93A 4HDVA 2IGKA 1R1TA 2KISA 4GO1A 2P5KA 4M6VA 1JXSA 3WGIA 1T38A 1APLC 1DP3A 3OYFA 2XAUA 3KNWA 2BGCA 3R0JA 3B02A 3DCFA 3MZ8A 4KN7X 4LLLA 4BEHB 4A93J 1GXPA 3S1QJ 1FWZA 2RKHA 1YX5A 3BJBA 3RKYA 3VP5A 3F3XA 4EJVA 2E7XA 2UXUA 4YFNF 2V1XA 1FZPB 2R5ZB 2QSHX 2ZCMA 5EZHA 2WAFA 5AQCA 4DBRA 1G3WA 1OMIA 2HS5A 3OYAA 5GPCA 3EYIA 2E35A 5FROA 1MJBA 3WTZA 1OYIA 5FRNA 3G3ZA 2LY1A 1SFKA 2KKOA 2HTSA 3U1KA 1F43A 2LSOA 3KX2A 3HBLA 3PSIA 2EA2A 2M0MA 3CC4I 3VOXA 2NVTJ 3TOAA 2R7TA 3HE0A 3WTUC 5J1UA 3RCOA 1VQ9I 2KJBA 5ICGA 3ZQIA 5E3MA 3GVAA 3I59B 3QYEA 3HM5A 1EA3A 4A0ZA 4MK6A 1IC8A 1XD7A 1U5TA 2HI3A 3S32A 1XSDA 3L00A 3CRJA 1OYYA 4M9SA 3H3ZA 1ZELA 1U8RA 3TOBA 3FBNB 1BBYA 4IOCF 5E8GA 1I6XA 4M3EA 3SZTA 2L7ZA 4ZYDA 1UB9A 3JRCA 1W0UA 1XTAA 4E4HA 1IN6A 1FPQA 1G8XA 2Q1ZB 3GO5A 3HSEA 3DLLF 1EH6A 1JTYA 1ZK8A 2V57A 3OL3A 4PUSA 4BQAA 1WRJA 4W1UA 2FJI1 4WXHA 2JVHA 3HIFA 1LE8B 5B1AH 4ZYAA 2NRAC 1IJWC 3K1NA 2KMUA 2EILH 2FOKA 3VDXA 1IDZA 4U9LA 2QOPA 4XKWA 3K1PA 5HVQC 4LFUA 2FEZA 1IG7A 2PJRB 3HG9A 3P9CA 4CXFA 1X4OA 4BY7J 5LGNA 3C18A 5HBUA 1D1BA 3FMRA 5D8LB 3S3MA 1LEBA 2R7FA 3NEUA 4FASD 1R49A 1VQ8I 4HEA2 2NVYJ 2CRGA 3OL4A 2GBYA 3OYEA 5HDNA 3OYLA 2PG4A 2PN6A 3B6AA 4MQVA 3LA7A 3LAPA 3K2ZA 3LSRA 2XGXA 3K4NA 2HYJA 4CCJA 4GGGA 4F52A 3J7AO 3CUQB 5FD6A 1HCRA 2RV8A 4XNFA 5CVJA 5IOZA 4KA4A 1G3SA 3ABTA 4KNYA 5JHUA 4RM3A 5IYDJ 2Z1DA 3T8RA 2L4AA 2EIJH 4CDGA 1EKEA 3CMEI 4BQNA 1BOAA 4A2UA 2FMLA 1C0WA 3RYPA 3IH2A 5EG0A 2WB1N 4DZJA 4MFDA 2LR8A 3V4GA 1JUMA 3DU6A 3T0YA 3KIOA 3MMYB 3G1OA 1I6HJ 3MQ0A 1MZBA 3RQ4A 3S16J 4AIJA 1T6SA 4NC7A 5FLMJ 2VC1A 3CUQC 3NWTA 3RIRA 3O60A 1FP1D 5HOOA 2V6EA 4I0AA 5B66C 1U9NA 2JRMA 1TC3C 1WZ2A 2X1CA 2ADUA 2VB6A 3BOQA 1FSEA 3K7AJ 2DK5A 1D1CA 5FGMA 1BA5A 4W97A 1DDNA 4JBAA 1WWXA 3FXLA 2CQKA 3BG3A 4AIHA 2CFXA 1A36A 4B4CA 1N78A 2DA5A 2K02A 2L9NA 1YOVB 1WJ5A 3RQIA 3ECOA 5CYVA 4U0VA 3DU5A 4UVBA 4AF5A 3DFGA 4WX9A 2M5WA 3IRQA 1TP4A 2AXLA 2L9RA 2P6SA 3E5UA 3CCEI 3MVPA 4CA0A 1X1PA 2VOOA 3HGYA 1H8AC 2Z5UA 2JRTA 4HV5A 4YIFA 4AD9A 2K9QA 5F04A 3GTMJ 1XPXA 2ME0A 1FT9A 3H3VK 4ACIA 1LFUP 2W48A 3B73A 3DEEA 3HRUA 1BI0A 2E1MB 1H89C 2CW8A 1TNSA 1XMAA 5JFRA 3SZPA 1T39A 3EUPA 1JKOC 2O0YA 3CCSI 3C2HA 2VUMJ 4BU2A 4DNCA 1X19A 4ASNA 1S72I 5L3CA 4XOTA 4AIDA 5HLHA 3JSPA 4KDPA 3J80K 1YX3A 3Q3SA 3OOPA 5J40A 1DPUA 3K0LA 2PEXA 5M5WJ 4BS9A 3ZQLA 2HQAA 5FKLA 2LY9A 4QLCU 1JHFA 5DCFA 2E1MC 3ASNH 5CPRB 2QQ8A 3WODF 1OFCX 4ZYHA 4ENJA 1ZG1A 3ERMA 1PP7U 2NNNA 4LLGF 2M0CA 2EFPA 2H94A 5C44J 1B8IB 2ZKZA 4NQWB 5ILSA 5EJCA 1UHSA 2ETHA 4ZZLA 2YVXA 4NELA 2R3SA 2NAZA 2HXIA 3W2VA 2OU2A 2GIVA 4PCQA 1X4PA 3TKYA 2KP6A 4F55A 4Y52J 3KZ9A 1WH5A 2PQ8A 1VQ5I 1FEXA 2DMQA 3HYIA 2X6YA 3ZQ7A 1HW2A 1W36D 1E0EA 3G2BA 2VE9A 3BZKA 2IGOA 2YVHA 2PFVA 2O8KA 1RKWA 1RKTA 3Q9SA 2IGMA 4BQQA 2RN7A 4PJJA 5AIQA 2YX4A 3FF5A 3CTAA 3GLXA 2O7TA 2UXHA 3OSGA 1QQIA 3HPHA 4Q48A 1W7PA 3W6VA 3JRDA 4L0ZB 3QKXA 3ON2A 2E7WA 2MC4A 3NWSA 4RA2A 2VONA 1OJLA 3PFYA 4A5MA 2GOMA 2IXSA 3G71I 5K5QA 3OYBA 4EJOA 5E3NA 4DOZA 2DA7A 3H3UA 2D1VA 2DLLA 2VJ4A 4BACA 2RASA 3VW2A 3G1MA 4O3MA 2ZMEA 4AU7A 5LD2C 1TW2A 2L2OA 1YTYA 2PJPA 1BJZA 1YI2I 1W5CC 5CLSA 2BY3A 4EM1A 1IUFA 5DS9A 3AG1H 1BC8C 4BXFA 6PAXA 3LSPA 3Q5FA 2CGPA 3KPHA 2G7GA 4QIWN 3RD3A 5ICFA 2HFHA 1U0JA 5D4SA 2ZBKA 2HTJA 2WV0A 4UB6C 2QQBA 1E3PA 4B47A 3W3CA 3PQJA 4V19K 4B1RA 1TWAJ 1PUFA 1SD5A 4N4NB 4EGZA 2HPMA 4YIRX 3M7GA 2V9KA 2BVMA 3GYHX 1VNDA 1YIOA 2LREA 4L9NA 2LH9A 3C3WA 4OAZA 3H1CA 3ZMZA 1B4AA 4L9JA 5D6EA 3L2RA 2EA4A 3TO6A 5IP9J 3KP2A 3K69A 4XIDA 2QZ8A 3M1CA 5BQTA 2LP0A 2LTPA 2MA3A 3WHCA 2JVGA 3FDYA 4BQOA 2Y9ZA 1OYWA 5CVVA 1FBUA 2QSFX 5KCMA 2M2EA 3A01B 3K4CA 2ZXJA 2ZJRF 2W24A 1HKQA 2IS2A 1IXRC 3JRFA 3H0GJ 3ONQA 2FQ4A 1B72A 2ZOYA 4OIQF 4RB1A 2GXAA 3WTYC 5HDKA 3O3KA 1YIJI 1GHCA 2XASA 4A12A 2G7LA 4CCKA 3DPUA 4WXDA 1IRGA 2DDAA 3ANGA 1IF1A 4ENKA 1YW8A 5E20A 2KIQA 4Y13A 3HSFA 2H1KA 1R6RA 1K4SA 2F4IA 1R00A 1HW5A 3WG7H 1WSUA 1AOYA 2H6CA 2HZDA 3IH4A 2K9MA 5C3EJ 4UUSA 2HYGD 4I98B 1Z05A 3A4CA 4B3AA 5HLIA 2NOGA 3GEZA 1AA7A 5B1BH 4MXMA 3BRUA 1H88C 4OIPF 2DPDA 1UI5A 1ZLKA 1T56A 3G56A 1YJ9I 3NNRA 2G0EA 2M30A 3K4LA 2W57A 3V78A 2X6XA 1DGRM 4ZZDA 3JRHA 1DUXC 1QO0D 1MMSA 4F92B 3BJOA 1Z0XA 2KHMA 3GFMA 2Y0MA 1TQPA 4C2UA 3S15J 1IXSB 2XRLA 5H6RA 2A3SA 2BEOA 2JSCA 3T8TA 2VT3A 3K4MA 1YO5C 2E2JJ 2OUMA 2L3DA 3CJTB 3IKVA 3F8BA 5H20A 4S0HB 2VBZA 4Q47A 2IVMA 3ZMSA 1YITI 2DFEA 3KEOA 3BZCA 3BCAA 2OTJI 2KL4A 2LKPA 1RNLA 2V26A 3ULQB 2WAEA 2LLKA 4LD5A 1MW7A 3QRFF 3VB2A 3OYJA 1MH3A 3SXYA 2Q2EA 2L4MA 1ETXA 2XF7A 1W0TA 2E1NA 1MIJA 3I4MJ 3HOSA 3OIQA 4OOIA 5D4RA 4AM3A 1MNDA 1W1WE 3HPGA 3PNTA 3QBMA 1O57A 2NVXJ 5HS7A 3ABMH 1KYWA 2MC3A 2W4SA 5FKMA 4GXOA 2DTRA 3NAUA 3VPRA 2N8GA 4NBQA 3ZQCA 2VQGA 5CQGA 1VTNC 3I64A 3ZGKA 3FMQA 1HLVA 5IYCJ 1IN8A 1XCVA 3CMMA 4M3BA 4Y3OA 1G59A 1QA6A 5AONA 3BROA 3CUOA 2BW3A 3KLNA 3OV8A 1YYVA 1WJEA 4CICA 4M72A 3AQTA 2FMYA 1W4MA 3BTLA 4Z2YA 3RZOJ 2XF6A 1MH4A 1I5ZA 2CWEA 2ZB9A 1JUPA 2L02A 5FFZA 4Y15A 5ILUA 1P92A 1MJAA 3HJEA 1P4WA 4BJ5C 2TRTA 2UXXA 1BI2A 2DAOA 3MAJA 1JE8A 1QGPA 2X48A 1BL0A 4DGWB 4XRFA 4EM2A 5E1WA 1Y0UA 2G7HA 2ZJQF 1BC7C 3A02A 4X6AJ 4QWQA 2EZHA 2DJNA 1V54H 3OY9A 2V9VA 5ICEA 4IKFA 2ZFUA 3R4KA 4C3IJ 3COLA 2ESNA 3M3YJ 2YS9A 4E7SA 1TNTA 2CUJA 3HTJA 1LFBA 3DXJF 1P4AA 1X2MA 3OIOA 4I76A 3BP8A 2CYYA 4M73A 1FTTA 3S5RA 1ZR2A 1S5LC 3ISPA 3J7AY 2PBXA 4PJMA 3I71A 5HSZA 2QKOA 4HNTA 2HVSA 3CWRA 4BKXA 4XL9A 3GZIA 4CYDA 4PSWA 4RLFA 1S7AA 3JCUC 3K2AA 5F1RA 2BHYA 2WY7Q 1SAUA 3AAFA 2P0WA 4PJNA 2KDOA 3PO3J 2D45A 3PQKA 2QKMB 3WTWC 3BJ6A 1SD6A 2FD5A 3NARA 4ESFA 4UV9A 3DPLC 1P2FA 2FOWA 4RGUA 2K9SA 1YQAA 2B1EA 4C2MA 3IUOA 5D6FA 4LIUA 1IDYA 3H92A 3S2DJ 1JUSA 1Y56A 4UUVA 4IHVA 2JA2A 3FISA 3IC7A 5D19A 3VODA 3W2AA 1TWFJ 2UXPA 3HXLA 2XRNA 3MEXA 2ISYA 2V1NA 3RYRA 1WI3A 1K78A 4A3EJ 4MEXF 3K9TA 3H5AA 2FF4A 2IEKA 1BJAA 3X2QH 1J75A 1V3FA 4XRSA 4DVYP 3VFZA 3HOUJ 3ZQFA 2MYSA 4ENNA 3IL2A 5BS6A 3KKCA 2Y0SA 4KMFA 1Y1VJ 2EFNA 4FQGA 2UZKA 1HSTA 1LKXA 2ZOZA 3CC7I 2V9PA 2HKUA 2OJED 2M7AA 2CV2A 3FXJA 2XAHA 3N05A 4ZYGA 3L2UA 1YG2A 3J7YJ 3P5JA 2R7RA 1J9IA 3FXKA 4LITA 1Z6RA 2YVEA 2W7NA 2LFBA 1MDMA 2FA5A 3CESA 3MN2A 3FXOA 2DW4A 3VVXA 2ZJPF 5BPIA 1XMKA 2ECCA 4C3HJ 3O2PE 5TISC 2R92J 3SFZA 1JKRC 4HLXA 1YS6A 2PX9A 1FOYA 2V7FA 2VBWA 2XSDC 1MBFA 1WH7A 3JAMZ 3S2WA 3AQSA 1T08B 1NG6A 1FLIA 5CXGA 2CV0A 2O7OA 3TDUC 3BTIA 4MLOA 2B7EA 5ILVA 5M5YJ 3R6SA 2UXIA 2ZNZA 3VOKA 3NRVA 1Z6TA 3GZ6A 4LB5A 1FBQA 1KU2A 1ZRFA 2Z99A 1R5GA 4NC8A 4I6ZA 1N75A 2JJ7A 3I5UA 3OR1C 5LFAA 3SYTA 3CP2A 4P55A 3FX3A 2I5UA 3C1DA 5E8IA 2CW7A 3DBRB 3RJPA 3CMYA 4DZPA 2O5RA 4BJTA 1I27A 2PBIA 3JRAA 3TGNA 2E36A 2EWNA 4EM0B 3J7ZI 1VZ0A 2FNAA 4OWRB 3CCMI 1Z7LA 2YU3A 3KE2A 3K70C 1IO2A 5GP9A 1U5TB 5DCMA 3FIWA 2CSOA 1T98A 1S8NA 3U9GA 4OMYA 5DAJA 1U2WA 4XKBA 5LRRA 4Y7NJ 5LGUA 2YPRA 1JHHA 4ME9A 2CUZA 1ZR4A 3EQLF 3PIPF 4HZFA 2QKLB 3S1NJ 2DQRA 3F22A 1YW9A 1HOMA 4N4OB 2HDDA 3HOXJ 5FMPA 4P1WA 3HRMA 4G6DA 4NUBA 4MHGA 1H9TA 1X1BA 4KUMA 4KIBA 3WGGA 5IY5H 1PDNC 5JR3A 1A5JA 1K6OA 3F6OA 1OCZH 3M07A 3OWTA 4BXUA 2K27A 1B1BA 2W00A 2Y69H 2DMNA 4ABZA 3FRQA 3ZN0A 1U5TC 4RAZA 3J81Z 4OD4A 3BDDA 4JOMA 5LHHA 3AG4H 1ZYRF 3GWZA 2HDWA 3G6EI 2GXGA 4UNOA 1V5FA 4RGSA 1ZARA 1U9OA 3GTQJ 3CCUI 2VXZA 3CDLA 3DPTA 3LHQA 4I02A 1ACIA 1MBJA 4IHTA 1R4MB 1E3OC 2IAIA 3Q0VA 1MNMC 3CO6C 1WCMJ 3CCQI 2EBIA 3FHZA 1LFPA 3CDIA 3E7LA 4GCKA 1J59A 1AWCA 2LKXA 1GLNA 3E3VA 4IX7A 1NH3A 2STWA 3SFIA 1CQTA 2HOTA 3K8PC 5D5WB 2Z9OA 2GQQA 2EV5A 4IXAA 4A3BJ 2L5QA 2H1LA 3GUDA 3Q0UA 1D5VA 1T0FC 1BW5A 2CW0F 2XPVA 4ENMA 3QQAA 2VI6A 2ZSIB 3WE3A 2W84A 3QPTA 4P9FA 3MKYB 2X0LA 1IW7F 3HTHA 2E1CA 2R7DA 2ZXWH 4XQFA 5M5XJ 3CP8A 5EG0B 4HYEA 4ZDOA 1A31A 2MW8A 2H8RA 3K4KA 1T0FA 2COBA 1OISA 3QU3A 4J00A 2LVSA 4HQMA 2MGQA 1UI6A 4CGRA 4PGGA 3S1MJ 1P6RA 4IJAA 3GLLA 4M6YA 4U88A 2M1BA 4QTRA 4A3KJ 2K85A 1E2XA 2XPUA 4QPOA 5CJ9A 1HKSA 2OV7A 1XSXA 3KFWX 3ERED 2XDNA 2L0KA 5DUKA 2DMTA 2M34A 2GAUA 1BW6A 1UHWA 1SD4A 4GCVA 2OCEA 2Z2SB 4E7JA 1FMVA 2RNJA 1TW3A 1OQYA 1LDDA 2K3PA 1HDDC 1S29A 2LOOA 1IRZA 4IL6C 2X51A 1FX7A 1PP8F 3T1BA 4UXNA 2DYRH 1D8KA 1LUJB 3FXUA 2NP5A 1USTA 3D0SA 3I3LA 5JVTA 2QYOA 3H9JA 5FKNA 1VQKI 5DTDA 1XC5A 3LSHA 4AWXB 1AKHA 1FYLA 4NN1A 3M1EA 3HOYJ 1N77A 1ZH5A 1HDPA 1OPCA 3ZRGA 4HQEA 1SVOA 3IAM2 4LLNA 2RDPA 5FLVA 3TDZC 3FHNA 3REOA 2QWWA 1NK3P 2HPIA 4GFLA 5ICCA 2VJJA 3A1YA 2F5EA 2B0LA 2BHZA 4KISA 3A0BC 1FOKA 1QVUA 2O8XA 4CCNA 2JTVA 2QM3A 2X6OA 4JNNA 2WUIA 2BY1A 2R7WA 2L7KA 5EFYA 2KRCA 4U0WA 5J47A 2ZC2A 4AC6A 4A0XA 3IWFA 2Y30A 2DFIA 2E60A 3CCRI 2V1DA 4FX0A 3HHGA 1QVTA 1FYKA 1J5YA 2M3AA 4PK4A 2JQ7A 1OR7A 3PNYA 4ZDLA 1I3QJ 3DKYA 3KYDB 1JKQC 1ON2A 2EPFA 2LG4A 2VQCA 2CQQA 3CCYA 3LFUA 2ID6A 1RUOA 5GAHJ 2DMUA 3BY6A 5HS9A 2HOEA 3ZMDA 2DMPA 1A6IA 1HKTA 4J19A 3P7NA 1JKPC 1FSHA 4XONA 2VQHA 5M3MJ 1KQ8A 3OOUA 4Y33A 5B5EC 3NI7A 5D5VB 4D5CA 2DXIA 3PASA 2MH9A 2GA1A 4I0BA 3C2GA 1UELB 2OPTA 4QPQA 4B3XA 4OU0A 2FU4A 2DDBA 2B9SA 2L7MP 2K4BA 3JTGA 1GXQA 1WKMA 1W7PB 1Z77A 3E6MA 1NTCA 2DA6A 2IP2A 2HZTA 2UXOA 3O8GA 5F6FA 4FHTA 2EJRA 4RGXA 5CVUA 3OS1A 2W53A 4PJLA 1W5TA 4P9UA 3H35A 2JA6J 1P7JA 1VF9A 4M3FA 2XB0X 3HUGA 2P6TA 3KZYA 3KETA 2YR2A 4G8XA 4XKCA 1STZA 1ETVA 1TTYA 2ZMEB 4IPAA 3TO9A 2OA4A 2A6TA 2VJIA 5K5RA 2M7BA 3ZOBA 2IPQX 3HTIA 1XGOA 2D6YA 3E5QA 1XCBA 4GFKA 3QU6A 3G73A 3TEDA 3ECHA 3P9KA 2XAQA 2FXAA 2EFOA 1EH8A 1YW7A 3CF5F 1QBJA 3VW0A 2Y0SN 2GUHA 3HOZJ 2JUGA 1R22A 3PUBA 3JAMK 1IXCA 2DFFA 1IAWA 4QSHA 3L9FA 1I39A 3V7CA 2V79A 1H9GA 3CLQA 2A68F 2DK8A 4P96A 3E1SA 2ZMEC 1PUFB 5H2FC 1YFHA 3ANPA 3EETA 1KU7A 1M1EB 3LOCA 2XC7A 1JT6A 1RZ4A 5D5XB 3ABKH 1ZKGA 3AFHA 3EUKL 1KONA 5DDGA 2O03A 2F4OB 4AVZA 4RBOA 4CYCA 2GLOA 2O6GE 2DODA 4UVAA 3VYTB 4HA8A 2ELHA 5GTIC 1OLTA 4YG2F 1VQOI 1G3YA 1EF4A 5CW8A 3D5SC 3KYLA 3GTPJ 3PFIA 1WI9A 5KHDA 1MBEA 1XG1A 2KFDA 3GFIA 1U8BA 4UVCA 2G7UA 5C4YA 4EMSA 2HR3A 3FKJA 4IQ4A 5J3LA 1IV6A 4GCLA 1SVLA 3QODA 4XM3A 1OKRA 1B72B 4N9HA 1KU3A 1R1VA 5GTHC 2ZY9A 3AG2H
chains in the Genus database with same CATH topology
1X58A 4JX4A 4C2MJ 5F08A 1LE8A 1QRYA 4UUTA 3IUVA 2K9NA 3VW1A 4D5FA 3ZQGA 3VIBA 3BR6A 2VKVA 3AQTA 5IYBJ 1MBKA 2FX0A 4A3GJ 2R5YA 3CJDA 3BTLA 3RZOJ 2P81A 1MH4A 5IPAA 2M8GX 2ZB9A 1JUPA 5J1YA 3TP3A 4XICA 3BR1A 2DA1A 3VVZA 3TW6A 4NDLA 3LJLA 5H9TA 1R9TJ 2TRTA 3BR3A 4UUSB 2X48A 2QF7A 1BL0A 1ETQA 2FBQA 3G1LA 4M6VA 3HGGA 1APLC 3GTLJ 2LD5A 4FCYA 4IEJA 3UKGA 5D18A 3A02A 2WAQN 4X6AJ 3G7RA 3KNWA 3DCFA 4A93J 2EZHA 2DJNA 3S1QJ 1POGA 3PM1A 5FKKA 3BJBA 3VP5A 4C3IJ 3COLA 2F07A 3M3YJ 2UXUA 2YS9A 2R5ZB 2ZCMA 5EZHA 5E3LA 3HTJA 5AQCA 1LFBA 5JLXA 5HAWA 2B63J 1X2MA 3OIOA 4I76A 1FTTA 1ETYA 4JX6A 5GPCA 3S5RA 3MKLA 1ZR2A 1AU7A 2PBXA 3HOWJ 5HSZA 4AUXA 2QKOA 3CWRA 4BKXA 5EZGA 2ZCNA 2O9LA 2G7SA 3GZIA 5FHPA 4D7NA 1F43A 3HBLA 3K2AA 3HEFA 2HYTA 3VOXA 2XGCA 4XRSG 2NVTJ 1ZQ3P 2JN6A 3HE0A 5J1UA 3NXCA 1FIPA 3PO3J 3BHQA 2DA4A 3OSFA 3B81A 3ZQIA 5E3MA 2FD5A 3NARA 3HM5A 4MK6A 1IC8A 2HI3A 3BTCA 1DU6A 2ELKA 3CRJA 4CYCB 2K9SA 1RESA 3D1NI 1HF0A 1XS9A 4A3LJ 2LK2A 1IDYA 4IHXA 3S2DJ 1JUSA 2R7ZJ 2E2HJ 5GPAA 4IHVA 4M3EA 3KKDA 3V6GA 3FISA 2G3BA 2R0QC 3LSJA 5D19A 2EZIA 2L7ZA 3GTKJ 1TWFJ 3JRCA 1W0UA 2UXPA 3DPJA 1WI3A 5F1JA 4A3EJ 2V57A 1JTYA 1ZK8A 2IEKA 3WHBA 2E2IJ 4W1UA 4XRSA 4YZEA 1LE8B 2QCOA 1IJWC 3HOUJ 3ZQFA 3GEUA 3TW7A 5HODA 2Y2ZA 1IDZA 3KKCA 2R5YB 2QOPA 1Y1VJ 2DA2A 4V2GA 2ZOZA 3QPLA 1IG7A 1U78A 4XRMA 2HKUA 2EZKA 4BY7J 5HBUA 2VKEA 1JT0A 1MSEC 3HB9A 3NPIA 2YVEA 3ON4A 1F36A 2LFBA 2JK3A 2NVYJ 2DG7A 3SDGA 3FK6A 2CRGA 2GBYA 3MN2A 3VVXA 3B6AA 4C3HJ 2ECCA 3BG9A 3T6NA 2R92J 1JKRC 2NVQJ 3LSRA 3S1RJ 2GFNA 4L5EA 2HYJA 1OCPA 5F0FA 2XSDC 1MBFA 1WH7A 3AQSA 5K7FA 3BG5A 1HCRA 3PPBA 1SANA 5IOZA 1DU0A 2AO9A 3JR9A 2REKA 5CXGA 2O7OA 1GV5A 3BTIA 5F0CA 5BNGA 1B8IA 4IHYA 4MLOA 5IYDJ 5M5YJ 2UXIA 3VOKA 1ZTRA 1TWCJ 3IH2A 5EG0A 2WB1N 5K7ZA 4I6ZA 4L62A 2JJ7A 3GBGA 4MFDA 2LR8A 4DZJA 2NX4A 1JUMA 1MSFC 1GVDA 3G1OA 1I6HJ 4JYKA 3CMYA 3S16J 4DZPA 5FLMJ 1RPWA 1UG2A 3JRAA 4X1EA 2EH3A 3O60A 1U9NA 4HKUA 1TC3C 5GP9A 3IH3A 3FIWA 3K7AJ 3QPSA 5DAJA 4Y7NJ 1BA5A 4W97A 1IGNA 4ME9A 1ZR4A 2YUSA 3BG3A 2GENA 4B4CA 2DTZA 4JP0A 2DA5A 3S1NJ 1HOMA 5E3OA 4JL3A 2CUFA 2HDDA 3HOXJ 3BR2A 3RQIA 1ORKA 5FMPA 2GM4A 3HIMA 4AF5A 2K40A 2CU7A 2L9RA 2XGEA 1A5JA 3BR0A 3MVPA 3HGYA 1H8AC 3FRQA 4ABZA 2DMNA 2K9QA 3MNLA 5F04A 3GTMJ 3RH2A 2ME0A 3H3VK 4ACIA 1LFUP 3ZQHA 2W48A 1H89C 1ZGWA 1U9OA 3GTQJ 3EUPA 5K58A 1JKOC 3BTJA 3CDLA 2ECBA 2VUMJ 3LHQA 4V2FA 1MBJA 1VI0A 3JRIA 5EEAA 1E3OC 3Q3SA 2IAIA 3Q0VA 4D7MA 2IBDA 1MNMC 3HTAA 1WCMJ 2EBIA 2JWTA 3E7LA 4GCKA 5M5WJ 2LKXA 1JTXA 2CJJA 5K7HA 4JX5A 3SFIA 3RKQA 1CQTA 3ZQLA 2HOTA 5FKLA 2LY9A 4A3BJ 2E19A 3Q0UA 3S14J 2XGDA 5JLWA 1JJ6C 1BW5A 4GCTA 1OFCX 2XB5A 1Y1WJ 2XPVA 1TWHJ 4KWAA 3QQAA 2M0CA 1GV2A 5C44J 2VI6A 1B8IB 1ETKA 2JA8J 1QPIA 2IU5A 1UHSA 2QTQA 4NELA 3BQZA 5J1RA 3HTHA 2HXIA 1O4XA 1K83J 5M5XJ 5EG0B 1I50J 2MW8A 1GDTA 3A01A 2H8RA 4Y52J 3KZ9A 1WH5A 2COBA 1FEXA 1ETOA 2LVSA 5FGLA 2DMQA 2MGQA 1UI6A 4CGRA 1FJLA 2JA7J 3S1MJ 5EGOA 4HNVA 2NS7A 4QTRA 2YVHA 4A3KJ 2O8KA 1S7EA 1RKWA 1RKTA 5C4XJ 2XPUA 4PXIA 4FISA 5FKOA 3BR5A 2ID3A 3EGQA 3BT9A 2XDNA 4M3GA 2L0KA 2DMTA 2M34A 1BW6A 2O7TA 2UXHA 3OSGA 2L7FP 1P7IA 5EYRA 1G2HA 3W6VA 3JRDA 9ANTA 4A3CJ 3QKXA 3JREA 3ON2A 1HDDC 2PZ9A 2Q24A 2DA3A 2X9DA 1OJLA 4A3MJ 1IRZA 3DEWA 2E1OA 2OERA 3E7QA 4GFBA 2NP5A 5E3NA 4MFEA 2DA7A 4DYQA 2RASA 5FKNA 2R93J 3VW2A 4BY1J 3FKIJ 5DTDA 2ZCXA 3G1MA 1XC5A 4DYRA 1AKHA 2DG8A 2OF7A 3GTJJ 4NN1A 3HOYJ 4A3FJ 3Q0WA 1SGMA 2ME6A 1BJZA 1ETWA 1YRNA 4A3IJ 1HDPA 3HOVJ 2XPWA 3IV5A 3HKZN 4DYCA 5FLVA 1IUFA 4MIMA 5DS9A 4IHWA 1NK3P 4GFLA 1X2NA 3NRGA 2HOSA 1K61A 3LSPA 1RETA 2D5VA 1QVUA 2G7GA 2MG4A 3LSGA 1UMQA 2X6OA 4QIWN 4JNNA 2WUIA 5FJ8J 3RD3A 3A03A 5EFYA 1GUUA 3SJMA 3TP0A 4AC6A 5D1RA 2TCTA 2Y30A 4B1RA 1TWAJ 1PUFA 4BBSJ 5M3FJ 1ITYA 4BBRJ 4JKZA 4MO7A 1QVTA 5EDNA 1VNDA 3O8HA 2KDZA 2VPRA 4G12A 1I3QJ 1NK2P 1JKQC 2I10A 3I4NJ 5IP9J 2KT0A 4XIDA 2CQQA 2WV1A 3CCYA 4C3JJ 1MBHA 2ID6A 2LP0A 2LTPA 4AC0A 3BQYA 3WHCA 5F27A 5IP6A 4UDSA 2Y9ZA 1TWGJ 2DMUA 3JRBA 2M2EA 3A01B 2DMPA 1A6IA 4FE4A 4J19A 1JKPC 4AYBN 3F0CA 5IOYA 4XK4A 3JRFA 3H0GJ 1B72A 2FQ4A 5EGOB 3S2HJ 2ZOYA 5M3MJ 4ICHA 3OOUA 4A69C 3NI7A 4D5CA 3JRGA 3CQZJ 3PASA 2EQRA 2DN0A 2G7LA 2OPTA 3BCGA 3ANGA 1ENHA 1D5YA 2RHAA 2L7MP 2H1KA 4FTHA 3M4OJ 1WGXA 1Z77A 3F1BA 5F0HA 1NTCA 2DA6A 2UXOA 3IH4A 1FIAA 5C3EJ 4UUSA 1WPKA 4B3AA 3O8GA 2NOGA 4M3DA 3P9TA 4MXMA 3BRUA 1H88C 2W53A 4A3DJ 2M9HA 1UI5A 2JA6J 3BNIA 1P7JA 1T56A 3G56A 1VF9A 2QWTA 4M3FA 2XB0X 4A3JJ 3GTGJ 2CQXA 2G0EA 2MSYA 3NNRA 3JSJA 5EF6A 3V78A 1T33A 3JRHA 1ETVA 1AKHB 3HDDA 1SFOJ 3B6CA 2R5ZA 1Z0XA 5CXIA 3PO2J 3ZOBA 3HTIA 1YRNB 3S15J 2YU9J 2WGBA 2XRLA 1AHDP 2D6YA 2Y31A 2QIBA 4GFKA 3TEDA 2AHQA 2RAEA 3LNQA 3FK7A 2FJ1A 2E2JJ 3VW0A 2Y0SN 2GUHA 3HOZJ 1MBGA 3VUQA 4S0HB 4QSHA 1GT0C 2OI8A 2EZLA 3S17J 2NP3A 2CUEA 3GTOJ 1VFCA 2PMZN 1PUFB 3ANPA 2LLKA 1JJ8C 3LOCA 1JT6A 1MH3A 1ZKGA 2HQ5A 5IP7J 1ETXA 3RZDJ 1W0TA 4RDUA 3I4MJ 4RBOA 4CYCA 2GLOA 4BXXJ 3QBMA 1EF4A 1FTZA 5CW8A 1Q1VA 2NVXJ 3GTPJ 2HOAA 1MBEA 3C07A 1XG1A 4DW6A 2JA5J 2JMWA 4EEFG 5FKMA 1JGGA 1U8BA 1OCTC 2NS8A 3NAUA 3VPRA 2N8GA 3ZQCA 3VVYA 5C4YA 3L1PA 5J3LA 4GCLA 3LWJA 1IV6A 2Y9YA 5C4JJ 1HLVA 5IYCJ 4FE7A 4LOCA 1RR7A 1B72B 4M3BA 2HXOA 3C2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X58 A;  4JX4 A;  4C2M J;  5F08 A;  1LE8 A;  1QRY A;  4UUT A;  3IUV A;  2K9N A;  3VW1 A;  4D5F A;  3ZQG A;  3VIB A;  3BR6 A;  2VKV A;  3AQT A;  5IYB J;  1MBK A;  2FX0 A;  4A3G J;  2R5Y A;  3CJD A;  3BTL A;  3RZO J;  2P81 A;  1MH4 A;  5IPA A;  2M8G X;  2ZB9 A;  1JUP A;  5J1Y A;  3TP3 A;  4XIC A;  3BR1 A;  2DA1 A;  3VVZ A;  3TW6 A;  4NDL A;  3LJL A;  5H9T A;  1R9T J;  2TRT A;  3BR3 A;  4UUS B;  2X48 A;  2QF7 A;  1BL0 A;  1ETQ A;  2FBQ A;  3G1L A;  4M6V A;  3HGG A;  1APL C;  3GTL J;  2LD5 A;  4FCY A;  4IEJ A;  3UKG A;  5D18 A;  3A02 A;  2WAQ N;  4X6A J;  3G7R A;  3KNW A;  3DCF A;  4A93 J;  2EZH A;  2DJN A;  3S1Q J;  1POG A;  3PM1 A;  5FKK A;  3BJB A;  3VP5 A;  4C3I J;  3COL A;  2F07 A;  3M3Y J;  2UXU A;  2YS9 A;  2R5Z B;  2ZCM A;  5EZH A;  5E3L A;  3HTJ A;  5AQC A;  1LFB A;  5JLX A;  5HAW A;  2B63 J;  1X2M A;  3OIO A;  4I76 A;  1FTT A;  1ETY A;  4JX6 A;  5GPC A;  3S5R A;  3MKL A;  1ZR2 A;  1AU7 A;  2PBX A;  3HOW J;  5HSZ A;  4AUX A;  2QKO A;  3CWR A;  4BKX A;  5EZG A;  2ZCN A;  2O9L A;  2G7S A;  3GZI A;  5FHP A;  4D7N A;  1F43 A;  3HBL A;  3K2A A;  3HEF A;  2HYT A;  3VOX A;  2XGC A;  4XRS G;  2NVT J;  1ZQ3 P;  2JN6 A;  3HE0 A;  5J1U A;  3NXC A;  1FIP A;  3PO3 J;  3BHQ A;  2DA4 A;  3OSF A;  3B81 A;  3ZQI A;  5E3M A;  2FD5 A;  3NAR A;  3HM5 A;  4MK6 A;  1IC8 A;  2HI3 A;  3BTC A;  1DU6 A;  2ELK A;  3CRJ A;  4CYC B;  2K9S A;  1RES A;  3D1N I;  1HF0 A;  1XS9 A;  4A3L J;  2LK2 A;  1IDY A;  4IHX A;  3S2D J;  1JUS A;  2R7Z J;  2E2H J;  5GPA A;  4IHV A;  4M3E A;  3KKD A;  3V6G A;  3FIS A;  2G3B A;  2R0Q C;  3LSJ A;  5D19 A;  2EZI A;  2L7Z A;  3GTK J;  1TWF J;  3JRC A;  1W0U A;  2UXP A;  3DPJ A;  1WI3 A;  5F1J A;  4A3E J;  2V57 A;  1JTY A;  1ZK8 A;  2IEK A;  3WHB A;  2E2I J;  4W1U A;  4XRS A;  4YZE A;  1LE8 B;  2QCO A;  1IJW C;  3HOU J;  3ZQF A;  3GEU A;  3TW7 A;  5HOD A;  2Y2Z A;  1IDZ A;  3KKC A;  2R5Y B;  2QOP A;  1Y1V J;  2DA2 A;  4V2G A;  2ZOZ A;  3QPL A;  1IG7 A;  1U78 A;  4XRM A;  2HKU A;  2EZK A;  4BY7 J;  5HBU A;  2VKE A;  1JT0 A;  1MSE C;  3HB9 A;  3NPI A;  2YVE A;  3ON4 A;  1F36 A;  2LFB A;  2JK3 A;  2NVY J;  2DG7 A;  3SDG A;  3FK6 A;  2CRG A;  2GBY A;  3MN2 A;  3VVX A;  3B6A A;  4C3H J;  2ECC A;  3BG9 A;  3T6N A;  2R92 J;  1JKR C;  2NVQ J;  3LSR A;  3S1R J;  2GFN A;  4L5E A;  2HYJ A;  1OCP A;  5F0F A;  2XSD C;  1MBF A;  1WH7 A;  3AQS A;  5K7F A;  3BG5 A;  1HCR A;  3PPB A;  1SAN A;  5IOZ A;  1DU0 A;  2AO9 A;  3JR9 A;  2REK A;  5CXG A;  2O7O A;  1GV5 A;  3BTI A;  5F0C A;  5BNG A;  1B8I A;  4IHY A;  4MLO A;  5IYD J;  5M5Y J;  2UXI A;  3VOK A;  1ZTR A;  1TWC J;  3IH2 A;  5EG0 A;  2WB1 N;  5K7Z A;  4I6Z A;  4L62 A;  2JJ7 A;  3GBG A;  4MFD A;  2LR8 A;  4DZJ A;  2NX4 A;  1JUM A;  1MSF C;  1GVD A;  3G1O A;  1I6H J;  4JYK A;  3CMY A;  3S16 J;  4DZP A;  5FLM J;  1RPW A;  1UG2 A;  3JRA A;  4X1E A;  2EH3 A;  3O60 A;  1U9N A;  4HKU A;  1TC3 C;  5GP9 A;  3IH3 A;  3FIW A;  3K7A J;  3QPS A;  5DAJ A;  4Y7N J;  1BA5 A;  4W97 A;  1IGN A;  4ME9 A;  1ZR4 A;  2YUS A;  3BG3 A;  2GEN A;  4B4C A;  2DTZ A;  4JP0 A;  2DA5 A;  3S1N J;  1HOM A;  5E3O A;  4JL3 A;  2CUF A;  2HDD A;  3HOX J;  3BR2 A;  3RQI A;  1ORK A;  5FMP A;  2GM4 A;  3HIM A;  4AF5 A;  2K40 A;  2CU7 A;  2L9R A;  2XGE A;  1A5J A;  3BR0 A;  3MVP A;  3HGY A;  1H8A C;  3FRQ A;  4ABZ A;  2DMN A;  2K9Q A;  3MNL A;  5F04 A;  3GTM J;  3RH2 A;  2ME0 A;  3H3V K;  4ACI A;  1LFU P;  3ZQH A;  2W48 A;  1H89 C;  1ZGW A;  1U9O A;  3GTQ J;  3EUP A;  5K58 A;  1JKO C;  3BTJ A;  3CDL A;  2ECB A;  2VUM J;  3LHQ A;  4V2F A;  1MBJ A;  1VI0 A;  3JRI A;  5EEA A;  1E3O C;  3Q3S A;  2IAI A;  3Q0V A;  4D7M A;  2IBD A;  1MNM C;  3HTA A;  1WCM J;  2EBI A;  2JWT A;  3E7L A;  4GCK A;  5M5W J;  2LKX A;  1JTX A;  2CJJ A;  5K7H A;  4JX5 A;  3SFI A;  3RKQ A;  1CQT A;  3ZQL A;  2HOT A;  5FKL A;  2LY9 A;  4A3B J;  2E19 A;  3Q0U A;  3S14 J;  2XGD A;  5JLW A;  1JJ6 C;  1BW5 A;  4GCT A;  1OFC X;  2XB5 A;  1Y1W J;  2XPV A;  1TWH J;  4KWA A;  3QQA A;  2M0C A;  1GV2 A;  5C44 J;  2VI6 A;  1B8I B;  1ETK A;  2JA8 J;  1QPI A;  2IU5 A;  1UHS A;  2QTQ A;  4NEL A;  3BQZ A;  5J1R A;  3HTH A;  2HXI A;  1O4X A;  1K83 J;  5M5X J;  5EG0 B;  1I50 J;  2MW8 A;  1GDT A;  3A01 A;  2H8R A;  4Y52 J;  3KZ9 A;  1WH5 A;  2COB A;  1FEX A;  1ETO A;  2LVS A;  5FGL A;  2DMQ A;  2MGQ A;  1UI6 A;  4CGR A;  1FJL A;  2JA7 J;  3S1M J;  5EGO A;  4HNV A;  2NS7 A;  4QTR A;  2YVH A;  4A3K J;  2O8K A;  1S7E A;  1RKW A;  1RKT A;  5C4X J;  2XPU A;  4PXI A;  4FIS A;  5FKO A;  3BR5 A;  2ID3 A;  3EGQ A;  3BT9 A;  2XDN A;  4M3G A;  2L0K A;  2DMT A;  2M34 A;  1BW6 A;  2O7T A;  2UXH A;  3OSG A;  2L7F P;  1P7I A;  5EYR A;  1G2H A;  3W6V A;  3JRD A;  9ANT A;  4A3C J;  3QKX A;  3JRE A;  3ON2 A;  1HDD C;  2PZ9 A;  2Q24 A;  2DA3 A;  2X9D A;  1OJL A;  4A3M J;  1IRZ A;  3DEW A;  2E1O A;  2OER A;  3E7Q A;  4GFB A;  2NP5 A;  5E3N A;  4MFE A;  2DA7 A;  4DYQ A;  2RAS A;  5FKN A;  2R93 J;  3VW2 A;  4BY1 J;  3FKI J;  5DTD A;  2ZCX A;  3G1M A;  1XC5 A;  4DYR A;  1AKH A;  2DG8 A;  2OF7 A;  3GTJ J;  4NN1 A;  3HOY J;  4A3F J;  3Q0W A;  1SGM A;  2ME6 A;  1BJZ A;  1ETW A;  1YRN A;  4A3I J;  1HDP A;  3HOV J;  2XPW A;  3IV5 A;  3HKZ N;  4DYC A;  5FLV A;  1IUF A;  4MIM A;  5DS9 A;  4IHW A;  1NK3 P;  4GFL A;  1X2N A;  3NRG A;  2HOS A;  1K61 A;  3LSP A;  1RET A;  2D5V A;  1QVU A;  2G7G A;  2MG4 A;  3LSG A;  1UMQ A;  2X6O A;  4QIW N;  4JNN A;  2WUI A;  5FJ8 J;  3RD3 A;  3A03 A;  5EFY A;  1GUU A;  3SJM A;  3TP0 A;  4AC6 A;  5D1R A;  2TCT A;  2Y30 A;  4B1R A;  1TWA J;  1PUF A;  4BBS J;  5M3F J;  1ITY A;  4BBR J;  4JKZ A;  4MO7 A;  1QVT A;  5EDN A;  1VND A;  3O8H A;  2KDZ A;  2VPR A;  4G12 A;  1I3Q J;  1NK2 P;  1JKQ C;  2I10 A;  3I4N J;  5IP9 J;  2KT0 A;  4XID A;  2CQQ A;  2WV1 A;  3CCY A;  4C3J J;  1MBH A;  2ID6 A;  2LP0 A;  2LTP A;  4AC0 A;  3BQY A;  3WHC A;  5F27 A;  5IP6 A;  4UDS A;  2Y9Z A;  1TWG J;  2DMU A;  3JRB A;  2M2E A;  3A01 B;  2DMP A;  1A6I A;  4FE4 A;  4J19 A;  1JKP C;  4AYB N;  3F0C A;  5IOY A;  4XK4 A;  3JRF A;  3H0G J;  1B72 A;  2FQ4 A;  5EGO B;  3S2H J;  2ZOY A;  5M3M J;  4ICH A;  3OOU A;  4A69 C;  3NI7 A;  4D5C A;  3JRG A;  3CQZ J;  3PAS A;  2EQR A;  2DN0 A;  2G7L A;  2OPT A;  3BCG A;  3ANG A;  1ENH A;  1D5Y A;  2RHA A;  2L7M P;  2H1K A;  4FTH A;  3M4O J;  1WGX A;  1Z77 A;  3F1B A;  5F0H A;  1NTC A;  2DA6 A;  2UXO A;  3IH4 A;  1FIA A;  5C3E J;  4UUS A;  1WPK A;  4B3A A;  3O8G A;  2NOG A;  4M3D A;  3P9T A;  4MXM A;  3BRU A;  1H88 C;  2W53 A;  4A3D J;  2M9H A;  1UI5 A;  2JA6 J;  3BNI A;  1P7J A;  1T56 A;  3G56 A;  1VF9 A;  2QWT A;  4M3F A;  2XB0 X;  4A3J J;  3GTG J;  2CQX A;  2G0E A;  2MSY A;  3NNR A;  3JSJ A;  5EF6 A;  3V78 A;  1T33 A;  3JRH A;  1ETV A;  1AKH B;  3HDD A;  1SFO J;  3B6C A;  2R5Z A;  1Z0X A;  5CXI A;  3PO2 J;  3ZOB A;  3HTI A;  1YRN B;  3S15 J;  2YU9 J;  2WGB A;  2XRL A;  1AHD P;  2D6Y A;  2Y31 A;  2QIB A;  4GFK A;  3TED A;  2AHQ A;  2RAE A;  3LNQ A;  3FK7 A;  2FJ1 A;  2E2J J;  3VW0 A;  2Y0S N;  2GUH A;  3HOZ J;  1MBG A;  3VUQ A;  4S0H B;  4QSH A;  1GT0 C;  2OI8 A;  2EZL A;  3S17 J;  2NP3 A;  2CUE A;  3GTO J;  1VFC A;  2PMZ N;  1PUF B;  3ANP A;  2LLK A;  1JJ8 C;  3LOC A;  1JT6 A;  1MH3 A;  1ZKG A;  2HQ5 A;  5IP7 J;  1ETX A;  3RZD J;  1W0T A;  4RDU A;  3I4M J;  4RBO A;  4CYC A;  2GLO A;  4BXX J;  3QBM A;  1EF4 A;  1FTZ A;  5CW8 A;  1Q1V A;  2NVX J;  3GTP J;  2HOA A;  1MBE A;  3C07 A;  1XG1 A;  4DW6 A;  2JA5 J;  2JMW A;  4EEF G;  5FKM A;  1JGG A;  1U8B A;  1OCT C;  2NS8 A;  3NAU A;  3VPR A;  2N8G A;  3ZQC A;  3VVY A;  5C4Y A;  3L1P A;  5J3L A;  4GCL A;  3LWJ A;  1IV6 A;  2Y9Y A;  5C4J J;  1HLV A;  5IYC J;  4FE7 A;  4LOC A;  1RR7 A;  1B72 B;  4M3B A;  2HXO A;  3C2B A; 
#chains in the Genus database with same CATH topology
 4Y4R A;  4C2M J;  3OIP A;  3JTH A;  4LG0 B;  2VPL A;  4UUT A;  3IUV A;  4KJZ A;  3VIB A;  3BR6 A;  4KIT B;  5IYB J;  2R5Y A;  2Z3Y A;  4XLP F;  3GFJ A;  2M8G X;  5J1Y A;  2WA0 A;  3WGH A;  4YEL A;  1BR2 A;  1R4N B;  3BR1 A;  3DF8 A;  2Y75 A;  2HKX A;  5HNF A;  1X1C A;  5H9T A;  3BR3 A;  4GRI A;  4Q5S F;  1OCR H;  4R8H A;  4UUS B;  2QF7 A;  1ETQ A;  3LSM A;  4BDY A;  2JZY A;  3K70 D;  3J81 K;  4XLN F;  2QA4 I;  1BOB A;  3GTL J;  3ZMV A;  1ULY A;  3MFK A;  1V55 H;  1WFX A;  4IEJ A;  3NQO A;  5D18 A;  2H09 A;  3KEY A;  4I01 A;  1ZG5 A;  1Q1H A;  3G7R A;  2F5C A;  2F2E A;  2GZW A;  2M4G A;  3BLY A;  2CS3 A;  4G7Z F;  1TT5 B;  3PM1 A;  5FKK A;  1HC8 A;  4WK8 F;  2F07 A;  3W6J B;  4ZYE A;  4X0G A;  2KIM A;  3HRS A;  2VJ5 A;  2VBY A;  4CCM A;  4IRG A;  1ETY A;  4JX6 A;  1ERD A;  4B09 A;  1XGM A;  2G9W A;  1AU7 A;  4LG0 A;  1ON1 A;  1H0M A;  4AYB A;  4CGZ A;  3CDH A;  4AUX A;  3S3N A;  3W6K B;  3MWM A;  2ZCN A;  4D7N A;  2WC2 A;  2ZXH A;  4CSW A;  5LLQ A;  1YJW I;  3QP6 A;  1VQM I;  2WBM A;  2W85 A;  1R1U A;  2HYT A;  2XGC A;  4XRS G;  1MMA A;  2JN6 A;  2E71 A;  1S6L A;  2FBH A;  5ERI A;  1ZG3 A;  5CQE A;  2Q2E B;  2M4K A;  2ELK A;  4IRI A;  1RES A;  1J2X A;  2P7V B;  3BWG A;  4IHX A;  5GPA A;  4YRV A;  3RKX A;  3LST A;  1KQ0 A;  2EFQ A;  3V6G A;  1IV8 A;  3MKW B;  3COA C;  3FM5 A;  2R0Q C;  4KN4 X;  2EZI A;  2XUB A;  3GTK J;  2IA2 A;  4XOP A;  3LQQ A;  3DPJ A;  1O7L A;  2GA2 A;  5F1J A;  4HF2 A;  3KP3 A;  4B44 A;  3KEQ A;  2RGV A;  3DKW A;  3WHB A;  2E2I J;  3EUH A;  3KP6 A;  4KIC A;  4YZE A;  4M9X A;  4E7Z A;  3PL8 A;  2BW3 B;  2BV6 A;  3S3O A;  3GEU A;  3RDI A;  5HOD A;  2Y2Z A;  1ZLJ A;  3PJR A;  2LC2 A;  2OC6 A;  2VKD A;  3VEP A;  3RI4 A;  2C6Y A;  4V2G A;  1XDS A;  3QPL A;  3L2W A;  1BI3 A;  4CCO A;  2EZK A;  4GYI A;  4JK1 X;  3LL7 A;  4G7H F;  3EPZ A;  2VKE A;  1MSE C;  2ACJ A;  4L9V A;  1YE9 A;  3HB9 A;  2DOE A;  2XDV A;  3NPI A;  1F36 A;  2DG7 A;  2JK3 A;  4O5V A;  1U3E M;  5DD4 A;  4TV7 A;  3BJA A;  1FY7 A;  4Z6Y A;  4I7H A;  5L3F A;  2P7C B;  1A6Q A;  2FE3 A;  4L5E A;  3V8K A;  1OCP A;  4KIG A;  4HF1 A;  1WVR A;  5HS8 A;  1DU0 A;  2AO9 A;  3IHU A;  3JR9 A;  1V4R A;  1DP7 P;  2REK A;  1GV5 A;  3OYC A;  2K4J A;  5F0C A;  5BNG A;  4EQQ A;  1Y39 A;  2WTE A;  4LG3 A;  2VKH A;  4BGD A;  3H9Q A;  5HNH A;  4IHS A;  1G6N A;  3E97 A;  3JSO A;  3LWF A;  4HDU A;  2BZT A;  2KLO A;  4N0B A;  5K7Z A;  1SAX A;  2A05 A;  1XSV A;  3GBG A;  1Y0N A;  2NX4 A;  1MSF C;  1GVD A;  5J6X A;  3K1M A;  3F23 A;  2O61 A;  1LNW A;  1RPW A;  2HU9 A;  1UG2 A;  4LIV A;  4RAY A;  3CD6 I;  5DD8 A;  2KJC A;  5L3D A;  4CZZ A;  1FYM A;  3KCC A;  5LHI A;  2MLG A;  3IH3 A;  1T2K A;  3QYF A;  4IRV A;  2MAB A;  1W5S A;  1DQU A;  1LEA A;  2DJI A;  2PI0 A;  2QBY A;  1QNT A;  2YUS A;  4MGR A;  2GEN A;  3F8M A;  2DTZ A;  4JP0 A;  2WAQ A;  3A2K A;  2M87 A;  5E3O A;  3SDB A;  2CUF A;  3BR2 A;  1ORK A;  2NNY A;  2GM4 A;  1IN4 A;  2QQA A;  1B9M A;  2RNG A;  2K40 A;  2CU7 A;  3GCM A;  1K78 B;  5LRS A;  1XGS A;  5EEG A;  4KT6 A;  3MZH A;  2X4H A;  4NC6 A;  5DYM A;  4B48 A;  3MNL A;  1Z7U A;  3I9V 2;  2HQR A;  3GZN B;  1VQL I;  3VYU B;  4OIO F;  1ODD A;  4BUP A;  3ZQH A;  4CUG A;  3WG9 A;  4WIB A;  3DP7 A;  3VSK A;  1SFU A;  2HVR A;  4DIQ A;  3CJN A;  1PVE A;  2ECB A;  2P8T A;  4OIN F;  2EIK H;  3IP4 B;  1UHM A;  5E1X A;  3TL4 X;  4Q4Z F;  5IT9 Z;  3SEZ A;  4V2F A;  3TO7 A;  1F1Z A;  1VI0 A;  5J4Y A;  3JRI A;  5DM7 F;  2LY2 A;  2RQP A;  2IBD A;  1MDM B;  2ZCW A;  5A2Q Z;  4XN3 A;  1IZ1 A;  1JTX A;  4FT8 A;  3HC7 A;  4PSX A;  4F3Q A;  2CJJ A;  5K7H A;  1FP2 A;  4XLA A;  1O3R A;  2F5D A;  4J01 A;  2JT1 A;  2IGN A;  2GOX B;  3BG6 A;  2E19 A;  5GAE J;  4S04 A;  3S14 J;  5JLW A;  3W2W A;  1Y8R B;  4WF2 A;  2F48 A;  1TWH J;  3OMY A;  4KWA A;  4P5O A;  5E18 F;  3M8F A;  1ETK A;  2FSW A;  2E5Z A;  4FET A;  2JA8 J;  3M8E A;  1CGP A;  5LHG A;  3BQZ A;  1KGS A;  1QZE A;  1K83 J;  3ZP5 A;  2R7O A;  1B6A A;  4AVP A;  3BZ6 A;  1RRJ A;  1ETO A;  3MKZ A;  5FGL A;  4G6Q A;  2J5P A;  3KZI C;  3I4P A;  1FJL A;  5EGO A;  2NS7 A;  1NG7 A;  4GDF A;  4WWC A;  3N97 A;  2UWM A;  4PFP A;  4CH7 A;  5FKO A;  1BIB A;  2XAG A;  3EGQ A;  1A35 A;  2OZ6 A;  2BY2 A;  5DCM B;  3RTR A;  2R7U A;  2K7L A;  4MEY F;  4XLF A;  4YFK F;  2L7F P;  1G2H A;  3QPH A;  4XBF A;  1X3Z B;  9ANT A;  4A3C J;  3DLA A;  3AKZ A;  3BPV A;  3U1D A;  2DA3 A;  2X9D A;  1XX5 A;  2MD5 A;  3DEW A;  3WU1 B;  2DOA A;  1Y6I A;  2E1O A;  4XR6 A;  2OER A;  4G94 A;  3WTT C;  4GFB A;  1UJ8 A;  1IN5 A;  5GAG J;  4C2T A;  4DYQ A;  1RI7 A;  4M71 A;  2VC0 A;  3FM3 A;  2R93 J;  1RR8 C;  3FKI J;  1D8J A;  1F9N A;  3KP7 A;  1K7A A;  2K5C A;  2ZCX A;  2OF7 A;  3LA2 A;  4XLE A;  2DO7 A;  4A3F J;  4II2 A;  3Q0W A;  4KFC A;  1SGM A;  1ETW A;  1YRN A;  3H0D A;  2V6C A;  2XPW A;  4OAY A;  4RLQ A;  1YS7 A;  1UZC A;  4IHW A;  2CO5 A;  1L3L A;  4KIF A;  1IN7 A;  3WU2 C;  4CZC A;  1CF7 A;  1X2N A;  3NRG A;  2XKO A;  4ON0 A;  2HOS A;  3UNG C;  1K79 A;  1YJN I;  2VIX A;  2IT0 A;  1LQ1 A;  4KT5 C;  3LSG A;  4IOA F;  4LGW A;  1JGS A;  3EDP A;  1DPR A;  2KRF A;  1L0O C;  4HSR A;  4C9Y A;  5LGT A;  5FJ8 J;  4MTD A;  1IRX A;  3SJM A;  2H6B A;  1XGN A;  3V7R A;  5D1R A;  5E17 F;  2OBP A;  2ZO4 A;  5M3F J;  1ITY A;  2JSP A;  2DBB A;  4U0Y A;  2MH2 A;  3M8J A;  2MD0 A;  4MO7 A;  3C7J A;  5EDN A;  2VPR A;  3FZV A;  4XSX F;  4DBQ A;  2Q0O A;  4BYY A;  3G4S I;  2I10 A;  4HG2 A;  1XB4 A;  2KT0 A;  4G7O F;  2VQL A;  2WV1 A;  1J0R A;  1MBH A;  3RKW A;  5IP6 A;  5F27 A;  2JPB A;  4HX7 A;  3VYR B;  2ELJ A;  2JPC A;  1I1G A;  2XVC A;  2OCC H;  3SZG A;  4AYB N;  3F0C A;  2XSJ C;  3S2H J;  3VYS B;  2NOJ B;  4A69 C;  3OYN A;  3JRG A;  4G6T B;  3CQZ J;  3CO7 C;  2EQR A;  2DQL A;  5DEQ A;  2CMP A;  3OYG A;  4BNC A;  1G4D A;  5ED4 A;  2LBF A;  1X1D A;  4UY8 I;  3I53 A;  3BCG A;  4ESJ A;  2RHA A;  3I55 I;  3E6B A;  4FTH A;  1S3J A;  5F0H A;  1RC9 A;  3R0A A;  4ITV A;  3U2R A;  2XV4 S;  1FIA A;  1UCR A;  1TBX A;  2QQ9 A;  4M3D A;  3P9T A;  2CFO A;  1KA8 A;  2PFB A;  5CVR A;  2R7S A;  4A3D J;  2M9H A;  3DKX A;  2CG4 A;  3KZZ A;  2QWT A;  5L3E A;  4E7H A;  1PJR A;  2XAJ A;  2IS4 A;  2MSY A;  2W25 A;  2AS5 F;  4BEH A;  1UFM A;  3JSJ A;  2ZFW A;  3E0J B;  2NYX A;  3V42 A;  2KZV A;  4EJW A;  3E6D A;  1AKH B;  3RPU D;  3HDD A;  4L9T A;  3PIO F;  2R5Z A;  3HSR A;  4O6J A;  2EB7 A;  5CXI A;  4B43 A;  2YU9 J;  1AHD P;  1SMT A;  1ZN2 A;  4XLC A;  2QGU A;  2Y31 A;  2QIB A;  2A6E F;  1WJF A;  4HV6 A;  4HLY A;  4EAT A;  4NNJ A;  3KLO A;  2MBF A;  2RAE A;  3MD2 A;  3LNQ A;  2PLY A;  3FK7 A;  2FJ1 A;  1HSJ A;  2Y48 A;  3K10 A;  3ZMU A;  3KP4 A;  4I99 C;  4DJA A;  2FBK A;  4R79 A;  3VUQ A;  2FUG 2;  4F7Z A;  2OI8 A;  2KRH A;  2EZL A;  1SC7 A;  2CUE A;  3GFL A;  3K6G A;  3DWL E;  1YHQ I;  4HX8 A;  1QZZ A;  3F21 A;  3I59 A;  2XHK A;  3HTU A;  3OR2 C;  3RZD J;  1S7O A;  3F8F A;  1LPQ A;  3CCJ I;  2IS6 A;  1FTZ A;  1Q1V A;  2IJL A;  2BBY A;  2HOA A;  4ANJ A;  3C07 A;  3I56 I;  1FMW A;  2JA5 J;  2NS8 A;  4HRI A;  2OQR A;  5HLT A;  3VVY A;  3L09 A;  1A04 A;  3L1P A;  3D5L A;  3LWJ A;  1TQM A;  2Y9Y A;  5C4J J;  5HDG A;  5FFX A;  3ABU A;  1XN7 A;  1ZGA A;  3Q9V A;  4FE7 A;  3WE2 A;  3WTV C;  2FNP A;  1RR7 A;  2VXD A;  3NS4 A;  2OQG A;  3C2B A;  1XMX A;  2WAD A;  1X58 A;  3WU0 A;  3HKZ A;  5F08 A;  1LE8 A;  5DUI A;  1OR7 C;  5L3G A;  1D3Y A;  2LDU A;  3ZQG A;  2VKV A;  3QWL A;  2YSR A;  5K5O A;  3T5X A;  3VTI A;  1LDK B;  3IWZ A;  5D5U B;  4ZDP A;  2LF8 A;  4XIC A;  2PJR A;  1R23 A;  2IRF G;  1PYV A;  4L0Y B;  2K86 A;  2F6C A;  1R58 A;  2FBQ A;  1VQP I;  3G1L A;  1BR1 A;  3HGG A;  4XSZ F;  1T8I A;  4KYW A;  2GWR A;  4FCY A;  3UKG A;  5BPD A;  2WAQ N;  4II3 A;  1Z21 A;  3ROU A;  2HVQ A;  2CH0 A;  3HUG B;  3L2Q A;  2QEX I;  1IUY A;  1POG A;  3CUQ A;  5IT9 K;  2WWY A;  4PFO A;  2HKO A;  3HZJ A;  2A2F X;  5E3L A;  2Z33 A;  2ZXI A;  4A6E A;  5JLX A;  1BI1 A;  2KIU A;  5HAW A;  2KIF A;  2XAF A;  2B63 J;  1TQI A;  3V8J A;  2EIN H;  2PMH A;  2F5V A;  2VLA A;  5A2Q K;  3MKL A;  1N25 A;  3PUF A;  3HOW J;  3GX4 X;  1Z67 A;  3LFK A;  5EZG A;  3OYD A;  2O9L A;  2G7S A;  2DI3 A;  5FHP A;  3LSK A;  1RIO H;  4EGY A;  1SD7 A;  1XDU A;  3HEF A;  1ZQ3 P;  1VQ7 I;  4HPQ A;  1MKM A;  3NXC A;  1FIP A;  2DT5 A;  3BHQ A;  2DA4 A;  2MLK A;  2HEO A;  2D1H A;  3OSF A;  3B81 A;  1EJ9 A;  2RVC A;  1DU6 A;  3BTC A;  4CYC B;  3D1N I;  1HF0 A;  3ZPL A;  2A69 F;  1XS9 A;  2X1E A;  4GYG A;  4A3L J;  2LK2 A;  4A6D A;  4G9Y A;  1VQ4 I;  1OCO H;  4RS8 A;  4OD5 A;  2R7Z J;  2E2H J;  3FXQ A;  4LK0 F;  1X3U A;  2IS1 A;  3KKD A;  3D5R C;  1ZRE A;  2G3B A;  3LSJ A;  3TMO A;  1LVK A;  4BL0 B;  4L5I A;  2Q8K A;  3SQN A;  3QOE A;  2R7X A;  1Y8Q B;  2DT7 B;  2QCO A;  3IRR A;  3ZCO A;  2UXN A;  3TW7 A;  4MQ9 F;  2R5Y B;  3ESW B;  3F6V A;  4F91 B;  4PJ0 C;  3M9A A;  4C30 A;  2GXB A;  4E70 A;  2DA2 A;  4IZZ A;  2QVO A;  4DQ2 A;  1U78 A;  4XRM A;  3HHH A;  3CLO A;  4RAG A;  4U7B A;  2P5L C;  2H27 A;  2XF5 A;  3OYH A;  3QYB A;  1BIA A;  2DT6 A;  3HL2 A;  1JT0 A;  4ZTJ A;  5EEH A;  3EUA A;  2HGC A;  2PMZ A;  1DGW Y;  3ON4 A;  5J8F A;  3SDG A;  3FK6 A;  4OMZ A;  4HF0 A;  5TRD A;  2DOF A;  3DTE A;  2A6H F;  3GF2 A;  1ZHF A;  3EYY A;  4JQF A;  5FLX Z;  3BG9 A;  3OS2 A;  3T6N A;  2NVQ J;  1BM9 A;  3S1R J;  2GFN A;  3ELK A;  4IQJ A;  5F0F A;  3P9I A;  4A0Y A;  1D0Z A;  4S05 A;  1Z9C A;  5K7F A;  2V4J C;  3H5R A;  4UHT A;  3BG5 A;  1VQ6 I;  3PPB A;  1SAN A;  1QHG A;  4HAM A;  1V5E A;  2VAS A;  4ETS A;  3CJR B;  3ZR8 X;  2HYF A;  4IHY A;  1B8I A;  4NQW A;  2XKP A;  2VN2 A;  1REP C;  1SEU A;  2DFH A;  1ZTR A;  2W82 A;  1TWC J;  3CC2 I;  4N9I A;  2CV1 A;  1USS A;  4WXC A;  2B3W A;  3F9K A;  4XMY A;  5D8K B;  4L62 A;  1BR4 A;  1TT0 A;  1SFX A;  1QHH D;  4Y17 A;  2OAZ A;  3GZ5 A;  3ZN1 A;  1LDJ A;  1HXD A;  4BHP A;  1HQC A;  4JYK A;  3GW2 A;  4YFX F;  4K2E A;  1MMN A;  3SHF A;  3E5X A;  4X1E A;  4ESB A;  2EH3 A;  1EH7 A;  2A5W A;  4E7L A;  4PGH A;  3GME A;  4HKU A;  4A5N A;  3CF2 A;  3QPS A;  5B3S H;  3DBL B;  2A5Y B;  3UR3 C;  2PMU A;  4BJ6 C;  4HBL A;  2MFZ A;  5BOX A;  1IGN A;  4U7D A;  4M6X A;  4JL3 A;  5CKT A;  1O7F A;  5L3B A;  3L7W A;  3WTX C;  1D0Y A;  2VOP A;  2R7V A;  4CCL A;  3HIM A;  2LNB A;  4D0P A;  3CCV I;  1OCC H;  2XGE A;  3I58 A;  1R5I D;  1I3A A;  2D2W A;  5J4V A;  2VOD A;  4ZC3 A;  2FBI A;  3BR0 A;  3U21 A;  3V8L A;  3BPX A;  1KU9 A;  2V1U A;  1O3Q A;  1TLH B;  4U87 A;  4ZH4 F;  2LF7 A;  5J8C A;  1KZH A;  3RH2 A;  2RC4 A;  1PUE E;  5HLG A;  5GAD J;  2W1O A;  4XKV A;  1F4K A;  2QEN A;  3AG3 H;  5F64 A;  1E3H A;  3SWH A;  3A0H C;  5AIP A;  2OTL I;  3R60 A;  3LQR A;  2KZG A;  1ZGW A;  1TL8 A;  5K58 A;  3BTJ A;  3V7S A;  2L9S A;  2ISZ A;  4I09 A;  4RB3 C;  2R7Q A;  3DQV C;  3RPQ A;  3OYM A;  4PDK A;  5EEA A;  3HTA A;  2EV0 A;  4D7M A;  1S9H A;  5FO5 A;  4EJU A;  2JWT A;  3EUH C;  5FB2 A;  3IAS 2;  1IRF A;  2OD5 A;  3GXO A;  3VWB A;  2ZJ2 A;  2CQN A;  3VOE A;  2OZU A;  3H36 A;  3O6B B;  4JX5 A;  3RKQ A;  4H4K C;  4PZJ A;  2XGD A;  1JJ6 C;  2BXY A;  2HNH A;  4R1H A;  2EFW A;  4GCT A;  2X6W A;  2QUF A;  2DCE A;  2XB5 A;  1Y1W J;  2STT A;  3OYI A;  2CQ7 A;  3QOP A;  1GV2 A;  3WTS C;  3VSL A;  4OIR F;  1QPI A;  2IU5 A;  2QTQ A;  2HWV A;  1V5G A;  5J1R A;  2EK5 A;  2IA0 A;  1O4X A;  4M74 A;  2J5O A;  1R36 A;  2VE8 A;  1I50 J;  3CCL I;  1GDT A;  3A01 A;  1R5H A;  1SMY F;  2JA7 J;  4BE2 A;  1FBS A;  4HNV A;  2R4G A;  1WJA A;  3E6C C;  1LVA A;  4E7K A;  1WJD A;  2IW5 A;  1S7E A;  5C4X J;  4PXI A;  2DPU A;  4FIS A;  1ZAO A;  3F72 A;  3BR5 A;  2ID3 A;  2L54 A;  1GVJ A;  2M45 A;  3BT9 A;  3I54 A;  4XN0 A;  4M3G A;  2BXZ A;  1FOX A;  3RPU A;  1R7J A;  3OYK A;  5E79 C;  1E17 A;  3K4B A;  2QBY B;  4BH9 A;  1P7I A;  2I8D A;  5EYR A;  5K1Y A;  5KAF C;  1K4T A;  1ZRD A;  3JRE A;  1J7K A;  2PZ9 A;  3FWE A;  2XIG A;  3ZQQ A;  2GIZ A;  2Q24 A;  4A3M J;  2KQR A;  2K9L A;  1LJ9 A;  1UG0 A;  2EV6 A;  3E7Q A;  1X1A A;  3DV8 A;  5FD5 A;  3S8P A;  4U9N A;  1WJC A;  4MFE A;  2DYS H;  1FOW A;  4IVN A;  4MTE A;  3ZMT A;  4BY1 J;  1D0X A;  2Z16 A;  4HST A;  2X85 A;  1NHA A;  4DYR A;  2DG8 A;  1MGT A;  1P9Q C;  2RRE A;  2BYV E;  3GTJ J;  1P4X A;  2K3F A;  1Z1D A;  4LMY A;  4IO9 F;  2ME6 A;  5DV5 A;  4A3I J;  3HOV J;  2BE5 F;  2WB1 A;  4ZTF A;  3IV5 A;  3HKZ N;  4DYC A;  3L2C A;  3TBI A;  4MIM A;  5KK1 A;  4BE0 A;  3FBI B;  4NB5 A;  1KQ9 A;  4XOR A;  5FRM A;  1B59 A;  4LB6 B;  1K61 A;  2ESH A;  2L01 A;  2NXN B;  2O3F A;  1RET A;  2YX7 A;  3I0T A;  3LA3 A;  2COM A;  2KPM A;  2D5V A;  2MG4 A;  4H0E A;  1UMQ A;  3N4M A;  3BG7 A;  3MZY A;  3A03 A;  3HOT A;  1GUU A;  5JHF A;  1FC3 A;  3TP0 A;  1D1A A;  2TCT A;  3ZXS A;  2LKS A;  2E34 A;  4BBS J;  3DTK A;  4RB0 A;  4BBR J;  4JKZ A;  1KYZ A;  1Z3Y A;  2QSG X;  3DEU A;  1MJ9 A;  3O8H A;  2KDZ A;  1FNN A;  4F93 B;  2AQE A;  4G12 A;  1YLF A;  2E5N A;  2ICW G;  1NK2 P;  3BCB A;  2BY0 A;  4MNU A;  4UB8 C;  4ZJZ A;  3R61 A;  3I4N J;  4LJZ F;  2NVU B;  1WHU A;  1SVM A;  4C3J J;  2ZSH B;  2AXT C;  2EIM H;  5CVI A;  4AC0 A;  3BQY A;  4UDS A;  4BHC A;  4YII A;  1TWG J;  2H8W A;  3OS0 A;  3JRB A;  1HA8 A;  4RGR A;  4FE4 A;  2DU9 A;  4RB2 C;  5BMZ A;  4WCG A;  1RUN A;  5IOY A;  4XK4 A;  4ICH A;  5EGO B;  4KMU X;  4HX4 A;  2RQQ A;  4CO8 A;  5KVR A;  4E7I A;  4EJT A;  2IA1 A;  2A07 F;  3ML6 A;  2DN0 A;  3HRT A;  3CMA I;  4RAF A;  1MNE A;  3H9G A;  1ENH A;  5JVG F;  1D5Y A;  4IF4 A;  2LRD A;  2ZNY A;  3PSF A;  3M4O J;  4HNU A;  1WGX A;  2X1D A;  3F1B A;  3LSI A;  5KNL A;  3L2V A;  4I2O A;  1R71 A;  3F8C A;  3IKT A;  1WPK A;  1QU3 A;  4L18 B;  2FRH A;  2UUZ A;  3QP5 A;  1O3T A;  1O3S A;  4D9J A;  3AL0 B;  5KAI C;  2JUC A;  3BNI A;  1G3T A;  3RSN A;  2A61 A;  1ZRC A;  3ASO H;  3GTG J;  4A3J J;  2CQX A;  1B9N A;  5EF6 A;  1T33 A;  1F5T A;  1SFE A;  4E6K G;  3J80 Z;  4FX4 A;  3FMS A;  4IRH A;  1VQN I;  1SFO J;  2WY8 Q;  3B6C A;  4NHJ A;  2UV1 A;  2TDX A;  2BOL A;  1W7P D;  3PO2 J;  1YRN B;  2WGB A;  2LMD A;  2F4M B;  3DTI A;  1K6Y A;  3MCZ A;  1W36 C;  5H6Q A;  3SEQ A;  5JI6 A;  1EV7 A;  1Z91 A;  2VBX A;  1CF7 B;  2AHQ A;  4YEJ A;  3TQN A;  1BN5 A;  3PNV A;  4EVI A;  5FLX K;  3AL0 C;  2HQN A;  1MBG A;  4M9Z A;  4RMN A;  3BC8 A;  2VL8 A;  1GT0 C;  2HDC A;  4HW0 A;  4B8X A;  3JW4 A;  3S17 J;  2NP3 A;  4RM2 A;  3GTO J;  1TZL A;  2BVL A;  1VFC A;  2LYC A;  5IT3 A;  2FQ3 A;  2P5V A;  5LEJ A;  2PMZ N;  1MMG A;  3FXR A;  1ZGJ A;  1JJ8 C;  4XLH A;  1HW1 A;  3K4J A;  1Z3X A;  5E1Z B;  3KYC B;  2HQ5 A;  2NS0 A;  5IP7 J;  1WJB A;  1ONV A;  3DBH B;  1MD0 A;  3FXM A;  3F8N A;  4RDU A;  4AIK A;  1MMD A;  5TGT A;  4BXX J;  3LMM A;  4BDZ A;  4DW6 A;  2M8E A;  5DM6 F;  2JMW A;  4EEF G;  1JGG A;  1OCT C;  4BHB A;  2P4W A;  1QPM A;  5LBQ A;  4BE1 A;  4CHU A;  4HOB A;  1U6G A;  1T95 A;  3HTS B;  3QAH A;  1LB2 A;  1QZY A;  2L9V A;  2QLZ A;  4LOC A;  5LEK A;  1I1S A;  2HXO A;  4BAY A;  4L5J A;  2F5F A;  2LD5 A;  1X3W B;  1UAA A;  4JX4 A;  2AQF A;  1WQ2 A;  5TJJ A;  1QRY A;  4D1Q A;  2K9N A;  2VT2 A;  3VW1 A;  4D5F A;  4UV8 A;  1MBK A;  2FX0 A;  4EV0 A;  2LBF B;  4A3G J;  1JI8 A;  3CJD A;  1HBX G;  2P81 A;  3H5N A;  5IPA A;  2XRO A;  3LAJ A;  3ABL H;  1J09 A;  4LK1 F;  3TP3 A;  2DA1 A;  3VVZ A;  3KP5 A;  3CJQ B;  4NDL A;  3CZ6 A;  3TW6 A;  3LJL A;  1R9T J;  3S93 A;  4HDV A;  2IGK A;  1R1T A;  2KIS A;  4GO1 A;  2P5K A;  4M6V A;  1JXS A;  3WGI A;  1T38 A;  1APL C;  1DP3 A;  3OYF A;  2XAU A;  3KNW A;  2BGC A;  3R0J A;  3B02 A;  3DCF A;  3MZ8 A;  4KN7 X;  4LLL A;  4BEH B;  4A93 J;  1GXP A;  3S1Q J;  1FWZ A;  2RKH A;  1YX5 A;  3BJB A;  3RKY A;  3VP5 A;  3F3X A;  4EJV A;  2E7X A;  2UXU A;  4YFN F;  2V1X A;  1FZP B;  2R5Z B;  2QSH X;  2ZCM A;  5EZH A;  2WAF A;  5AQC A;  4DBR A;  1G3W A;  1OMI A;  2HS5 A;  3OYA A;  5GPC A;  3EYI A;  2E35 A;  5FRO A;  1MJB A;  3WTZ A;  1OYI A;  5FRN A;  3G3Z A;  2LY1 A;  1SFK A;  2KKO A;  2HTS A;  3U1K A;  1F43 A;  2LSO A;  3KX2 A;  3HBL A;  3PSI A;  2EA2 A;  2M0M A;  3CC4 I;  3VOX A;  2NVT J;  3TOA A;  2R7T A;  3HE0 A;  3WTU C;  5J1U A;  3RCO A;  1VQ9 I;  2KJB A;  5ICG A;  3ZQI A;  5E3M A;  3GVA A;  3I59 B;  3QYE A;  3HM5 A;  1EA3 A;  4A0Z A;  4MK6 A;  1IC8 A;  1XD7 A;  1U5T A;  2HI3 A;  3S32 A;  1XSD A;  3L00 A;  3CRJ A;  1OYY A;  4M9S A;  3H3Z A;  1ZEL A;  1U8R A;  3TOB A;  3FBN B;  1BBY A;  4IOC F;  5E8G A;  1I6X A;  4M3E A;  3SZT A;  2L7Z A;  4ZYD A;  1UB9 A;  3JRC A;  1W0U A;  1XTA A;  4E4H A;  1IN6 A;  1FPQ A;  1G8X A;  2Q1Z B;  3GO5 A;  3HSE A;  3DLL F;  1EH6 A;  1JTY A;  1ZK8 A;  2V57 A;  3OL3 A;  4PUS A;  4BQA A;  1WRJ A;  4W1U A;  2FJI 1;  4WXH A;  2JVH A;  3HIF A;  1LE8 B;  5B1A H;  4ZYA A;  2NRA C;  1IJW C;  3K1N A;  2KMU A;  2EIL H;  2FOK A;  3VDX A;  1IDZ A;  4U9L A;  2QOP A;  4XKW A;  3K1P A;  5HVQ C;  4LFU A;  2FEZ A;  1IG7 A;  2PJR B;  3HG9 A;  3P9C A;  4CXF A;  1X4O A;  4BY7 J;  5LGN A;  3C18 A;  5HBU A;  1D1B A;  3FMR A;  5D8L B;  3S3M A;  1LEB A;  2R7F A;  3NEU A;  4FAS D;  1R49 A;  1VQ8 I;  4HEA 2;  2NVY J;  2CRG A;  3OL4 A;  2GBY A;  3OYE A;  5HDN A;  3OYL A;  2PG4 A;  2PN6 A;  3B6A A;  4MQV A;  3LA7 A;  3LAP A;  3K2Z A;  3LSR A;  2XGX A;  3K4N A;  2HYJ A;  4CCJ A;  4GGG A;  4F52 A;  3J7A O;  3CUQ B;  5FD6 A;  1HCR A;  2RV8 A;  4XNF A;  5CVJ A;  5IOZ A;  4KA4 A;  1G3S A;  3ABT A;  4KNY A;  5JHU A;  4RM3 A;  5IYD J;  2Z1D A;  3T8R A;  2L4A A;  2EIJ H;  4CDG A;  1EKE A;  3CME I;  4BQN A;  1BOA A;  4A2U A;  2FML A;  1C0W A;  3RYP A;  3IH2 A;  5EG0 A;  2WB1 N;  4DZJ A;  4MFD A;  2LR8 A;  3V4G A;  1JUM A;  3DU6 A;  3T0Y A;  3KIO A;  3MMY B;  3G1O A;  1I6H J;  3MQ0 A;  1MZB A;  3RQ4 A;  3S16 J;  4AIJ A;  1T6S A;  4NC7 A;  5FLM J;  2VC1 A;  3CUQ C;  3NWT A;  3RIR A;  3O60 A;  1FP1 D;  5HOO A;  2V6E A;  4I0A A;  5B66 C;  1U9N A;  2JRM A;  1TC3 C;  1WZ2 A;  2X1C A;  2ADU A;  2VB6 A;  3BOQ A;  1FSE A;  3K7A J;  2DK5 A;  1D1C A;  5FGM A;  1BA5 A;  4W97 A;  1DDN A;  4JBA A;  1WWX A;  3FXL A;  2CQK A;  3BG3 A;  4AIH A;  2CFX A;  1A36 A;  4B4C A;  1N78 A;  2DA5 A;  2K02 A;  2L9N A;  1YOV B;  1WJ5 A;  3RQI A;  3ECO A;  5CYV A;  4U0V A;  3DU5 A;  4UVB A;  4AF5 A;  3DFG A;  4WX9 A;  2M5W A;  3IRQ A;  1TP4 A;  2AXL A;  2L9R A;  2P6S A;  3E5U A;  3CCE I;  3MVP A;  4CA0 A;  1X1P A;  2VOO A;  3HGY A;  1H8A C;  2Z5U A;  2JRT A;  4HV5 A;  4YIF A;  4AD9 A;  2K9Q A;  5F04 A;  3GTM J;  1XPX A;  2ME0 A;  1FT9 A;  3H3V K;  4ACI A;  1LFU P;  2W48 A;  3B73 A;  3DEE A;  3HRU A;  1BI0 A;  2E1M B;  1H89 C;  2CW8 A;  1TNS A;  1XMA A;  5JFR A;  3SZP A;  1T39 A;  3EUP A;  1JKO C;  2O0Y A;  3CCS I;  3C2H A;  2VUM J;  4BU2 A;  4DNC A;  1X19 A;  4ASN A;  1S72 I;  5L3C A;  4XOT A;  4AID A;  5HLH A;  3JSP A;  4KDP A;  3J80 K;  1YX3 A;  3Q3S A;  3OOP A;  5J40 A;  1DPU A;  3K0L A;  2PEX A;  5M5W J;  4BS9 A;  3ZQL A;  2HQA A;  5FKL A;  2LY9 A;  4QLC U;  1JHF A;  5DCF A;  2E1M C;  3ASN H;  5CPR B;  2QQ8 A;  3WOD F;  1OFC X;  4ZYH A;  4ENJ A;  1ZG1 A;  3ERM A;  1PP7 U;  2NNN A;  4LLG F;  2M0C A;  2EFP A;  2H94 A;  5C44 J;  1B8I B;  2ZKZ A;  4NQW B;  5ILS A;  5EJC A;  1UHS A;  2ETH A;  4ZZL A;  2YVX A;  4NEL A;  2R3S A;  2NAZ A;  2HXI A;  3W2V A;  2OU2 A;  2GIV A;  4PCQ A;  1X4P A;  3TKY A;  2KP6 A;  4F55 A;  4Y52 J;  3KZ9 A;  1WH5 A;  2PQ8 A;  1VQ5 I;  1FEX A;  2DMQ A;  3HYI A;  2X6Y A;  3ZQ7 A;  1HW2 A;  1W36 D;  1E0E A;  3G2B A;  2VE9 A;  3BZK A;  2IGO A;  2YVH A;  2PFV A;  2O8K A;  1RKW A;  1RKT A;  3Q9S A;  2IGM A;  4BQQ A;  2RN7 A;  4PJJ A;  5AIQ A;  2YX4 A;  3FF5 A;  3CTA A;  3GLX A;  2O7T A;  2UXH A;  3OSG A;  1QQI A;  3HPH A;  4Q48 A;  1W7P A;  3W6V A;  3JRD A;  4L0Z B;  3QKX A;  3ON2 A;  2E7W A;  2MC4 A;  3NWS A;  4RA2 A;  2VON A;  1OJL A;  3PFY A;  4A5M A;  2GOM A;  2IXS A;  3G71 I;  5K5Q A;  3OYB A;  4EJO A;  5E3N A;  4DOZ A;  2DA7 A;  3H3U A;  2D1V A;  2DLL A;  2VJ4 A;  4BAC A;  2RAS A;  3VW2 A;  3G1M A;  4O3M A;  2ZME A;  4AU7 A;  5LD2 C;  1TW2 A;  2L2O A;  1YTY A;  2PJP A;  1BJZ A;  1YI2 I;  1W5C C;  5CLS A;  2BY3 A;  4EM1 A;  1IUF A;  5DS9 A;  3AG1 H;  1BC8 C;  4BXF A;  6PAX A;  3LSP A;  3Q5F A;  2CGP A;  3KPH A;  2G7G A;  4QIW N;  3RD3 A;  5ICF A;  2HFH A;  1U0J A;  5D4S A;  2ZBK A;  2HTJ A;  2WV0 A;  4UB6 C;  2QQB A;  1E3P A;  4B47 A;  3W3C A;  3PQJ A;  4V19 K;  4B1R A;  1TWA J;  1PUF A;  1SD5 A;  4N4N B;  4EGZ A;  2HPM A;  4YIR X;  3M7G A;  2V9K A;  2BVM A;  3GYH X;  1VND A;  1YIO A;  2LRE A;  4L9N A;  2LH9 A;  3C3W A;  4OAZ A;  3H1C A;  3ZMZ A;  1B4A A;  4L9J A;  5D6E A;  3L2R A;  2EA4 A;  3TO6 A;  5IP9 J;  3KP2 A;  3K69 A;  4XID A;  2QZ8 A;  3M1C A;  5BQT A;  2LP0 A;  2LTP A;  2MA3 A;  3WHC A;  2JVG A;  3FDY A;  4BQO A;  2Y9Z A;  1OYW A;  5CVV A;  1FBU A;  2QSF X;  5KCM A;  2M2E A;  3A01 B;  3K4C A;  2ZXJ A;  2ZJR F;  2W24 A;  1HKQ A;  2IS2 A;  1IXR C;  3JRF A;  3H0G J;  3ONQ A;  2FQ4 A;  1B72 A;  2ZOY A;  4OIQ F;  4RB1 A;  2GXA A;  3WTY C;  5HDK A;  3O3K A;  1YIJ I;  1GHC A;  2XAS A;  4A12 A;  2G7L A;  4CCK A;  3DPU A;  4WXD A;  1IRG A;  2DDA A;  3ANG A;  1IF1 A;  4ENK A;  1YW8 A;  5E20 A;  2KIQ A;  4Y13 A;  3HSF A;  2H1K A;  1R6R A;  1K4S A;  2F4I A;  1R00 A;  1HW5 A;  3WG7 H;  1WSU A;  1AOY A;  2H6C A;  2HZD A;  3IH4 A;  2K9M A;  5C3E J;  4UUS A;  2HYG D;  4I98 B;  1Z05 A;  3A4C A;  4B3A A;  5HLI A;  2NOG A;  3GEZ A;  1AA7 A;  5B1B H;  4MXM A;  3BRU A;  1H88 C;  4OIP F;  2DPD A;  1UI5 A;  1ZLK A;  1T56 A;  3G56 A;  1YJ9 I;  3NNR A;  2G0E A;  2M30 A;  3K4L A;  2W57 A;  3V78 A;  2X6X A;  1DGR M;  4ZZD A;  3JRH A;  1DUX C;  1QO0 D;  1MMS A;  4F92 B;  3BJO A;  1Z0X A;  2KHM A;  3GFM A;  2Y0M A;  1TQP A;  4C2U A;  3S15 J;  1IXS B;  2XRL A;  5H6R A;  2A3S A;  2BEO A;  2JSC A;  3T8T A;  2VT3 A;  3K4M A;  1YO5 C;  2E2J J;  2OUM A;  2L3D A;  3CJT B;  3IKV A;  3F8B A;  5H20 A;  4S0H B;  2VBZ A;  4Q47 A;  2IVM A;  3ZMS A;  1YIT I;  2DFE A;  3KEO A;  3BZC A;  3BCA A;  2OTJ I;  2KL4 A;  2LKP A;  1RNL A;  2V26 A;  3ULQ B;  2WAE A;  2LLK A;  4LD5 A;  1MW7 A;  3QRF F;  3VB2 A;  3OYJ A;  1MH3 A;  3SXY A;  2Q2E A;  2L4M A;  1ETX A;  2XF7 A;  1W0T A;  2E1N A;  1MIJ A;  3I4M J;  3HOS A;  3OIQ A;  4OOI A;  5D4R A;  4AM3 A;  1MND A;  1W1W E;  3HPG A;  3PNT A;  3QBM A;  1O57 A;  2NVX J;  5HS7 A;  3ABM H;  1KYW A;  2MC3 A;  2W4S A;  5FKM A;  4GXO A;  2DTR A;  3NAU A;  3VPR A;  2N8G A;  4NBQ A;  3ZQC A;  2VQG A;  5CQG A;  1VTN C;  3I64 A;  3ZGK A;  3FMQ A;  1HLV A;  5IYC J;  1IN8 A;  1XCV A;  3CMM A;  4M3B A;  4Y3O A;  1G59 A;  1QA6 A;  5AON A;  3BRO A;  3CUO A;  2BW3 A;  3KLN A;  3OV8 A;  1YYV A;  1WJE A;  4CIC A;  4M72 A;  3AQT A;  2FMY A;  1W4M A;  3BTL A;  4Z2Y A;  3RZO J;  2XF6 A;  1MH4 A;  1I5Z A;  2CWE A;  2ZB9 A;  1JUP A;  2L02 A;  5FFZ A;  4Y15 A;  5ILU A;  1P92 A;  1MJA A;  3HJE A;  1P4W A;  4BJ5 C;  2TRT A;  2UXX A;  1BI2 A;  2DAO A;  3MAJ A;  1JE8 A;  1QGP A;  2X48 A;  1BL0 A;  4DGW B;  4XRF A;  4EM2 A;  5E1W A;  1Y0U A;  2G7H A;  2ZJQ F;  1BC7 C;  3A02 A;  4X6A J;  4QWQ A;  2EZH A;  2DJN A;  1V54 H;  3OY9 A;  2V9V A;  5ICE A;  4IKF A;  2ZFU A;  3R4K A;  4C3I J;  3COL A;  2ESN A;  3M3Y J;  2YS9 A;  4E7S A;  1TNT A;  2CUJ A;  3HTJ A;  1LFB A;  3DXJ F;  1P4A A;  1X2M A;  3OIO A;  4I76 A;  3BP8 A;  2CYY A;  4M73 A;  1FTT A;  3S5R A;  1ZR2 A;  1S5L C;  3ISP A;  3J7A Y;  2PBX A;  4PJM A;  3I71 A;  5HSZ A;  2QKO A;  4HNT A;  2HVS A;  3CWR A;  4BKX A;  4XL9 A;  3GZI A;  4CYD A;  4PSW A;  4RLF A;  1S7A A;  3JCU C;  3K2A A;  5F1R A;  2BHY A;  2WY7 Q;  1SAU A;  3AAF A;  2P0W A;  4PJN A;  2KDO A;  3PO3 J;  2D45 A;  3PQK A;  2QKM B;  3WTW C;  3BJ6 A;  1SD6 A;  2FD5 A;  3NAR A;  4ESF A;  4UV9 A;  3DPL C;  1P2F A;  2FOW A;  4RGU A;  2K9S A;  1YQA A;  2B1E A;  4C2M A;  3IUO A;  5D6F A;  4LIU A;  1IDY A;  3H92 A;  3S2D J;  1JUS A;  1Y56 A;  4UUV A;  4IHV A;  2JA2 A;  3FIS A;  3IC7 A;  5D19 A;  3VOD A;  3W2A A;  1TWF J;  2UXP A;  3HXL A;  2XRN A;  3MEX A;  2ISY A;  2V1N A;  3RYR A;  1WI3 A;  1K78 A;  4A3E J;  4MEX F;  3K9T A;  3H5A A;  2FF4 A;  2IEK A;  1BJA A;  3X2Q H;  1J75 A;  1V3F A;  4XRS A;  4DVY P;  3VFZ A;  3HOU J;  3ZQF A;  2MYS A;  4ENN A;  3IL2 A;  5BS6 A;  3KKC A;  2Y0S A;  4KMF A;  1Y1V J;  2EFN A;  4FQG A;  2UZK A;  1HST A;  1LKX A;  2ZOZ A;  3CC7 I;  2V9P A;  2HKU A;  2OJE D;  2M7A A;  2CV2 A;  3FXJ A;  2XAH A;  3N05 A;  4ZYG A;  3L2U A;  1YG2 A;  3J7Y J;  3P5J A;  2R7R A;  1J9I A;  3FXK A;  4LIT A;  1Z6R A;  2YVE A;  2W7N A;  2LFB A;  1MDM A;  2FA5 A;  3CES A;  3MN2 A;  3FXO A;  2DW4 A;  3VVX A;  2ZJP F;  5BPI A;  1XMK A;  2ECC A;  4C3H J;  3O2P E;  5TIS C;  2R92 J;  3SFZ A;  1JKR C;  4HLX A;  1YS6 A;  2PX9 A;  1FOY A;  2V7F A;  2VBW A;  2XSD C;  1MBF A;  1WH7 A;  3JAM Z;  3S2W A;  3AQS A;  1T08 B;  1NG6 A;  1FLI A;  5CXG A;  2CV0 A;  2O7O A;  3TDU C;  3BTI A;  4MLO A;  2B7E A;  5ILV A;  5M5Y J;  3R6S A;  2UXI A;  2ZNZ A;  3VOK A;  3NRV A;  1Z6T A;  3GZ6 A;  4LB5 A;  1FBQ A;  1KU2 A;  1ZRF A;  2Z99 A;  1R5G A;  4NC8 A;  4I6Z A;  1N75 A;  2JJ7 A;  3I5U A;  3OR1 C;  5LFA A;  3SYT A;  3CP2 A;  4P55 A;  3FX3 A;  2I5U A;  3C1D A;  5E8I A;  2CW7 A;  3DBR B;  3RJP A;  3CMY A;  4DZP A;  2O5R A;  4BJT A;  1I27 A;  2PBI A;  3JRA A;  3TGN A;  2E36 A;  2EWN A;  4EM0 B;  3J7Z I;  1VZ0 A;  2FNA A;  4OWR B;  3CCM I;  1Z7L A;  2YU3 A;  3KE2 A;  3K70 C;  1IO2 A;  5GP9 A;  1U5T B;  5DCM A;  3FIW A;  2CSO A;  1T98 A;  1S8N A;  3U9G A;  4OMY A;  5DAJ A;  1U2W A;  4XKB A;  5LRR A;  4Y7N J;  5LGU A;  2YPR A;  1JHH A;  4ME9 A;  2CUZ A;  1ZR4 A;  3EQL F;  3PIP F;  4HZF A;  2QKL B;  3S1N J;  2DQR A;  3F22 A;  1YW9 A;  1HOM A;  4N4O B;  2HDD A;  3HOX J;  5FMP A;  4P1W A;  3HRM A;  4G6D A;  4NUB A;  4MHG A;  1H9T A;  1X1B A;  4KUM A;  4KIB A;  3WGG A;  5IY5 H;  1PDN C;  5JR3 A;  1A5J A;  1K6O A;  3F6O A;  1OCZ H;  3M07 A;  3OWT A;  4BXU A;  2K27 A;  1B1B A;  2W00 A;  2Y69 H;  2DMN A;  4ABZ A;  3FRQ A;  3ZN0 A;  1U5T C;  4RAZ A;  3J81 Z;  4OD4 A;  3BDD A;  4JOM A;  5LHH A;  3AG4 H;  1ZYR F;  3GWZ A;  2HDW A;  3G6E I;  2GXG A;  4UNO A;  1V5F A;  4RGS A;  1ZAR A;  1U9O A;  3GTQ J;  3CCU I;  2VXZ A;  3CDL A;  3DPT A;  3LHQ A;  4I02 A;  1ACI A;  1MBJ A;  4IHT A;  1R4M B;  1E3O C;  2IAI A;  3Q0V A;  1MNM C;  3CO6 C;  1WCM J;  3CCQ I;  2EBI A;  3FHZ A;  1LFP A;  3CDI A;  3E7L A;  4GCK A;  1J59 A;  1AWC A;  2LKX A;  1GLN A;  3E3V A;  4IX7 A;  1NH3 A;  2STW A;  3SFI A;  1CQT A;  2HOT A;  3K8P C;  5D5W B;  2Z9O A;  2GQQ A;  2EV5 A;  4IXA A;  4A3B J;  2L5Q A;  2H1L A;  3GUD A;  3Q0U A;  1D5V A;  1T0F C;  1BW5 A;  2CW0 F;  2XPV A;  4ENM A;  3QQA A;  2VI6 A;  2ZSI B;  3WE3 A;  2W84 A;  3QPT A;  4P9F A;  3MKY B;  2X0L A;  1IW7 F;  3HTH A;  2E1C A;  2R7D A;  2ZXW H;  4XQF A;  5M5X J;  3CP8 A;  5EG0 B;  4HYE A;  4ZDO A;  1A31 A;  2MW8 A;  2H8R A;  3K4K A;  1T0F A;  2COB A;  1OIS A;  3QU3 A;  4J00 A;  2LVS A;  4HQM A;  2MGQ A;  1UI6 A;  4CGR A;  4PGG A;  3S1M J;  1P6R A;  4IJA A;  3GLL A;  4M6Y A;  4U88 A;  2M1B A;  4QTR A;  4A3K J;  2K85 A;  1E2X A;  2XPU A;  4QPO A;  5CJ9 A;  1HKS A;  2OV7 A;  1XSX A;  3KFW X;  3ERE D;  2XDN A;  2L0K A;  5DUK A;  2DMT A;  2M34 A;  2GAU A;  1BW6 A;  1UHW A;  1SD4 A;  4GCV A;  2OCE A;  2Z2S B;  4E7J A;  1FMV A;  2RNJ A;  1TW3 A;  1OQY A;  1LDD A;  2K3P A;  1HDD C;  1S29 A;  2LOO A;  1IRZ A;  4IL6 C;  2X51 A;  1FX7 A;  1PP8 F;  3T1B A;  4UXN A;  2DYR H;  1D8K A;  1LUJ B;  3FXU A;  2NP5 A;  1UST A;  3D0S A;  3I3L A;  5JVT A;  2QYO A;  3H9J A;  5FKN A;  1VQK I;  5DTD A;  1XC5 A;  3LSH A;  4AWX B;  1AKH A;  1FYL A;  4NN1 A;  3M1E A;  3HOY J;  1N77 A;  1ZH5 A;  1HDP A;  1OPC A;  3ZRG A;  4HQE A;  1SVO A;  3IAM 2;  4LLN A;  2RDP A;  5FLV A;  3TDZ C;  3FHN A;  3REO A;  2QWW A;  1NK3 P;  2HPI A;  4GFL A;  5ICC A;  2VJJ A;  3A1Y A;  2F5E A;  2B0L A;  2BHZ A;  4KIS A;  3A0B C;  1FOK A;  1QVU A;  2O8X A;  4CCN A;  2JTV A;  2QM3 A;  2X6O A;  4JNN A;  2WUI A;  2BY1 A;  2R7W A;  2L7K A;  5EFY A;  2KRC A;  4U0W A;  5J47 A;  2ZC2 A;  4AC6 A;  4A0X A;  3IWF A;  2Y30 A;  2DFI A;  2E60 A;  3CCR I;  2V1D A;  4FX0 A;  3HHG A;  1QVT A;  1FYK A;  1J5Y A;  2M3A A;  4PK4 A;  2JQ7 A;  1OR7 A;  3PNY A;  4ZDL A;  1I3Q J;  3DKY A;  3KYD B;  1JKQ C;  1ON2 A;  2EPF A;  2LG4 A;  2VQC A;  2CQQ A;  3CCY A;  3LFU A;  2ID6 A;  1RUO A;  5GAH J;  2DMU A;  3BY6 A;  5HS9 A;  2HOE A;  3ZMD A;  2DMP A;  1A6I A;  1HKT A;  4J19 A;  3P7N A;  1JKP C;  1FSH A;  4XON A;  2VQH A;  5M3M J;  1KQ8 A;  3OOU A;  4Y33 A;  5B5E C;  3NI7 A;  5D5V B;  4D5C A;  2DXI A;  3PAS A;  2MH9 A;  2GA1 A;  4I0B A;  3C2G A;  1UEL B;  2OPT A;  4QPQ A;  4B3X A;  4OU0 A;  2FU4 A;  2DDB A;  2B9S A;  2L7M P;  2K4B A;  3JTG A;  1GXQ A;  1WKM A;  1W7P B;  1Z77 A;  3E6M A;  1NTC A;  2DA6 A;  2IP2 A;  2HZT A;  2UXO A;  3O8G A;  5F6F A;  4FHT A;  2EJR A;  4RGX A;  5CVU A;  3OS1 A;  2W53 A;  4PJL A;  1W5T A;  4P9U A;  3H35 A;  2JA6 J;  1P7J A;  1VF9 A;  4M3F A;  2XB0 X;  3HUG A;  2P6T A;  3KZY A;  3KET A;  2YR2 A;  4G8X A;  4XKC A;  1STZ A;  1ETV A;  1TTY A;  2ZME B;  4IPA A;  3TO9 A;  2OA4 A;  2A6T A;  2VJI A;  5K5R A;  2M7B A;  3ZOB A;  2IPQ X;  3HTI A;  1XGO A;  2D6Y A;  3E5Q A;  1XCB A;  4GFK A;  3QU6 A;  3G73 A;  3TED A;  3ECH A;  3P9K A;  2XAQ A;  2FXA A;  2EFO A;  1EH8 A;  1YW7 A;  3CF5 F;  1QBJ A;  3VW0 A;  2Y0S N;  2GUH A;  3HOZ J;  2JUG A;  1R22 A;  3PUB A;  3JAM K;  1IXC A;  2DFF A;  1IAW A;  4QSH A;  3L9F A;  1I39 A;  3V7C A;  2V79 A;  1H9G A;  3CLQ A;  2A68 F;  2DK8 A;  4P96 A;  3E1S A;  2ZME C;  1PUF B;  5H2F C;  1YFH A;  3ANP A;  3EET A;  1KU7 A;  1M1E B;  3LOC A;  2XC7 A;  1JT6 A;  1RZ4 A;  5D5X B;  3ABK H;  1ZKG A;  3AFH A;  3EUK L;  1KON A;  5DDG A;  2O03 A;  2F4O B;  4AVZ A;  4RBO A;  4CYC A;  2GLO A;  2O6G E;  2DOD A;  4UVA A;  3VYT B;  4HA8 A;  2ELH A;  5GTI C;  1OLT A;  4YG2 F;  1VQO I;  1G3Y A;  1EF4 A;  5CW8 A;  3D5S C;  3KYL A;  3GTP J;  3PFI A;  1WI9 A;  5KHD A;  1MBE A;  1XG1 A;  2KFD A;  3GFI A;  1U8B A;  4UVC A;  2G7U A;  5C4Y A;  4EMS A;  2HR3 A;  3FKJ A;  4IQ4 A;  5J3L A;  1IV6 A;  4GCL A;  1SVL A;  3QOD A;  4XM3 A;  1OKR A;  1B72 B;  4N9H A;  1KU3 A;  1R1V A;  5GTH C;  2ZY9 A;  3AG2 H; 
#chains in the Genus database with same CATH homology
 1X58 A;  4JX4 A;  4C2M J;  5F08 A;  1LE8 A;  1QRY A;  4UUT A;  3IUV A;  2K9N A;  3VW1 A;  4D5F A;  3ZQG A;  3VIB A;  3BR6 A;  2VKV A;  3AQT A;  5IYB J;  1MBK A;  2FX0 A;  4A3G J;  2R5Y A;  3CJD A;  3BTL A;  3RZO J;  2P81 A;  1MH4 A;  5IPA A;  2M8G X;  2ZB9 A;  1JUP A;  5J1Y A;  3TP3 A;  4XIC A;  3BR1 A;  2DA1 A;  3VVZ A;  3TW6 A;  4NDL A;  3LJL A;  5H9T A;  1R9T J;  2TRT A;  3BR3 A;  4UUS B;  2X48 A;  2QF7 A;  1BL0 A;  1ETQ A;  2FBQ A;  3G1L A;  4M6V A;  3HGG A;  1APL C;  3GTL J;  2LD5 A;  4FCY A;  4IEJ A;  3UKG A;  5D18 A;  3A02 A;  2WAQ N;  4X6A J;  3G7R A;  3KNW A;  3DCF A;  4A93 J;  2EZH A;  2DJN A;  3S1Q J;  1POG A;  3PM1 A;  5FKK A;  3BJB A;  3VP5 A;  4C3I J;  3COL A;  2F07 A;  3M3Y J;  2UXU A;  2YS9 A;  2R5Z B;  2ZCM A;  5EZH A;  5E3L A;  3HTJ A;  5AQC A;  1LFB A;  5JLX A;  5HAW A;  2B63 J;  1X2M A;  3OIO A;  4I76 A;  1FTT A;  1ETY A;  4JX6 A;  5GPC A;  3S5R A;  3MKL A;  1ZR2 A;  1AU7 A;  2PBX A;  3HOW J;  5HSZ A;  4AUX A;  2QKO A;  3CWR A;  4BKX A;  5EZG A;  2ZCN A;  2O9L A;  2G7S A;  3GZI A;  5FHP A;  4D7N A;  1F43 A;  3HBL A;  3K2A A;  3HEF A;  2HYT A;  3VOX A;  2XGC A;  4XRS G;  2NVT J;  1ZQ3 P;  2JN6 A;  3HE0 A;  5J1U A;  3NXC A;  1FIP A;  3PO3 J;  3BHQ A;  2DA4 A;  3OSF A;  3B81 A;  3ZQI A;  5E3M A;  2FD5 A;  3NAR A;  3HM5 A;  4MK6 A;  1IC8 A;  2HI3 A;  3BTC A;  1DU6 A;  2ELK A;  3CRJ A;  4CYC B;  2K9S A;  1RES A;  3D1N I;  1HF0 A;  1XS9 A;  4A3L J;  2LK2 A;  1IDY A;  4IHX A;  3S2D J;  1JUS A;  2R7Z J;  2E2H J;  5GPA A;  4IHV A;  4M3E A;  3KKD A;  3V6G A;  3FIS A;  2G3B A;  2R0Q C;  3LSJ A;  5D19 A;  2EZI A;  2L7Z A;  3GTK J;  1TWF J;  3JRC A;  1W0U A;  2UXP A;  3DPJ A;  1WI3 A;  5F1J A;  4A3E J;  2V57 A;  1JTY A;  1ZK8 A;  2IEK A;  3WHB A;  2E2I J;  4W1U A;  4XRS A;  4YZE A;  1LE8 B;  2QCO A;  1IJW C;  3HOU J;  3ZQF A;  3GEU A;  3TW7 A;  5HOD A;  2Y2Z A;  1IDZ A;  3KKC A;  2R5Y B;  2QOP A;  1Y1V J;  2DA2 A;  4V2G A;  2ZOZ A;  3QPL A;  1IG7 A;  1U78 A;  4XRM A;  2HKU A;  2EZK A;  4BY7 J;  5HBU A;  2VKE A;  1JT0 A;  1MSE C;  3HB9 A;  3NPI A;  2YVE A;  3ON4 A;  1F36 A;  2LFB A;  2JK3 A;  2NVY J;  2DG7 A;  3SDG A;  3FK6 A;  2CRG A;  2GBY A;  3MN2 A;  3VVX A;  3B6A A;  4C3H J;  2ECC A;  3BG9 A;  3T6N A;  2R92 J;  1JKR C;  2NVQ J;  3LSR A;  3S1R J;  2GFN A;  4L5E A;  2HYJ A;  1OCP A;  5F0F A;  2XSD C;  1MBF A;  1WH7 A;  3AQS A;  5K7F A;  3BG5 A;  1HCR A;  3PPB A;  1SAN A;  5IOZ A;  1DU0 A;  2AO9 A;  3JR9 A;  2REK A;  5CXG A;  2O7O A;  1GV5 A;  3BTI A;  5F0C A;  5BNG A;  1B8I A;  4IHY A;  4MLO A;  5IYD J;  5M5Y J;  2UXI A;  3VOK A;  1ZTR A;  1TWC J;  3IH2 A;  5EG0 A;  2WB1 N;  5K7Z A;  4I6Z A;  4L62 A;  2JJ7 A;  3GBG A;  4MFD A;  2LR8 A;  4DZJ A;  2NX4 A;  1JUM A;  1MSF C;  1GVD A;  3G1O A;  1I6H J;  4JYK A;  3CMY A;  3S16 J;  4DZP A;  5FLM J;  1RPW A;  1UG2 A;  3JRA A;  4X1E A;  2EH3 A;  3O60 A;  1U9N A;  4HKU A;  1TC3 C;  5GP9 A;  3IH3 A;  3FIW A;  3K7A J;  3QPS A;  5DAJ A;  4Y7N J;  1BA5 A;  4W97 A;  1IGN A;  4ME9 A;  1ZR4 A;  2YUS A;  3BG3 A;  2GEN A;  4B4C A;  2DTZ A;  4JP0 A;  2DA5 A;  3S1N J;  1HOM A;  5E3O A;  4JL3 A;  2CUF A;  2HDD A;  3HOX J;  3BR2 A;  3RQI A;  1ORK A;  5FMP A;  2GM4 A;  3HIM A;  4AF5 A;  2K40 A;  2CU7 A;  2L9R A;  2XGE A;  1A5J A;  3BR0 A;  3MVP A;  3HGY A;  1H8A C;  3FRQ A;  4ABZ A;  2DMN A;  2K9Q A;  3MNL A;  5F04 A;  3GTM J;  3RH2 A;  2ME0 A;  3H3V K;  4ACI A;  1LFU P;  3ZQH A;  2W48 A;  1H89 C;  1ZGW A;  1U9O A;  3GTQ J;  3EUP A;  5K58 A;  1JKO C;  3BTJ A;  3CDL A;  2ECB A;  2VUM J;  3LHQ A;  4V2F A;  1MBJ A;  1VI0 A;  3JRI A;  5EEA A;  1E3O C;  3Q3S A;  2IAI A;  3Q0V A;  4D7M A;  2IBD A;  1MNM C;  3HTA A;  1WCM J;  2EBI A;  2JWT A;  3E7L A;  4GCK A;  5M5W J;  2LKX A;  1JTX A;  2CJJ A;  5K7H A;  4JX5 A;  3SFI A;  3RKQ A;  1CQT A;  3ZQL A;  2HOT A;  5FKL A;  2LY9 A;  4A3B J;  2E19 A;  3Q0U A;  3S14 J;  2XGD A;  5JLW A;  1JJ6 C;  1BW5 A;  4GCT A;  1OFC X;  2XB5 A;  1Y1W J;  2XPV A;  1TWH J;  4KWA A;  3QQA A;  2M0C A;  1GV2 A;  5C44 J;  2VI6 A;  1B8I B;  1ETK A;  2JA8 J;  1QPI A;  2IU5 A;  1UHS A;  2QTQ A;  4NEL A;  3BQZ A;  5J1R A;  3HTH A;  2HXI A;  1O4X A;  1K83 J;  5M5X J;  5EG0 B;  1I50 J;  2MW8 A;  1GDT A;  3A01 A;  2H8R A;  4Y52 J;  3KZ9 A;  1WH5 A;  2COB A;  1FEX A;  1ETO A;  2LVS A;  5FGL A;  2DMQ A;  2MGQ A;  1UI6 A;  4CGR A;  1FJL A;  2JA7 J;  3S1M J;  5EGO A;  4HNV A;  2NS7 A;  4QTR A;  2YVH A;  4A3K J;  2O8K A;  1S7E A;  1RKW A;  1RKT A;  5C4X J;  2XPU A;  4PXI A;  4FIS A;  5FKO A;  3BR5 A;  2ID3 A;  3EGQ A;  3BT9 A;  2XDN A;  4M3G A;  2L0K A;  2DMT A;  2M34 A;  1BW6 A;  2O7T A;  2UXH A;  3OSG A;  2L7F P;  1P7I A;  5EYR A;  1G2H A;  3W6V A;  3JRD A;  9ANT A;  4A3C J;  3QKX A;  3JRE A;  3ON2 A;  1HDD C;  2PZ9 A;  2Q24 A;  2DA3 A;  2X9D A;  1OJL A;  4A3M J;  1IRZ A;  3DEW A;  2E1O A;  2OER A;  3E7Q A;  4GFB A;  2NP5 A;  5E3N A;  4MFE A;  2DA7 A;  4DYQ A;  2RAS A;  5FKN A;  2R93 J;  3VW2 A;  4BY1 J;  3FKI J;  5DTD A;  2ZCX A;  3G1M A;  1XC5 A;  4DYR A;  1AKH A;  2DG8 A;  2OF7 A;  3GTJ J;  4NN1 A;  3HOY J;  4A3F J;  3Q0W A;  1SGM A;  2ME6 A;  1BJZ A;  1ETW A;  1YRN A;  4A3I J;  1HDP A;  3HOV J;  2XPW A;  3IV5 A;  3HKZ N;  4DYC A;  5FLV A;  1IUF A;  4MIM A;  5DS9 A;  4IHW A;  1NK3 P;  4GFL A;  1X2N A;  3NRG A;  2HOS A;  1K61 A;  3LSP A;  1RET A;  2D5V A;  1QVU A;  2G7G A;  2MG4 A;  3LSG A;  1UMQ A;  2X6O A;  4QIW N;  4JNN A;  2WUI A;  5FJ8 J;  3RD3 A;  3A03 A;  5EFY A;  1GUU A;  3SJM A;  3TP0 A;  4AC6 A;  5D1R A;  2TCT A;  2Y30 A;  4B1R A;  1TWA J;  1PUF A;  4BBS J;  5M3F J;  1ITY A;  4BBR J;  4JKZ A;  4MO7 A;  1QVT A;  5EDN A;  1VND A;  3O8H A;  2KDZ A;  2VPR A;  4G12 A;  1I3Q J;  1NK2 P;  1JKQ C;  2I10 A;  3I4N J;  5IP9 J;  2KT0 A;  4XID A;  2CQQ A;  2WV1 A;  3CCY A;  4C3J J;  1MBH A;  2ID6 A;  2LP0 A;  2LTP A;  4AC0 A;  3BQY A;  3WHC A;  5F27 A;  5IP6 A;  4UDS A;  2Y9Z A;  1TWG J;  2DMU A;  3JRB A;  2M2E A;  3A01 B;  2DMP A;  1A6I A;  4FE4 A;  4J19 A;  1JKP C;  4AYB N;  3F0C A;  5IOY A;  4XK4 A;  3JRF A;  3H0G J;  1B72 A;  2FQ4 A;  5EGO B;  3S2H J;  2ZOY A;  5M3M J;  4ICH A;  3OOU A;  4A69 C;  3NI7 A;  4D5C A;  3JRG A;  3CQZ J;  3PAS A;  2EQR A;  2DN0 A;  2G7L A;  2OPT A;  3BCG A;  3ANG A;  1ENH A;  1D5Y A;  2RHA A;  2L7M P;  2H1K A;  4FTH A;  3M4O J;  1WGX A;  1Z77 A;  3F1B A;  5F0H A;  1NTC A;  2DA6 A;  2UXO A;  3IH4 A;  1FIA A;  5C3E J;  4UUS A;  1WPK A;  4B3A A;  3O8G A;  2NOG A;  4M3D A;  3P9T A;  4MXM A;  3BRU A;  1H88 C;  2W53 A;  4A3D J;  2M9H A;  1UI5 A;  2JA6 J;  3BNI A;  1P7J A;  1T56 A;  3G56 A;  1VF9 A;  2QWT A;  4M3F A;  2XB0 X;  4A3J J;  3GTG J;  2CQX A;  2G0E A;  2MSY A;  3NNR A;  3JSJ A;  5EF6 A;  3V78 A;  1T33 A;  3JRH A;  1ETV A;  1AKH B;  3HDD A;  1SFO J;  3B6C A;  2R5Z A;  1Z0X A;  5CXI A;  3PO2 J;  3ZOB A;  3HTI A;  1YRN B;  3S15 J;  2YU9 J;  2WGB A;  2XRL A;  1AHD P;  2D6Y A;  2Y31 A;  2QIB A;  4GFK A;  3TED A;  2AHQ A;  2RAE A;  3LNQ A;  3FK7 A;  2FJ1 A;  2E2J J;  3VW0 A;  2Y0S N;  2GUH A;  3HOZ J;  1MBG A;  3VUQ A;  4S0H B;  4QSH A;  1GT0 C;  2OI8 A;  2EZL A;  3S17 J;  2NP3 A;  2CUE A;  3GTO J;  1VFC A;  2PMZ N;  1PUF B;  3ANP A;  2LLK A;  1JJ8 C;  3LOC A;  1JT6 A;  1MH3 A;  1ZKG A;  2HQ5 A;  5IP7 J;  1ETX A;  3RZD J;  1W0T A;  4RDU A;  3I4M J;  4RBO A;  4CYC A;  2GLO A;  4BXX J;  3QBM A;  1EF4 A;  1FTZ A;  5CW8 A;  1Q1V A;  2NVX J;  3GTP J;  2HOA A;  1MBE A;  3C07 A;  1XG1 A;  4DW6 A;  2JA5 J;  2JMW A;  4EEF G;  5FKM A;  1JGG A;  1U8B A;  1OCT C;  2NS8 A;  3NAU A;  3VPR A;  2N8G A;  3ZQC A;  3VVY A;  5C4Y A;  3L1P A;  5J3L A;  4GCL A;  3LWJ A;  1IV6 A;  2Y9Y A;  5C4J J;  1HLV A;  5IYC J;  4FE7 A;  4LOC A;  1RR7 A;  1B72 B;  4M3B A;  2HXO A;  3C2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...