4I6ZA

Crystal structure of the transcriptional regulator tm1030 with 24bp dna oligonucleotide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the transcriptional regulator TM1030 with 24bp DNA oligonucleotide
rcsb
source organism Thermotoga maritima
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4i6zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4i6zA02
4L62A 1DU6A 3MKLA 2Y2ZA 3RKQA 3HOWJ 4QSHA 3HTIA 1ZKGA 2JJ7A 2O7TA 4JP0A 5E3LA 2HOAA 2VPRA 4IEJA 3D1NI 3ANPA 2XGCA 3S1MJ 2QWTA 2LLKA 1JT0A 2JA6J 2F07A 1IUFA 1B8IA 2WAQN 1ETKA 1NK2P 4HNVA 1UI6A 1MSFC 4ME9A 3VW1A 2L0KA 2DA7A 3OSGA 3ZQIA 2GENA 3G56A 1QVTA 3KNWA 4B1RA 3A01B 1WGXA 3M3YJ 3TEDA 4A3LJ 1BL0A 2K40A 3I4MJ 2LD5A 3GTQJ 2NP3A 2DJNA 3FKIJ 1QRYA 2DMUA 2EZLA 2W48A 2ZOYA 2G7LA 1WI3A 4L5EA 2CU7A 3AQTA 3V6GA 5F0CA 5D1RA 2IBDA 1IJWC 1U9NA 3KZ9A 1ZTRA 1TWGJ 4JX6A 3FK6A 5FJ8J 4M3EA 3CCYA 3MNLA 1JKRC 2XGEA 4GFKA 2Y30A 2LTPA 5F1JA 1JKOC 3GTOJ 2DTZA 2TCTA 3G1MA 4AYBN 1WH7A 5M5XJ 5E3NA 1XC5A 4A69C 1FTTA 3I4NJ 3T6NA 2UXUA 5H9TA 2DA4A 1SGMA 1JUPA 4XRSG 3S1RJ 1D5YA 2OPTA 1FTZA 4C3IJ 1T33A 4DYQA 1JTYA 2W53A 2O7OA 5FKKA 5C4YA 3GTLJ 4UDSA 5AQCA 4CYCA 3OSFA 1SANA 2CQQA 4FE7A 3BR2A 3CMYA 2YU9J 1H89C 2YVHA 5IYBJ 5FLVA 2EZIA 2V57A 3NI7A 3LSJA 2NVYJ 3Q0UA 3TW6A 5HAWA 2K9QA 2EQRA 2HQ5A 1MSEC 3LSRA 1MBEA 5FKOA 3TP0A 3LNQA 2Y9ZA 3NPIA 4MIMA 1RPWA 2MG4A 4G12A 2Y31A 1MBJA 4D7NA 3EGQA 1JKQC 4EEFG 1O4XA 4W1UA 3BG5A 5GPAA 4UUSB 3HOXJ 5M5WJ 3W6VA 5J3LA 1IGNA 4A3JJ 3HE0A 5FKNA 5FMPA 2NS7A 5C44J 3E7QA 3BRUA 2IU5A 3A02A 3GZIA 2K9SA 1JUMA 3Q0VA 3OIOA 2M0CA 3A01A 4I76A 2JMWA 1X58A 3QPLA 3SFIA 2EZHA 4XIDA 4GFBA 1LFBA 3F0CA 1HOMA 2RHAA 3FK7A 2MW8A 2HDDA 3WHBA 3A03A 3H0GJ 3HKZN 3BQZA 4C3JJ 4MK6A 4MLOA 3S17J 5EYRA 5C3EJ 1AKHB 1IDYA 4IHVA 2YUSA 2B63J 2O8KA 3BTCA 1I6HJ 3BR3A 2ME6A 4M3FA 3JRBA 3ON4A 4UUTA 5F0HA 1ETYA 1HF0A 1Y1VJ 1EF4A 2CQXA 1POGA 5D19A 5DS9A 2XGDA 2LR8A 3HOUJ 3BQYA 1W0UA 3IV5A 2VUMJ 5FKMA 3HOZJ 3GEUA 4A3KJ 3GTGJ 3DPJA 4BXXJ 2JA7J 1OCTC 5IOZA 2NVTJ 2M9HA 2KT0A 1K61A 1FIPA 3P9TA 3BCGA 1JKPC 1UMQA 2M34A 5M5YJ 1HDPA 2M8GX 4S0HB 4QTRA 2XB0X 2OF7A 2VKVA 1ETWA 3QPSA 2RASA 2UXHA 2DA2A 2QIBA 3HB9A 2ECCA 2XPWA 4Y52J 2YVEA 3ZQFA 2ME0A 1VF9A 1G2HA 3VVYA 1DU0A 4IHYA 2COBA 3VOKA 3M4OJ 4DYRA 3RD3A 1TWFJ 4FE4A 2R0QC 3HGYA 2R7ZJ 1VI0A 1FJLA 3RZDJ 3HEFA 4KWAA 3VOXA 3BR0A 4ACIA 5GPCA 4UUSA 1BW5A 3CJDA 4A3IJ 2P81A 1U9OA 3BR5A 5M3FJ 3AQSA 3UKGA 2WUIA 4A93J 5IYDJ 3JR9A 1GVDA 1XG1A 1MBKA 2D6YA 3JREA 2OERA 4DZJA 1ETOA 2DA6A 2KDZA 2HOSA 3S1NJ 2AO9A 4C3HJ 3LHQA 3QBMA 3BTIA 4A3GJ 4MFDA 5EZGA 1A6IA 1LE8B 3LJLA 1H88C 4JNNA 4AC0A 1AKHA 2R92J 2G7GA 1TWAJ 3SDGA 3LOCA 1IV6A 2GM4A 4A3CJ 3ZQGA 2G7SA 3NXCA 5EEAA 1QPIA 1A5JA 5IP9J 2ZB9A 3K7AJ 2FQ4A 2I10A 5EDNA 1IRZA 4I6ZA 9ANTA 1IC8A 3GTKJ 3B6AA 1NK3P 3PASA 3PPBA 2Y0SN 5F0FA 3VW0A 3JRGA 2ZOZA 1ZQ3P 2JA5J 2Q24A 5EGOB 3VVXA 1Z0XA 1YRNB 4A3MJ 3RH2A 1GV2A 3VVZA 1TWCJ 2GUHA 3O8GA 2D5VA 2JN6A 2FD5A 2N8GA 3QQAA 2O9LA 1ETXA 4V2FA 3VUQA 2R5ZB 1UG2A 2MSYA 5BNGA 2VKEA 3S14J 5FHPA 5F08A 2NS8A 1AHDP 3OOUA 3S15J 2ZCXA 2G3BA 3C07A 3KKDA 4XK4A 5F04A 5J1YA 3S2DJ 4B3AA 1BJZA 1JJ8C 1I3QJ 1OFCX 2K9NA 3NARA 3G1LA 2FBQA 5IYCJ 2G0EA 2HI3A 5IOYA 3BHQA 4ICHA 1WCMJ 5IP7J 5JLWA 2XDNA 2E2HJ 2EH3A 2QKOA 4A3FJ 2QTQA 2CJJA 1OCPA 3IH2A 5JLXA 4A3BJ 3CQZJ 5K58A 5K7HA 2NVQJ 1LE8A 3ZOBA 4XICA 2NX4A 3ZQHA 3Q0WA 5HODA 2H8RA 1FEXA 5IPAA 4IHWA 5J1RA 3F1BA 1JGGA 1RESA 2R5YB 4NN1A 4A3EJ 2REKA 1HDDC 2DA3A 3RZOJ 1X2MA 1NTCA 5CXGA 3HIMA 5EFYA 1UI5A 1JJ6C 4C2MJ 4DYCA 3BG9A 4AUXA 4JX4A 1H8AC 2JA8J 3C2BA 2GFNA 2CUFA 5M3MJ 3S16J 2UXOA 1MH4A 1VNDA 2M2EA 3TW7A 2XB5A 1U78A 1RKWA 1PUFB 4XRSA 3ON2A 4V2GA 3HBLA 3LSPA 1SFOJ 1RETA 2E2JJ 4MXMA 5EGOA 1ETQA 3VW2A 2QOPA 5DAJA 5GP9A 1YRNA 3HOVJ 2AHQA 4X1EA 5EF6A 3JRIA 1K83J 1R9TJ 4B4CA 4AF5A 2L7ZA 1ZK8A 3CDLA 1APLC 2DMQA 4LOCA 1MNMC 4JL3A 3JRHA 2R5ZA 3V78A 3BTLA 5EG0B 3GTJJ 4JX5A 1QVUA 2NP5A 1ZGWA 4FISA 2IAIA 3IUVA 1HLVA 2FX0A 2LK2A 2ECBA 2TRTA 4CGRA 3O8HA 4M6VA 3BJBA 3JSJA 1JT6A 4XRMA 3BT9A 2WB1N 4DZPA 5K7ZA 2DMTA 2DMPA 3E7LA 2PBXA 3HGGA 5D18A 1Y1WJ 5C4XJ 3ANGA 1LFUP 2RAEA 4A3DJ 3HTAA 2LFBA 4PXIA 2LVSA 3BR1A 3PO2J 4D5FA 5E3MA 3JRFA 1HCRA 3K2AA 1GT0C 1MBFA 5J1UA 2HYTA 4GFLA 2CUEA 2PMZN 1WPKA 4RBOA 3GBGA 3DEWA 2EBIA 4ABZA 2XPVA 2ZCNA 2E2IJ 1CQTA 1F36A 3HM5A 3Q3SA 3VIBA 1S7EA 5CXIA 2UXIA 2MGQA 1B72B 2IEKA 2DG8A 5IP6A 1ZR2A 4MFEA 2R5YA 1OJLA 3FISA 1JTXA 4M3DA 1IG7A 3NNRA 1UHSA 2YS9A 1E3OC 2L9RA 2EZKA 2LY9A 3S5RA 4X6AJ 4JKZA 3EUPA 3VP5A 4GCTA 2PZ9A 2GBYA 4MO7A 4RDUA 5FGLA 2X48A 2L7FP 1PUFA 3VPRA 1X2NA 3B6CA 1MBHA 4BBSJ 5HSZA 5DTDA 3IH4A 3ZQCA 3MN2A 2WGBA 4GCLA 2ELKA 4M3GA 3S2HJ 5CW8A 3MVPA 2Y9YA 2HOTA 2HYJA 5F27A 1IDZA 4FCYA 4BKXA 3HOYJ 3BNIA 3HTHA 5FKLA 4HKUA 1WH5A 2OI8A 3BTJA 3FRQA 1Q1VA 1P7IA 5EG0A 2ID3A 2XPUA 3LSGA 1Z77A 1B8IB 2X6OA 1XS9A 3PO3J 2DG7A 4FTHA 2E19A 4QIWN 1W0TA 1ITYA 1BA5A 4YZEA 3L1PA 3WHCA 2GLOA 1P7JA 5E3OA 4BBRJ 2JWTA 4Y7NJ 1TWHJ 4BY7J 4IHXA 2XSDC 3G7RA 4J19A 2H1KA 1GDTA 1BW6A 2NVXJ 3NRGA 3SJMA 2CRGA 3DCFA 1U8BA 1ZR4A 1ENHA 4M3BA 2L7MP 5FLMJ 3PM1A 2X9DA 1MBGA 3TP3A 5C4JJ 1RR7A 2VI6A 1AU7A 4GCKA 2HXIA 4D7MA 3O60A 2UXPA 1TC3C 3CWRA 4NDLA 2DN0A 2QF7A 2HXOA 2DA5A 3FIWA 3JRAA 3ZQLA 3NAUA 1ETVA 1JUSA 2WV1A 3JRCA 3LWJA 3IH3A 4W97A 3GTPJ 2DMNA 1FIAA 4D5CA 2DA1A 5EZHA 4DW6A 2R93J 5HBUA 1B72A 3CRJA 4BY1J 4NELA 1MH3A 2NOGA 2FJ1A 4CYCB 2E1OA 1GV5A 1RKTA 2XRLA 2LP0A 2ZCMA 3B81A 2LKXA 3HTJA 1I50J 1T56A 3BR6A 3BG3A 3RQIA 5K7FA 3H3VK 2JK3A 4AC6A 1VFCA 3GTMJ 3KKCA 3HDDA 2ID6A 3JRDA 1F43A 2HKUA 2QCOA 3QKXA 1ORKA 3G1OA 4JYKA 1GUUA 3S1QJ 3COLA
chains in the Genus database with same CATH superfamily
2HEOA 4L62A 1DU6A 3MKLA 3H9JA 4OD4A 3FBNB 2H6BA 3TQNA 2RGVA 4UY8I 5H6RA 2O7TA 4JP0A 5HLTA 2Z1DA 2HOAA 2IA2A 4KIGA 2XGCA 1PP8F 2QSHX 2LLKA 2V1UA 4DBRA 2JA6J 1FYMA 1IZ1A 3NWSA 4PUSA 4ESBA 1B8IA 1ETKA 4ME9A 5GTIC 2QQ9A 3WG7H 2L0KA 2DA7A 2IA0A 3G56A 1X3UA 3HHGA 3TEDA 4A3LJ 2BGCA 1R6RA 3G73A 4BDZA 2EINH 1ZRCA 2DJNA 1IV8A 3PFYA 3MD2A 2E5NA 2XSJC 2EZLA 2HTJA 1WI3A 2X85A 2ZCWA 5KVRA 1NG7A 2A61A 4BXFA 3AQTA 2LF8A 2ZO4A 2KIMA 4XLCA 3EUHA 2KJCA 1TNTA 2M5WA 1YO5C 3KZ9A 1ZTRA 1TWGJ 1GXQA 4JX6A 3S8PA 1DQUA 2F5VA 1SFKA 3W6KB 2KFDA 2TCTA 4II3A 4AYBN 5M5XJ 1Z3YA 2IW5A 1P9QC 3I4NJ 2UXUA 1YOVB 2DAOA 2DFEA 1SMTA 3ZMTA 1SGMA 4AIHA 3S1RJ 1LQ1A 1FTZA 4C3IJ 1T33A 4DYQA 1Y39A 3HKZA 2W53A 3ZMSA 3J81K 4N9HA 3CD6I 3I0TA 4BE2A 3KE2A 5ICGA 4OOIA 2F5FA 1RUOA 3JTGA 3BR2A 1VQ4I 5IT9K 3J7AY 1H89C 2DT7B 2X51A 2NAZA 3FXLA 3K69A 2IGOA 3K4JA 3E6DA 2COMA 4UB6C 2V57A 4GYGA 2L4AA 1T38A 2EFPA 2HQ5A 3FZVA 3LSRA 1C0WA 3KP2A 3TP0A 3HPGA 2Y9ZA 4MIMA 1L0OC 2FNAA 1F4KA 4KUMA 3GLXA 2Y31A 4WIBA 1MBJA 4CXFA 4CYDA 1NG6A 3CC2I 2B7EA 1MW7A 3CCSI 1O4XA 4W1UA 1D1BA 4UUSB 3W6VA 3EYYA 4NC7A 1IGNA 1FYLA 6PAXA 2P8TA 5GAGJ 4CZCA 2OU2A 3ELKA 1TT5B 2IPQX 2RQPA 3SYTA 1SVMA 2IU5A 4U9NA 2L9NA 3S2WA 3OIOA 4A6EA 4H0EA 3A01A 4G7OF 2IXSA 2FE3A 3DKXA 2XF7A 1R58A 1X58A 3A0HC 4XIDA 1J2XA 4AIKA 5A2QK 5FLXZ 5LRRA 1WZ2A 2RHAA 2M3AA 2MW8A 2FJI1 1EJ9A 2HDDA 1T6SA 3WHBA 1S29A 1B6AA 1X1PA 1Z6RA 3MZ8A 4C3JJ 3I5UA 2QA4I 2L9SA 1S5LC 2DBBA 4PJNA 5E8GA 2ZY9A 4IVNA 2GA1A 4N4NB 3BR3A 2PMHA 2ME6A 2G9WA 3JRBA 5HS8A 2CYYA 1HF0A 4EVIA 5DS9A 4DNCA 3HOUJ 4LB5A 2XVCA 3HOZJ 3RPUA 1R1UA 2JA7J 1WJDA 1OR7C 3Q5FA 2VXDA 1HSTA 2M9HA 4HG2A 3QP6A 4B09A 1FIPA 2E35A 1GXPA 2KQRA 2LF7A 4HV5A 4Q47A 2M8GX 4II2A 4QTRA 4G6DA 3MMYB 3ZR8X 2VKVA 1ZLJA 3A1YA 2XHKA 5E1ZB 2DA2A 4OAYA 4IRHA 1W5CC 2A07F 2PJRA 1PP7U 3ZQFA 1VF9A 1G2HA 3VVYA 1GVJA 4IL6C 1USTA 3M4OJ 4LITA 1N75A 3L2RA 3ZXSA 3COAC 4NC6A 1MGTA 1G3YA 3I59B 1SVLA 3HEFA 4IOAF 1BN5A 4KWAA 1U0JA 1WJCA 3KP7A 4EJOA 1FSEA 1BW5A 2JT1A 3FXUA 2QBYB 3HRSA 3QOPA 1R71A 3FXKA 2KZGA 1U9OA 2DDAA 3BR5A 3AQSA 2IS6A 1T0FC 2WUIA 1BI3A 3GCMA 3WTZA 2WY8Q 1GVDA 1XMXA 4RM3A 2D6YA 3MKZA 4KA4A 2OERA 5TGTA 2STWA 3K8PC 5L3GA 1ETOA 5HS7A 3QBMA 2AO9A 4HSTA 3F23A 2UWMA 1OR7A 1R4MB 3AL0B 4MEYF 5F6FA 1A6IA 1R5GA 5H6QA 3DEEA 5FGMA 3MAJA 3GYHX 3JW4A 3H3ZA 4IHSA 5FROA 2DI3A 1H88C 4JOMA 1FBUA 2E60A 2G7GA 1RI7A 4RGRA 4A3CJ 3ZMZA 1B9NA 3K1PA 5EEAA 1XGOA 5D8KB 3E5UA 4CH7A 3ROUA 5DD4A 2GOXB 5EEHA 4OIPF 5CYVA 1U3EM 2I10A 1P4XA 2BV6A 2JVGA 2LDUA 1TW3A 1W36C 3B6AA 2G7HA 3EUAA 1HBXG 4EMSA 2J5OA 1LNWA 1ODDA 2LOOA 3DEUA 3I55I 4NC8A 1KQ8A 3WTWC 1T0FA 5GTHC 3ERMA 1MZBA 1YRNB 4BYYA 3ML6A 4XBFA 2GUHA 2D5VA 3M7GA 3JCUC 1W5SA 2FD5A 2WY7Q 1TZLA 3KYLA 3VUQA 1Z21A 4HA8A 3OL4A 2K86A 1TLHB 3FXJA 1AHDP 2ZCXA 2QENA 1LFPA 3H0DA 1IXRC 3BPVA 1Z91A 1BOBA 1F1ZA 3ZGKA 3VTIA 1JJ8C 1OFCX 2K9NA 3C2GA 2LNBA 5JR3A 1JE8A 1VQ8I 2V7FA 3OMYA 4L9TA 3BHQA 4ICHA 3ULQB 1WCMJ 4HF2A 3HRMA 3S93A 2XDNA 2E2HJ 1BI1A 2QKOA 4BNCA 2CJJA 4MTEA 1EH8A 4ZTJA 3C1DA 4A12A 5K7HA 4F55A 3X2QH 2CW7A 3ZOBA 3ECOA 3CJTB 5HODA 5IPAA 5F1RA 4UVAA 2AXLA 3HTUA 2M30A 4BS9A 2D2WA 3F21A 1SVOA 5K1YA 3RI4A 3C2HA 5EFYA 4C2UA 4QWQA 1JJ6C 2JA8J 2O61A 2PMZA 3GXOA 4KN7X 2VOPA 1I1GA 3C2BA 4IOCF 2CUFA 3NWTA 3KCCA 2GFNA 2OCCH 2M2EA 3TW7A 2XB5A 4FT8A 2HQRA 1W5TA 2ISYA 1RKWA 3ASOH 2OC6A 1Z05A 3KFWX 2DYSH 4A0XA 1OCZH 4PJLA 4UVCA 5EGOA 3O6BB 1K4TA 1B59A 3GUDA 2QOPA 3VW2A 5DD8A 1RRJA 4ENNA 2AHQA 2W00A 3I4PA 5D4SA 4CCOA 1UHWA 2EIJH 2K27A 2Y48A 3LA2A 4IRGA 2DMQA 4DBQA 3JRHA 2ZJ2A 3BTLA 3GTJJ 1O3QA 4BGDA 3HZJA 4FISA 1HLVA 2XGXA 1WWXA 2FX0A 3F8MA 1I5ZA 3O2PE 4Q48A 4M6VA 3BJBA 3U21A 4XRMA 2FXAA 2WB1N 3NRVA 1SAUA 2MYSA 3OV8A 4DZPA 3SEZA 1IN8A 2OD5A 5DCMB 5CVUA 4N4OB 1YS7A 1Y1WJ 5C4XJ 4A3DJ 2LC2A 2LVSA 2H6CA 2HOEA 3IHUA 1J7KA 4ITVA 3H3UA 3JRFA 2HYTA 1GT0C 4HRIA 3BZCA 2WAEA 2GZWA 3OYEA 3CCEI 4XSZF 4OD5A 2VC1A 2BZTA 3K2ZA 4BQQA 2BVMA 2K4JA 2R7DA 1U8RA 4ABZA 2XPVA 3R0AA 2QSFX 1CQTA 2OZ6A 2YR2A 1FYKA 2KISA 4YFKF 5DUKA 2DCEA 1B72B 5K5OA 1STZA 2DG8A 1UCRA 4G6TB 2Y69H 2BXZA 3JTHA 4Y3OA 1HXDA 3BWGA 1UHSA 1E3HA 2IP2A 3VOEA 2L9RA 1YJWI 3NQOA 1W7PA 2QVOA 1WRJA 2VBZA 3VP5A 4PGHA 3KIOA 2X48A 1PUFA 2CV2A 2PG4A 5TRDA 1L3LA 4BBSJ 4I98B 5HSZA 5J40A 3MFKA 2JPCA 4OIRF 5J4YA 3ZQCA 4P55A 3T5XA 3MZHA 1YIJI 3BC8A 3S2HJ 3MVPA 2Y9YA 3DKYA 5F27A 3E6MA 3QOEA 3Q9SA 2WTEA 2OI8A 1OCCH 3FRQA 1Q1VA 5ED4A 5EG0A 2JUCA 4QLCU 3BROA 2W82A 2MLKA 5DUIA 2JQ7A 2F4IA 2FBKA 2CGPA 1BA5A 4YZEA 3CMMA 3WHCA 1P7JA 2IT0A 4Y7NJ 1TWHJ 2H94A 2XSDC 4BHPA 1YG2A 3P7NA 2HNHA 2OQRA 2CRGA 3DCFA 2QGUA 1REPC 2HTSA 3LQRA 4M3BA 2E71A 5FLMJ 3K0LA 1R22A 1MJAA 4EGYA 1VQ9I 1RR7A 4UUVA 1X4OA 3AKZA 3GMEA 2VI6A 2ESHA 1IRGA 3O60A 3F6OA 2CO5A 3MQ0A 4L9JA 3CCLI 1TC3C 2UXPA 3CWRA 2JVHA 4CICA 3N97A 4XRFA 2LKSA 3H9GA 3NAUA 4ASNA 1KZHA 3L09A 4XLAA 4D5CA 2YPRA 1T98A 4YFXF 4BY1J 1Y8RB 4NELA 1UHMA 2FJ1A 4YEJA 4P9FA 2DFIA 2DOEA 1RKTA 3AG3H 4RGSA 2XRLA 3CUQB 2NNNA 2PEXA 2M4KA 2KLOA 2KRFA 1WHUA 3KZZA 3H92A 1Z6TA 3RJPA 3BG3A 3GFJA 5BQTA 4GDFA 3E6BA 2ID6A 2PJPA 1F43A 1IW7F 2EFOA 1I6XA 4AIDA 1FOKA 1TL8A 2VQCA 3W3CA 4QSHA 2BOLA 2E7WA 1KU7A 2JJ7A 4G9YA 2HDWA 2I5UA 2VPRA 1G8XA 2GXGA 4HPQA 3MCZA 3N05A 2QWTA 2IGMA 4XKWA 1VQPI 1JT0A 1P4WA 1IN6A 4IQJA 1NK2P 2QYOA 1MSFC 3F8BA 2CQ7A 3MWMA 4C2MA 3OSGA 2GENA 1QVTA 5B1BH 3KNWA 5HOOA 1YW8A 4B1RA 1WJ5A 1RUNA 4KYWA 3BJOA 4WCGA 3JAMK 1BL0A 4A0YA 3FM3A 4HF1A 1DGWY 2A6EF 2LD5A 3GTQJ 2NP3A 2O0YA 1QRYA 2W48A 2G7LA 2RQQA 3WU0A 3ZCOA 3CJQB 5F0CA 1FLIA 4D9JA 2IBDA 3CCUI 4N9IA 2V9PA 2XROA 4M3EA 5F1JA 3DBLB 3DU6A 2DTZA 1YIOA 2ZMEB 3LA7A 4LJZF 2HVRA 4A69C 5H9TA 3BP8A 3OIQA 4P5OA 1ZRDA 5DCFA 2VASA 1SD5A 3FWEA 3QP5A 1OPCA 5L3BA 2B9SA 2O7OA 1K78A 1O3SA 4OIOF 1CGPA 3F8CA 3OSFA 1D0YA 3REOA 2CQQA 3CMYA 2KPMA 4XOPA 2LRDA 1DPRA 1XDUA 3K4KA 4HYEA 5IYBJ 1T08B 2VT3A 3HIFA 2YVHA 5FLVA 2EPFA 2Z2SB 3LFKA 4BEHB 2NVYJ 3TW6A 2FBIA 5HAWA 2K9QA 2R7FA 2EQRA 2Y75A 2V26A 3SXYA 3VFZA 1LPQA 1MBEA 3BCBA 5K5RA 3LNQA 5ICEA 3NPIA 1RPWA 1OYYA 4G12A 2ZJQF 2VPLA 4B43A 4ETSA 3B73A 4LG0B 4CCKA 1R1VA 4BH9A 1KQ0A 4ZYEA 1ZG1A 2FEZA 4UB8C 1KU3A 1EV7A 3LSTA 3DV8A 5J3LA 3V8JA 3MKWB 4HQMA 4IX7A 1QZEA 5GAEJ 4A3JJ 2DK8A 1K7AA 5FKNA 2IVMA 5FMPA 1E2XA 3E7QA 3AG4H 3H5NA 4RB0A 5E79C 4HZFA 4EJVA 3CUOA 3W2WA 2JMWA 3QPLA 2FOKA 4NQWA 3TGNA 3F0CA 3T8RA 3WTTC 4G7HF 1X1AA 2STTA 3AFHA 4M6XA 4GCVA 4E70A 3HKZN 3H0GJ 4ENMA 3I71A 3QPTA 3LMMA 3S17J 1R36A 4IHVA 2FRHA 4IKFA 2V9KA 3W2AA 2A3SA 1ZRFA 5FD6A 4UUTA 3OYLA 1Y1VJ 3DFGA 2Z5UA 3CMAI 4LK0F 2CQXA 1OMIA 1POGA 3GFMA 2DLLA 2L3DA 4KN4X 1X1DA 5E18F 1FSHA 3BQYA 1W0UA 1D8KA 1JI8A 2UUZA 3DTEA 4MQ9F 2X6WA 5E8IA 5ICCA 3DXJF 2QQBA 3CJNA 4BQAA 2BY3A 2P7VB 3CLOA 1K61A 3P9TA 1OLTA 3BCGA 3DQVC 1UMQA 2M34A 2YSRA 4L9NA 1JKPC 1MD0A 2OF7A 2ADUA 2MBFA 3K70C 1QO0D 2UXHA 3OL3A 1G4DA 1LDDA 3OYNA 3HB9A 5BOXA 2LBFA 2YVEA 2ME0A 5IY5H 1DU0A 4M73A 3HTSB 3VOKA 1PJRA 3RSNA 2GWRA 4DYRA 4F92B 1MJ9A 4PSWA 2XAJA 3D0SA 3HGYA 4LFUA 2Y0SA 3WTUC 1FJLA 4ACIA 5GPCA 2W7NA 4U0VA 3IUOA 2ZXIA 5FD5A 2P81A 3KZYA 1JHHA 4G8XA 2R7TA 4HLYA 1FNNA 3KEYA 5IYDJ 4LLNA 2JRTA 3VYRB 1XG1A 1MBKA 2P5LC 3OYFA 1D8JA 2RDPA 2OCEA 1AA7A 3I64A 2DA6A 5LLQA 2HOSA 3S1NJ 3TL4X 1U5TB 1YLFA 3RKYA 1XDSA 1J0RA 2F6CA 4RAFA 1N77A 3LJLA 3OR2C 1ONVA 3DPTA 4E7ZA 2BY1A 4AC0A 1ULYA 1AKHA 4EJTA 2R92J 3KYCB 3VB2A 3E5QA 1TWAJ 1IV6A 4PJMA 2XAFA 3ZQGA 4HNUA 5FRNA 1B9MA 2QUFA 2VJ5A 3RDIA 1QGPA 4CGZA 2XUBA 1FZPB 3IRRA 4GRIA 2FQ4A 3BY6A 4L9VA 3PASA 3PPBA 1X1BA 3RIRA 2JPBA 2CV1A 4XNFA 1TTYA 5D5XB 4XORA 1ZQ3P 4D1QA 5DYMA 3M8FA 3EUKL 2BYVE 3HRTA 2RC4A 3VVZA 2M4GA 3O8GA 2M8EA 2XDVA 1X4PA 4BJ6C 4O3MA 2JN6A 2PFBA 2CG4A 3QQAA 1YS6A 2BW3B 4F93B 3HOTA 3P9IA 1RC9A 1V3FA 3Q9VA 3H1CA 3HUGB 2Q2EA 5BMZA 5HDNA 4IRIA 2VKEA 1Z9CA 4I0AA 2PLYA 5FHPA 5F08A 1TNSA 2A68F 3WE2A 4ESJA 3KKDA 1XPXA 2M7AA 1WJAA 4WXDA 5F04A 1KYZA 3OYAA 1Y0UA 3PL8A 1ZG5A 1BJZA 3PQJA 2ZSHB 3KX2A 4XOTA 4XLPF 3EDPA 2G0EA 3KLNA 2EV6A 5IOYA 1AWCA 1ZH5A 4P1WA 4CCLA 1BR1A 1IN7A 4B8XA 1P92A 5JLWA 2EK5A 2EH3A 4J00A 4A3FJ 2H09A 1Z7UA 3IH2A 4A3BJ 4LMYA 4PJ0C 1LE8A 4XICA 2EILH 4PJJA 4EQQA 4A0ZA 1FEXA 1XGSA 4AWXB 3AG1H 3F1BA 1JGGA 1ERDA 1MMNA 2DQRA 2R5YB 4NN1A 4A3EJ 3UR3C 1YHQI 4JK1X 2XKOA 3HIMA 1UI5A 1R00A 3W6JB 4C2MJ 2E5ZA 2VJIA 2DQLA 3IWFA 1WSUA 5LEJA 5CVVA 4HNTA 2LKPA 3GZ5A 1MH4A 4NHJA 3GVAA 1O57A 3P9CA 1ZELA 4LLGF 2E1MB 2BHZA 3GWZA 1N25A 2XAHA 2EFNA 1ZLKA 3LSHA 4V2GA 3LSPA 3ERED 1XSDA 1SFOJ 1RETA 4YELA 3QYEA 3J81Z 3CF5F 2E2JJ 1ETQA 4MXMA 1TQPA 1WKMA 5GP9A 1SEUA 1XGNA 1WI9A 5IT9Z 5LGTA 4L5IA 4AM3A 4B48A 1K83J 3TO6A 1P4AA 4B4CA 3OS1A 2HWVA 2F4MB 2L7ZA 1ZK8A 3CDLA 2LH9A 2MD5A 3HYIA 1APLC 2KDOA 4JL3A 4LOCA 1IO2A 3DPLC 2R5ZA 1RZ4A 4RAGA 3H5AA 4ESFA 4JX5A 2VQGA 1MDMA 3MZYA 5HVQC 2IAIA 2L4MA 3F3XA 4LD5A 3RQ4A 3FXMA 2TRTA 3IUVA 5F64A 2EB7A 3O8HA 3FX3A 4ZJZA 2ELHA 3BT9A 4CHUA 1X3ZB 2Q1ZB 2H1LA 3IKVA 2NRAC 3E7LA 4AIJA 2PBXA 2RVCA 1WVRA 3HGGA 4EM1A 5CKTA 3ANGA 1LFUP 4ZDLA 1Z3XA 3TKYA 2F2EA 3OYGA 3SZPA 2K7LA 2GAUA 5E3MA 2HVSA 2QKLB 3D5RC 4ZYHA 5BPDA 1MBFA 5J1UA 2HPMA 1BOAA 2CUEA 2PMZN 1WPKA 3F72A 4CA0A 1J5YA 4RBOA 3GW2A 1QHHD 3DEWA 4F52A 2VBWA 3HM5A 5A2QZ 4NB5A 4M9SA 1WJEA 3FMRA 4NNJA 4E7LA 1ZARA 4I0BA 5KK1A 4Y33A 2MGQA 3J7AO 2VQLA 2XAUA 4Z2YA 4E6KG 3GX4X 2R3SA 1ZR2A 1D0ZA 4RLQA 3IP4B 3K1MA 1HQCA 5D6EA 5CVRA 2GIZA 1IG7A 4BJ5C 3PNVA 5ICFA 2LY9A 1HKSA 1R4NB 4IF4A 1V54H 3EUPA 2EA2A 4RDUA 3V7RA 5FGLA 2V9VA 3L2UA 1X1CA 1K4SA 1X2NA 4QPOA 3KYDB 3IH4A 4RGXA 2WGBA 1USSA 4RLFA 1YI2I 5FO5A 5JHUA 3RCOA 4U87A 4FCYA 1IDZA 4RAYA 3S3NA 4XKVA 5FKLA 4HKUA 1MMGA 1WH5A 2L54A 3BTJA 3HOSA 1DGRM 3DWLE 1B8IB 3S3OA 1FX7A 2LSOA 2X6OA 1I27A 1XS9A 1FC3A 4NUBA 2E19A 1IXSB 3HSEA 2W57A 1B4AA 3L1PA 1VQNI 1RNLA 5E3OA 3DLLF 2JWTA 1HC8A 4J19A 3F9KA 2I8DA 2KRCA 2H1KA 4KIFA 3KEQA 1PDNC 2NVXJ 3NRGA 3SJMA 1U8BA 4EATA 2X6YA 3ZPLA 2L7MP 4MNUA 5C4JJ 2WAQA 5ILVA 1PUEE 2NXNB 1FP2A 4CO8A 4NDLA 2HXOA 2DA5A 3JRAA 1ETVA 1JUSA 2WV1A 1VQOI 3BLYA 3IH3A 4W97A 3PNTA 3LWJA 4IPAA 2R7XA 3VWBA 1FIAA 1LEBA 3RYPA 4CSWA 5EEGA 4DW6A 2R93J 1JXSA 2MH2A 1UB9A 3CRJA 1MH3A 4IO9F 3GO5A 4ZZDA 3VDXA 1GV5A 1HKTA 3ZN1A 2ZNYA 4HDVA 4XLHA 3A0BC 2K9LA 1T56A 4LG3A 4PCQA 2BE5F 4RM2A 2R7WA 1VFCA 3R4KA 3F8FA 2UXNA 2MABA 1WGXA 1CF7A 3V78A 2HPIA 5AIPA 4E7KA 3RKQA 2QLZA 4XN3A 1FT9A 2V1NA 4IEJA 3RPUD 5LHGA 3D1NI 2UZKA 4C9YA 3TO9A 3S1MJ 2L2OA 2LY1A 4YIFA 2DXIA 2DO7A 2F07A 1IUFA 1IRXA 2L01A 3U9GA 4HNVA 4AVZA 3A4CA 4Y4RA 1SFUA 5KCMA 4N0BA 3A01B 5LFAA 1K79A 4L0YB 3M3YJ 2OJED 4KMUX 2V6EA 4DGWB 2K40A 2K5CA 3FKIJ 2MC4A 3J80K 2ZOYA 1FOXA 5KAFC 1ZYRF 1A04A 4L5EA 4D0PA 3V6GA 1LEAA 5JI6A 5D1RA 2IJLA 2CUJA 1XSXA 3KLOA 3BPXA 1U9NA 2AXTC 2LG4A 2VB6A 1BM9A 5EJCA 3BJ6A 2R7QA 5FJ8J 1JKRC 4F91B 2XGEA 5LRSA 1JGSA 2Y30A 1JKOC 5CJ9A 3G1MA 2E7XA 1Z7LA 5E1XA 3WU2C 2JUGA 2DA4A 4FETA 2ZJPF 4KT6A 1D5YA 2OPTA 4V19K 2QZ8A 4OU0A 2YX7A 5JHFA 5FKKA 3GTLJ 2DJIA 4XR6A 4CYCA 1S8NA 1SANA 1G3TA 2MLGA 2V6CA 2FUG2 4GYIA 4CZZA 2YU9J 1YFHA 3IC7A 1MMAA 3LQQA 4RB2C 1HW2A 2P6TA 2X4HA 3CLQA 3DLAA 4BE1A 2YX4A 2EZIA 3TO7A 3NI7A 3LSJA 2CS3A 2KMUA 3LSKA 2DFFA 3GFIA 2XIGA 1MSEC 1YW7A 1BR2A 4E4HA 4BE0A 2MG4A 2KP6A 3OYBA 3WGIA 2VE8A 1XTAA 3H5RA 1HW1A 1G3SA 3E1SA 4U9LA 4M74A 3BG5A 4XQFA 5LD2C 4BL0B 4RMNA 4RGUA 5E20A 4LB6B 3FXQA 1I1SA 3IAM2 3CCVI 2NS7A 5C44J 2LREA 2GA2A 2L02A 4OIQF 3A02A 2OUMA 2K9SA 1JUMA 3PSFA 2FMYA 2R7UA 4I76A 2PBIA 2HZDA 2EZHA 4GFBA 2RN7A 4I99C 4Q4ZF 1VTNC 3PJRA 1FWZA 1FMVA 4FX0A 5DEQA 2TDXA 3A03A 4M72A 5CQEA 3BQZA 2CH0A 3ASNH 4MLOA 2JRMA 5C3EJ 2CW0F 3R6SA 1IDYA 3OYKA 3CP2A 3E6CC 3SZGA 2B63J 3BTCA 1IN5A 2IRFG 4UNOA 4TV7A 3H36A 1MNDA 3ON4A 1SMYF 5F0HA 1ETYA 5FB2A 2D1VA 2LYCA 1X3WB 2LR8A 1XCVA 2VUMJ 1J09A 4OWRB 2PN6A 5FKMA 1TQMA 3GEUA 4R8HA 4A3KJ 3GTGJ 2EV0A 3E0JB 2B0LA 5D5WB 3DPJA 2P5KA 1WQ2A 1OCTC 1W36D 2DU9A 2B1EA 2KT0A 2IGNA 5M5YJ 1HDPA 4S0HB 2VKDA 3GEZA 2QQAA 1ETWA 4B3XA 3CZ6A 1S9HA 1IXCA 3VYUB 3ZP5A 3PUFA 2DFHA 4KIBA 2IS4A 2ECCA 2XPWA 4Y52J 2D45A 5JVTA 2CUZA 4GO1A 2HR3A 3WTXC 1KU2A 2PMUA 1XD7A 3OY9A 1V55H 1TWFJ 2G7UA 3ZRGA 4DIQA 1LUJB 4AU7A 3CJRB 5D8LB 2R7ZJ 3V7SA 1VI0A 3RZDJ 2W25A 3QRFF 3DTKA 4I09A 4UUSA 3CJDA 4ZC3A 1T39A 4A3IJ 4O5VA 1ZGJA 3UKGA 1WJBA 3OIPA 4I7HA 3JR9A 4MQVA 4KJZA 1S3JA 2DDBA 1T95A 2H8WA 3OYIA 3P5JA 3FDYA 1QA6A 1P6RA 2KDZA 4IJAA 3ZMVA 1KU9A 3LHQA 3BTIA 4A3GJ 4MFDA 4HW0A 4XL9A 2VC0A 4L0ZB 2ZXWH 1K6YA 2Z3YA 1MJBA 2HKOA 3LWFA 4H4KC 2O03A 1TP4A 3I9V2 1AOYA 1R49A 2DOFA 3ABLH 3K4BA 1NHAA 2FU4A 4JNNA 4BDYA 2CW8A 2CQKA 3VSLA 2M7BA 1H9GA 2KIFA 3MEXA 2EIMH 3OYJA 2R7SA 2EA4A 2KKOA 2G7SA 2GM4A 3NXCA 1OYIA 2M87A 2VXZA 1VQMI 2O3FA 2ZB9A 3ESWB 1IF1A 5EDNA 2HU9A 2V79A 3M8EA 2XAGA 4I6ZA 1IC8A 3K9TA 1RIOH 1NK3P 3EYIA 3V4GA 1XN7A 2Y0SN 3VW0A 1SFEA 3AL0C 3DBRB 2JA5J 1G6NA 3ZN0A 5EGOB 5HLIA 2X0LA 4G7ZF 1R1TA 3PIOF 1BJAA 3RH2A 1GV2A 4OAZA 2OTJI 3ISPA 5IT3A 3IKTA 3SZTA 1ETXA 4V2FA 1UG2A 2MSYA 3I3LA 2XF6A 2F4OB 3CESA 2FMLA 4HAMA 2MFZA 2MD0A 3GF2A 4HV6A 1IUYA 3CDHA 3FM5A 4AVPA 2NS8A 3I59A 3OOUA 3S15J 3QWLA 1W7PD 3C07A 1SD4A 3S3MA 4XK4A 4B44A 3KPHA 3BG6A 2QBYA 1FOYA 4A5MA 5J1YA 2P6SA 4DQ2A 3S2DJ 2R7VA 4KT5C 1K6OA 4YIRX 1I3QJ 3NARA 3G1LA 3L2VA 2VN2A 2HI3A 3IAS2 3LSMA 3CCJI 3IL2A 3EQLF 3T8TA 3QU3A 3JAMZ 5JLXA 4JBAA 3CQZJ 4FQGA 5K58A 2NVQJ 1U6GA 1N78A 4HBLA 3ZQHA 2H8RA 3G3ZA 2DK5A 4IHWA 5AIQA 2REKA 3M8JA 2IS2A 4ZYDA 2MC3A 2AQFA 2DA3A 1X2MA 3TOAA 1S72I 3RZOJ 4LK1F 1XGMA 3G6EI 2ZNZA 4DYCA 1SC7A 3BG9A 4AUXA 4LLLA 3RKXA 2UXOA 1W7PB 3WGGA 1U78A 1QNTA 4E7IA 1PUFB 4E7SA 1BC7C 1G59A 3LA3A 4FX4A 1BIAA 1R23A 3F8NA 2EV5A 1A31A 5ILSA 3M9AA 5DAJA 1YRNA 2JTVA 3KP3A 3DF8A 3UNGC 4X1EA 5J4VA 5EF6A 3GFLA 4Y17A 4XMYA 2GOMA 1VQ7I 1UFMA 2VE9A 4CDGA 1V4RA 2MH9A 3KP5A 5EG0B 3L2WA 4GGGA 3KP4A 1ZGWA 2ZFUA 4X0GA 2HGCA 1O7FA 3VEPA 4BQOA 2LK2A 5DM7F 2RNJA 3ABUA 4YIIA 1JT6A 2VJ4A 5CPRB 2FSWA 4L5JA 5FLXK 3L00A 5K7ZA 2X1EA 2DMTA 2DMPA 1UJ8A 3T0YA 2P0WA 5D18A 1SFXA 3TDZC 3VSKA 1GLNA 2RAEA 4LGWA 4PXIA 3BR1A 2F5EA 2ICWG 3PO2J 1PVEA 2HKXA 4GFLA 1KYWA 5L3DA 2BXYA 3GBGA 2H27A 3K6GA 2C6YA 2QKMB 2Z9OA 1XCBA 4E7JA 1YJNI 2X1DA 3CF2A 2E2IJ 1F36A 2ZCNA 2ESNA 3Q3SA 3V8KA 3VIBA 3U1DA 2KIUA 1S7EA 1ZHFA 3CO6C 2CQNA 1Q1HA 2K02A 4KFCA 2W4SA 2MA3A 4U7DA 2IEKA 2EFQA 2D1HA 5IP6A 2XRNA 3K4MA 2OBPA 4L18B 1OJLA 1SD6A 2DYRH 3FISA 4JQFA 4PGGA 4ZZLA 4RB1A 1GHCA 4M3DA 3NNRA 2YS9A 5LGUA 2UXXA 2EZKA 4DVYP 3WG9A 4X6AJ 3OS2A 4JKZA 1E3PA 2HYFA 2PZ9A 4MO7A 5J8FA 2A5YB 2P5VA 2L7FP 3VPRA 3B6CA 2ZC2A 5FFZA 2Z33A 3VYSB 3MN2A 3QYFA 4GCLA 4M3GA 2L5QA 5CW8A 1TT0A 1F9NA 2OA4A 2HOTA 3PSIA 1ON1A 4RAZA 2F5CA 3FHNA 4CCNA 2YVXA 2V4JC 3L2CA 3HOYJ 2ACJA 3BNIA 3R0JA 1Y56A 1YX5A 1FP1D 2LY2A 1P7IA 5FFXA 3LSGA 1VQKI 1Z77A 3CDIA 5CLSA 3PO3J 4FTHA 1YQAA 1LKXA 1W0TA 2DOAA 1LVAA 1WFXA 1HKQA 3G4SI 4ON0A 4BBRJ 4PSXA 4BY7J 5TISC 5DCMA 4C30A 5CVJA 1BW6A 1ZR4A 1ENHA 4M9ZA 2GQQA 2EFWA 1J9IA 3LL7A 2ZXJA 5CQGA 3CCMI 3TP3A 3OS0A 4R79A 2RKHA 1AU7A 4GCKA 1EA3A 4D7MA 2JSPA 2DODA 2KHMA 2DN0A 1M1EB 1W4MA 3FIWA 2W85A 4I2OA 3ZQLA 1J59A 3CP8A 3GTPJ 2DMNA 1EH7A 4YFNF 1B72A 5D4RA 1XSVA 1K78B 2NOGA 5HS9A 2K3PA 4EV0A 4UV8A 1WJFA 2LP0A 2Q8KA 4F3QA 4J01A 2ETHA 5L3EA 3FBIB 3B81A 2LKXA 3HTJA 1EKEA 4AYBA 3BR6A 1R7JA 1YTYA 1LDJA 3B02A 3H9QA 2W1OA 2HQNA 2M1BA 3QAHA 1FPQA 3JRDA 1J75A 3QKXA 4JYKA 2FA5A 1ZG3A 3HSRA 2Y2ZA 3FXOA 2WA0A 1HW5A 3HOWJ 3HTIA 1ZKGA 4XKBA 5HDGA 1DPUA 5E3LA 2K3FA 3K4LA 3ANPA 4Y13A 3W2VA 4CCJA 1S6LA 2WAQN 4MEXF 3QYBA 1UI6A 3CUQC 3VW1A 4QPQA 4HX4A 3ZQIA 2WWYA 3CMEI 4ZH4F 4ZDOA 3HHHA 3I4MJ 4NQWB 3ABMH 2DMUA 3WGHA 3J7YJ 1P2FA 1OYWA 4UHTA 4YG2F 2CU7A 4OMZA 1MNEA 1MKMA 2LMDA 2NOJB 1E17A 3CCRI 2FQ3A 1IJWC 1UG0A 1SD7A 1X19A 4HF0A 2W24A 3FK6A 3TOBA 2R7RA 2FBHA 3DP7A 3CCYA 3MNLA 5B66C 1EH6A 2HYGD 3BZ6A 2KIQA 2LTPA 4GFKA 3VYTB 3WTVC 3A2KA 3GTOJ 1WH7A 5E3NA 4A2UA 2NS0A 4YRVA 1XC5A 1FTTA 2A2FX 3T6NA 1D1AA 2BY2A 3JSPA 1IRFA 1JUPA 3LSIA 3C18A 4XRSG 4KMFA 2BBYA 4WXHA 4ENJA 1JTYA 4PK4A 5H20A 3DU5A 4UDSA 3DTIA 5C4YA 5AQCA 1SAXA 5LGNA 1Y8QB 4HQEA 1R5HA 4FE7A 3ABKH 2VIXA 4IQ4A 3CUQA 3R61A 2VOOA 2PQ8A 1FMWA 3FMSA 4ANJA 5HNHA 4IXAA 1FBQA 3Q0UA 3K70D 1BR4A 2LBFB 2ISZA 5FKOA 3FKJA 2E1CA 2ZMEC 5TJJA 3GZ6A 4UXNA 2XASA 2ZFWA 5L3CA 3KP6A 1YW9A 3LFUA 4D7NA 3I54A 1VQ5I 3EGQA 1JKQC 4EEFG 1OQYA 2VT2A 4XM3A 2WADA 2CMPA 5GPAA 2CFXA 3HOXJ 5M5WJ 4RS8A 1FY7A 1D3YA 2F48A 4MTDA 4DOZA 1QBJA 4C2TA 3AG2H 3IRQA 3HE0A 5L3FA 1FBSA 5ERIA 2R4GA 2CV0A 3BRUA 4NBQA 3GZIA 2VKHA 3Q0VA 5D5UB 2M0CA 3KETA 2Y0MA 3SFIA 2O8XA 1T8IA 3DPUA 4PDKA 1LFBA 2A69F 3ECHA 3HXLA 1U2WA 2RV8A 1HOMA 3FK7A 5DV5A 4CUGA 2AQEA 1XB4A 2J5PA 3RPQA 1YJ9I 3N4MA 4MK6A 5EYRA 2HFHA 1LVKA 1AKHB 2YUSA 3HSFA 2O8KA 3K4NA 1I6HJ 5E1WA 1BI2A 4M3FA 1KA8A 3QPHA 2XAQA 1EF4A 4O6JA 2ZMEA 5D19A 3E5XA 1JHFA 2XGDA 2HVQA 3IV5A 4BAYA 1BC8C 3ZMDA 4IRVA 3BCAA 4BXXJ 3SHFA 3WU1B 4FHTA 4EM0B 5B3SH 2K9MA 3RYRA 3L9FA 5IOZA 2NVTJ 4HDUA 4XKCA 2XF5A 1Z67A 3HG9A 2XB0X 1NH3A 2FNPA 3QPSA 2K4BA 5HDKA 2A5WA 2NNYA 4WWCA 2XKPA 2RASA 4ENKA 2DW4A 2QIBA 4G6QA 3L2QA 4BEHA 3C3WA 1RR8C 3H35A 5HLHA 2PX9A 2ZKZA 2ZSIB 3V7CA 2COBA 1UELB 3SFZA 4IHYA 1D5VA 1G3WA 3RD3A 2Q2EB 2QQ8A 4FE4A 2R0QC 1VQLI 2WBMA 2KJBA 3J7ZI 3S32A 4LG0A 2Z16A 3TDUC 5BS6A 2VLAA 2AS5F 3BR0A 5HNFA 2QM3A 3OWTA 4GXOA 4XN0A 3G71I 3VOXA 1BIBA 2OTLI 3OR1C 5K5QA 5M3FJ 5BPIA 4A93J 1OKRA 3V8LA 3AAFA 3CC4I 3OYCA 2V1XA 3D5LA 3JREA 5DM6F 1I3AA 2YU3A 2OAZA 4K2EA 5AONA 4DZJA 2DPDA 4WF2A 4C3HJ 4A6DA 5EZGA 2WAFA 3K10A 5KNLA 3F22A 1A36A 2IA1A 1VQ6I 3D5SC 1LE8B 1BI0A 1FOWA 4BHCA 3U1KA 4XONA 3NS4A 4EM2A 4OMYA 1TW2A 3SDGA 3LOCA 5E17F 2VODA 2W84A 1QPIA 3PFIA 5IP9J 1A5JA 2VL8A 2IGKA 4XLEA 4BACA 3ZMUA 3K7AJ 1IRZA 1HSJA 2ZBKA 1S7OA 2GXBA 4KNYA 9ANTA 1H0MA 3PQKA 5J47A 4HX8A 3GTKJ 3K4CA 1Z1DA 5F0FA 4U7BA 3JRGA 5D6FA 1U5TC 2PJRB 1KGSA 2ZOZA 3BG7A 2EWNA 1QU3A 4EJUA 4HOBA 3BZKA 2Q24A 1DDNA 3VVXA 3HPHA 4P96A 1DP3A 1Y0NA 1Z0XA 2XV4S 4UV9A 4ZYAA 2HQAA 4A3MJ 3GZNB 5LBQA 1TWCJ 2FOWA 1MMSA 4XLNF 1D1CA 1YE9A 2P4WA 5B1AH 4LIVA 1MMDA 2N8GA 4PFPA 2EIKH 2O9LA 2R7OA 2OV7A 2R5ZB 3FXRA 3JSOA 1MDMB 3HC7A 5BNGA 1XMAA 3RKWA 3S14J 3KZIC 2E1NA 3G2BA 2VJJA 4R1HA 2QEXI 2JA2A 4LIUA 2CWEA 2G3BA 2RREA 5JVGF 1ZREA 4Y15A 3SQNA 5GAHJ 4B3AA 4PZJA 2PI0A 2FBQA 3LAJA 1VZ0A 4XSXF 1ON2A 5IYCJ 3SWHA 4F7ZA 4I02A 1O7LA 4BU2A 2O5RA 5IP7J 3NEUA 2E36A 1U5TA 1ACIA 2E34A 2QTQA 1OCPA 5JFRA 4BHBA 4BQNA 3J80Z 3WTSC 4OINF 2WB1A 2HDCA 4BJTA 2NX4A 3Q0WA 3WODF 2IS1A 4U0WA 4P9UA 1BBYA 2BY0A 5J1RA 1H9TA 5ILUA 2L7KA 1RESA 2GIVA 5H2FC 3IWZA 1HDDC 1B1BA 3DBHB 1IN4A 1O3RA 1NTCA 5CXGA 1H8AC 4JX4A 2VBYA 5M3MJ 3S16J 1VNDA 5J8CA 2M45A 2VBXA 1UAAA 4B47A 2O6GE 4XRSA 4E7HA 3ON2A 4EGZA 3HBLA 2M0MA 1YYVA 2B3WA 3L7WA 5KHDA 1TBXA 3EETA 3SDBA 1KQ9A 2HS5A 4U0YA 4XLFA 4S04A 4U88A 3HOVJ 3JRIA 4WK8F 1R9TJ 4AF5A 1Y6IA 3FF5A 1MNMC 4G94A 5DDGA 2BW3A 1QQIA 3RTRA 3P9KA 1QVUA 2NP5A 1OCRH 3HUGA 2PFVA 2ECBA 4CGRA 2F5DA 2A6TA 2X6XA 3JSJA 3U2RA 4HX7A 3CO7C 2WV0A 5LEKA 2QWWA 4KICA 2DTRA 3GLLA 5J6XA 2E1MC 1W1WE 2V1DA 4A5NA 3PIPF 4M9XA 4HLXA 2KL4A 4FASD 4Z6YA 1V5FA 3HTAA 2LFBA 4EJWA 5FRMA 2K85A 4D5FA 3DKWA 1HCRA 3K2AA 4IZZA 2L9VA 1QZYA 1HA8A 2QSGX 1QPMA 1V5EA 2EBIA 1DP7P 5CXIA 2OZUA 3PNYA 2UXIA 2KZVA 5B5EC 2JZYA 3I56I 3HL2A 1LDKB 4MFEA 2R5YA 3M1CA 1JTXA 3WE3A 1UZCA 3BJAA 3SEQA 4KDPA 2Q0OA 1E3OC 3CC7I 5CVIA 2DT6A 3S5RA 3ZQ7A 1LB2A 3TMOA 3O3KA 2X1CA 4GCTA 2A05A 2GBYA 1YX3A 3CTAA 1YITI 2BVLA 1MBHA 3I58A 1QHGA 2XC7A 1A6QA 3OOPA 5DTDA 3ABTA 1OISA 1CF7B 1ZGAA 1KONA 2ELKA 4WXCA 4ZDPA 1TQIA 1V5GA 2BHYA 4ZTFA 4RA2A 2HYJA 2VONA 4WX9A 1S7AA 5GADJ 4IHTA 4PFOA 4BKXA 1I39A 3HTHA 3WTYC 1LJ9A 1DUXC 4KITB 2ZXHA 3HRUA 1O3TA 2ID3A 2XPUA 1QZZA 2RNGA 2DG7A 4QIWN 3CCQI 1ITYA 3ZQQA 3VODA 3BDDA 3OYMA 2GLOA 3OYHA 3MKYB 3M1EA 4IHXA 3G7RA 4CCMA 1XMKA 3LAPA 4RB3C 1GDTA 4ZYGA 4M71A 2JSCA 5HLGA 2GXAA 3M07A 3BOQA 3QODA 5KAIC 3EPZA 3PM1A 2BEOA 2X9DA 1MBGA 2EJRA 4M6YA 5LHIA 5LHHA 3I53A 3FHZA 2DT5A 2HXIA 1OCOH 4HEA2 2P7CB 2UV1A 2QF7A 1D0XA 4Q5SF 3R60A 3JRCA 3PUBA 4AD9A 4KISA 3ONQA 2Z99A 2DA1A 5EZHA 5HBUA 2CFOA 2A6HF 3E3VA 4UVBA 5D5VB 1E0EA 4CYCB 2E1OA 1XX5A 4BUPA 1PYVA 2NYXA 2NVUB 3TBIA 1T2KA 4MGRA 2WC2A 3KEOA 1IAWA 2HZTA 3HJEA 2ZCMA 2OQGA 1ZN2A 1ZAOA 2KRHA 3QU6A 1MIJA 3FMQA 4HSRA 4I01A 4BXUA 2ZJRF 3V42A 4S05A 3EUHC 2ELJA 3T1BA 3F6VA 3C7JA 3K1NA 1I50J 3RQIA 3OYDA 1R5ID 1F5TA 5K7FA 3H3VK 2JK3A 2CSOA 4AC6A 3GTMJ 3E97A 4MHGA 2DPUA 2VQHA 2FF4A 4DJAA 3HDDA 2HKUA 2QCOA 3KKCA 1ORKA 3G1OA 1GUUA 3S1QJ 1A35A 3COLA
chains in the Genus database with same CATH topology
4L62A 1DU6A 3MKLA 2Y2ZA 3RKQA 3HOWJ 4QSHA 3HTIA 1ZKGA 2JJ7A 2O7TA 4JP0A 5E3LA 2HOAA 2VPRA 4IEJA 3D1NI 3ANPA 2XGCA 3S1MJ 2QWTA 2LLKA 1JT0A 2JA6J 2F07A 1IUFA 1B8IA 2WAQN 1ETKA 1NK2P 4HNVA 1UI6A 1MSFC 4ME9A 3VW1A 2L0KA 2DA7A 3OSGA 3ZQIA 2GENA 3G56A 1QVTA 3KNWA 4B1RA 3A01B 1WGXA 3M3YJ 3TEDA 4A3LJ 1BL0A 2K40A 3I4MJ 2LD5A 3GTQJ 2NP3A 2DJNA 3FKIJ 1QRYA 2DMUA 2EZLA 2W48A 2ZOYA 2G7LA 1WI3A 4L5EA 2CU7A 3AQTA 3V6GA 5F0CA 5D1RA 2IBDA 1IJWC 1U9NA 3KZ9A 1ZTRA 1TWGJ 4JX6A 3FK6A 5FJ8J 4M3EA 3CCYA 3MNLA 1JKRC 2XGEA 4GFKA 2Y30A 2LTPA 5F1JA 1JKOC 3GTOJ 2DTZA 2TCTA 3G1MA 4AYBN 1WH7A 5M5XJ 5E3NA 1XC5A 4A69C 1FTTA 3I4NJ 3T6NA 2UXUA 5H9TA 2DA4A 1SGMA 1JUPA 4XRSG 3S1RJ 1D5YA 2OPTA 1FTZA 4C3IJ 1T33A 4DYQA 1JTYA 2W53A 2O7OA 5FKKA 5C4YA 3GTLJ 4UDSA 5AQCA 4CYCA 3OSFA 1SANA 2CQQA 4FE7A 3BR2A 3CMYA 2YU9J 1H89C 2YVHA 5IYBJ 5FLVA 2EZIA 2V57A 3NI7A 3LSJA 2NVYJ 3Q0UA 3TW6A 5HAWA 2K9QA 2EQRA 2HQ5A 1MSEC 3LSRA 1MBEA 5FKOA 3TP0A 3LNQA 2Y9ZA 3NPIA 4MIMA 1RPWA 2MG4A 4G12A 2Y31A 1MBJA 4D7NA 3EGQA 1JKQC 4EEFG 1O4XA 4W1UA 3BG5A 5GPAA 4UUSB 3HOXJ 5M5WJ 3W6VA 5J3LA 1IGNA 4A3JJ 3HE0A 5FKNA 5FMPA 2NS7A 5C44J 3E7QA 3BRUA 2IU5A 3A02A 3GZIA 2K9SA 1JUMA 3Q0VA 3OIOA 2M0CA 3A01A 4I76A 2JMWA 1X58A 3QPLA 3SFIA 2EZHA 4XIDA 4GFBA 1LFBA 3F0CA 1HOMA 2RHAA 3FK7A 2MW8A 2HDDA 3WHBA 3A03A 3H0GJ 3HKZN 3BQZA 4C3JJ 4MK6A 4MLOA 3S17J 5EYRA 5C3EJ 1AKHB 1IDYA 4IHVA 2YUSA 2B63J 2O8KA 3BTCA 1I6HJ 3BR3A 2ME6A 4M3FA 3JRBA 3ON4A 4UUTA 5F0HA 1ETYA 1HF0A 1Y1VJ 1EF4A 2CQXA 1POGA 5D19A 5DS9A 2XGDA 2LR8A 3HOUJ 3BQYA 1W0UA 3IV5A 2VUMJ 5FKMA 3HOZJ 3GEUA 4A3KJ 3GTGJ 3DPJA 4BXXJ 2JA7J 1OCTC 5IOZA 2NVTJ 2M9HA 2KT0A 1K61A 1FIPA 3P9TA 3BCGA 1JKPC 1UMQA 2M34A 5M5YJ 1HDPA 2M8GX 4S0HB 4QTRA 2XB0X 2OF7A 2VKVA 1ETWA 3QPSA 2RASA 2UXHA 2DA2A 2QIBA 3HB9A 2ECCA 2XPWA 4Y52J 2YVEA 3ZQFA 2ME0A 1VF9A 1G2HA 3VVYA 1DU0A 4IHYA 2COBA 3VOKA 3M4OJ 4DYRA 3RD3A 1TWFJ 4FE4A 2R0QC 3HGYA 2R7ZJ 1VI0A 1FJLA 3RZDJ 3HEFA 4KWAA 3VOXA 3BR0A 4ACIA 5GPCA 4UUSA 1BW5A 3CJDA 4A3IJ 2P81A 1U9OA 3BR5A 5M3FJ 3AQSA 3UKGA 2WUIA 4A93J 5IYDJ 3JR9A 1GVDA 1XG1A 1MBKA 2D6YA 3JREA 2OERA 4DZJA 1ETOA 2DA6A 2KDZA 2HOSA 3S1NJ 2AO9A 4C3HJ 3LHQA 3QBMA 3BTIA 4A3GJ 4MFDA 5EZGA 1A6IA 1LE8B 3LJLA 1H88C 4JNNA 4AC0A 1AKHA 2R92J 2G7GA 1TWAJ 3SDGA 3LOCA 1IV6A 2GM4A 4A3CJ 3ZQGA 2G7SA 3NXCA 5EEAA 1QPIA 1A5JA 5IP9J 2ZB9A 3K7AJ 2FQ4A 2I10A 5EDNA 1IRZA 4I6ZA 9ANTA 1IC8A 3GTKJ 3B6AA 1NK3P 3PASA 3PPBA 2Y0SN 5F0FA 3VW0A 3JRGA 2ZOZA 1ZQ3P 2JA5J 2Q24A 5EGOB 3VVXA 1Z0XA 1YRNB 4A3MJ 3RH2A 1GV2A 3VVZA 1TWCJ 2GUHA 3O8GA 2D5VA 2JN6A 2FD5A 2N8GA 3QQAA 2O9LA 1ETXA 4V2FA 3VUQA 2R5ZB 1UG2A 2MSYA 5BNGA 2VKEA 3S14J 5FHPA 5F08A 2NS8A 1AHDP 3OOUA 3S15J 2ZCXA 2G3BA 3C07A 3KKDA 4XK4A 5F04A 5J1YA 3S2DJ 4B3AA 1BJZA 1JJ8C 1I3QJ 1OFCX 2K9NA 3NARA 3G1LA 2FBQA 5IYCJ 2G0EA 2HI3A 5IOYA 3BHQA 4ICHA 1WCMJ 5IP7J 5JLWA 2XDNA 2E2HJ 2EH3A 2QKOA 4A3FJ 2QTQA 2CJJA 1OCPA 3IH2A 5JLXA 4A3BJ 3CQZJ 5K58A 5K7HA 2NVQJ 1LE8A 3ZOBA 4XICA 2NX4A 3ZQHA 3Q0WA 5HODA 2H8RA 1FEXA 5IPAA 4IHWA 5J1RA 3F1BA 1JGGA 1RESA 2R5YB 4NN1A 4A3EJ 2REKA 1HDDC 2DA3A 3RZOJ 1X2MA 1NTCA 5CXGA 3HIMA 5EFYA 1UI5A 1JJ6C 4C2MJ 4DYCA 3BG9A 4AUXA 4JX4A 1H8AC 2JA8J 3C2BA 2GFNA 2CUFA 5M3MJ 3S16J 2UXOA 1MH4A 1VNDA 2M2EA 3TW7A 2XB5A 1U78A 1RKWA 1PUFB 4XRSA 3ON2A 4V2GA 3HBLA 3LSPA 1SFOJ 1RETA 2E2JJ 4MXMA 5EGOA 1ETQA 3VW2A 2QOPA 5DAJA 5GP9A 1YRNA 3HOVJ 2AHQA 4X1EA 5EF6A 3JRIA 1K83J 1R9TJ 4B4CA 4AF5A 2L7ZA 1ZK8A 3CDLA 1APLC 2DMQA 4LOCA 1MNMC 4JL3A 3JRHA 2R5ZA 3V78A 3BTLA 5EG0B 3GTJJ 4JX5A 1QVUA 2NP5A 1ZGWA 4FISA 2IAIA 3IUVA 1HLVA 2FX0A 2LK2A 2ECBA 2TRTA 4CGRA 3O8HA 4M6VA 3BJBA 3JSJA 1JT6A 4XRMA 3BT9A 2WB1N 4DZPA 5K7ZA 2DMTA 2DMPA 3E7LA 2PBXA 3HGGA 5D18A 1Y1WJ 5C4XJ 3ANGA 1LFUP 2RAEA 4A3DJ 3HTAA 2LFBA 4PXIA 2LVSA 3BR1A 3PO2J 4D5FA 5E3MA 3JRFA 1HCRA 3K2AA 1GT0C 1MBFA 5J1UA 2HYTA 4GFLA 2CUEA 2PMZN 1WPKA 4RBOA 3GBGA 3DEWA 2EBIA 4ABZA 2XPVA 2ZCNA 2E2IJ 1CQTA 1F36A 3HM5A 3Q3SA 3VIBA 1S7EA 5CXIA 2UXIA 2MGQA 1B72B 2IEKA 2DG8A 5IP6A 1ZR2A 4MFEA 2R5YA 1OJLA 3FISA 1JTXA 4M3DA 1IG7A 3NNRA 1UHSA 2YS9A 1E3OC 2L9RA 2EZKA 2LY9A 3S5RA 4X6AJ 4JKZA 3EUPA 3VP5A 4GCTA 2PZ9A 2GBYA 4MO7A 4RDUA 5FGLA 2X48A 2L7FP 1PUFA 3VPRA 1X2NA 3B6CA 1MBHA 4BBSJ 5HSZA 5DTDA 3IH4A 3ZQCA 3MN2A 2WGBA 4GCLA 2ELKA 4M3GA 3S2HJ 5CW8A 3MVPA 2Y9YA 2HOTA 2HYJA 5F27A 1IDZA 4FCYA 4BKXA 3HOYJ 3BNIA 3HTHA 5FKLA 4HKUA 1WH5A 2OI8A 3BTJA 3FRQA 1Q1VA 1P7IA 5EG0A 2ID3A 2XPUA 3LSGA 1Z77A 1B8IB 2X6OA 1XS9A 3PO3J 2DG7A 4FTHA 2E19A 4QIWN 1W0TA 1ITYA 1BA5A 4YZEA 3L1PA 3WHCA 2GLOA 1P7JA 5E3OA 4BBRJ 2JWTA 4Y7NJ 1TWHJ 4BY7J 4IHXA 2XSDC 3G7RA 4J19A 2H1KA 1GDTA 1BW6A 2NVXJ 3NRGA 3SJMA 2CRGA 3DCFA 1U8BA 1ZR4A 1ENHA 4M3BA 2L7MP 5FLMJ 3PM1A 2X9DA 1MBGA 3TP3A 5C4JJ 1RR7A 2VI6A 1AU7A 4GCKA 2HXIA 4D7MA 3O60A 2UXPA 1TC3C 3CWRA 4NDLA 2DN0A 2QF7A 2HXOA 2DA5A 3FIWA 3JRAA 3ZQLA 3NAUA 1ETVA 1JUSA 2WV1A 3JRCA 3LWJA 3IH3A 4W97A 3GTPJ 2DMNA 1FIAA 4D5CA 2DA1A 5EZHA 4DW6A 2R93J 5HBUA 1B72A 3CRJA 4BY1J 4NELA 1MH3A 2NOGA 2FJ1A 4CYCB 2E1OA 1GV5A 1RKTA 2XRLA 2LP0A 2ZCMA 3B81A 2LKXA 3HTJA 1I50J 1T56A 3BR6A 3BG3A 3RQIA 5K7FA 3H3VK 2JK3A 4AC6A 1VFCA 3GTMJ 3KKCA 3HDDA 2ID6A 3JRDA 1F43A 2HKUA 2QCOA 3QKXA 1ORKA 3G1OA 4JYKA 1GUUA 3S1QJ 3COLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L62 A;  1DU6 A;  3MKL A;  2Y2Z A;  3RKQ A;  3HOW J;  4QSH A;  3HTI A;  1ZKG A;  2JJ7 A;  2O7T A;  4JP0 A;  5E3L A;  2HOA A;  2VPR A;  4IEJ A;  3D1N I;  3ANP A;  2XGC A;  3S1M J;  2QWT A;  2LLK A;  1JT0 A;  2JA6 J;  2F07 A;  1IUF A;  1B8I A;  2WAQ N;  1ETK A;  1NK2 P;  4HNV A;  1UI6 A;  1MSF C;  4ME9 A;  3VW1 A;  2L0K A;  2DA7 A;  3OSG A;  3ZQI A;  2GEN A;  3G56 A;  1QVT A;  3KNW A;  4B1R A;  3A01 B;  1WGX A;  3M3Y J;  3TED A;  4A3L J;  1BL0 A;  2K40 A;  3I4M J;  2LD5 A;  3GTQ J;  2NP3 A;  2DJN A;  3FKI J;  1QRY A;  2DMU A;  2EZL A;  2W48 A;  2ZOY A;  2G7L A;  1WI3 A;  4L5E A;  2CU7 A;  3AQT A;  3V6G A;  5F0C A;  5D1R A;  2IBD A;  1IJW C;  1U9N A;  3KZ9 A;  1ZTR A;  1TWG J;  4JX6 A;  3FK6 A;  5FJ8 J;  4M3E A;  3CCY A;  3MNL A;  1JKR C;  2XGE A;  4GFK A;  2Y30 A;  2LTP A;  5F1J A;  1JKO C;  3GTO J;  2DTZ A;  2TCT A;  3G1M A;  4AYB N;  1WH7 A;  5M5X J;  5E3N A;  1XC5 A;  4A69 C;  1FTT A;  3I4N J;  3T6N A;  2UXU A;  5H9T A;  2DA4 A;  1SGM A;  1JUP A;  4XRS G;  3S1R J;  1D5Y A;  2OPT A;  1FTZ A;  4C3I J;  1T33 A;  4DYQ A;  1JTY A;  2W53 A;  2O7O A;  5FKK A;  5C4Y A;  3GTL J;  4UDS A;  5AQC A;  4CYC A;  3OSF A;  1SAN A;  2CQQ A;  4FE7 A;  3BR2 A;  3CMY A;  2YU9 J;  1H89 C;  2YVH A;  5IYB J;  5FLV A;  2EZI A;  2V57 A;  3NI7 A;  3LSJ A;  2NVY J;  3Q0U A;  3TW6 A;  5HAW A;  2K9Q A;  2EQR A;  2HQ5 A;  1MSE C;  3LSR A;  1MBE A;  5FKO A;  3TP0 A;  3LNQ A;  2Y9Z A;  3NPI A;  4MIM A;  1RPW A;  2MG4 A;  4G12 A;  2Y31 A;  1MBJ A;  4D7N A;  3EGQ A;  1JKQ C;  4EEF G;  1O4X A;  4W1U A;  3BG5 A;  5GPA A;  4UUS B;  3HOX J;  5M5W J;  3W6V A;  5J3L A;  1IGN A;  4A3J J;  3HE0 A;  5FKN A;  5FMP A;  2NS7 A;  5C44 J;  3E7Q A;  3BRU A;  2IU5 A;  3A02 A;  3GZI A;  2K9S A;  1JUM A;  3Q0V A;  3OIO A;  2M0C A;  3A01 A;  4I76 A;  2JMW A;  1X58 A;  3QPL A;  3SFI A;  2EZH A;  4XID A;  4GFB A;  1LFB A;  3F0C A;  1HOM A;  2RHA A;  3FK7 A;  2MW8 A;  2HDD A;  3WHB A;  3A03 A;  3H0G J;  3HKZ N;  3BQZ A;  4C3J J;  4MK6 A;  4MLO A;  3S17 J;  5EYR A;  5C3E J;  1AKH B;  1IDY A;  4IHV A;  2YUS A;  2B63 J;  2O8K A;  3BTC A;  1I6H J;  3BR3 A;  2ME6 A;  4M3F A;  3JRB A;  3ON4 A;  4UUT A;  5F0H A;  1ETY A;  1HF0 A;  1Y1V J;  1EF4 A;  2CQX A;  1POG A;  5D19 A;  5DS9 A;  2XGD A;  2LR8 A;  3HOU J;  3BQY A;  1W0U A;  3IV5 A;  2VUM J;  5FKM A;  3HOZ J;  3GEU A;  4A3K J;  3GTG J;  3DPJ A;  4BXX J;  2JA7 J;  1OCT C;  5IOZ A;  2NVT J;  2M9H A;  2KT0 A;  1K61 A;  1FIP A;  3P9T A;  3BCG A;  1JKP C;  1UMQ A;  2M34 A;  5M5Y J;  1HDP A;  2M8G X;  4S0H B;  4QTR A;  2XB0 X;  2OF7 A;  2VKV A;  1ETW A;  3QPS A;  2RAS A;  2UXH A;  2DA2 A;  2QIB A;  3HB9 A;  2ECC A;  2XPW A;  4Y52 J;  2YVE A;  3ZQF A;  2ME0 A;  1VF9 A;  1G2H A;  3VVY A;  1DU0 A;  4IHY A;  2COB A;  3VOK A;  3M4O J;  4DYR A;  3RD3 A;  1TWF J;  4FE4 A;  2R0Q C;  3HGY A;  2R7Z J;  1VI0 A;  1FJL A;  3RZD J;  3HEF A;  4KWA A;  3VOX A;  3BR0 A;  4ACI A;  5GPC A;  4UUS A;  1BW5 A;  3CJD A;  4A3I J;  2P81 A;  1U9O A;  3BR5 A;  5M3F J;  3AQS A;  3UKG A;  2WUI A;  4A93 J;  5IYD J;  3JR9 A;  1GVD A;  1XG1 A;  1MBK A;  2D6Y A;  3JRE A;  2OER A;  4DZJ A;  1ETO A;  2DA6 A;  2KDZ A;  2HOS A;  3S1N J;  2AO9 A;  4C3H J;  3LHQ A;  3QBM A;  3BTI A;  4A3G J;  4MFD A;  5EZG A;  1A6I A;  1LE8 B;  3LJL A;  1H88 C;  4JNN A;  4AC0 A;  1AKH A;  2R92 J;  2G7G A;  1TWA J;  3SDG A;  3LOC A;  1IV6 A;  2GM4 A;  4A3C J;  3ZQG A;  2G7S A;  3NXC A;  5EEA A;  1QPI A;  1A5J A;  5IP9 J;  2ZB9 A;  3K7A J;  2FQ4 A;  2I10 A;  5EDN A;  1IRZ A;  4I6Z A;  9ANT A;  1IC8 A;  3GTK J;  3B6A A;  1NK3 P;  3PAS A;  3PPB A;  2Y0S N;  5F0F A;  3VW0 A;  3JRG A;  2ZOZ A;  1ZQ3 P;  2JA5 J;  2Q24 A;  5EGO B;  3VVX A;  1Z0X A;  1YRN B;  4A3M J;  3RH2 A;  1GV2 A;  3VVZ A;  1TWC J;  2GUH A;  3O8G A;  2D5V A;  2JN6 A;  2FD5 A;  2N8G A;  3QQA A;  2O9L A;  1ETX A;  4V2F A;  3VUQ A;  2R5Z B;  1UG2 A;  2MSY A;  5BNG A;  2VKE A;  3S14 J;  5FHP A;  5F08 A;  2NS8 A;  1AHD P;  3OOU A;  3S15 J;  2ZCX A;  2G3B A;  3C07 A;  3KKD A;  4XK4 A;  5F04 A;  5J1Y A;  3S2D J;  4B3A A;  1BJZ A;  1JJ8 C;  1I3Q J;  1OFC X;  2K9N A;  3NAR A;  3G1L A;  2FBQ A;  5IYC J;  2G0E A;  2HI3 A;  5IOY A;  3BHQ A;  4ICH A;  1WCM J;  5IP7 J;  5JLW A;  2XDN A;  2E2H J;  2EH3 A;  2QKO A;  4A3F J;  2QTQ A;  2CJJ A;  1OCP A;  3IH2 A;  5JLX A;  4A3B J;  3CQZ J;  5K58 A;  5K7H A;  2NVQ J;  1LE8 A;  3ZOB A;  4XIC A;  2NX4 A;  3ZQH A;  3Q0W A;  5HOD A;  2H8R A;  1FEX A;  5IPA A;  4IHW A;  5J1R A;  3F1B A;  1JGG A;  1RES A;  2R5Y B;  4NN1 A;  4A3E J;  2REK A;  1HDD C;  2DA3 A;  3RZO J;  1X2M A;  1NTC A;  5CXG A;  3HIM A;  5EFY A;  1UI5 A;  1JJ6 C;  4C2M J;  4DYC A;  3BG9 A;  4AUX A;  4JX4 A;  1H8A C;  2JA8 J;  3C2B A;  2GFN A;  2CUF A;  5M3M J;  3S16 J;  2UXO A;  1MH4 A;  1VND A;  2M2E A;  3TW7 A;  2XB5 A;  1U78 A;  1RKW A;  1PUF B;  4XRS A;  3ON2 A;  4V2G A;  3HBL A;  3LSP A;  1SFO J;  1RET A;  2E2J J;  4MXM A;  5EGO A;  1ETQ A;  3VW2 A;  2QOP A;  5DAJ A;  5GP9 A;  1YRN A;  3HOV J;  2AHQ A;  4X1E A;  5EF6 A;  3JRI A;  1K83 J;  1R9T J;  4B4C A;  4AF5 A;  2L7Z A;  1ZK8 A;  3CDL A;  1APL C;  2DMQ A;  4LOC A;  1MNM C;  4JL3 A;  3JRH A;  2R5Z A;  3V78 A;  3BTL A;  5EG0 B;  3GTJ J;  4JX5 A;  1QVU A;  2NP5 A;  1ZGW A;  4FIS A;  2IAI A;  3IUV A;  1HLV A;  2FX0 A;  2LK2 A;  2ECB A;  2TRT A;  4CGR A;  3O8H A;  4M6V A;  3BJB A;  3JSJ A;  1JT6 A;  4XRM A;  3BT9 A;  2WB1 N;  4DZP A;  5K7Z A;  2DMT A;  2DMP A;  3E7L A;  2PBX A;  3HGG A;  5D18 A;  1Y1W J;  5C4X J;  3ANG A;  1LFU P;  2RAE A;  4A3D J;  3HTA A;  2LFB A;  4PXI A;  2LVS A;  3BR1 A;  3PO2 J;  4D5F A;  5E3M A;  3JRF A;  1HCR A;  3K2A A;  1GT0 C;  1MBF A;  5J1U A;  2HYT A;  4GFL A;  2CUE A;  2PMZ N;  1WPK A;  4RBO A;  3GBG A;  3DEW A;  2EBI A;  4ABZ A;  2XPV A;  2ZCN A;  2E2I J;  1CQT A;  1F36 A;  3HM5 A;  3Q3S A;  3VIB A;  1S7E A;  5CXI A;  2UXI A;  2MGQ A;  1B72 B;  2IEK A;  2DG8 A;  5IP6 A;  1ZR2 A;  4MFE A;  2R5Y A;  1OJL A;  3FIS A;  1JTX A;  4M3D A;  1IG7 A;  3NNR A;  1UHS A;  2YS9 A;  1E3O C;  2L9R A;  2EZK A;  2LY9 A;  3S5R A;  4X6A J;  4JKZ A;  3EUP A;  3VP5 A;  4GCT A;  2PZ9 A;  2GBY A;  4MO7 A;  4RDU A;  5FGL A;  2X48 A;  2L7F P;  1PUF A;  3VPR A;  1X2N A;  3B6C A;  1MBH A;  4BBS J;  5HSZ A;  5DTD A;  3IH4 A;  3ZQC A;  3MN2 A;  2WGB A;  4GCL A;  2ELK A;  4M3G A;  3S2H J;  5CW8 A;  3MVP A;  2Y9Y A;  2HOT A;  2HYJ A;  5F27 A;  1IDZ A;  4FCY A;  4BKX A;  3HOY J;  3BNI A;  3HTH A;  5FKL A;  4HKU A;  1WH5 A;  2OI8 A;  3BTJ A;  3FRQ A;  1Q1V A;  1P7I A;  5EG0 A;  2ID3 A;  2XPU A;  3LSG A;  1Z77 A;  1B8I B;  2X6O A;  1XS9 A;  3PO3 J;  2DG7 A;  4FTH A;  2E19 A;  4QIW N;  1W0T A;  1ITY A;  1BA5 A;  4YZE A;  3L1P A;  3WHC A;  2GLO A;  1P7J A;  5E3O A;  4BBR J;  2JWT A;  4Y7N J;  1TWH J;  4BY7 J;  4IHX A;  2XSD C;  3G7R A;  4J19 A;  2H1K A;  1GDT A;  1BW6 A;  2NVX J;  3NRG A;  3SJM A;  2CRG A;  3DCF A;  1U8B A;  1ZR4 A;  1ENH A;  4M3B A;  2L7M P;  5FLM J;  3PM1 A;  2X9D A;  1MBG A;  3TP3 A;  5C4J J;  1RR7 A;  2VI6 A;  1AU7 A;  4GCK A;  2HXI A;  4D7M A;  3O60 A;  2UXP A;  1TC3 C;  3CWR A;  4NDL A;  2DN0 A;  2QF7 A;  2HXO A;  2DA5 A;  3FIW A;  3JRA A;  3ZQL A;  3NAU A;  1ETV A;  1JUS A;  2WV1 A;  3JRC A;  3LWJ A;  3IH3 A;  4W97 A;  3GTP J;  2DMN A;  1FIA A;  4D5C A;  2DA1 A;  5EZH A;  4DW6 A;  2R93 J;  5HBU A;  1B72 A;  3CRJ A;  4BY1 J;  4NEL A;  1MH3 A;  2NOG A;  2FJ1 A;  4CYC B;  2E1O A;  1GV5 A;  1RKT A;  2XRL A;  2LP0 A;  2ZCM A;  3B81 A;  2LKX A;  3HTJ A;  1I50 J;  1T56 A;  3BR6 A;  3BG3 A;  3RQI A;  5K7F A;  3H3V K;  2JK3 A;  4AC6 A;  1VFC A;  3GTM J;  3KKC A;  3HDD A;  2ID6 A;  3JRD A;  1F43 A;  2HKU A;  2QCO A;  3QKX A;  1ORK A;  3G1O A;  4JYK A;  1GUU A;  3S1Q J;  3COL A; 
#chains in the Genus database with same CATH topology
 2HEO A;  4L62 A;  1DU6 A;  3MKL A;  3H9J A;  4OD4 A;  3FBN B;  2H6B A;  3TQN A;  2RGV A;  4UY8 I;  5H6R A;  2O7T A;  4JP0 A;  5HLT A;  2Z1D A;  2HOA A;  2IA2 A;  4KIG A;  2XGC A;  1PP8 F;  2QSH X;  2LLK A;  2V1U A;  4DBR A;  2JA6 J;  1FYM A;  1IZ1 A;  3NWS A;  4PUS A;  4ESB A;  1B8I A;  1ETK A;  4ME9 A;  5GTI C;  2QQ9 A;  3WG7 H;  2L0K A;  2DA7 A;  2IA0 A;  3G56 A;  1X3U A;  3HHG A;  3TED A;  4A3L J;  2BGC A;  1R6R A;  3G73 A;  4BDZ A;  2EIN H;  1ZRC A;  2DJN A;  1IV8 A;  3PFY A;  3MD2 A;  2E5N A;  2XSJ C;  2EZL A;  2HTJ A;  1WI3 A;  2X85 A;  2ZCW A;  5KVR A;  1NG7 A;  2A61 A;  4BXF A;  3AQT A;  2LF8 A;  2ZO4 A;  2KIM A;  4XLC A;  3EUH A;  2KJC A;  1TNT A;  2M5W A;  1YO5 C;  3KZ9 A;  1ZTR A;  1TWG J;  1GXQ A;  4JX6 A;  3S8P A;  1DQU A;  2F5V A;  1SFK A;  3W6K B;  2KFD A;  2TCT A;  4II3 A;  4AYB N;  5M5X J;  1Z3Y A;  2IW5 A;  1P9Q C;  3I4N J;  2UXU A;  1YOV B;  2DAO A;  2DFE A;  1SMT A;  3ZMT A;  1SGM A;  4AIH A;  3S1R J;  1LQ1 A;  1FTZ A;  4C3I J;  1T33 A;  4DYQ A;  1Y39 A;  3HKZ A;  2W53 A;  3ZMS A;  3J81 K;  4N9H A;  3CD6 I;  3I0T A;  4BE2 A;  3KE2 A;  5ICG A;  4OOI A;  2F5F A;  1RUO A;  3JTG A;  3BR2 A;  1VQ4 I;  5IT9 K;  3J7A Y;  1H89 C;  2DT7 B;  2X51 A;  2NAZ A;  3FXL A;  3K69 A;  2IGO A;  3K4J A;  3E6D A;  2COM A;  4UB6 C;  2V57 A;  4GYG A;  2L4A A;  1T38 A;  2EFP A;  2HQ5 A;  3FZV A;  3LSR A;  1C0W A;  3KP2 A;  3TP0 A;  3HPG A;  2Y9Z A;  4MIM A;  1L0O C;  2FNA A;  1F4K A;  4KUM A;  3GLX A;  2Y31 A;  4WIB A;  1MBJ A;  4CXF A;  4CYD A;  1NG6 A;  3CC2 I;  2B7E A;  1MW7 A;  3CCS I;  1O4X A;  4W1U A;  1D1B A;  4UUS B;  3W6V A;  3EYY A;  4NC7 A;  1IGN A;  1FYL A;  6PAX A;  2P8T A;  5GAG J;  4CZC A;  2OU2 A;  3ELK A;  1TT5 B;  2IPQ X;  2RQP A;  3SYT A;  1SVM A;  2IU5 A;  4U9N A;  2L9N A;  3S2W A;  3OIO A;  4A6E A;  4H0E A;  3A01 A;  4G7O F;  2IXS A;  2FE3 A;  3DKX A;  2XF7 A;  1R58 A;  1X58 A;  3A0H C;  4XID A;  1J2X A;  4AIK A;  5A2Q K;  5FLX Z;  5LRR A;  1WZ2 A;  2RHA A;  2M3A A;  2MW8 A;  2FJI 1;  1EJ9 A;  2HDD A;  1T6S A;  3WHB A;  1S29 A;  1B6A A;  1X1P A;  1Z6R A;  3MZ8 A;  4C3J J;  3I5U A;  2QA4 I;  2L9S A;  1S5L C;  2DBB A;  4PJN A;  5E8G A;  2ZY9 A;  4IVN A;  2GA1 A;  4N4N B;  3BR3 A;  2PMH A;  2ME6 A;  2G9W A;  3JRB A;  5HS8 A;  2CYY A;  1HF0 A;  4EVI A;  5DS9 A;  4DNC A;  3HOU J;  4LB5 A;  2XVC A;  3HOZ J;  3RPU A;  1R1U A;  2JA7 J;  1WJD A;  1OR7 C;  3Q5F A;  2VXD A;  1HST A;  2M9H A;  4HG2 A;  3QP6 A;  4B09 A;  1FIP A;  2E35 A;  1GXP A;  2KQR A;  2LF7 A;  4HV5 A;  4Q47 A;  2M8G X;  4II2 A;  4QTR A;  4G6D A;  3MMY B;  3ZR8 X;  2VKV A;  1ZLJ A;  3A1Y A;  2XHK A;  5E1Z B;  2DA2 A;  4OAY A;  4IRH A;  1W5C C;  2A07 F;  2PJR A;  1PP7 U;  3ZQF A;  1VF9 A;  1G2H A;  3VVY A;  1GVJ A;  4IL6 C;  1UST A;  3M4O J;  4LIT A;  1N75 A;  3L2R A;  3ZXS A;  3COA C;  4NC6 A;  1MGT A;  1G3Y A;  3I59 B;  1SVL A;  3HEF A;  4IOA F;  1BN5 A;  4KWA A;  1U0J A;  1WJC A;  3KP7 A;  4EJO A;  1FSE A;  1BW5 A;  2JT1 A;  3FXU A;  2QBY B;  3HRS A;  3QOP A;  1R71 A;  3FXK A;  2KZG A;  1U9O A;  2DDA A;  3BR5 A;  3AQS A;  2IS6 A;  1T0F C;  2WUI A;  1BI3 A;  3GCM A;  3WTZ A;  2WY8 Q;  1GVD A;  1XMX A;  4RM3 A;  2D6Y A;  3MKZ A;  4KA4 A;  2OER A;  5TGT A;  2STW A;  3K8P C;  5L3G A;  1ETO A;  5HS7 A;  3QBM A;  2AO9 A;  4HST A;  3F23 A;  2UWM A;  1OR7 A;  1R4M B;  3AL0 B;  4MEY F;  5F6F A;  1A6I A;  1R5G A;  5H6Q A;  3DEE A;  5FGM A;  3MAJ A;  3GYH X;  3JW4 A;  3H3Z A;  4IHS A;  5FRO A;  2DI3 A;  1H88 C;  4JOM A;  1FBU A;  2E60 A;  2G7G A;  1RI7 A;  4RGR A;  4A3C J;  3ZMZ A;  1B9N A;  3K1P A;  5EEA A;  1XGO A;  5D8K B;  3E5U A;  4CH7 A;  3ROU A;  5DD4 A;  2GOX B;  5EEH A;  4OIP F;  5CYV A;  1U3E M;  2I10 A;  1P4X A;  2BV6 A;  2JVG A;  2LDU A;  1TW3 A;  1W36 C;  3B6A A;  2G7H A;  3EUA A;  1HBX G;  4EMS A;  2J5O A;  1LNW A;  1ODD A;  2LOO A;  3DEU A;  3I55 I;  4NC8 A;  1KQ8 A;  3WTW C;  1T0F A;  5GTH C;  3ERM A;  1MZB A;  1YRN B;  4BYY A;  3ML6 A;  4XBF A;  2GUH A;  2D5V A;  3M7G A;  3JCU C;  1W5S A;  2FD5 A;  2WY7 Q;  1TZL A;  3KYL A;  3VUQ A;  1Z21 A;  4HA8 A;  3OL4 A;  2K86 A;  1TLH B;  3FXJ A;  1AHD P;  2ZCX A;  2QEN A;  1LFP A;  3H0D A;  1IXR C;  3BPV A;  1Z91 A;  1BOB A;  1F1Z A;  3ZGK A;  3VTI A;  1JJ8 C;  1OFC X;  2K9N A;  3C2G A;  2LNB A;  5JR3 A;  1JE8 A;  1VQ8 I;  2V7F A;  3OMY A;  4L9T A;  3BHQ A;  4ICH A;  3ULQ B;  1WCM J;  4HF2 A;  3HRM A;  3S93 A;  2XDN A;  2E2H J;  1BI1 A;  2QKO A;  4BNC A;  2CJJ A;  4MTE A;  1EH8 A;  4ZTJ A;  3C1D A;  4A12 A;  5K7H A;  4F55 A;  3X2Q H;  2CW7 A;  3ZOB A;  3ECO A;  3CJT B;  5HOD A;  5IPA A;  5F1R A;  4UVA A;  2AXL A;  3HTU A;  2M30 A;  4BS9 A;  2D2W A;  3F21 A;  1SVO A;  5K1Y A;  3RI4 A;  3C2H A;  5EFY A;  4C2U A;  4QWQ A;  1JJ6 C;  2JA8 J;  2O61 A;  2PMZ A;  3GXO A;  4KN7 X;  2VOP A;  1I1G A;  3C2B A;  4IOC F;  2CUF A;  3NWT A;  3KCC A;  2GFN A;  2OCC H;  2M2E A;  3TW7 A;  2XB5 A;  4FT8 A;  2HQR A;  1W5T A;  2ISY A;  1RKW A;  3ASO H;  2OC6 A;  1Z05 A;  3KFW X;  2DYS H;  4A0X A;  1OCZ H;  4PJL A;  4UVC A;  5EGO A;  3O6B B;  1K4T A;  1B59 A;  3GUD A;  2QOP A;  3VW2 A;  5DD8 A;  1RRJ A;  4ENN A;  2AHQ A;  2W00 A;  3I4P A;  5D4S A;  4CCO A;  1UHW A;  2EIJ H;  2K27 A;  2Y48 A;  3LA2 A;  4IRG A;  2DMQ A;  4DBQ A;  3JRH A;  2ZJ2 A;  3BTL A;  3GTJ J;  1O3Q A;  4BGD A;  3HZJ A;  4FIS A;  1HLV A;  2XGX A;  1WWX A;  2FX0 A;  3F8M A;  1I5Z A;  3O2P E;  4Q48 A;  4M6V A;  3BJB A;  3U21 A;  4XRM A;  2FXA A;  2WB1 N;  3NRV A;  1SAU A;  2MYS A;  3OV8 A;  4DZP A;  3SEZ A;  1IN8 A;  2OD5 A;  5DCM B;  5CVU A;  4N4O B;  1YS7 A;  1Y1W J;  5C4X J;  4A3D J;  2LC2 A;  2LVS A;  2H6C A;  2HOE A;  3IHU A;  1J7K A;  4ITV A;  3H3U A;  3JRF A;  2HYT A;  1GT0 C;  4HRI A;  3BZC A;  2WAE A;  2GZW A;  3OYE A;  3CCE I;  4XSZ F;  4OD5 A;  2VC1 A;  2BZT A;  3K2Z A;  4BQQ A;  2BVM A;  2K4J A;  2R7D A;  1U8R A;  4ABZ A;  2XPV A;  3R0A A;  2QSF X;  1CQT A;  2OZ6 A;  2YR2 A;  1FYK A;  2KIS A;  4YFK F;  5DUK A;  2DCE A;  1B72 B;  5K5O A;  1STZ A;  2DG8 A;  1UCR A;  4G6T B;  2Y69 H;  2BXZ A;  3JTH A;  4Y3O A;  1HXD A;  3BWG A;  1UHS A;  1E3H A;  2IP2 A;  3VOE A;  2L9R A;  1YJW I;  3NQO A;  1W7P A;  2QVO A;  1WRJ A;  2VBZ A;  3VP5 A;  4PGH A;  3KIO A;  2X48 A;  1PUF A;  2CV2 A;  2PG4 A;  5TRD A;  1L3L A;  4BBS J;  4I98 B;  5HSZ A;  5J40 A;  3MFK A;  2JPC A;  4OIR F;  5J4Y A;  3ZQC A;  4P55 A;  3T5X A;  3MZH A;  1YIJ I;  3BC8 A;  3S2H J;  3MVP A;  2Y9Y A;  3DKY A;  5F27 A;  3E6M A;  3QOE A;  3Q9S A;  2WTE A;  2OI8 A;  1OCC H;  3FRQ A;  1Q1V A;  5ED4 A;  5EG0 A;  2JUC A;  4QLC U;  3BRO A;  2W82 A;  2MLK A;  5DUI A;  2JQ7 A;  2F4I A;  2FBK A;  2CGP A;  1BA5 A;  4YZE A;  3CMM A;  3WHC A;  1P7J A;  2IT0 A;  4Y7N J;  1TWH J;  2H94 A;  2XSD C;  4BHP A;  1YG2 A;  3P7N A;  2HNH A;  2OQR A;  2CRG A;  3DCF A;  2QGU A;  1REP C;  2HTS A;  3LQR A;  4M3B A;  2E71 A;  5FLM J;  3K0L A;  1R22 A;  1MJA A;  4EGY A;  1VQ9 I;  1RR7 A;  4UUV A;  1X4O A;  3AKZ A;  3GME A;  2VI6 A;  2ESH A;  1IRG A;  3O60 A;  3F6O A;  2CO5 A;  3MQ0 A;  4L9J A;  3CCL I;  1TC3 C;  2UXP A;  3CWR A;  2JVH A;  4CIC A;  3N97 A;  4XRF A;  2LKS A;  3H9G A;  3NAU A;  4ASN A;  1KZH A;  3L09 A;  4XLA A;  4D5C A;  2YPR A;  1T98 A;  4YFX F;  4BY1 J;  1Y8R B;  4NEL A;  1UHM A;  2FJ1 A;  4YEJ A;  4P9F A;  2DFI A;  2DOE A;  1RKT A;  3AG3 H;  4RGS A;  2XRL A;  3CUQ B;  2NNN A;  2PEX A;  2M4K A;  2KLO A;  2KRF A;  1WHU A;  3KZZ A;  3H92 A;  1Z6T A;  3RJP A;  3BG3 A;  3GFJ A;  5BQT A;  4GDF A;  3E6B A;  2ID6 A;  2PJP A;  1F43 A;  1IW7 F;  2EFO A;  1I6X A;  4AID A;  1FOK A;  1TL8 A;  2VQC A;  3W3C A;  4QSH A;  2BOL A;  2E7W A;  1KU7 A;  2JJ7 A;  4G9Y A;  2HDW A;  2I5U A;  2VPR A;  1G8X A;  2GXG A;  4HPQ A;  3MCZ A;  3N05 A;  2QWT A;  2IGM A;  4XKW A;  1VQP I;  1JT0 A;  1P4W A;  1IN6 A;  4IQJ A;  1NK2 P;  2QYO A;  1MSF C;  3F8B A;  2CQ7 A;  3MWM A;  4C2M A;  3OSG A;  2GEN A;  1QVT A;  5B1B H;  3KNW A;  5HOO A;  1YW8 A;  4B1R A;  1WJ5 A;  1RUN A;  4KYW A;  3BJO A;  4WCG A;  3JAM K;  1BL0 A;  4A0Y A;  3FM3 A;  4HF1 A;  1DGW Y;  2A6E F;  2LD5 A;  3GTQ J;  2NP3 A;  2O0Y A;  1QRY A;  2W48 A;  2G7L A;  2RQQ A;  3WU0 A;  3ZCO A;  3CJQ B;  5F0C A;  1FLI A;  4D9J A;  2IBD A;  3CCU I;  4N9I A;  2V9P A;  2XRO A;  4M3E A;  5F1J A;  3DBL B;  3DU6 A;  2DTZ A;  1YIO A;  2ZME B;  3LA7 A;  4LJZ F;  2HVR A;  4A69 C;  5H9T A;  3BP8 A;  3OIQ A;  4P5O A;  1ZRD A;  5DCF A;  2VAS A;  1SD5 A;  3FWE A;  3QP5 A;  1OPC A;  5L3B A;  2B9S A;  2O7O A;  1K78 A;  1O3S A;  4OIO F;  1CGP A;  3F8C A;  3OSF A;  1D0Y A;  3REO A;  2CQQ A;  3CMY A;  2KPM A;  4XOP A;  2LRD A;  1DPR A;  1XDU A;  3K4K A;  4HYE A;  5IYB J;  1T08 B;  2VT3 A;  3HIF A;  2YVH A;  5FLV A;  2EPF A;  2Z2S B;  3LFK A;  4BEH B;  2NVY J;  3TW6 A;  2FBI A;  5HAW A;  2K9Q A;  2R7F A;  2EQR A;  2Y75 A;  2V26 A;  3SXY A;  3VFZ A;  1LPQ A;  1MBE A;  3BCB A;  5K5R A;  3LNQ A;  5ICE A;  3NPI A;  1RPW A;  1OYY A;  4G12 A;  2ZJQ F;  2VPL A;  4B43 A;  4ETS A;  3B73 A;  4LG0 B;  4CCK A;  1R1V A;  4BH9 A;  1KQ0 A;  4ZYE A;  1ZG1 A;  2FEZ A;  4UB8 C;  1KU3 A;  1EV7 A;  3LST A;  3DV8 A;  5J3L A;  3V8J A;  3MKW B;  4HQM A;  4IX7 A;  1QZE A;  5GAE J;  4A3J J;  2DK8 A;  1K7A A;  5FKN A;  2IVM A;  5FMP A;  1E2X A;  3E7Q A;  3AG4 H;  3H5N A;  4RB0 A;  5E79 C;  4HZF A;  4EJV A;  3CUO A;  3W2W A;  2JMW A;  3QPL A;  2FOK A;  4NQW A;  3TGN A;  3F0C A;  3T8R A;  3WTT C;  4G7H F;  1X1A A;  2STT A;  3AFH A;  4M6X A;  4GCV A;  4E70 A;  3HKZ N;  3H0G J;  4ENM A;  3I71 A;  3QPT A;  3LMM A;  3S17 J;  1R36 A;  4IHV A;  2FRH A;  4IKF A;  2V9K A;  3W2A A;  2A3S A;  1ZRF A;  5FD6 A;  4UUT A;  3OYL A;  1Y1V J;  3DFG A;  2Z5U A;  3CMA I;  4LK0 F;  2CQX A;  1OMI A;  1POG A;  3GFM A;  2DLL A;  2L3D A;  4KN4 X;  1X1D A;  5E18 F;  1FSH A;  3BQY A;  1W0U A;  1D8K A;  1JI8 A;  2UUZ A;  3DTE A;  4MQ9 F;  2X6W A;  5E8I A;  5ICC A;  3DXJ F;  2QQB A;  3CJN A;  4BQA A;  2BY3 A;  2P7V B;  3CLO A;  1K61 A;  3P9T A;  1OLT A;  3BCG A;  3DQV C;  1UMQ A;  2M34 A;  2YSR A;  4L9N A;  1JKP C;  1MD0 A;  2OF7 A;  2ADU A;  2MBF A;  3K70 C;  1QO0 D;  2UXH A;  3OL3 A;  1G4D A;  1LDD A;  3OYN A;  3HB9 A;  5BOX A;  2LBF A;  2YVE A;  2ME0 A;  5IY5 H;  1DU0 A;  4M73 A;  3HTS B;  3VOK A;  1PJR A;  3RSN A;  2GWR A;  4DYR A;  4F92 B;  1MJ9 A;  4PSW A;  2XAJ A;  3D0S A;  3HGY A;  4LFU A;  2Y0S A;  3WTU C;  1FJL A;  4ACI A;  5GPC A;  2W7N A;  4U0V A;  3IUO A;  2ZXI A;  5FD5 A;  2P81 A;  3KZY A;  1JHH A;  4G8X A;  2R7T A;  4HLY A;  1FNN A;  3KEY A;  5IYD J;  4LLN A;  2JRT A;  3VYR B;  1XG1 A;  1MBK A;  2P5L C;  3OYF A;  1D8J A;  2RDP A;  2OCE A;  1AA7 A;  3I64 A;  2DA6 A;  5LLQ A;  2HOS A;  3S1N J;  3TL4 X;  1U5T B;  1YLF A;  3RKY A;  1XDS A;  1J0R A;  2F6C A;  4RAF A;  1N77 A;  3LJL A;  3OR2 C;  1ONV A;  3DPT A;  4E7Z A;  2BY1 A;  4AC0 A;  1ULY A;  1AKH A;  4EJT A;  2R92 J;  3KYC B;  3VB2 A;  3E5Q A;  1TWA J;  1IV6 A;  4PJM A;  2XAF A;  3ZQG A;  4HNU A;  5FRN A;  1B9M A;  2QUF A;  2VJ5 A;  3RDI A;  1QGP A;  4CGZ A;  2XUB A;  1FZP B;  3IRR A;  4GRI A;  2FQ4 A;  3BY6 A;  4L9V A;  3PAS A;  3PPB A;  1X1B A;  3RIR A;  2JPB A;  2CV1 A;  4XNF A;  1TTY A;  5D5X B;  4XOR A;  1ZQ3 P;  4D1Q A;  5DYM A;  3M8F A;  3EUK L;  2BYV E;  3HRT A;  2RC4 A;  3VVZ A;  2M4G A;  3O8G A;  2M8E A;  2XDV A;  1X4P A;  4BJ6 C;  4O3M A;  2JN6 A;  2PFB A;  2CG4 A;  3QQA A;  1YS6 A;  2BW3 B;  4F93 B;  3HOT A;  3P9I A;  1RC9 A;  1V3F A;  3Q9V A;  3H1C A;  3HUG B;  2Q2E A;  5BMZ A;  5HDN A;  4IRI A;  2VKE A;  1Z9C A;  4I0A A;  2PLY A;  5FHP A;  5F08 A;  1TNS A;  2A68 F;  3WE2 A;  4ESJ A;  3KKD A;  1XPX A;  2M7A A;  1WJA A;  4WXD A;  5F04 A;  1KYZ A;  3OYA A;  1Y0U A;  3PL8 A;  1ZG5 A;  1BJZ A;  3PQJ A;  2ZSH B;  3KX2 A;  4XOT A;  4XLP F;  3EDP A;  2G0E A;  3KLN A;  2EV6 A;  5IOY A;  1AWC A;  1ZH5 A;  4P1W A;  4CCL A;  1BR1 A;  1IN7 A;  4B8X A;  1P92 A;  5JLW A;  2EK5 A;  2EH3 A;  4J00 A;  4A3F J;  2H09 A;  1Z7U A;  3IH2 A;  4A3B J;  4LMY A;  4PJ0 C;  1LE8 A;  4XIC A;  2EIL H;  4PJJ A;  4EQQ A;  4A0Z A;  1FEX A;  1XGS A;  4AWX B;  3AG1 H;  3F1B A;  1JGG A;  1ERD A;  1MMN A;  2DQR A;  2R5Y B;  4NN1 A;  4A3E J;  3UR3 C;  1YHQ I;  4JK1 X;  2XKO A;  3HIM A;  1UI5 A;  1R00 A;  3W6J B;  4C2M J;  2E5Z A;  2VJI A;  2DQL A;  3IWF A;  1WSU A;  5LEJ A;  5CVV A;  4HNT A;  2LKP A;  3GZ5 A;  1MH4 A;  4NHJ A;  3GVA A;  1O57 A;  3P9C A;  1ZEL A;  4LLG F;  2E1M B;  2BHZ A;  3GWZ A;  1N25 A;  2XAH A;  2EFN A;  1ZLK A;  3LSH A;  4V2G A;  3LSP A;  3ERE D;  1XSD A;  1SFO J;  1RET A;  4YEL A;  3QYE A;  3J81 Z;  3CF5 F;  2E2J J;  1ETQ A;  4MXM A;  1TQP A;  1WKM A;  5GP9 A;  1SEU A;  1XGN A;  1WI9 A;  5IT9 Z;  5LGT A;  4L5I A;  4AM3 A;  4B48 A;  1K83 J;  3TO6 A;  1P4A A;  4B4C A;  3OS1 A;  2HWV A;  2F4M B;  2L7Z A;  1ZK8 A;  3CDL A;  2LH9 A;  2MD5 A;  3HYI A;  1APL C;  2KDO A;  4JL3 A;  4LOC A;  1IO2 A;  3DPL C;  2R5Z A;  1RZ4 A;  4RAG A;  3H5A A;  4ESF A;  4JX5 A;  2VQG A;  1MDM A;  3MZY A;  5HVQ C;  2IAI A;  2L4M A;  3F3X A;  4LD5 A;  3RQ4 A;  3FXM A;  2TRT A;  3IUV A;  5F64 A;  2EB7 A;  3O8H A;  3FX3 A;  4ZJZ A;  2ELH A;  3BT9 A;  4CHU A;  1X3Z B;  2Q1Z B;  2H1L A;  3IKV A;  2NRA C;  3E7L A;  4AIJ A;  2PBX A;  2RVC A;  1WVR A;  3HGG A;  4EM1 A;  5CKT A;  3ANG A;  1LFU P;  4ZDL A;  1Z3X A;  3TKY A;  2F2E A;  3OYG A;  3SZP A;  2K7L A;  2GAU A;  5E3M A;  2HVS A;  2QKL B;  3D5R C;  4ZYH A;  5BPD A;  1MBF A;  5J1U A;  2HPM A;  1BOA A;  2CUE A;  2PMZ N;  1WPK A;  3F72 A;  4CA0 A;  1J5Y A;  4RBO A;  3GW2 A;  1QHH D;  3DEW A;  4F52 A;  2VBW A;  3HM5 A;  5A2Q Z;  4NB5 A;  4M9S A;  1WJE A;  3FMR A;  4NNJ A;  4E7L A;  1ZAR A;  4I0B A;  5KK1 A;  4Y33 A;  2MGQ A;  3J7A O;  2VQL A;  2XAU A;  4Z2Y A;  4E6K G;  3GX4 X;  2R3S A;  1ZR2 A;  1D0Z A;  4RLQ A;  3IP4 B;  3K1M A;  1HQC A;  5D6E A;  5CVR A;  2GIZ A;  1IG7 A;  4BJ5 C;  3PNV A;  5ICF A;  2LY9 A;  1HKS A;  1R4N B;  4IF4 A;  1V54 H;  3EUP A;  2EA2 A;  4RDU A;  3V7R A;  5FGL A;  2V9V A;  3L2U A;  1X1C A;  1K4S A;  1X2N A;  4QPO A;  3KYD B;  3IH4 A;  4RGX A;  2WGB A;  1USS A;  4RLF A;  1YI2 I;  5FO5 A;  5JHU A;  3RCO A;  4U87 A;  4FCY A;  1IDZ A;  4RAY A;  3S3N A;  4XKV A;  5FKL A;  4HKU A;  1MMG A;  1WH5 A;  2L54 A;  3BTJ A;  3HOS A;  1DGR M;  3DWL E;  1B8I B;  3S3O A;  1FX7 A;  2LSO A;  2X6O A;  1I27 A;  1XS9 A;  1FC3 A;  4NUB A;  2E19 A;  1IXS B;  3HSE A;  2W57 A;  1B4A A;  3L1P A;  1VQN I;  1RNL A;  5E3O A;  3DLL F;  2JWT A;  1HC8 A;  4J19 A;  3F9K A;  2I8D A;  2KRC A;  2H1K A;  4KIF A;  3KEQ A;  1PDN C;  2NVX J;  3NRG A;  3SJM A;  1U8B A;  4EAT A;  2X6Y A;  3ZPL A;  2L7M P;  4MNU A;  5C4J J;  2WAQ A;  5ILV A;  1PUE E;  2NXN B;  1FP2 A;  4CO8 A;  4NDL A;  2HXO A;  2DA5 A;  3JRA A;  1ETV A;  1JUS A;  2WV1 A;  1VQO I;  3BLY A;  3IH3 A;  4W97 A;  3PNT A;  3LWJ A;  4IPA A;  2R7X A;  3VWB A;  1FIA A;  1LEB A;  3RYP A;  4CSW A;  5EEG A;  4DW6 A;  2R93 J;  1JXS A;  2MH2 A;  1UB9 A;  3CRJ A;  1MH3 A;  4IO9 F;  3GO5 A;  4ZZD A;  3VDX A;  1GV5 A;  1HKT A;  3ZN1 A;  2ZNY A;  4HDV A;  4XLH A;  3A0B C;  2K9L A;  1T56 A;  4LG3 A;  4PCQ A;  2BE5 F;  4RM2 A;  2R7W A;  1VFC A;  3R4K A;  3F8F A;  2UXN A;  2MAB A;  1WGX A;  1CF7 A;  3V78 A;  2HPI A;  5AIP A;  4E7K A;  3RKQ A;  2QLZ A;  4XN3 A;  1FT9 A;  2V1N A;  4IEJ A;  3RPU D;  5LHG A;  3D1N I;  2UZK A;  4C9Y A;  3TO9 A;  3S1M J;  2L2O A;  2LY1 A;  4YIF A;  2DXI A;  2DO7 A;  2F07 A;  1IUF A;  1IRX A;  2L01 A;  3U9G A;  4HNV A;  4AVZ A;  3A4C A;  4Y4R A;  1SFU A;  5KCM A;  4N0B A;  3A01 B;  5LFA A;  1K79 A;  4L0Y B;  3M3Y J;  2OJE D;  4KMU X;  2V6E A;  4DGW B;  2K40 A;  2K5C A;  3FKI J;  2MC4 A;  3J80 K;  2ZOY A;  1FOX A;  5KAF C;  1ZYR F;  1A04 A;  4L5E A;  4D0P A;  3V6G A;  1LEA A;  5JI6 A;  5D1R A;  2IJL A;  2CUJ A;  1XSX A;  3KLO A;  3BPX A;  1U9N A;  2AXT C;  2LG4 A;  2VB6 A;  1BM9 A;  5EJC A;  3BJ6 A;  2R7Q A;  5FJ8 J;  1JKR C;  4F91 B;  2XGE A;  5LRS A;  1JGS A;  2Y30 A;  1JKO C;  5CJ9 A;  3G1M A;  2E7X A;  1Z7L A;  5E1X A;  3WU2 C;  2JUG A;  2DA4 A;  4FET A;  2ZJP F;  4KT6 A;  1D5Y A;  2OPT A;  4V19 K;  2QZ8 A;  4OU0 A;  2YX7 A;  5JHF A;  5FKK A;  3GTL J;  2DJI A;  4XR6 A;  4CYC A;  1S8N A;  1SAN A;  1G3T A;  2MLG A;  2V6C A;  2FUG 2;  4GYI A;  4CZZ A;  2YU9 J;  1YFH A;  3IC7 A;  1MMA A;  3LQQ A;  4RB2 C;  1HW2 A;  2P6T A;  2X4H A;  3CLQ A;  3DLA A;  4BE1 A;  2YX4 A;  2EZI A;  3TO7 A;  3NI7 A;  3LSJ A;  2CS3 A;  2KMU A;  3LSK A;  2DFF A;  3GFI A;  2XIG A;  1MSE C;  1YW7 A;  1BR2 A;  4E4H A;  4BE0 A;  2MG4 A;  2KP6 A;  3OYB A;  3WGI A;  2VE8 A;  1XTA A;  3H5R A;  1HW1 A;  1G3S A;  3E1S A;  4U9L A;  4M74 A;  3BG5 A;  4XQF A;  5LD2 C;  4BL0 B;  4RMN A;  4RGU A;  5E20 A;  4LB6 B;  3FXQ A;  1I1S A;  3IAM 2;  3CCV I;  2NS7 A;  5C44 J;  2LRE A;  2GA2 A;  2L02 A;  4OIQ F;  3A02 A;  2OUM A;  2K9S A;  1JUM A;  3PSF A;  2FMY A;  2R7U A;  4I76 A;  2PBI A;  2HZD A;  2EZH A;  4GFB A;  2RN7 A;  4I99 C;  4Q4Z F;  1VTN C;  3PJR A;  1FWZ A;  1FMV A;  4FX0 A;  5DEQ A;  2TDX A;  3A03 A;  4M72 A;  5CQE A;  3BQZ A;  2CH0 A;  3ASN H;  4MLO A;  2JRM A;  5C3E J;  2CW0 F;  3R6S A;  1IDY A;  3OYK A;  3CP2 A;  3E6C C;  3SZG A;  2B63 J;  3BTC A;  1IN5 A;  2IRF G;  4UNO A;  4TV7 A;  3H36 A;  1MND A;  3ON4 A;  1SMY F;  5F0H A;  1ETY A;  5FB2 A;  2D1V A;  2LYC A;  1X3W B;  2LR8 A;  1XCV A;  2VUM J;  1J09 A;  4OWR B;  2PN6 A;  5FKM A;  1TQM A;  3GEU A;  4R8H A;  4A3K J;  3GTG J;  2EV0 A;  3E0J B;  2B0L A;  5D5W B;  3DPJ A;  2P5K A;  1WQ2 A;  1OCT C;  1W36 D;  2DU9 A;  2B1E A;  2KT0 A;  2IGN A;  5M5Y J;  1HDP A;  4S0H B;  2VKD A;  3GEZ A;  2QQA A;  1ETW A;  4B3X A;  3CZ6 A;  1S9H A;  1IXC A;  3VYU B;  3ZP5 A;  3PUF A;  2DFH A;  4KIB A;  2IS4 A;  2ECC A;  2XPW A;  4Y52 J;  2D45 A;  5JVT A;  2CUZ A;  4GO1 A;  2HR3 A;  3WTX C;  1KU2 A;  2PMU A;  1XD7 A;  3OY9 A;  1V55 H;  1TWF J;  2G7U A;  3ZRG A;  4DIQ A;  1LUJ B;  4AU7 A;  3CJR B;  5D8L B;  2R7Z J;  3V7S A;  1VI0 A;  3RZD J;  2W25 A;  3QRF F;  3DTK A;  4I09 A;  4UUS A;  3CJD A;  4ZC3 A;  1T39 A;  4A3I J;  4O5V A;  1ZGJ A;  3UKG A;  1WJB A;  3OIP A;  4I7H A;  3JR9 A;  4MQV A;  4KJZ A;  1S3J A;  2DDB A;  1T95 A;  2H8W A;  3OYI A;  3P5J A;  3FDY A;  1QA6 A;  1P6R A;  2KDZ A;  4IJA A;  3ZMV A;  1KU9 A;  3LHQ A;  3BTI A;  4A3G J;  4MFD A;  4HW0 A;  4XL9 A;  2VC0 A;  4L0Z B;  2ZXW H;  1K6Y A;  2Z3Y A;  1MJB A;  2HKO A;  3LWF A;  4H4K C;  2O03 A;  1TP4 A;  3I9V 2;  1AOY A;  1R49 A;  2DOF A;  3ABL H;  3K4B A;  1NHA A;  2FU4 A;  4JNN A;  4BDY A;  2CW8 A;  2CQK A;  3VSL A;  2M7B A;  1H9G A;  2KIF A;  3MEX A;  2EIM H;  3OYJ A;  2R7S A;  2EA4 A;  2KKO A;  2G7S A;  2GM4 A;  3NXC A;  1OYI A;  2M87 A;  2VXZ A;  1VQM I;  2O3F A;  2ZB9 A;  3ESW B;  1IF1 A;  5EDN A;  2HU9 A;  2V79 A;  3M8E A;  2XAG A;  4I6Z A;  1IC8 A;  3K9T A;  1RIO H;  1NK3 P;  3EYI A;  3V4G A;  1XN7 A;  2Y0S N;  3VW0 A;  1SFE A;  3AL0 C;  3DBR B;  2JA5 J;  1G6N A;  3ZN0 A;  5EGO B;  5HLI A;  2X0L A;  4G7Z F;  1R1T A;  3PIO F;  1BJA A;  3RH2 A;  1GV2 A;  4OAZ A;  2OTJ I;  3ISP A;  5IT3 A;  3IKT A;  3SZT A;  1ETX A;  4V2F A;  1UG2 A;  2MSY A;  3I3L A;  2XF6 A;  2F4O B;  3CES A;  2FML A;  4HAM A;  2MFZ A;  2MD0 A;  3GF2 A;  4HV6 A;  1IUY A;  3CDH A;  3FM5 A;  4AVP A;  2NS8 A;  3I59 A;  3OOU A;  3S15 J;  3QWL A;  1W7P D;  3C07 A;  1SD4 A;  3S3M A;  4XK4 A;  4B44 A;  3KPH A;  3BG6 A;  2QBY A;  1FOY A;  4A5M A;  5J1Y A;  2P6S A;  4DQ2 A;  3S2D J;  2R7V A;  4KT5 C;  1K6O A;  4YIR X;  1I3Q J;  3NAR A;  3G1L A;  3L2V A;  2VN2 A;  2HI3 A;  3IAS 2;  3LSM A;  3CCJ I;  3IL2 A;  3EQL F;  3T8T A;  3QU3 A;  3JAM Z;  5JLX A;  4JBA A;  3CQZ J;  4FQG A;  5K58 A;  2NVQ J;  1U6G A;  1N78 A;  4HBL A;  3ZQH A;  2H8R A;  3G3Z A;  2DK5 A;  4IHW A;  5AIQ A;  2REK A;  3M8J A;  2IS2 A;  4ZYD A;  2MC3 A;  2AQF A;  2DA3 A;  1X2M A;  3TOA A;  1S72 I;  3RZO J;  4LK1 F;  1XGM A;  3G6E I;  2ZNZ A;  4DYC A;  1SC7 A;  3BG9 A;  4AUX A;  4LLL A;  3RKX A;  2UXO A;  1W7P B;  3WGG A;  1U78 A;  1QNT A;  4E7I A;  1PUF B;  4E7S A;  1BC7 C;  1G59 A;  3LA3 A;  4FX4 A;  1BIA A;  1R23 A;  3F8N A;  2EV5 A;  1A31 A;  5ILS A;  3M9A A;  5DAJ A;  1YRN A;  2JTV A;  3KP3 A;  3DF8 A;  3UNG C;  4X1E A;  5J4V A;  5EF6 A;  3GFL A;  4Y17 A;  4XMY A;  2GOM A;  1VQ7 I;  1UFM A;  2VE9 A;  4CDG A;  1V4R A;  2MH9 A;  3KP5 A;  5EG0 B;  3L2W A;  4GGG A;  3KP4 A;  1ZGW A;  2ZFU A;  4X0G A;  2HGC A;  1O7F A;  3VEP A;  4BQO A;  2LK2 A;  5DM7 F;  2RNJ A;  3ABU A;  4YII A;  1JT6 A;  2VJ4 A;  5CPR B;  2FSW A;  4L5J A;  5FLX K;  3L00 A;  5K7Z A;  2X1E A;  2DMT A;  2DMP A;  1UJ8 A;  3T0Y A;  2P0W A;  5D18 A;  1SFX A;  3TDZ C;  3VSK A;  1GLN A;  2RAE A;  4LGW A;  4PXI A;  3BR1 A;  2F5E A;  2ICW G;  3PO2 J;  1PVE A;  2HKX A;  4GFL A;  1KYW A;  5L3D A;  2BXY A;  3GBG A;  2H27 A;  3K6G A;  2C6Y A;  2QKM B;  2Z9O A;  1XCB A;  4E7J A;  1YJN I;  2X1D A;  3CF2 A;  2E2I J;  1F36 A;  2ZCN A;  2ESN A;  3Q3S A;  3V8K A;  3VIB A;  3U1D A;  2KIU A;  1S7E A;  1ZHF A;  3CO6 C;  2CQN A;  1Q1H A;  2K02 A;  4KFC A;  2W4S A;  2MA3 A;  4U7D A;  2IEK A;  2EFQ A;  2D1H A;  5IP6 A;  2XRN A;  3K4M A;  2OBP A;  4L18 B;  1OJL A;  1SD6 A;  2DYR H;  3FIS A;  4JQF A;  4PGG A;  4ZZL A;  4RB1 A;  1GHC A;  4M3D A;  3NNR A;  2YS9 A;  5LGU A;  2UXX A;  2EZK A;  4DVY P;  3WG9 A;  4X6A J;  3OS2 A;  4JKZ A;  1E3P A;  2HYF A;  2PZ9 A;  4MO7 A;  5J8F A;  2A5Y B;  2P5V A;  2L7F P;  3VPR A;  3B6C A;  2ZC2 A;  5FFZ A;  2Z33 A;  3VYS B;  3MN2 A;  3QYF A;  4GCL A;  4M3G A;  2L5Q A;  5CW8 A;  1TT0 A;  1F9N A;  2OA4 A;  2HOT A;  3PSI A;  1ON1 A;  4RAZ A;  2F5C A;  3FHN A;  4CCN A;  2YVX A;  2V4J C;  3L2C A;  3HOY J;  2ACJ A;  3BNI A;  3R0J A;  1Y56 A;  1YX5 A;  1FP1 D;  2LY2 A;  1P7I A;  5FFX A;  3LSG A;  1VQK I;  1Z77 A;  3CDI A;  5CLS A;  3PO3 J;  4FTH A;  1YQA A;  1LKX A;  1W0T A;  2DOA A;  1LVA A;  1WFX A;  1HKQ A;  3G4S I;  4ON0 A;  4BBR J;  4PSX A;  4BY7 J;  5TIS C;  5DCM A;  4C30 A;  5CVJ A;  1BW6 A;  1ZR4 A;  1ENH A;  4M9Z A;  2GQQ A;  2EFW A;  1J9I A;  3LL7 A;  2ZXJ A;  5CQG A;  3CCM I;  3TP3 A;  3OS0 A;  4R79 A;  2RKH A;  1AU7 A;  4GCK A;  1EA3 A;  4D7M A;  2JSP A;  2DOD A;  2KHM A;  2DN0 A;  1M1E B;  1W4M A;  3FIW A;  2W85 A;  4I2O A;  3ZQL A;  1J59 A;  3CP8 A;  3GTP J;  2DMN A;  1EH7 A;  4YFN F;  1B72 A;  5D4R A;  1XSV A;  1K78 B;  2NOG A;  5HS9 A;  2K3P A;  4EV0 A;  4UV8 A;  1WJF A;  2LP0 A;  2Q8K A;  4F3Q A;  4J01 A;  2ETH A;  5L3E A;  3FBI B;  3B81 A;  2LKX A;  3HTJ A;  1EKE A;  4AYB A;  3BR6 A;  1R7J A;  1YTY A;  1LDJ A;  3B02 A;  3H9Q A;  2W1O A;  2HQN A;  2M1B A;  3QAH A;  1FPQ A;  3JRD A;  1J75 A;  3QKX A;  4JYK A;  2FA5 A;  1ZG3 A;  3HSR A;  2Y2Z A;  3FXO A;  2WA0 A;  1HW5 A;  3HOW J;  3HTI A;  1ZKG A;  4XKB A;  5HDG A;  1DPU A;  5E3L A;  2K3F A;  3K4L A;  3ANP A;  4Y13 A;  3W2V A;  4CCJ A;  1S6L A;  2WAQ N;  4MEX F;  3QYB A;  1UI6 A;  3CUQ C;  3VW1 A;  4QPQ A;  4HX4 A;  3ZQI A;  2WWY A;  3CME I;  4ZH4 F;  4ZDO A;  3HHH A;  3I4M J;  4NQW B;  3ABM H;  2DMU A;  3WGH A;  3J7Y J;  1P2F A;  1OYW A;  4UHT A;  4YG2 F;  2CU7 A;  4OMZ A;  1MNE A;  1MKM A;  2LMD A;  2NOJ B;  1E17 A;  3CCR I;  2FQ3 A;  1IJW C;  1UG0 A;  1SD7 A;  1X19 A;  4HF0 A;  2W24 A;  3FK6 A;  3TOB A;  2R7R A;  2FBH A;  3DP7 A;  3CCY A;  3MNL A;  5B66 C;  1EH6 A;  2HYG D;  3BZ6 A;  2KIQ A;  2LTP A;  4GFK A;  3VYT B;  3WTV C;  3A2K A;  3GTO J;  1WH7 A;  5E3N A;  4A2U A;  2NS0 A;  4YRV A;  1XC5 A;  1FTT A;  2A2F X;  3T6N A;  1D1A A;  2BY2 A;  3JSP A;  1IRF A;  1JUP A;  3LSI A;  3C18 A;  4XRS G;  4KMF A;  2BBY A;  4WXH A;  4ENJ A;  1JTY A;  4PK4 A;  5H20 A;  3DU5 A;  4UDS A;  3DTI A;  5C4Y A;  5AQC A;  1SAX A;  5LGN A;  1Y8Q B;  4HQE A;  1R5H A;  4FE7 A;  3ABK H;  2VIX A;  4IQ4 A;  3CUQ A;  3R61 A;  2VOO A;  2PQ8 A;  1FMW A;  3FMS A;  4ANJ A;  5HNH A;  4IXA A;  1FBQ A;  3Q0U A;  3K70 D;  1BR4 A;  2LBF B;  2ISZ A;  5FKO A;  3FKJ A;  2E1C A;  2ZME C;  5TJJ A;  3GZ6 A;  4UXN A;  2XAS A;  2ZFW A;  5L3C A;  3KP6 A;  1YW9 A;  3LFU A;  4D7N A;  3I54 A;  1VQ5 I;  3EGQ A;  1JKQ C;  4EEF G;  1OQY A;  2VT2 A;  4XM3 A;  2WAD A;  2CMP A;  5GPA A;  2CFX A;  3HOX J;  5M5W J;  4RS8 A;  1FY7 A;  1D3Y A;  2F48 A;  4MTD A;  4DOZ A;  1QBJ A;  4C2T A;  3AG2 H;  3IRQ A;  3HE0 A;  5L3F A;  1FBS A;  5ERI A;  2R4G A;  2CV0 A;  3BRU A;  4NBQ A;  3GZI A;  2VKH A;  3Q0V A;  5D5U B;  2M0C A;  3KET A;  2Y0M A;  3SFI A;  2O8X A;  1T8I A;  3DPU A;  4PDK A;  1LFB A;  2A69 F;  3ECH A;  3HXL A;  1U2W A;  2RV8 A;  1HOM A;  3FK7 A;  5DV5 A;  4CUG A;  2AQE A;  1XB4 A;  2J5P A;  3RPQ A;  1YJ9 I;  3N4M A;  4MK6 A;  5EYR A;  2HFH A;  1LVK A;  1AKH B;  2YUS A;  3HSF A;  2O8K A;  3K4N A;  1I6H J;  5E1W A;  1BI2 A;  4M3F A;  1KA8 A;  3QPH A;  2XAQ A;  1EF4 A;  4O6J A;  2ZME A;  5D19 A;  3E5X A;  1JHF A;  2XGD A;  2HVQ A;  3IV5 A;  4BAY A;  1BC8 C;  3ZMD A;  4IRV A;  3BCA A;  4BXX J;  3SHF A;  3WU1 B;  4FHT A;  4EM0 B;  5B3S H;  2K9M A;  3RYR A;  3L9F A;  5IOZ A;  2NVT J;  4HDU A;  4XKC A;  2XF5 A;  1Z67 A;  3HG9 A;  2XB0 X;  1NH3 A;  2FNP A;  3QPS A;  2K4B A;  5HDK A;  2A5W A;  2NNY A;  4WWC A;  2XKP A;  2RAS A;  4ENK A;  2DW4 A;  2QIB A;  4G6Q A;  3L2Q A;  4BEH A;  3C3W A;  1RR8 C;  3H35 A;  5HLH A;  2PX9 A;  2ZKZ A;  2ZSI B;  3V7C A;  2COB A;  1UEL B;  3SFZ A;  4IHY A;  1D5V A;  1G3W A;  3RD3 A;  2Q2E B;  2QQ8 A;  4FE4 A;  2R0Q C;  1VQL I;  2WBM A;  2KJB A;  3J7Z I;  3S32 A;  4LG0 A;  2Z16 A;  3TDU C;  5BS6 A;  2VLA A;  2AS5 F;  3BR0 A;  5HNF A;  2QM3 A;  3OWT A;  4GXO A;  4XN0 A;  3G71 I;  3VOX A;  1BIB A;  2OTL I;  3OR1 C;  5K5Q A;  5M3F J;  5BPI A;  4A93 J;  1OKR A;  3V8L A;  3AAF A;  3CC4 I;  3OYC A;  2V1X A;  3D5L A;  3JRE A;  5DM6 F;  1I3A A;  2YU3 A;  2OAZ A;  4K2E A;  5AON A;  4DZJ A;  2DPD A;  4WF2 A;  4C3H J;  4A6D A;  5EZG A;  2WAF A;  3K10 A;  5KNL A;  3F22 A;  1A36 A;  2IA1 A;  1VQ6 I;  3D5S C;  1LE8 B;  1BI0 A;  1FOW A;  4BHC A;  3U1K A;  4XON A;  3NS4 A;  4EM2 A;  4OMY A;  1TW2 A;  3SDG A;  3LOC A;  5E17 F;  2VOD A;  2W84 A;  1QPI A;  3PFI A;  5IP9 J;  1A5J A;  2VL8 A;  2IGK A;  4XLE A;  4BAC A;  3ZMU A;  3K7A J;  1IRZ A;  1HSJ A;  2ZBK A;  1S7O A;  2GXB A;  4KNY A;  9ANT A;  1H0M A;  3PQK A;  5J47 A;  4HX8 A;  3GTK J;  3K4C A;  1Z1D A;  5F0F A;  4U7B A;  3JRG A;  5D6F A;  1U5T C;  2PJR B;  1KGS A;  2ZOZ A;  3BG7 A;  2EWN A;  1QU3 A;  4EJU A;  4HOB A;  3BZK A;  2Q24 A;  1DDN A;  3VVX A;  3HPH A;  4P96 A;  1DP3 A;  1Y0N A;  1Z0X A;  2XV4 S;  4UV9 A;  4ZYA A;  2HQA A;  4A3M J;  3GZN B;  5LBQ A;  1TWC J;  2FOW A;  1MMS A;  4XLN F;  1D1C A;  1YE9 A;  2P4W A;  5B1A H;  4LIV A;  1MMD A;  2N8G A;  4PFP A;  2EIK H;  2O9L A;  2R7O A;  2OV7 A;  2R5Z B;  3FXR A;  3JSO A;  1MDM B;  3HC7 A;  5BNG A;  1XMA A;  3RKW A;  3S14 J;  3KZI C;  2E1N A;  3G2B A;  2VJJ A;  4R1H A;  2QEX I;  2JA2 A;  4LIU A;  2CWE A;  2G3B A;  2RRE A;  5JVG F;  1ZRE A;  4Y15 A;  3SQN A;  5GAH J;  4B3A A;  4PZJ A;  2PI0 A;  2FBQ A;  3LAJ A;  1VZ0 A;  4XSX F;  1ON2 A;  5IYC J;  3SWH A;  4F7Z A;  4I02 A;  1O7L A;  4BU2 A;  2O5R A;  5IP7 J;  3NEU A;  2E36 A;  1U5T A;  1ACI A;  2E34 A;  2QTQ A;  1OCP A;  5JFR A;  4BHB A;  4BQN A;  3J80 Z;  3WTS C;  4OIN F;  2WB1 A;  2HDC A;  4BJT A;  2NX4 A;  3Q0W A;  3WOD F;  2IS1 A;  4U0W A;  4P9U A;  1BBY A;  2BY0 A;  5J1R A;  1H9T A;  5ILU A;  2L7K A;  1RES A;  2GIV A;  5H2F C;  3IWZ A;  1HDD C;  1B1B A;  3DBH B;  1IN4 A;  1O3R A;  1NTC A;  5CXG A;  1H8A C;  4JX4 A;  2VBY A;  5M3M J;  3S16 J;  1VND A;  5J8C A;  2M45 A;  2VBX A;  1UAA A;  4B47 A;  2O6G E;  4XRS A;  4E7H A;  3ON2 A;  4EGZ A;  3HBL A;  2M0M A;  1YYV A;  2B3W A;  3L7W A;  5KHD A;  1TBX A;  3EET A;  3SDB A;  1KQ9 A;  2HS5 A;  4U0Y A;  4XLF A;  4S04 A;  4U88 A;  3HOV J;  3JRI A;  4WK8 F;  1R9T J;  4AF5 A;  1Y6I A;  3FF5 A;  1MNM C;  4G94 A;  5DDG A;  2BW3 A;  1QQI A;  3RTR A;  3P9K A;  1QVU A;  2NP5 A;  1OCR H;  3HUG A;  2PFV A;  2ECB A;  4CGR A;  2F5D A;  2A6T A;  2X6X A;  3JSJ A;  3U2R A;  4HX7 A;  3CO7 C;  2WV0 A;  5LEK A;  2QWW A;  4KIC A;  2DTR A;  3GLL A;  5J6X A;  2E1M C;  1W1W E;  2V1D A;  4A5N A;  3PIP F;  4M9X A;  4HLX A;  2KL4 A;  4FAS D;  4Z6Y A;  1V5F A;  3HTA A;  2LFB A;  4EJW A;  5FRM A;  2K85 A;  4D5F A;  3DKW A;  1HCR A;  3K2A A;  4IZZ A;  2L9V A;  1QZY A;  1HA8 A;  2QSG X;  1QPM A;  1V5E A;  2EBI A;  1DP7 P;  5CXI A;  2OZU A;  3PNY A;  2UXI A;  2KZV A;  5B5E C;  2JZY A;  3I56 I;  3HL2 A;  1LDK B;  4MFE A;  2R5Y A;  3M1C A;  1JTX A;  3WE3 A;  1UZC A;  3BJA A;  3SEQ A;  4KDP A;  2Q0O A;  1E3O C;  3CC7 I;  5CVI A;  2DT6 A;  3S5R A;  3ZQ7 A;  1LB2 A;  3TMO A;  3O3K A;  2X1C A;  4GCT A;  2A05 A;  2GBY A;  1YX3 A;  3CTA A;  1YIT I;  2BVL A;  1MBH A;  3I58 A;  1QHG A;  2XC7 A;  1A6Q A;  3OOP A;  5DTD A;  3ABT A;  1OIS A;  1CF7 B;  1ZGA A;  1KON A;  2ELK A;  4WXC A;  4ZDP A;  1TQI A;  1V5G A;  2BHY A;  4ZTF A;  4RA2 A;  2HYJ A;  2VON A;  4WX9 A;  1S7A A;  5GAD J;  4IHT A;  4PFO A;  4BKX A;  1I39 A;  3HTH A;  3WTY C;  1LJ9 A;  1DUX C;  4KIT B;  2ZXH A;  3HRU A;  1O3T A;  2ID3 A;  2XPU A;  1QZZ A;  2RNG A;  2DG7 A;  4QIW N;  3CCQ I;  1ITY A;  3ZQQ A;  3VOD A;  3BDD A;  3OYM A;  2GLO A;  3OYH A;  3MKY B;  3M1E A;  4IHX A;  3G7R A;  4CCM A;  1XMK A;  3LAP A;  4RB3 C;  1GDT A;  4ZYG A;  4M71 A;  2JSC A;  5HLG A;  2GXA A;  3M07 A;  3BOQ A;  3QOD A;  5KAI C;  3EPZ A;  3PM1 A;  2BEO A;  2X9D A;  1MBG A;  2EJR A;  4M6Y A;  5LHI A;  5LHH A;  3I53 A;  3FHZ A;  2DT5 A;  2HXI A;  1OCO H;  4HEA 2;  2P7C B;  2UV1 A;  2QF7 A;  1D0X A;  4Q5S F;  3R60 A;  3JRC A;  3PUB A;  4AD9 A;  4KIS A;  3ONQ A;  2Z99 A;  2DA1 A;  5EZH A;  5HBU A;  2CFO A;  2A6H F;  3E3V A;  4UVB A;  5D5V B;  1E0E A;  4CYC B;  2E1O A;  1XX5 A;  4BUP A;  1PYV A;  2NYX A;  2NVU B;  3TBI A;  1T2K A;  4MGR A;  2WC2 A;  3KEO A;  1IAW A;  2HZT A;  3HJE A;  2ZCM A;  2OQG A;  1ZN2 A;  1ZAO A;  2KRH A;  3QU6 A;  1MIJ A;  3FMQ A;  4HSR A;  4I01 A;  4BXU A;  2ZJR F;  3V42 A;  4S05 A;  3EUH C;  2ELJ A;  3T1B A;  3F6V A;  3C7J A;  3K1N A;  1I50 J;  3RQI A;  3OYD A;  1R5I D;  1F5T A;  5K7F A;  3H3V K;  2JK3 A;  2CSO A;  4AC6 A;  3GTM J;  3E97 A;  4MHG A;  2DPU A;  2VQH A;  2FF4 A;  4DJA A;  3HDD A;  2HKU A;  2QCO A;  3KKC A;  1ORK A;  3G1O A;  1GUU A;  3S1Q J;  1A35 A;  3COL A; 
#chains in the Genus database with same CATH homology
 4L62 A;  1DU6 A;  3MKL A;  2Y2Z A;  3RKQ A;  3HOW J;  4QSH A;  3HTI A;  1ZKG A;  2JJ7 A;  2O7T A;  4JP0 A;  5E3L A;  2HOA A;  2VPR A;  4IEJ A;  3D1N I;  3ANP A;  2XGC A;  3S1M J;  2QWT A;  2LLK A;  1JT0 A;  2JA6 J;  2F07 A;  1IUF A;  1B8I A;  2WAQ N;  1ETK A;  1NK2 P;  4HNV A;  1UI6 A;  1MSF C;  4ME9 A;  3VW1 A;  2L0K A;  2DA7 A;  3OSG A;  3ZQI A;  2GEN A;  3G56 A;  1QVT A;  3KNW A;  4B1R A;  3A01 B;  1WGX A;  3M3Y J;  3TED A;  4A3L J;  1BL0 A;  2K40 A;  3I4M J;  2LD5 A;  3GTQ J;  2NP3 A;  2DJN A;  3FKI J;  1QRY A;  2DMU A;  2EZL A;  2W48 A;  2ZOY A;  2G7L A;  1WI3 A;  4L5E A;  2CU7 A;  3AQT A;  3V6G A;  5F0C A;  5D1R A;  2IBD A;  1IJW C;  1U9N A;  3KZ9 A;  1ZTR A;  1TWG J;  4JX6 A;  3FK6 A;  5FJ8 J;  4M3E A;  3CCY A;  3MNL A;  1JKR C;  2XGE A;  4GFK A;  2Y30 A;  2LTP A;  5F1J A;  1JKO C;  3GTO J;  2DTZ A;  2TCT A;  3G1M A;  4AYB N;  1WH7 A;  5M5X J;  5E3N A;  1XC5 A;  4A69 C;  1FTT A;  3I4N J;  3T6N A;  2UXU A;  5H9T A;  2DA4 A;  1SGM A;  1JUP A;  4XRS G;  3S1R J;  1D5Y A;  2OPT A;  1FTZ A;  4C3I J;  1T33 A;  4DYQ A;  1JTY A;  2W53 A;  2O7O A;  5FKK A;  5C4Y A;  3GTL J;  4UDS A;  5AQC A;  4CYC A;  3OSF A;  1SAN A;  2CQQ A;  4FE7 A;  3BR2 A;  3CMY A;  2YU9 J;  1H89 C;  2YVH A;  5IYB J;  5FLV A;  2EZI A;  2V57 A;  3NI7 A;  3LSJ A;  2NVY J;  3Q0U A;  3TW6 A;  5HAW A;  2K9Q A;  2EQR A;  2HQ5 A;  1MSE C;  3LSR A;  1MBE A;  5FKO A;  3TP0 A;  3LNQ A;  2Y9Z A;  3NPI A;  4MIM A;  1RPW A;  2MG4 A;  4G12 A;  2Y31 A;  1MBJ A;  4D7N A;  3EGQ A;  1JKQ C;  4EEF G;  1O4X A;  4W1U A;  3BG5 A;  5GPA A;  4UUS B;  3HOX J;  5M5W J;  3W6V A;  5J3L A;  1IGN A;  4A3J J;  3HE0 A;  5FKN A;  5FMP A;  2NS7 A;  5C44 J;  3E7Q A;  3BRU A;  2IU5 A;  3A02 A;  3GZI A;  2K9S A;  1JUM A;  3Q0V A;  3OIO A;  2M0C A;  3A01 A;  4I76 A;  2JMW A;  1X58 A;  3QPL A;  3SFI A;  2EZH A;  4XID A;  4GFB A;  1LFB A;  3F0C A;  1HOM A;  2RHA A;  3FK7 A;  2MW8 A;  2HDD A;  3WHB A;  3A03 A;  3H0G J;  3HKZ N;  3BQZ A;  4C3J J;  4MK6 A;  4MLO A;  3S17 J;  5EYR A;  5C3E J;  1AKH B;  1IDY A;  4IHV A;  2YUS A;  2B63 J;  2O8K A;  3BTC A;  1I6H J;  3BR3 A;  2ME6 A;  4M3F A;  3JRB A;  3ON4 A;  4UUT A;  5F0H A;  1ETY A;  1HF0 A;  1Y1V J;  1EF4 A;  2CQX A;  1POG A;  5D19 A;  5DS9 A;  2XGD A;  2LR8 A;  3HOU J;  3BQY A;  1W0U A;  3IV5 A;  2VUM J;  5FKM A;  3HOZ J;  3GEU A;  4A3K J;  3GTG J;  3DPJ A;  4BXX J;  2JA7 J;  1OCT C;  5IOZ A;  2NVT J;  2M9H A;  2KT0 A;  1K61 A;  1FIP A;  3P9T A;  3BCG A;  1JKP C;  1UMQ A;  2M34 A;  5M5Y J;  1HDP A;  2M8G X;  4S0H B;  4QTR A;  2XB0 X;  2OF7 A;  2VKV A;  1ETW A;  3QPS A;  2RAS A;  2UXH A;  2DA2 A;  2QIB A;  3HB9 A;  2ECC A;  2XPW A;  4Y52 J;  2YVE A;  3ZQF A;  2ME0 A;  1VF9 A;  1G2H A;  3VVY A;  1DU0 A;  4IHY A;  2COB A;  3VOK A;  3M4O J;  4DYR A;  3RD3 A;  1TWF J;  4FE4 A;  2R0Q C;  3HGY A;  2R7Z J;  1VI0 A;  1FJL A;  3RZD J;  3HEF A;  4KWA A;  3VOX A;  3BR0 A;  4ACI A;  5GPC A;  4UUS A;  1BW5 A;  3CJD A;  4A3I J;  2P81 A;  1U9O A;  3BR5 A;  5M3F J;  3AQS A;  3UKG A;  2WUI A;  4A93 J;  5IYD J;  3JR9 A;  1GVD A;  1XG1 A;  1MBK A;  2D6Y A;  3JRE A;  2OER A;  4DZJ A;  1ETO A;  2DA6 A;  2KDZ A;  2HOS A;  3S1N J;  2AO9 A;  4C3H J;  3LHQ A;  3QBM A;  3BTI A;  4A3G J;  4MFD A;  5EZG A;  1A6I A;  1LE8 B;  3LJL A;  1H88 C;  4JNN A;  4AC0 A;  1AKH A;  2R92 J;  2G7G A;  1TWA J;  3SDG A;  3LOC A;  1IV6 A;  2GM4 A;  4A3C J;  3ZQG A;  2G7S A;  3NXC A;  5EEA A;  1QPI A;  1A5J A;  5IP9 J;  2ZB9 A;  3K7A J;  2FQ4 A;  2I10 A;  5EDN A;  1IRZ A;  4I6Z A;  9ANT A;  1IC8 A;  3GTK J;  3B6A A;  1NK3 P;  3PAS A;  3PPB A;  2Y0S N;  5F0F A;  3VW0 A;  3JRG A;  2ZOZ A;  1ZQ3 P;  2JA5 J;  2Q24 A;  5EGO B;  3VVX A;  1Z0X A;  1YRN B;  4A3M J;  3RH2 A;  1GV2 A;  3VVZ A;  1TWC J;  2GUH A;  3O8G A;  2D5V A;  2JN6 A;  2FD5 A;  2N8G A;  3QQA A;  2O9L A;  1ETX A;  4V2F A;  3VUQ A;  2R5Z B;  1UG2 A;  2MSY A;  5BNG A;  2VKE A;  3S14 J;  5FHP A;  5F08 A;  2NS8 A;  1AHD P;  3OOU A;  3S15 J;  2ZCX A;  2G3B A;  3C07 A;  3KKD A;  4XK4 A;  5F04 A;  5J1Y A;  3S2D J;  4B3A A;  1BJZ A;  1JJ8 C;  1I3Q J;  1OFC X;  2K9N A;  3NAR A;  3G1L A;  2FBQ A;  5IYC J;  2G0E A;  2HI3 A;  5IOY A;  3BHQ A;  4ICH A;  1WCM J;  5IP7 J;  5JLW A;  2XDN A;  2E2H J;  2EH3 A;  2QKO A;  4A3F J;  2QTQ A;  2CJJ A;  1OCP A;  3IH2 A;  5JLX A;  4A3B J;  3CQZ J;  5K58 A;  5K7H A;  2NVQ J;  1LE8 A;  3ZOB A;  4XIC A;  2NX4 A;  3ZQH A;  3Q0W A;  5HOD A;  2H8R A;  1FEX A;  5IPA A;  4IHW A;  5J1R A;  3F1B A;  1JGG A;  1RES A;  2R5Y B;  4NN1 A;  4A3E J;  2REK A;  1HDD C;  2DA3 A;  3RZO J;  1X2M A;  1NTC A;  5CXG A;  3HIM A;  5EFY A;  1UI5 A;  1JJ6 C;  4C2M J;  4DYC A;  3BG9 A;  4AUX A;  4JX4 A;  1H8A C;  2JA8 J;  3C2B A;  2GFN A;  2CUF A;  5M3M J;  3S16 J;  2UXO A;  1MH4 A;  1VND A;  2M2E A;  3TW7 A;  2XB5 A;  1U78 A;  1RKW A;  1PUF B;  4XRS A;  3ON2 A;  4V2G A;  3HBL A;  3LSP A;  1SFO J;  1RET A;  2E2J J;  4MXM A;  5EGO A;  1ETQ A;  3VW2 A;  2QOP A;  5DAJ A;  5GP9 A;  1YRN A;  3HOV J;  2AHQ A;  4X1E A;  5EF6 A;  3JRI A;  1K83 J;  1R9T J;  4B4C A;  4AF5 A;  2L7Z A;  1ZK8 A;  3CDL A;  1APL C;  2DMQ A;  4LOC A;  1MNM C;  4JL3 A;  3JRH A;  2R5Z A;  3V78 A;  3BTL A;  5EG0 B;  3GTJ J;  4JX5 A;  1QVU A;  2NP5 A;  1ZGW A;  4FIS A;  2IAI A;  3IUV A;  1HLV A;  2FX0 A;  2LK2 A;  2ECB A;  2TRT A;  4CGR A;  3O8H A;  4M6V A;  3BJB A;  3JSJ A;  1JT6 A;  4XRM A;  3BT9 A;  2WB1 N;  4DZP A;  5K7Z A;  2DMT A;  2DMP A;  3E7L A;  2PBX A;  3HGG A;  5D18 A;  1Y1W J;  5C4X J;  3ANG A;  1LFU P;  2RAE A;  4A3D J;  3HTA A;  2LFB A;  4PXI A;  2LVS A;  3BR1 A;  3PO2 J;  4D5F A;  5E3M A;  3JRF A;  1HCR A;  3K2A A;  1GT0 C;  1MBF A;  5J1U A;  2HYT A;  4GFL A;  2CUE A;  2PMZ N;  1WPK A;  4RBO A;  3GBG A;  3DEW A;  2EBI A;  4ABZ A;  2XPV A;  2ZCN A;  2E2I J;  1CQT A;  1F36 A;  3HM5 A;  3Q3S A;  3VIB A;  1S7E A;  5CXI A;  2UXI A;  2MGQ A;  1B72 B;  2IEK A;  2DG8 A;  5IP6 A;  1ZR2 A;  4MFE A;  2R5Y A;  1OJL A;  3FIS A;  1JTX A;  4M3D A;  1IG7 A;  3NNR A;  1UHS A;  2YS9 A;  1E3O C;  2L9R A;  2EZK A;  2LY9 A;  3S5R A;  4X6A J;  4JKZ A;  3EUP A;  3VP5 A;  4GCT A;  2PZ9 A;  2GBY A;  4MO7 A;  4RDU A;  5FGL A;  2X48 A;  2L7F P;  1PUF A;  3VPR A;  1X2N A;  3B6C A;  1MBH A;  4BBS J;  5HSZ A;  5DTD A;  3IH4 A;  3ZQC A;  3MN2 A;  2WGB A;  4GCL A;  2ELK A;  4M3G A;  3S2H J;  5CW8 A;  3MVP A;  2Y9Y A;  2HOT A;  2HYJ A;  5F27 A;  1IDZ A;  4FCY A;  4BKX A;  3HOY J;  3BNI A;  3HTH A;  5FKL A;  4HKU A;  1WH5 A;  2OI8 A;  3BTJ A;  3FRQ A;  1Q1V A;  1P7I A;  5EG0 A;  2ID3 A;  2XPU A;  3LSG A;  1Z77 A;  1B8I B;  2X6O A;  1XS9 A;  3PO3 J;  2DG7 A;  4FTH A;  2E19 A;  4QIW N;  1W0T A;  1ITY A;  1BA5 A;  4YZE A;  3L1P A;  3WHC A;  2GLO A;  1P7J A;  5E3O A;  4BBR J;  2JWT A;  4Y7N J;  1TWH J;  4BY7 J;  4IHX A;  2XSD C;  3G7R A;  4J19 A;  2H1K A;  1GDT A;  1BW6 A;  2NVX J;  3NRG A;  3SJM A;  2CRG A;  3DCF A;  1U8B A;  1ZR4 A;  1ENH A;  4M3B A;  2L7M P;  5FLM J;  3PM1 A;  2X9D A;  1MBG A;  3TP3 A;  5C4J J;  1RR7 A;  2VI6 A;  1AU7 A;  4GCK A;  2HXI A;  4D7M A;  3O60 A;  2UXP A;  1TC3 C;  3CWR A;  4NDL A;  2DN0 A;  2QF7 A;  2HXO A;  2DA5 A;  3FIW A;  3JRA A;  3ZQL A;  3NAU A;  1ETV A;  1JUS A;  2WV1 A;  3JRC A;  3LWJ A;  3IH3 A;  4W97 A;  3GTP J;  2DMN A;  1FIA A;  4D5C A;  2DA1 A;  5EZH A;  4DW6 A;  2R93 J;  5HBU A;  1B72 A;  3CRJ A;  4BY1 J;  4NEL A;  1MH3 A;  2NOG A;  2FJ1 A;  4CYC B;  2E1O A;  1GV5 A;  1RKT A;  2XRL A;  2LP0 A;  2ZCM A;  3B81 A;  2LKX A;  3HTJ A;  1I50 J;  1T56 A;  3BR6 A;  3BG3 A;  3RQI A;  5K7F A;  3H3V K;  2JK3 A;  4AC6 A;  1VFC A;  3GTM J;  3KKC A;  3HDD A;  2ID6 A;  3JRD A;  1F43 A;  2HKU A;  2QCO A;  3QKX A;  1ORK A;  3G1O A;  4JYK A;  1GUU A;  3S1Q J;  3COL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...