4I6ZA

Crystal structure of the transcriptional regulator tm1030 with 24bp dna oligonucleotide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
200
structure length
200
Chain Sequence
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of the transcriptional regulator TM1030 with 24bp DNA oligonucleotide
rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator/dna
total genus 65
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4i6zA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4i6zA02
1PUFB 1UI6A 2G7SA 2MW8A 2R5YA 1MSFC 3H0GJ 3NAUA 5EZGA 2RAEA 2EZLA 3WHCA 3BNIA 2G0EA 3ZQFA 2HOSA 1ETWA 2CUEA 3A03A 2ZCNA 2HYTA 1RR7A 4A3LJ 4AC0A 5FKOA 3A01B 1HF0A 3CDLA 1XG1A 1S7EA 1VNDA 1MBJA 2DMTA 3DEWA 1QPIA 3PASA 5EYRA 3M3YJ 4L5EA 4A3BJ 4Y7NJ 1X2NA 2G7GA 2CUFA 2Y9YA 4BBSJ 3BG3A 2XPUA 2M34A 2XRLA 1ITYA 2Q24A 2DMQA 3DCFA 3LOCA 5E3LA 4AYBN 1TC3C 1JUMA 2NP5A 5EG0B 2XB5A 4GCKA 3HB9A 4A3KJ 1JTYA 3TW6A 2O8KA 2GENA 2X9DA 4W1UA 2HYJA 2DG8A 3NPIA 2OF7A 3VVXA 3G1MA 4V2FA 3I4NJ 3TEDA 3GTKJ 3Q0UA 3RH2A 3BJBA 4DYCA 1POGA 1JUSA 4M3BA 2TRTA 4GFLA 1JT0A 1ZK8A 5C3EJ 1I50J 2Y31A 2PZ9A 1VF9A 5EDNA 4C2MJ 3NXCA 5IOYA 2PMZN 1APLC 4C3JJ 4XICA 1PUFA 2LTPA 2LP0A 3HBLA 1IV6A 2CJJA 4DW6A 3MKLA 4IHWA 2I10A 2Y2ZA 2GBYA 3OIOA 3LNQA 3FK6A 1CQTA 2AHQA 2CQXA 2DA6A 4DYRA 2B63J 2FX0A 5IP9J 4JX6A 2GUHA 2FQ4A 2UXOA 3LHQA 2HOTA 2K9SA 3F0CA 1JJ8C 1VI0A 2O7TA 5FHPA 5AQCA 3OSFA 3JR9A 4CGRA 2LFBA 4NELA 3GTQJ 5EFYA 5HBUA 2DA4A 3S14J 1ETVA 1O4XA 3RZDJ 3L1PA 2EZIA 2LR8A 3S16J 2E19A 1QRYA 2LY9A 3VW2A 2R0QC 1ENHA 4BXXJ 1QVTA 4UUTA 3HTAA 5J1UA 1F36A 3SDGA 1NK3P 2DTZA 3HM5A 1DU0A 4GCTA 2DMNA 3RD3A 2M8GX 5M5WJ 3S1MJ 4A3CJ 4JP0A 3IH4A 1F43A 1ZKGA 1R9TJ 2G7LA 3G56A 1SANA 4DZJA 3GTLJ 3CCYA 1GVDA 3BRUA 5K7ZA 3P9TA 2QOPA 3ANGA 4QSHA 5EGOB 3FRQA 3T6NA 1HDDC 5GPAA 2VUMJ 3PPBA 2DA1A 1U9OA 2ECBA 2FD5A 3HEFA 1U8BA 4MFDA 3B81A 1AKHA 1LFUP 2CQQA 5HSZA 2JK3A 3VVZA 4XRSA 2FJ1A 2XPWA 3FKIJ 1TWGJ 2IAIA 1Q1VA 3E7LA 1JKRC 1WPKA 2EZKA 1W0UA 2IU5A 2OI8A 4MXMA 2XSDC 3WHBA 4MIMA 5F1JA 2WGBA 4D7NA 3BHQA 1H8AC 5BNGA 4D5CA 3BG9A 1JGGA 2HOAA 5JLWA 2E1OA 1I6HJ 2V57A 5F0CA 3VVYA 1GV2A 3B6AA 1JT6A 2LK2A 4D7MA 1BL0A 3COLA 1IJWC 1JUPA 3KNWA 1Z77A 1ETKA 4NDLA 3O8HA 2M2EA 3KKDA 2ZOZA 2DN0A 3EGQA 2E2IJ 5HAWA 1X58A 2H8RA 4KWAA 2NVTJ 5K7FA 2JMWA 5C44J 2NX4A 1WCMJ 1GT0C 2R5ZB 2ID6A 4FE4A 2HKUA 1LFBA 3S2DJ 4JNNA 4G12A 4A3FJ 3VUQA 3G1LA 5FMPA 4XIDA 2YVEA 1BA5A 3GEUA 3ANPA 2E2HJ 5C4XJ 5EGOA 1IG7A 3W6VA 2QF7A 2WV1A 4A93J 2JA7J 4I76A 5D18A 4FE7A 3KKCA 4M3GA 2CU7A 3OOUA 3NRGA 5CW8A 1HLVA 5K58A 3GBGA 3ON2A 3S17J 5IP7J 3O8GA 4M3EA 3CWRA 2KDZA 1RETA 4IHYA 3S1RJ 1W0TA 4A3GJ 1Z0XA 4MFEA 3Q0WA 1EF4A 1HDPA 3BR2A 3GTOJ 1WGXA 4ACIA 3BTCA 3Q3SA 1FIAA 1RESA 1HOMA 1GDTA 2WUIA 3HOZJ 5E3MA 2K9QA 2WB1N 4DZPA 3QBMA 3S5RA 1MBKA 2DA5A 4EEFG 4JYKA 5F04A 5M5YJ 1MH3A 3IV5A 3VW0A 2WAQN 1LE8A 1AKHB 2OERA 2JA6J 2VKEA 2KT0A 1JKOC 3IUVA 1FTZA 2NVQJ 2ZCMA 1BW6A 4A3EJ 2YS9A 3BT9A 2UXHA 1SGMA 2R5ZA 5IYDJ 2ZOYA 2UXUA 1OCTC 3HOVJ 2HDDA 1UHSA 1ZR2A 3HIMA 3FIWA 3BQZA 1UG2A 3KZ9A 5F0HA 2LD5A 4MLOA 1Y1VJ 3NARA 4Y52J 3LSRA 2R93J 1MNMC 1VFCA 2GM4A 3HOUJ 4YZEA 1JKPC 2DMUA 2EQRA 4IEJA 1TWAJ 2EZHA 1E3OC 2JJ7A 1UMQA 3RQIA 3VOXA 5K7HA 2NP3A 2ZCXA 4UDSA 5EF6A 1XC5A 2GLOA 1P7IA 3LSPA 3HGGA 2DJNA 2EBIA 4M3FA 2PBXA 5FKKA 2E2JJ 4B4CA 3LWJA 3VP5A 1T33A 1AU7A 3HDDA 3F1BA 3VOKA 3TW7A 5FKMA 5EZHA 3K7AJ 3Q0VA 4HKUA 2UXIA 2XGCA 3JRHA 2HXIA 3GTJJ 1TWFJ 3M4OJ 3ZQCA 3S1NJ 1RPWA 3JRGA 1YRNB 5HODA 3V78A 3HTJA 3MN2A 4FTHA 4AF5A 3JREA 3QPLA 2XGDA 1BJZA 2RHAA 2Y30A 2LLKA 5CXIA 2O9LA 5E3NA 2HI3A 1ZTRA 3DPJA 2JWTA 1OJLA 4A3IJ 2QCOA 3I4MJ 3NNRA 1MBFA 2VI6A 3SFIA 1D5YA 3UKGA 3PO3J 3GZIA 1ZQ3P 2REKA 4QIWN 3SJMA 1OCPA 4M3DA 4B1RA 2R92J 1ETYA 3RZOJ 2IEKA 2L7ZA 2NS8A 4A3JJ 3JRIA 5FGLA 1WI3A 4A3DJ 1LE8B 4JKZA 2K9NA 1IC8A 3TP3A 4QTRA 3HOWJ 3JRBA 3NI7A 5H9TA 3ZQLA 1TWHJ 2M0CA 2Y0SN 4XK4A 4XRMA 2LKXA 3EUPA 3BTIA 5FJ8J 5FKLA 1FIPA 4GFBA 1ETQA 1FJLA 1NK2P 5CXGA 1P7JA 2VPRA 1IDZA 1FEXA 5DS9A 2QKOA 2D5VA 4RBOA 5IP6A 2MGQA 2K40A 2D6YA 3ZQGA 1NTCA 3GTMJ 2JA5J 3BTJA 1B8IB 1TWCJ 3BR5A 4M6VA 5GPCA 3BR6A 4MK6A 1DU6A 2P81A 2IBDA 2ID3A 2L9RA 4AC6A 1YRNA 4IHVA 2MG4A 3BR0A 3LSGA 3CQZJ 2NS7A 3VPRA 1IGNA 5IOZA 4PXIA 3HE0A 2X48A 2GFNA 4CYCA 3BG5A 3V6GA 4L62A 3G7RA 2MSYA 1MBHA 1IUFA 4W97A 5C4JJ 4I6ZA 2ME6A 3JRFA 2QTQA 4UUSB 2JN6A 2L7MP 1WH5A 4AUXA 3IH2A 2COBA 3PO2J 4ME9A 4A3MJ 1ETXA 2X6OA 3HGYA 3S1QJ 2FBQA 3E7QA 3CMYA 4J19A 4ABZA 3FK7A 3G1OA 4GCLA 5J3LA 5DTDA 1B72B 1SFOJ 2XDNA 1OFCX 2NOGA 1RKTA 2XPVA 3OSGA 1K61A 3QQAA 1IDYA 2M9HA 2AO9A 1ZR4A 2OPTA 5C4YA 1T56A 2ELKA 2W53A 4BY7J 3VW1A 3BR1A 5F27A 3CJDA 2N8GA 3HOXJ 3JRCA 1AHDP 1GUUA 5FLVA 3LJLA 1X2MA 4GFKA 2UXPA 1B8IA 3IH3A 2H1KA 3S15J 1MBGA 2HXOA 5F08A 3FISA 2LVSA 2DMPA 5E3OA 3S2HJ 3ON4A 3QKXA 4RDUA 5M5XJ 1I3QJ 3A01A 4X6AJ 3C07A 4JL3A 1JTXA 5J1YA 2NVXJ 1Y1WJ 9ANTA 2ME0A 3A02A 1H88C 2O7OA 3VIBA 1A6IA 5IPAA 3BCGA 2F07A 1H89C 2NVYJ 2DA7A 3GTPJ 5M3MJ 3K2AA 4B3AA 3H3VK 4UUSA 5FLMJ 5EG0A 2JA8J 3GTGJ 1JJ6C 4V2GA 2R5YB 3MNLA 1K83J 1U9NA 1IRZA 1JKQC 5D1RA 2EH3A 2QIBA 1WH7A 2DA2A 2XB0X 5EEAA 3RKQA 3CRJA 5J1RA 4HNVA 1ORKA 3PM1A 1B72A 3ZQHA 2XGEA 4S0HB 4BY1J 1A5JA 3BQYA 2TCTA 2R7ZJ 1ETOA 1XS9A 2HQ5A 4CYCB 3JRDA 3QPSA 4A69C 1QVUA 3LSJA 4BKXA 1MBEA 3BR3A 1RKWA 2CRGA 2W48A 5JLXA 2ECCA 1BW5A 3AQSA 3HTIA 3HKZN 4JX5A 5F0FA 2VKVA 2L7FP 4IHXA 2ZB9A 5IYCJ 1GV5A 4JX4A 3JRAA 1ZGWA 1U78A 2QWTA 5D19A 1UI5A 2YUSA 1G2HA 3MVPA 3BTLA 4C3IJ 5DAJA 4D5FA 2RASA 2YVHA 3ZOBA 4X1EA 3B6CA 2DG7A 4ICHA 4C3HJ 2L0KA 4LOCA 4MO7A 5FKNA 2DA3A 4XRSG 4BBRJ 2Y9ZA 4NN1A 4FISA 3HOYJ 3TP0A 1MSEC 2YU9J 3HTHA 3AQTA 4FCYA 3C2BA 4DYQA 3JSJA 3D1NI 1HCRA 5GP9A 5IYBJ 5M3FJ 2G3BA 3O60A 1MH4A 3ZQIA 1FTTA
chains in the Genus database with same CATH superfamily
1UI6A 1IZ1A 2MW8A 2R5YA 3OIQA 1XB4A 5EZGA 1RC9A 4F52A 5KAFC 1BI0A 4ITVA 2VT3A 3OR2C 2PLYA 1ETWA 3A03A 2LKSA 4O5VA 3WTYC 3GVAA 2HYTA 1RR7A 3DFGA 3DKXA 4HW0A 4A3LJ 1V5GA 3ZGKA 1VQOI 4A5MA 3M3YJ 1WVRA 4A3BJ 1FOWA 1CF7B 2Y9YA 3TO9A 3BG3A 3NWTA 1DUXC 1ITYA 4DJAA 4F7ZA 2WC2A 2M5WA 4EATA 1TC3C 4ETSA 2RVCA 2NP5A 1D8JA 2OBPA 1L0OC 5EG0B 1R4NB 1HA8A 4BH9A 4GCKA 4A3KJ 1G3YA 2QLZA 3P9IA 1TZLA 2X9DA 2O8XA 3HRTA 3IWZA 3MD2A 2HYJA 4W1UA 4UVBA 5K5OA 2HS5A 4KT5C 3NPIA 3VVXA 4L9JA 3G1MA 1LEBA 3GEZA 3RH2A 1HW5A 2MC4A 3BJBA 1W36D 4ZYDA 3RKWA 2PJRB 3F8NA 3SZGA 3RJPA 2FJI1 4IX7A 2ETHA 4PUSA 1ZK8A 4CH7A 5C3EJ 1I50J 4WIBA 1WJFA 3WTUC 1S29A 2QGUA 2Y31A 4ZZLA 2PZ9A 3V7RA 2AXTC 5EDNA 3JTHA 1K79A 3VFZA 1O57A 2XF6A 1W5CC 3FHZA 1Z1DA 3QYBA 2Q8KA 2FOWA 4IJAA 3K4MA 2LTPA 4GXOA 5KAIC 1IV6A 3WGIA 3N05A 4HQMA 4DW6A 2XASA 5JHUA 4BNCA 2I10A 3BCAA 2GBYA 3OIOA 2ZXIA 1MNEA 2PG4A 1Z6TA 3HRMA 2GUHA 1QO0D 3IAM2 4Q47A 4BXUA 3A4CA 2HOTA 4UUVA 3BJ6A 2O7TA 4GGGA 3K1PA 4GO1A 1U6GA 4Y17A 3AG2H 4CGRA 5EFYA 5HBUA 2DA4A 5FLXZ 3S3NA 3S14J 3RZDJ 1GHCA 3EETA 3IAS2 2QYOA 1B1BA 2LY9A 1IF1A 2VLAA 4FQGA 2HYGD 1QVTA 2AXLA 4XBFA 5J1UA 4GCTA 2DLLA 3FBIB 4A3CJ 1J59A 4JP0A 1GXQA 3G56A 5HNHA 3S3OA 3HOSA 2PJRA 2LDUA 4XLCA 1SAXA 5KCMA 1ONVA 2BYVE 2HKXA 5B5EC 4Q48A 3FRQA 2WY8Q 2VUMJ 1Y8RB 3HEFA 1U9OA 2ECBA 2FD5A 4I0AA 2W25A 3K10A 4WF2A 4EJOA 1EH8A 2FOKA 1S7AA 4ZTJA 2F5EA 3OYCA 2E71A 2VBWA 4XRSA 4I98B 3FKIJ 1TWGJ 2IAIA 3E7LA 3I58A 3I3LA 2EZKA 2IU5A 4MXMA 2XSDC 1OMIA 2L7KA 2EINH 1TW3A 2QVOA 2CW8A 1I1GA 3CDIA 1U0JA 1VQ8I 3CD6I 4D5CA 3G2BA 3BP8A 1IXRC 2PQ8A 3FXJA 2E1OA 5JLWA 2HEOA 5CPRB 5K5QA 1DP3A 4P55A 3COLA 4I99C 2P5VA 2QQAA 1T98A 2D45A 2M2EA 3KKDA 2XKPA 2ZOZA 2DN0A 3DPLC 2V9VA 2NVTJ 2JMWA 2NX4A 1X4PA 1WCMJ 1ZG3A 2ID6A 2HKUA 3ERMA 2BXZA 2IA2A 2A6HF 5FMPA 2YVEA 3IKTA 1OLTA 4ZYHA 1IG7A 1ZRFA 2QF7A 1FOKA 2H09A 4BQNA 2R7DA 2LRDA 3NRGA 3VOEA 5CW8A 1SVMA 2RQPA 4XN0A 3CCMI 5K58A 2H1LA 3ABUA 2NS0A 3ON2A 3ONQA 5IP7J 3CWRA 1W0TA 5CLSA 5GAHJ 1I6XA 2DOAA 4G7HF 5DM6F 3H0DA 2VXDA 1Z3XA 3GTOJ 1RESA 2IRFG 2ZJRF 2K9QA 2MBFA 4X0GA 2GXAA 3S5RA 4OMZA 4NB5A 4JYKA 4CICA 1GVJA 1I27A 3IV5A 1LE8A 3F8FA 3KFWX 3OYDA 4XORA 4IRIA 3DKWA 1MJBA 2QSGX 2QUFA 1FTZA 1T08B 3NRVA 2NVQJ 1N75A 2ZCMA 3TO6A 1HKSA 3L2CA 4A3EJ 4PJNA 3CJRB 1DPUA 3O6BB 1RNLA 2CV0A 3HOVJ 3E6MA 2VE8A 2OCCH 1BOAA 1MD0A 4F3QA 3C3WA 1HW1A 1SAUA 4XLAA 3KZ9A 1X3UA 5F0HA 2JVGA 4A6DA 2V26A 4Y52J 2R93J 3T1BA 3J81K 3IRRA 1LQ1A 4YZEA 2VKDA 2F2EA 1FMWA 4ASNA 2BE5F 2DMUA 1MJ9A 2EQRA 3ZN1A 2JVHA 2EZHA 2JRTA 2CO5A 1E3OC 1UAAA 2WADA 4ZZDA 3CTAA 3RQIA 3F72A 2F5FA 3GLXA 5K7HA 2NP3A 4UDSA 4A0ZA 1O7FA 3PUBA 2EBIA 3OS0A 5CVIA 4AD9A 3ROUA 3BROA 3GFLA 1D1AA 4EJUA 3VOKA 3TW7A 2OZ6A 3T5XA 1VQ7I 3EUHC 2OJED 5LEKA 2XGCA 2HXIA 4M6XA 3E3VA 2FXAA 1RPWA 4CZCA 4KDPA 4AU7A 4L9NA 2WAQA 3EUHA 2P4WA 1X1PA 5B1AH 1I39A 3C2HA 2ZMEB 2Y30A 2LLKA 2M4GA 2HI3A 3JAMZ 4N9HA 1DPRA 3UKGA 3EUAA 2REKA 4AVZA 2BGCA 4BGDA 1OCPA 3IP4B 4M3DA 2QSHX 5IY5H 2L7ZA 3DP7A 5J4VA 3CF2A 1WI3A 1LDDA 2JSCA 3ECHA 2ZJQF 1D8KA 1IC8A 2E1CA 2STWA 4KUMA 1JGSA 1S7OA 3GWZA 2M0CA 3TKYA 3QRFF 4XK4A 4OIOF 3BTIA 2RV8A 2YU3A 4KFCA 2HTJA 4WCGA 3KEOA 4UY8I 3GFMA 1R7JA 1P7JA 4D9JA 1F9NA 1TNTA 2VQCA 2V1NA 1Z9CA 5F64A 1BR2A 2HPIA 1LDJA 2D6YA 3OOPA 3ZQGA 1XGNA 2JA5J 4BE1A 3BTJA 4U9LA 5LLQA 2VPLA 2W85A 3K4JA 2HKOA 2HTSA 3BR6A 4CCLA 1DU6A 2L9RA 2CV1A 2BW3A 2WAFA 2TDXA 3DTEA 2EB7A 3G71I 2ZJ2A 5H6QA 4BDZA 4IHVA 2A3SA 2E1MB 3VPRA 4V19K 1IGNA 5CQGA 1ZELA 5CJ9A 2LBFB 5E17F 3BG5A 3CO6C 2LH9A 3ABLH 1VQ9I 1XCBA 2MSYA 1MNDA 1QBJA 1YG2A 3JRFA 5E8GA 4UUSB 2L7MP 1G3WA 4Y33A 3S3MA 1TT0A 3PO2J 1F5TA 3TDUC 4U9NA 1LVAA 1DP7P 1DQUA 1FMVA 1TT5B 2HU9A 2KHMA 2DDBA 4ABZA 4HPQA 4GCLA 4R1HA 3UR3C 3BJAA 5DTDA 3X2QH 1FC3A 3C2GA 1OFCX 4P1WA 1RKTA 2XPVA 2HYFA 3V8KA 2VBYA 4OINF 2R3SA 3OSGA 5K1YA 3U1KA 1IDYA 4HX8A 2AO9A 1PJRA 5L3GA 1ZR4A 2XAQA 2G9WA 1T56A 4GRIA 4Q5SF 2ELKA 3KYCB 1X1DA 4BY7J 4Q4ZF 3QP5A 5F27A 3CJDA 1AHDP 4L9TA 3DV8A 2JUCA 2QQ8A 3LJLA 3P7NA 3KZYA 3FXOA 3HSFA 2E1MC 4AIKA 4LG3A 1G3SA 5E1WA 1MMDA 3I55I 3ABKH 3OL3A 3G6EI 4KMFA 3FISA 2LVSA 4CA0A 3TGNA 3QOPA 3A01A 2VJIA 2EFWA 2BOLA 3V7SA 4WXHA 2VC0A 1QQIA 2LBFA 3H5AA 3KX2A 2FMLA 2O7OA 1A6IA 5IPAA 4KN4X 5DUIA 3MKYB 3HSEA 3OYGA 4L9VA 5M3MJ 4XSXF 4UUSA 4FX4A 3HUGA 1M1EB 2GQQA 3M8EA 4ZYAA 4F91B 4N9IA 5D4RA 1OCZH 3K69A 5LFAA 3F21A 1JKQC 3ZQ7A 2WTEA 4LLGF 1N78A 2QIBA 2KISA 4RB3C 2W7NA 3CRJA 5J1RA 4LD5A 4A0XA 3F9KA 2XGEA 1FT9A 3OYNA 2QQBA 1XS9A 1HSTA 3RCOA 4CYCB 3F6VA 3RIRA 3LQQA 4DOZA 4ZDPA 1BW5A 5BS6A 1G4DA 3I0TA 5DD8A 4BU2A 2QENA 2VKVA 2L7FP 4GDFA 4LIUA 2VJ5A 2PMUA 5DEQA 2Q2EB 5IYCJ 5D19A 1GV5A 3WTZA 4HSTA 1UI5A 2MYSA 2YUSA 3G3ZA 5TJJA 1G2HA 3BTLA 2GZWA 2EFOA 2W1OA 1JXSA 5FD5A 3RYPA 4X1EA 3B6CA 3FM5A 2DG7A 4IOCF 4K2EA 4L18B 4BBRJ 3J80K 1WRJA 4FISA 3HOYJ 2GA1A 4CCJA 4XKBA 2JRMA 3NWSA 5JHFA 1R5ID 2COMA 4FCYA 3MKZA 5IYBJ 2V6CA 2A5YB 2R7QA 2IP2A 3DU6A 5JR3A 3F23A 3MMYB 2G7SA 2CFOA 3ULQB 5FROA 4B44A 3PUFA 3ZP5A 2EZLA 2W4SA 5TISC 3BNIA 2G0EA 4RM3A 1MMNA 2HOSA 4IHTA 3VYRB 5DV5A 2XAJA 5GADJ 1OR7C 4R79A 4AC0A 3VEPA 3CDLA 4I02A 3K4KA 3CESA 5EYRA 4Y13A 4BUPA 2LY2A 4L5EA 2H6CA 2DOFA 4PFPA 2IS2A 1OR7A 1SD5A 2DT7B 3TO7A 4BE2A 2OV7A 1YX5A 4HNUA 2XRLA 2Q24A 3DCFA 3V7CA 4RB2C 2MFZA 3CUQB 3QWLA 4BEHA 1I1SA 3OWTA 2DK8A 2FNPA 1JTYA 3TW6A 4BHPA 2QKMB 3BJOA 2L9NA 4XONA 2PFBA 4EM2A 2A68F 2OF7A 5LEJA 2ZY9A 5EEHA 1RIOH 2L54A 3TEDA 3Q0UA 4RGUA 1USSA 2P6SA 1HW2A 1TNSA 1POGA 4L5JA 2VL8A 2VKHA 1JUSA 1PP8F 2DAOA 6PAXA 3CO7C 4GFLA 1JT0A 2M30A 3TBIA 4Z2YA 2EFNA 1VF9A 4TV7A 1UELB 1WI9A 1OCOH 1QZZA 2L2OA 4C2MJ 3NXCA 2FBIA 3PL8A 3HXLA 1HC8A 2CQKA 2OTJI 4U87A 4C3JJ 2BZTA 4XICA 1DGWY 2GAUA 3L7WA 2R7TA 3HBLA 2V7FA 5E18F 4LB5A 1J75A 2LNBA 3MKLA 4IHWA 2Y2ZA 1ON1A 1Z7LA 4C2UA 3PQJA 4HX4A 3S2WA 5DUKA 2AHQA 2DBBA 2B63J 2FX0A 2KRHA 4PDKA 2DT5A 3DPUA 2UXOA 2K9SA 2VASA 3ABTA 3F0CA 2NNYA 5FHPA 2CH0A 4JK1X 5AQCA 2HQAA 2QZ8A 3GTQJ 2P6TA 4HLXA 1O4XA 1R5HA 2VQGA 3L1PA 2EZIA 4JQFA 4LB6B 3S16J 2E19A 2M87A 5HDGA 3V42A 4UUTA 2DI3A 2XRNA 1F36A 4EGYA 2UXXA 5D8LB 1NK3P 1A35A 5FLXK 3RD3A 3RKXA 3TL4X 1VQPI 2M8GX 2KDOA 3S1MJ 2IS6A 3AKZA 1R9TJ 1K7AA 2XDVA 4DVYP 3GTLJ 3PNVA 2BHYA 3L09A 3QU6A 1SEUA 1GVDA 1MIJA 3DTKA 1QHHD 2VBZA 3L2WA 2QOPA 4QSHA 3I9V2 3T6NA 3E6CC 1O3SA 1FP1D 3OV8A 2DODA 4MFDA 1PUEE 1LFUP 3CMEI 4RGSA 3QYFA 2FU4A 2LREA 2Y75A 5FO5A 3ZXSA 2FJ1A 3J80Z 4KYWA 1WPKA 3LQRA 2QSFX 1IN6A 1LKXA 3A2KA 3GZ5A 4LFUA 1IXCA 3Q5FA 3VDXA 5LGUA 3BZKA 1UG0A 2KJCA 3K4CA 3KP6A 3TOBA 1IN5A 4RAGA 3PIOF 1B6AA 2E36A 3Q9VA 2R7VA 5BNGA 1O7LA 3VYUB 5F0CA 1FPQA 2KZGA 2GIZA 2ISYA 2LYCA 4OU0A 4F92B 1OYWA 1P2FA 2LSOA 3GLLA 5J40A 3WGGA 3KNWA 3RSNA 2W82A 2R7UA 1Z77A 5BMZA 3V8LA 1ODDA 3EGQA 1OYYA 1RI7A 1X3WB 1X58A 4JOMA 4ZDOA 2GENA 1V4RA 4KWAA 1GT0C 2R5ZB 4PGHA 4IPAA 5CKTA 4JNNA 3WTWC 3P5JA 3G1LA 1IW7F 1FP2A 4YIIA 1W36C 1FY7A 5B1BH 3OYEA 2WV1A 4ANJA 3CZ6A 1WJDA 1O3RA 5CYVA 2CU7A 2OQGA 3OOUA 4RLFA 4I7HA 2FEZA 3CJQB 3WTVC 1HLVA 3F8MA 3C7JA 3GBGA 3F8BA 2UXNA 3GZNB 4KIGA 5D5VB 2MH2A 3OYLA 2KDZA 4HLYA 1U3EM 1ERDA 3FF5A 2IJLA 4XKWA 5ED4A 2HDWA 2XAFA 3REOA 4MFEA 2G7HA 3K8PC 3BR2A 3QU3A 4OIPF 2XVCA 5D8KB 1W7PA 1FIAA 4H4KC 5CVUA 2WUIA 1KYZA 2NVUB 3QBMA 2DA5A 4BHBA 1B4AA 2IGOA 2DT6A 5F04A 4M74A 2RDPA 1W7PD 1ZARA 2NRAC 3R4KA 1JKOC 5DYMA 2IGKA 3VODA 4LITA 3H3ZA 5HVQC 1N25A 1UB9A 2F4OB 4IO9F 2XROA 4OIQF 4XNFA 4IL6C 1SGMA 2R5ZA 2ZOYA 1OCTC 2HDDA 4YFNF 2ZJPF 2V6EA 3FIWA 3UNGC 1XMAA 1SFKA 3BQZA 2GXGA 3VTIA 2J5OA 4A2UA 1QU3A 2LD5A 1KQ0A 2Z99A 3NARA 2UWMA 4KT6A 3HOUJ 1VFCA 2GM4A 4PJJA 4II2A 4E7IA 2V1DA 5D5XB 1SD6A 1YW8A 1FBSA 3U21A 3QP6A 1QGPA 3HTSB 2NOJB 2QQ9A 1Z6RA 1G3TA 5EF6A 1TTYA 1XC5A 3W6JB 3SQNA 3RI4A 3HGGA 1R1TA 5FKKA 2X1EA 3LWJA 3CLQA 1T33A 5KK1A 2Y0MA 1AU7A 3SEZA 3W2VA 3WTXC 3KP2A 1FLIA 1TQMA 2NNNA 5FKMA 4II3A 4O6JA 3JRHA 4M9SA 1TWFJ 3S1NJ 1CGPA 1HXDA 4XKVA 1YRNB 3G4SI 5E8IA 3QPLA 1BJZA 2M7BA 1IV8A 1F1ZA 3GO5A 1XGMA 2O9LA 5E3NA 3DPJA 1ZTRA 2JWTA 1OJLA 4IF4A 1R23A 4I09A 4IOAF 3HRUA 3LSHA 2AQEA 2CYYA 3PO3J 3VYTB 1ZQ3P 3DLLF 2KIUA 3RZOJ 4B1RA 2L5QA 3JAMK 5FD6A 3QODA 2IEKA 2JT1A 1IRGA 4A3JJ 1AWCA 1HKQA 1TP4A 1LE8B 3KEQA 1SD4A 4PJ0C 2VOPA 2FNAA 3TP3A 4CHUA 1V3FA 4QTRA 5CQEA 3RKYA 3FXRA 1O3TA 3JSOA 1MDMB 3HHGA 2Y0SN 2VODA 2GA2A 4XRMA 2LKXA 3EUPA 1FIPA 5LHIA 3GUDA 1FJLA 1NK2P 3HYIA 2DTRA 5CXGA 1TQIA 3WE2A 2HZDA 1D3YA 2DCEA 1SFEA 5FB2A 1T38A 4WX9A 1IDZA 1OCRH 1QZYA 2MGQA 2A61A 5IP6A 3CCQI 3GTMJ 1VQMI 5CVJA 3FKJA 4UNOA 1FBQA 3CMMA 4F93B 4BQOA 5GPCA 4Y15A 3DF8A 2IW5A 1YRNA 2ZXHA 2BY3A 2MG4A 3BR0A 2YVXA 2DDAA 2OA4A 4LK1F 4ENNA 3OYBA 5IOZA 4PFOA 4PXIA 1XCVA 2X48A 3HE0A 3OS2A 4HSRA 1VTNC 4C2MA 4YEJA 1TLHB 4MQ9F 3K2ZA 3D5SC 3ECOA 2DFEA 1R1VA 3DEUA 1YTYA 1WH5A 3BZCA 4AUXA 3DBLB 4QWQA 4ESJA 2LG4A 3BG6A 1ETXA 2K9MA 4IQ4A 3S1QJ 3CMYA 2Y48A 4C2TA 3FHNA 4I01A 3SZTA 1FYLA 1U8RA 1MDMA 5LRRA 1EKEA 1VQ5I 1W1WE 2FBKA 3J7YJ 4LLNA 1BIBA 2OPTA 2VC1A 5F1RA 2XAHA 3S32A 3KYDB 3WU1B 3VW1A 2EK5A 3WG9A 2KJBA 4A5NA 2LMDA 1X2MA 3CCEI 4HG2A 3OYMA 1XMKA 3IH3A 2P7CB 1LB2A 1ON2A 3ZMUA 1FSEA 2KQRA 1MBGA 3AG3H 3ESWB 4L0ZB 3KP4A 2DMPA 2Z1DA 3BLYA 5E3OA 2P5LC 3ON4A 4UXNA 4RDUA 4M72A 3C07A 2P7VB 2IXSA 2RGVA 5L3BA 5J1YA 5JVTA 4G94A 4XR6A 5ICEA 1H88C 2XKOA 2C6YA 3KP3A 2XSJC 3VIBA 3BCGA 1I3AA 4Y4RA 1VQNI 3LA7A 5L3EA 2CFXA 2F07A 4DNCA 1OQYA 1VZ0A 2JA8J 3GTGJ 5HDNA 4E7JA 1YO5C 1K83J 5FGMA 4XKCA 4IHSA 2HFHA 1ACIA 2YSRA 1WH7A 2BW3B 2DA2A 4KJZA 5EEAA 3PFYA 5IT3A 2FSWA 3FDYA 4BY1J 1LVKA 4OAZA 1EH6A 4RB1A 2R7ZJ 5J8CA 1H0MA 3JRDA 1V5EA 1QVUA 2LF8A 1MBEA 1KU9A 3BR3A 2CRGA 5JLXA 2ECCA 4G8XA 3AQSA 2R7FA 2LF7A 1LEAA 1W5TA 2D1HA 3HKZN 4JX5A 4S04A 2STTA 2QBYA 1DGRM 1K6YA 5F0FA 4MQVA 1YI2I 1U5TC 3K9TA 3R60A 2ZB9A 5ILVA 3JRAA 3N4MA 1ZGWA 1Y0NA 4HF2A 3MVPA 3RPUD 4C3IJ 4FT8A 1E0EA 4R8HA 1R71A 1U5TA 3ZOBA 4YIRX 3GYHX 4C3HJ 2MD5A 2L0KA 5FKNA 2Y9ZA 3HHHA 4CGZA 1KU3A 1X1BA 4XM3A 3AG1H 1OCCH 3TP0A 1XTAA 5J6XA 2M1BA 3HTUA 5KVRA 1MSEC 2A6TA 1ZN2A 2DFIA 5AONA 3HTHA 4I2OA 2M0MA 2BHZA 2FBHA 3BOQA 4I0BA 4LIVA 1HCRA 3O60A 3LFUA 4YELA 4CCMA 4M6YA 1Y39A 5ILSA 2X4HA 4L5IA 1FTTA 2B1EA 2LY1A 2MD0A 3L2QA 1V54H 3GXOA 3H0GJ 2Z3YA 1D1CA 4E6KG 1Z05A 4FASD 4NC7A 3ZQFA 2I8DA 2ZCNA 1XSXA 4LGWA 4CCOA 4P9UA 3A01B 4J00A 3DEWA 1S7EA 1VNDA 1MBJA 2DMTA 4ESBA 4YG2F 4G6TB 4AIJA 4FX0A 5IT9Z 5E79C 3PASA 4UVCA 4Y7NJ 2FA5A 3LAPA 3Q9SA 2G7GA 2CUFA 3E1SA 3HPHA 2BY0A 5HLHA 2YX4A 2XPUA 2Z33A 5LRSA 2M34A 4B8XA 3FBNB 4N0BA 2OC6A 1ZREA 2DMQA 1Y6IA 4LG0A 5E3LA 4AYBN 4MTDA 2CMPA 2VBXA 3HUGB 5HDKA 2XB5A 2EIJH 1Z21A 4HBLA 3MCZA 3GFIA 5LHGA 2A2FX 3FMRA 2NXNB 2BY1A 4V2FA 3I4NJ 2VQHA 3GTKJ 2DQLA 1ZLKA 3MWMA 4BHCA 1VQ6I 4KICA 4M3BA 1HKTA 2E34A 3HG9A 4MHGA 3KLNA 4GYIA 1SMTA 1X19A 3WGHA 1PVEA 2ZSIB 1YOVB 1X1AA 3KCCA 5JFRA 1KGSA 2JA2A 5TGTA 5BPIA 3LMMA 4BJ6C 4YIFA 5DCMA 1E17A 2R7OA 1Z67A 2A6EF 3D5RC 4U7BA 4ZYGA 3K1NA 2PMZN 2HVQA 2K3FA 2M7AA 4CCNA 3ZMTA 1RUNA 4B47A 4QLCU 2LP0A 4E7KA 1FNNA 1S3JA 3P9CA 4MGRA 2CJJA 1PDNC 1P4WA 4BJ5C 3C1DA 3W2AA 3B73A 4ENKA 4M73A 2YPRA 3F3XA 4PJLA 2P8TA 3LNQA 2OQRA 1CQTA 2CQXA 2DA6A 5IP9J 4JX6A 2FQ4A 3KYLA 2CG4A 3LHQA 4RMNA 1VI0A 2J5PA 3VWBA 3OSFA 1T2KA 4HOBA 2K02A 4OMYA 4NELA 1IN7A 1ETVA 2E5NA 1YX3A 1QRYA 4NBQA 3IHUA 1ENHA 2E7WA 3M9AA 3V4GA 3HOTA 3SWHA 3HTAA 1FYMA 2O6GE 3SDGA 2DTZA 2VJ4A 1A6QA 5B66C 2DMNA 1DU0A 2IA1A 2K27A 1Y56A 1F43A 1ZKGA 2V1UA 2IVMA 1SANA 2DYSH 1UCRA 1MMGA 4BXFA 4DZJA 4U0WA 3W3CA 3BRUA 5HLIA 5K7ZA 1YYVA 3ANGA 1WHUA 2O03A 2Z5UA 3RYRA 3J7AO 1B59A 1HDDC 5GPAA 3LA3A 1J9IA 3OR1C 1STZA 1D5VA 4BEHB 4Z6YA 3MZYA 3B81A 1J0RA 1AKHA 1BR1A 2CQQA 1BI3A 1T0FC 2WB1A 3H3UA 4XL9A 3AAFA 3LSKA 2CQ7A 3M07A 3CCVI 1JKRC 3W6KB 1Q1VA 1T0FA 1SC7A 3W2WA 5L3CA 2CUZA 2OD5A 4HNTA 2X0LA 3DBHB 1WKMA 3GZ6A 4AM3A 2RC4A 2EFQA 3EDPA 3WE3A 5F1JA 2WGBA 4D7NA 3BHQA 2HVRA 1SFXA 1Z7UA 2RN7A 3CF5F 1JGGA 1I6HJ 4YRVA 4UHTA 2V57A 2ELHA 4CO8A 3KLOA 3B6AA 1BL0A 1IJWC 3SZPA 1ETKA 4NDLA 5AIPA 2BBYA 1QA6A 2IPQX 1WQ2A 3ZQQA 5HAWA 2H8RA 2ZKZA 1WJBA 5C44J 2EA2A 1YE9A 4BQAA 2GXBA 4FE4A 3S2DJ 4G12A 3VUQA 4XN3A 4KITB 4XIDA 1UFMA 1BA5A 1WWXA 2DQRA 2CS3A 2E2HJ 3ANPA 3W6VA 4E70A 1FOYA 4BQQA 4UV9A 1XDSA 4A93J 2JA7J 4FE7A 3VSKA 3I56I 4M3GA 2IA0A 4AWXB 1EV7A 4NQWB 4HQEA 2PEXA 1P9QC 2WAEA 3S17J 2KRCA 1MZBA 3O8GA 4XLNF 4M3EA 2PN6A 3I53A 1RETA 3M8FA 4OAYA 4IHYA 4ZDLA 3S1RJ 4A3GJ 3QPHA 5DDGA 1EF4A 3KZIC 1WGXA 4ACIA 3Q3SA 3AFHA 2M3AA 3I71A 4IVNA 2H94A 1FOXA 4DZPA 1RZ4A 2WB1N 2Z16A 4CXFA 1MBKA 3CCRI 2VONA 5DCFA 3RPQA 4EV0A 4G6DA 2XIGA 2HPMA 2X6WA 1MH3A 4WWCA 4XOPA 2JA6J 1NG6A 2A05A 2X1DA 4ZTFA 1JHFA 3LSTA 1ZLJA 1KZHA 2R7SA 3IUVA 1BW6A 4OD4A 2HR3A 2YS9A 4G9YA 2UXHA 3H1CA 3H5RA 4XOTA 1UHSA 4AVPA 1ZR2A 1R22A 4HAMA 4WXCA 3LL7A 4U0VA 4ENJA 3WU2C 5E1ZB 4HA8A 3NEUA 1UG2A 5D5WB 4IRHA 4MLOA 1WJ5A 2KIQA 5GTIC 3K1MA 2HZTA 2KL4A 3LSRA 2CUJA 5FFZA 2ZO4A 4NQWA 3PFIA 4XLEA 4IEJA 3CCSI 1H9TA 3BPVA 2JJ7A 1UMQA 3FX3A 2DU9A 3S93A 3N97A 2JPCA 1JI8A 2B9SA 2XUBA 2CWEA 2ESHA 1P7IA 2DJNA 4M3FA 2E2JJ 2HWVA 3BDDA 1NHAA 3HDDA 4G6QA 4IXAA 3DWLE 4YFXF 2RKHA 2P0WA 5EZHA 3K7AJ 4HKUA 5B3SH 4J01A 2E7XA 3H9QA 4BJTA 3ZQCA 3LSIA 3JRGA 4AF5A 3MN2A 1B9NA 3H5NA 2X1CA 3R61A 1A04A 4N4NB 2RHAA 3QOEA 5CXIA 3SFZA 3BG7A 1LDKB 3EYIA 1BBYA 4A3IJ 1X1CA 3FXMA 2R4GA 2EV5A 3NNRA 3M7GA 2VI6A 1W7PB 3SFIA 4HF0A 3AL0C 2P5KA 1R49A 2ZSHB 1ETYA 2LC2A 2WY7Q 3HC7A 3DQVC 5HS8A 5CVVA 5LGNA 4A3DJ 1VQ4I 1ZGAA 3CCUI 2K9NA 1SMYF 3G73A 1FWZA 2K4BA 3JRBA 1EH7A 3NI7A 5GAGJ 2L9VA 1TWHJ 2HGCA 3FXKA 4E4HA 1BR4A 3PNYA 2EPFA 5FKLA 4Y3OA 2FE3A 1ETQA 1SD7A 2BVMA 4S05A 4IRGA 1R36A 5K5RA 4XRFA 1S9HA 2DPUA 3K70C 2VPRA 3CP8A 3WODF 2QKOA 2Q0OA 5H2FC 4RBOA 3OY9A 1K4SA 2IS1A 4U88A 2PMHA 1JHHA 1B8IB 1S5LC 3KZZA 1AOYA 1Y8QB 1GXPA 2PX9A 3RTRA 3L2VA 2P81A 2IBDA 3ML6A 4G7ZF 3CQZJ 2NS7A 3K70D 1R58A 5LBQA 2R7WA 2XGXA 1KU7A 1ZH5A 3I4PA 3OYHA 1BM9A 4CZZA 3V6GA 2HOEA 1S72I 3ASNH 3G7RA 4KIFA 4I6ZA 1IUFA 2DFFA 3C18A 1YIJI 4KN7X 4IZZA 3CC4I 4EJVA 3VYSB 3IWFA 1MMSA 2JN6A 1A36A 3WU0A 1XGOA 3IH2A 4ME9A 2BVLA 2XF7A 2KLOA 2ADUA 5L3FA 2LOOA 5LHHA 3E7QA 4XQFA 4J19A 2H6BA 4NNJA 5J3LA 5CVRA 2VOOA 2ZXJA 2ZXWH 3L9FA 1B72B 5HNFA 1SFOJ 2NOGA 4EQQA 2KP6A 1BI1A 3E5XA 3I59A 1XN7A 3H9JA 3QQAA 2B3WA 2M9HA 4C9YA 3FWEA 5C4YA 2Y0SA 3GFJA 3HJEA 2A69F 4FETA 5FLVA 1PYVA 1OISA 2BXYA 2EIMH 2IGMA 1IO2A 4F55A 5D5UB 4GFKA 1D0ZA 2UXPA 1B8IA 3E6BA 3S15J 3FXQA 3L2RA 3DU5A 2HXOA 5F08A 2JTVA 2K7LA 2OUMA 4U7DA 3S2HJ 2X85A 4P5OA 4HDVA 4X6AJ 5M5XJ 3QKXA 2O5RA 4PSXA 4JL3A 1IRXA 1JTXA 4XSZF 2KRFA 2F48A 1RR8C 1UJ8A 3D0SA 4RB0A 3E5QA 2XHKA 1YFHA 1CF7A 3RQ4A 1WJCA 1MMAA 3MFKA 3I64A 4E7ZA 2DA7A 1HQCA 1R6RA 3I54A 4PK4A 2OZUA 3H3VK 2PBIA 5FLMJ 5EG0A 1YJNI 2QA4I 3LSMA 3DBRB 1R4MB 2GOXB 4V2GA 2E1NA 1IRZA 4PJMA 3IL2A 2RNGA 3T8RA 5D1RA 2EV0A 2EFPA 1F4KA 2XB0X 3RKQA 1YS7A 2Y69H 1B72A 2IS4A 2V4JC 1A5JA 3IRQA 1LJ9A 3EPZA 4DQ2A 2TCTA 2HQ5A 5J47A 3BCBA 3EUKL 3LSJA 2F5CA 3KIOA 3GW2A 1RKWA 5ERIA 4WK8F 4OOIA 1P92A 1P4AA 2V1XA 5F6FA 2JSPA 5EJCA 2ZFWA 4IHXA 2ZCWA 1R5GA 4JX4A 2F6CA 5J4YA 2ELJA 4LJZF 5DAJA 5D6FA 5FRMA 4D5FA 3GMEA 4ICHA 1SVOA 4XRSG 2DA3A 2GOMA 4UB6C 4P9FA 3LAJA 2YU9J 2FUG2 3AQTA 1H9GA 1W4MA 3C2BA 4DYQA 3D1NI 3SYTA 5EEGA 5M3FJ 2G3BA 3QYEA 2AQFA 1MH4A 2V79A 1T6SA 3ZQIA 2I5UA 1PUFB 2CSOA 3F22A 4E7HA 1MSFC 4BAYA 2X6XA 3NAUA 3BZ6A 3GX4X 2RAEA 2VQLA 3WHCA 5HS9A 1ZRCA 2CUEA 3IC7A 3CLOA 3H36A 2M4KA 3OYIA 3BC8A 3TQNA 5AIQA 5FKOA 1HF0A 3U9GA 1XG1A 1QPIA 1P4XA 4QPOA 2VXZA 1X2NA 2ZFUA 4B43A 4BBSJ 4P96A 5IT9K 3LOCA 2EILH 1JUMA 5JVGF 4IRVA 3OYKA 1ZHFA 2YX7A 3HB9A 1QHGA 2KFDA 2O8KA 4ENMA 2DG8A 4GYGA 4HV5A 3HKZA 4RGRA 2F5VA 2EIKH 3HSRA 3WG7H 2CW7A 3ZR8X 3L2UA 5BQTA 2O61A 2D1VA 4DYCA 2ACJA 1P6RA 3ELKA 3CP2A 4JBAA 2VE9A 2TRTA 1EJ9A 4XLHA 4KISA 3FXUA 1V5FA 2O0YA 4KMUX 1J5YA 3K4NA 3LFKA 2XAUA 3ZRGA 5IOYA 2MC3A 3FMSA 4GCVA 3ABMH 1APLC 2QBYB 3A1YA 4RAYA 4RLQA 1PUFA 4NC6A 4LMYA 2FMYA 3H35A 2VN2A 4RS8A 4ON0A 4EM0B 3OMYA 2DW4A 3VSLA 4KNYA 4HZFA 1ZYRF 4OWRB 4HRIA 1U5TB 1WJEA 3FM3A 3FK6A 4DYRA 1J09A 2OU2A 3FZVA 2VB6A 3K4LA 3CCLI 2ZNYA 3RDIA 1JJ8C 2D2WA 1GLNA 4M9XA 3JR9A 4ZH4F 2LFBA 4PCQA 1R1UA 2DPDA 2K86A 2VJJA 2LR8A 2OTLI 3VW2A 1OPCA 2R0QC 2MH9A 4C30A 4BXXJ 1BC8C 4B48A 4AYBA 2UZKA 3HM5A 2DO7A 4D1QA 1YS6A 1ZG1A 1C0WA 5M5WJ 1D0XA 5ILUA 4EJTA 3OIPA 3IH4A 1FSHA 3OYFA 1XMXA 2G7LA 1LUJB 1FYKA 3D5LA 3ZMDA 3CCYA 2F4IA 1XX5A 2E35A 5DD4A 1LPQA 2HNHA 3BPXA 3CUOA 3DEEA 5HS7A 1HBXG 4DBRA 3P9TA 1BI2A 5EGOB 2XF5A 4LG0B 4CUGA 3AG4H 3PPBA 2DA1A 1KONA 3ERED 3RPUA 3DXJF 1U8BA 5E20A 2EJRA 3LA2A 2Z2SB 5HSZA 4CSWA 1UHMA 2JK3A 3M1EA 3VVZA 2V9PA 2PMZA 1WSUA 2CGPA 2XPWA 4DGWB 1XDUA 4AIHA 1W0UA 1R00A 2DXIA 2OI8A 3O3KA 4WXDA 3WHBA 4MIMA 4M9ZA 4MTEA 2WBMA 1NG7A 5KNLA 5H20A 2LKPA 4EM1A 5LD2C 1QZEA 3E0JB 1H8AC 4L0YB 5DCMB 3BG9A 2HOAA 3MZ8A 4NHJA 2GWRA 2QKLB 3VVYA 1GV2A 2DK5A 1QNTA 1XSVA 1JT6A 2LK2A 4D7MA 1IAWA 1YIOA 1JUPA 3ASOH 1A31A 3QAHA 1SVLA 2NAZA 3O8HA 3SEQA 3K6GA 2KIFA 2KKOA 2L9SA 1RRJA 2E2IJ 3KETA 2A07F 2PJPA 3A0HC 1D0YA 5K7FA 3JTGA 5TRDA 2AS5F 5FRNA 3WTSC 3J7ZI 2CQNA 2DJIA 1LFBA 2L4AA 2OCEA 3O2PE 3CMAI 4A3FJ 4XMYA 3T0YA 3V8JA 3R6SA 3GEUA 5C4XJ 5EGOA 4I76A 5D18A 2XC7A 3KKCA 3BWGA 3NQOA 4MEYF 4PZJA 2ZMEC 4B3XA 1YJ9I 1UZCA 4M71A 2H27A 1UHWA 1NH3A 4RAFA 4UVAA 5ICGA 3DLAA 1Z0XA 2M8EA 2ZMEA 1IXSB 4D0PA 5JI6A 4UV8A 3Q0WA 1ZRDA 2W00A 1HDPA 2F4MB 3PSFA 2F5DA 3E5UA 2PFVA 1MGTA 2ZNZA 3BTCA 1K6OA 1G8XA 1HOMA 1GDTA 2DFHA 3HOZJ 5E3MA 3FMQA 4EEFG 2L3DA 3MQ0A 3PSIA 3TOAA 4HX7A 1YJWI 5M5YJ 5A2QK 3VW0A 2WAQN 2E60A 2QM3A 3EQLF 1AKHB 1KQ9A 2HQNA 2OERA 2VKEA 2JQ7A 2XV4S 2KT0A 3CDHA 2MLKA 3PJRA 4RM2A 3FXLA 2B0LA 1E3HA 1LFPA 2KZVA 4ZYEA 1Q1HA 2B7EA 3BT9A 2GIVA 4XLFA 2K9LA 3DPTA 3EYYA 5IYDJ 1S8NA 5D6EA 4AIDA 2UXUA 3KP7A 3NS4A 3HIMA 4RGXA 2NYXA 2Q1ZB 1U2WA 3J81Z 2UUZA 3MEXA 3T8TA 3ZMSA 2BEOA 4ESFA 1FZPB 1IUYA 4EGZA 1Y1VJ 3L00A 1WJAA 5GAEJ 1XD7A 4H0EA 1MNMC 5GTHC 3PQKA 4LK0F 2L01A 3U1DA 1JKPC 5HLGA 3K0LA 1TWAJ 3VB2A 5LGTA 1BJAA 3TDZC 1V55H 3SDBA 2A5WA 2CV2A 4HEA2 3OYJA 3VOXA 1QPMA 4ZJZA 4QPQA 2JUGA 2ZCXA 1OYIA 2K3PA 2GLOA 2W84A 2WV0A 3LSPA 2IGNA 3A0BC 3BY6A 2PBXA 4B4CA 4RAZA 4EJWA 3VP5A 3MKWB 3F1BA 1RUOA 2KPMA 2DYRH 3Q0VA 3KEYA 2UXIA 4BL0B 3GTJJ 1O3QA 3M4OJ 5HLTA 5HODA 3V78A 3TMOA 4FTHA 3HTJA 3JREA 3ZN0A 2XGDA 4A12A 1MKMA 2QEXI 1J7KA 1Z3YA 3ZMZA 3ZMVA 5BOXA 3I4MJ 2QCOA 1BIAA 5L3DA 3E97A 1MBFA 3PIPF 3ISPA 3QPTA 1D5YA 5ICFA 3U2RA 1EA3A 3GZIA 2BY2A 3CCJI 2EA4A 4QIWN 3SJMA 1IN8A 2ICWG 1K78B 2R92J 1TQPA 2HDCA 2NS8A 3MAJA 3JRIA 5FGLA 1X4OA 1ZGJA 3HL2A 4BS9A 4JKZA 1XSDA 3PNTA 2JPBA 5HOOA 1FX7A 3HOWJ 5H9TA 4MNUA 3ZQLA 1KU2A 5J8FA 1USTA 3CC2I 3B02A 1KA8A 5FJ8J 3CJNA 4GFBA 3DTIA 3H92A 3LWFA 5FFXA 2R7XA 3R0AA 1ULYA 3R0JA 3JCUC 3CJTB 4HDUA 4BE0A 1FEXA 1YW7A 5DS9A 1I5ZA 1Z91A 2D5VA 1YLFA 3COAC 2K40A 3HRSA 4PSWA 1NTCA 1XPXA 3CC7I 1JE8A 3JW4A 1TWCJ 4IQJA 1TL8A 3BR5A 4LLLA 5DM7F 4HV6A 4HYEA 3I5UA 4M6VA 4BDYA 4MK6A 4CDGA 2ID3A 4AC6A 1SFUA 3JSPA 3MZHA 4EMSA 1VQKI 3LSGA 3M1CA 1KYWA 4CYDA 2X6YA 2GFNA 2VIXA 4CYCA 3OS1A 4DBQA 4L62A 4O3MA 2G7UA 2W57A 1MBHA 4W97A 5A2QZ 1XGSA 5C4JJ 2ME6A 2ZC2A 1WFXA 2K4JA 2QTQA 4KA4A 1K78A 2COBA 2FF4A 1G6NA 3K4BA 4A3MJ 4FHTA 4MEXF 2HQRA 2X6OA 3HGYA 2FBQA 2Q2EA 1T95A 2DOEA 3FK7A 3G1OA 2R7RA 2RREA 2XDNA 3GCMA 1MJAA 3SXYA 1E2XA 1N77A 3E6DA 3GF2A 3KE2A 4DIQA 2QWWA 2X51A 1K61A 4E7LA 4G7OF 2ISZA 1FBUA 3KPHA 3DKYA 3WTTC 2W53A 3BR1A 3M8JA 1BN5A 1T8IA 5H6RA 2N8GA 4BYYA 3JRCA 3HOXJ 1GUUA 3ZPLA 2Z9OA 3J7AY 1IN4A 1IRFA 3AL0B 1BC7C 4NUBA 2H1KA 4OIRF 1W5SA 3HZJA 2W24A 4XLPF 5BPDA 1ZG5A 4OD5A 4HF1A 1J2XA 1YITI 2ESNA 2MA3A 4PGGA 1DDNA 1X3ZB 1I3QJ 2EV6A 1VQLI 2NVXJ 4UB8C 1Y1WJ 9ANTA 1REPC 4U0YA 1HSJA 1TBXA 2ME0A 3A02A 3F8CA 3CUQC 2O3FA 1ZAOA 2YR2A 3SHFA 3HPGA 1G59A 4A6EA 3OYAA 1H89C 1Y0UA 2NVYJ 1BOBA 5ICCA 3ZCOA 2K5CA 3GTPJ 3CUQA 2V9KA 3K2AA 4A0YA 4B3AA 4BACA 2JZYA 1AA7A 2E5ZA 1JJ6C 2RNJA 2R5YB 3MNLA 1U9NA 2KIMA 2OAZA 3IUOA 2HVSA 2IT0A 3HIFA 2EH3A 4N4OB 4YFKF 4EVIA 5D4SA 1YW9A 4HNVA 1ORKA 3PM1A 1S6LA 3ZQHA 2ZBKA 2FRHA 4S0HB 2CW0F 4CCKA 3BQYA 1ETOA 2H8WA 1LNWA 2KMUA 3QPSA 2M45A 4A69C 2BV6A 4BKXA 1WZ2A 1TW2A 2MABA 4KIBA 2W48A 4B09A 5KHDA 2MLGA 2L4MA 3HTIA 1OKRA 2WWYA 2L02A 3S8PA 1MW7A 5E1XA 2FQ3A 1D1BA 2VT2A 1U78A 1K4TA 2QWTA 1L3LA 4ZC3A 1PP7U 4RA2A 3F6OA 2RASA 1T39A 2YVHA 2XAGA 1E3PA 4IKFA 3I59B 4NC8A 4LOCA 4MO7A 4NN1A 1YQAA 3OL4A 2K85A 2RQQA 3IKVA 3P9KA 3KP5A 2PI0A 1B9MA 3JSJA 1KQ8A 4E7SA 5GP9A 2EWNA 3H9GA 1YHQI 2WA0A 2UV1A
chains in the Genus database with same CATH topology
1PUFB 1UI6A 2G7SA 2MW8A 2R5YA 1MSFC 3H0GJ 3NAUA 5EZGA 2RAEA 2EZLA 3WHCA 3BNIA 2G0EA 3ZQFA 2HOSA 1ETWA 2CUEA 3A03A 2ZCNA 2HYTA 1RR7A 4A3LJ 4AC0A 5FKOA 3A01B 1HF0A 3CDLA 1XG1A 1S7EA 1VNDA 1MBJA 2DMTA 3DEWA 1QPIA 3PASA 5EYRA 3M3YJ 4L5EA 4A3BJ 4Y7NJ 1X2NA 2G7GA 2CUFA 2Y9YA 4BBSJ 3BG3A 2XPUA 2M34A 2XRLA 1ITYA 2Q24A 2DMQA 3DCFA 3LOCA 5E3LA 4AYBN 1TC3C 1JUMA 2NP5A 5EG0B 2XB5A 4GCKA 3HB9A 4A3KJ 1JTYA 3TW6A 2O8KA 2GENA 2X9DA 4W1UA 2HYJA 2DG8A 3NPIA 2OF7A 3VVXA 3G1MA 4V2FA 3I4NJ 3TEDA 3GTKJ 3Q0UA 3RH2A 3BJBA 4DYCA 1POGA 1JUSA 4M3BA 2TRTA 4GFLA 1JT0A 1ZK8A 5C3EJ 1I50J 2Y31A 2PZ9A 1VF9A 5EDNA 4C2MJ 3NXCA 5IOYA 2PMZN 1APLC 4C3JJ 4XICA 1PUFA 2LTPA 2LP0A 3HBLA 1IV6A 2CJJA 4DW6A 3MKLA 4IHWA 2I10A 2Y2ZA 2GBYA 3OIOA 3LNQA 3FK6A 1CQTA 2AHQA 2CQXA 2DA6A 4DYRA 2B63J 2FX0A 5IP9J 4JX6A 2GUHA 2FQ4A 2UXOA 3LHQA 2HOTA 2K9SA 3F0CA 1JJ8C 1VI0A 2O7TA 5FHPA 5AQCA 3OSFA 3JR9A 4CGRA 2LFBA 4NELA 3GTQJ 5EFYA 5HBUA 2DA4A 3S14J 1ETVA 1O4XA 3RZDJ 3L1PA 2EZIA 2LR8A 3S16J 2E19A 1QRYA 2LY9A 3VW2A 2R0QC 1ENHA 4BXXJ 1QVTA 4UUTA 3HTAA 5J1UA 1F36A 3SDGA 1NK3P 2DTZA 3HM5A 1DU0A 4GCTA 2DMNA 3RD3A 2M8GX 5M5WJ 3S1MJ 4A3CJ 4JP0A 3IH4A 1F43A 1ZKGA 1R9TJ 2G7LA 3G56A 1SANA 4DZJA 3GTLJ 3CCYA 1GVDA 3BRUA 5K7ZA 3P9TA 2QOPA 3ANGA 4QSHA 5EGOB 3FRQA 3T6NA 1HDDC 5GPAA 2VUMJ 3PPBA 2DA1A 1U9OA 2ECBA 2FD5A 3HEFA 1U8BA 4MFDA 3B81A 1AKHA 1LFUP 2CQQA 5HSZA 2JK3A 3VVZA 4XRSA 2FJ1A 2XPWA 3FKIJ 1TWGJ 2IAIA 1Q1VA 3E7LA 1JKRC 1WPKA 2EZKA 1W0UA 2IU5A 2OI8A 4MXMA 2XSDC 3WHBA 4MIMA 5F1JA 2WGBA 4D7NA 3BHQA 1H8AC 5BNGA 4D5CA 3BG9A 1JGGA 2HOAA 5JLWA 2E1OA 1I6HJ 2V57A 5F0CA 3VVYA 1GV2A 3B6AA 1JT6A 2LK2A 4D7MA 1BL0A 3COLA 1IJWC 1JUPA 3KNWA 1Z77A 1ETKA 4NDLA 3O8HA 2M2EA 3KKDA 2ZOZA 2DN0A 3EGQA 2E2IJ 5HAWA 1X58A 2H8RA 4KWAA 2NVTJ 5K7FA 2JMWA 5C44J 2NX4A 1WCMJ 1GT0C 2R5ZB 2ID6A 4FE4A 2HKUA 1LFBA 3S2DJ 4JNNA 4G12A 4A3FJ 3VUQA 3G1LA 5FMPA 4XIDA 2YVEA 1BA5A 3GEUA 3ANPA 2E2HJ 5C4XJ 5EGOA 1IG7A 3W6VA 2QF7A 2WV1A 4A93J 2JA7J 4I76A 5D18A 4FE7A 3KKCA 4M3GA 2CU7A 3OOUA 3NRGA 5CW8A 1HLVA 5K58A 3GBGA 3ON2A 3S17J 5IP7J 3O8GA 4M3EA 3CWRA 2KDZA 1RETA 4IHYA 3S1RJ 1W0TA 4A3GJ 1Z0XA 4MFEA 3Q0WA 1EF4A 1HDPA 3BR2A 3GTOJ 1WGXA 4ACIA 3BTCA 3Q3SA 1FIAA 1RESA 1HOMA 1GDTA 2WUIA 3HOZJ 5E3MA 2K9QA 2WB1N 4DZPA 3QBMA 3S5RA 1MBKA 2DA5A 4EEFG 4JYKA 5F04A 5M5YJ 1MH3A 3IV5A 3VW0A 2WAQN 1LE8A 1AKHB 2OERA 2JA6J 2VKEA 2KT0A 1JKOC 3IUVA 1FTZA 2NVQJ 2ZCMA 1BW6A 4A3EJ 2YS9A 3BT9A 2UXHA 1SGMA 2R5ZA 5IYDJ 2ZOYA 2UXUA 1OCTC 3HOVJ 2HDDA 1UHSA 1ZR2A 3HIMA 3FIWA 3BQZA 1UG2A 3KZ9A 5F0HA 2LD5A 4MLOA 1Y1VJ 3NARA 4Y52J 3LSRA 2R93J 1MNMC 1VFCA 2GM4A 3HOUJ 4YZEA 1JKPC 2DMUA 2EQRA 4IEJA 1TWAJ 2EZHA 1E3OC 2JJ7A 1UMQA 3RQIA 3VOXA 5K7HA 2NP3A 2ZCXA 4UDSA 5EF6A 1XC5A 2GLOA 1P7IA 3LSPA 3HGGA 2DJNA 2EBIA 4M3FA 2PBXA 5FKKA 2E2JJ 4B4CA 3LWJA 3VP5A 1T33A 1AU7A 3HDDA 3F1BA 3VOKA 3TW7A 5FKMA 5EZHA 3K7AJ 3Q0VA 4HKUA 2UXIA 2XGCA 3JRHA 2HXIA 3GTJJ 1TWFJ 3M4OJ 3ZQCA 3S1NJ 1RPWA 3JRGA 1YRNB 5HODA 3V78A 3HTJA 3MN2A 4FTHA 4AF5A 3JREA 3QPLA 2XGDA 1BJZA 2RHAA 2Y30A 2LLKA 5CXIA 2O9LA 5E3NA 2HI3A 1ZTRA 3DPJA 2JWTA 1OJLA 4A3IJ 2QCOA 3I4MJ 3NNRA 1MBFA 2VI6A 3SFIA 1D5YA 3UKGA 3PO3J 3GZIA 1ZQ3P 2REKA 4QIWN 3SJMA 1OCPA 4M3DA 4B1RA 2R92J 1ETYA 3RZOJ 2IEKA 2L7ZA 2NS8A 4A3JJ 3JRIA 5FGLA 1WI3A 4A3DJ 1LE8B 4JKZA 2K9NA 1IC8A 3TP3A 4QTRA 3HOWJ 3JRBA 3NI7A 5H9TA 3ZQLA 1TWHJ 2M0CA 2Y0SN 4XK4A 4XRMA 2LKXA 3EUPA 3BTIA 5FJ8J 5FKLA 1FIPA 4GFBA 1ETQA 1FJLA 1NK2P 5CXGA 1P7JA 2VPRA 1IDZA 1FEXA 5DS9A 2QKOA 2D5VA 4RBOA 5IP6A 2MGQA 2K40A 2D6YA 3ZQGA 1NTCA 3GTMJ 2JA5J 3BTJA 1B8IB 1TWCJ 3BR5A 4M6VA 5GPCA 3BR6A 4MK6A 1DU6A 2P81A 2IBDA 2ID3A 2L9RA 4AC6A 1YRNA 4IHVA 2MG4A 3BR0A 3LSGA 3CQZJ 2NS7A 3VPRA 1IGNA 5IOZA 4PXIA 3HE0A 2X48A 2GFNA 4CYCA 3BG5A 3V6GA 4L62A 3G7RA 2MSYA 1MBHA 1IUFA 4W97A 5C4JJ 4I6ZA 2ME6A 3JRFA 2QTQA 4UUSB 2JN6A 2L7MP 1WH5A 4AUXA 3IH2A 2COBA 3PO2J 4ME9A 4A3MJ 1ETXA 2X6OA 3HGYA 3S1QJ 2FBQA 3E7QA 3CMYA 4J19A 4ABZA 3FK7A 3G1OA 4GCLA 5J3LA 5DTDA 1B72B 1SFOJ 2XDNA 1OFCX 2NOGA 1RKTA 2XPVA 3OSGA 1K61A 3QQAA 1IDYA 2M9HA 2AO9A 1ZR4A 2OPTA 5C4YA 1T56A 2ELKA 2W53A 4BY7J 3VW1A 3BR1A 5F27A 3CJDA 2N8GA 3HOXJ 3JRCA 1AHDP 1GUUA 5FLVA 3LJLA 1X2MA 4GFKA 2UXPA 1B8IA 3IH3A 2H1KA 3S15J 1MBGA 2HXOA 5F08A 3FISA 2LVSA 2DMPA 5E3OA 3S2HJ 3ON4A 3QKXA 4RDUA 5M5XJ 1I3QJ 3A01A 4X6AJ 3C07A 4JL3A 1JTXA 5J1YA 2NVXJ 1Y1WJ 9ANTA 2ME0A 3A02A 1H88C 2O7OA 3VIBA 1A6IA 5IPAA 3BCGA 2F07A 1H89C 2NVYJ 2DA7A 3GTPJ 5M3MJ 3K2AA 4B3AA 3H3VK 4UUSA 5FLMJ 5EG0A 2JA8J 3GTGJ 1JJ6C 4V2GA 2R5YB 3MNLA 1K83J 1U9NA 1IRZA 1JKQC 5D1RA 2EH3A 2QIBA 1WH7A 2DA2A 2XB0X 5EEAA 3RKQA 3CRJA 5J1RA 4HNVA 1ORKA 3PM1A 1B72A 3ZQHA 2XGEA 4S0HB 4BY1J 1A5JA 3BQYA 2TCTA 2R7ZJ 1ETOA 1XS9A 2HQ5A 4CYCB 3JRDA 3QPSA 4A69C 1QVUA 3LSJA 4BKXA 1MBEA 3BR3A 1RKWA 2CRGA 2W48A 5JLXA 2ECCA 1BW5A 3AQSA 3HTIA 3HKZN 4JX5A 5F0FA 2VKVA 2L7FP 4IHXA 2ZB9A 5IYCJ 1GV5A 4JX4A 3JRAA 1ZGWA 1U78A 2QWTA 5D19A 1UI5A 2YUSA 1G2HA 3MVPA 3BTLA 4C3IJ 5DAJA 4D5FA 2RASA 2YVHA 3ZOBA 4X1EA 3B6CA 2DG7A 4ICHA 4C3HJ 2L0KA 4LOCA 4MO7A 5FKNA 2DA3A 4XRSG 4BBRJ 2Y9ZA 4NN1A 4FISA 3HOYJ 3TP0A 1MSEC 2YU9J 3HTHA 3AQTA 4FCYA 3C2BA 4DYQA 3JSJA 3D1NI 1HCRA 5GP9A 5IYBJ 5M3FJ 2G3BA 3O60A 1MH4A 3ZQIA 1FTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PUF B;  1UI6 A;  2G7S A;  2MW8 A;  2R5Y A;  1MSF C;  3H0G J;  3NAU A;  5EZG A;  2RAE A;  2EZL A;  3WHC A;  3BNI A;  2G0E A;  3ZQF A;  2HOS A;  1ETW A;  2CUE A;  3A03 A;  2ZCN A;  2HYT A;  1RR7 A;  4A3L J;  4AC0 A;  5FKO A;  3A01 B;  1HF0 A;  3CDL A;  1XG1 A;  1S7E A;  1VND A;  1MBJ A;  2DMT A;  3DEW A;  1QPI A;  3PAS A;  5EYR A;  3M3Y J;  4L5E A;  4A3B J;  4Y7N J;  1X2N A;  2G7G A;  2CUF A;  2Y9Y A;  4BBS J;  3BG3 A;  2XPU A;  2M34 A;  2XRL A;  1ITY A;  2Q24 A;  2DMQ A;  3DCF A;  3LOC A;  5E3L A;  4AYB N;  1TC3 C;  1JUM A;  2NP5 A;  5EG0 B;  2XB5 A;  4GCK A;  3HB9 A;  4A3K J;  1JTY A;  3TW6 A;  2O8K A;  2GEN A;  2X9D A;  4W1U A;  2HYJ A;  2DG8 A;  3NPI A;  2OF7 A;  3VVX A;  3G1M A;  4V2F A;  3I4N J;  3TED A;  3GTK J;  3Q0U A;  3RH2 A;  3BJB A;  4DYC A;  1POG A;  1JUS A;  4M3B A;  2TRT A;  4GFL A;  1JT0 A;  1ZK8 A;  5C3E J;  1I50 J;  2Y31 A;  2PZ9 A;  1VF9 A;  5EDN A;  4C2M J;  3NXC A;  5IOY A;  2PMZ N;  1APL C;  4C3J J;  4XIC A;  1PUF A;  2LTP A;  2LP0 A;  3HBL A;  1IV6 A;  2CJJ A;  4DW6 A;  3MKL A;  4IHW A;  2I10 A;  2Y2Z A;  2GBY A;  3OIO A;  3LNQ A;  3FK6 A;  1CQT A;  2AHQ A;  2CQX A;  2DA6 A;  4DYR A;  2B63 J;  2FX0 A;  5IP9 J;  4JX6 A;  2GUH A;  2FQ4 A;  2UXO A;  3LHQ A;  2HOT A;  2K9S A;  3F0C A;  1JJ8 C;  1VI0 A;  2O7T A;  5FHP A;  5AQC A;  3OSF A;  3JR9 A;  4CGR A;  2LFB A;  4NEL A;  3GTQ J;  5EFY A;  5HBU A;  2DA4 A;  3S14 J;  1ETV A;  1O4X A;  3RZD J;  3L1P A;  2EZI A;  2LR8 A;  3S16 J;  2E19 A;  1QRY A;  2LY9 A;  3VW2 A;  2R0Q C;  1ENH A;  4BXX J;  1QVT A;  4UUT A;  3HTA A;  5J1U A;  1F36 A;  3SDG A;  1NK3 P;  2DTZ A;  3HM5 A;  1DU0 A;  4GCT A;  2DMN A;  3RD3 A;  2M8G X;  5M5W J;  3S1M J;  4A3C J;  4JP0 A;  3IH4 A;  1F43 A;  1ZKG A;  1R9T J;  2G7L A;  3G56 A;  1SAN A;  4DZJ A;  3GTL J;  3CCY A;  1GVD A;  3BRU A;  5K7Z A;  3P9T A;  2QOP A;  3ANG A;  4QSH A;  5EGO B;  3FRQ A;  3T6N A;  1HDD C;  5GPA A;  2VUM J;  3PPB A;  2DA1 A;  1U9O A;  2ECB A;  2FD5 A;  3HEF A;  1U8B A;  4MFD A;  3B81 A;  1AKH A;  1LFU P;  2CQQ A;  5HSZ A;  2JK3 A;  3VVZ A;  4XRS A;  2FJ1 A;  2XPW A;  3FKI J;  1TWG J;  2IAI A;  1Q1V A;  3E7L A;  1JKR C;  1WPK A;  2EZK A;  1W0U A;  2IU5 A;  2OI8 A;  4MXM A;  2XSD C;  3WHB A;  4MIM A;  5F1J A;  2WGB A;  4D7N A;  3BHQ A;  1H8A C;  5BNG A;  4D5C A;  3BG9 A;  1JGG A;  2HOA A;  5JLW A;  2E1O A;  1I6H J;  2V57 A;  5F0C A;  3VVY A;  1GV2 A;  3B6A A;  1JT6 A;  2LK2 A;  4D7M A;  1BL0 A;  3COL A;  1IJW C;  1JUP A;  3KNW A;  1Z77 A;  1ETK A;  4NDL A;  3O8H A;  2M2E A;  3KKD A;  2ZOZ A;  2DN0 A;  3EGQ A;  2E2I J;  5HAW A;  1X58 A;  2H8R A;  4KWA A;  2NVT J;  5K7F A;  2JMW A;  5C44 J;  2NX4 A;  1WCM J;  1GT0 C;  2R5Z B;  2ID6 A;  4FE4 A;  2HKU A;  1LFB A;  3S2D J;  4JNN A;  4G12 A;  4A3F J;  3VUQ A;  3G1L A;  5FMP A;  4XID A;  2YVE A;  1BA5 A;  3GEU A;  3ANP A;  2E2H J;  5C4X J;  5EGO A;  1IG7 A;  3W6V A;  2QF7 A;  2WV1 A;  4A93 J;  2JA7 J;  4I76 A;  5D18 A;  4FE7 A;  3KKC A;  4M3G A;  2CU7 A;  3OOU A;  3NRG A;  5CW8 A;  1HLV A;  5K58 A;  3GBG A;  3ON2 A;  3S17 J;  5IP7 J;  3O8G A;  4M3E A;  3CWR A;  2KDZ A;  1RET A;  4IHY A;  3S1R J;  1W0T A;  4A3G J;  1Z0X A;  4MFE A;  3Q0W A;  1EF4 A;  1HDP A;  3BR2 A;  3GTO J;  1WGX A;  4ACI A;  3BTC A;  3Q3S A;  1FIA A;  1RES A;  1HOM A;  1GDT A;  2WUI A;  3HOZ J;  5E3M A;  2K9Q A;  2WB1 N;  4DZP A;  3QBM A;  3S5R A;  1MBK A;  2DA5 A;  4EEF G;  4JYK A;  5F04 A;  5M5Y J;  1MH3 A;  3IV5 A;  3VW0 A;  2WAQ N;  1LE8 A;  1AKH B;  2OER A;  2JA6 J;  2VKE A;  2KT0 A;  1JKO C;  3IUV A;  1FTZ A;  2NVQ J;  2ZCM A;  1BW6 A;  4A3E J;  2YS9 A;  3BT9 A;  2UXH A;  1SGM A;  2R5Z A;  5IYD J;  2ZOY A;  2UXU A;  1OCT C;  3HOV J;  2HDD A;  1UHS A;  1ZR2 A;  3HIM A;  3FIW A;  3BQZ A;  1UG2 A;  3KZ9 A;  5F0H A;  2LD5 A;  4MLO A;  1Y1V J;  3NAR A;  4Y52 J;  3LSR A;  2R93 J;  1MNM C;  1VFC A;  2GM4 A;  3HOU J;  4YZE A;  1JKP C;  2DMU A;  2EQR A;  4IEJ A;  1TWA J;  2EZH A;  1E3O C;  2JJ7 A;  1UMQ A;  3RQI A;  3VOX A;  5K7H A;  2NP3 A;  2ZCX A;  4UDS A;  5EF6 A;  1XC5 A;  2GLO A;  1P7I A;  3LSP A;  3HGG A;  2DJN A;  2EBI A;  4M3F A;  2PBX A;  5FKK A;  2E2J J;  4B4C A;  3LWJ A;  3VP5 A;  1T33 A;  1AU7 A;  3HDD A;  3F1B A;  3VOK A;  3TW7 A;  5FKM A;  5EZH A;  3K7A J;  3Q0V A;  4HKU A;  2UXI A;  2XGC A;  3JRH A;  2HXI A;  3GTJ J;  1TWF J;  3M4O J;  3ZQC A;  3S1N J;  1RPW A;  3JRG A;  1YRN B;  5HOD A;  3V78 A;  3HTJ A;  3MN2 A;  4FTH A;  4AF5 A;  3JRE A;  3QPL A;  2XGD A;  1BJZ A;  2RHA A;  2Y30 A;  2LLK A;  5CXI A;  2O9L A;  5E3N A;  2HI3 A;  1ZTR A;  3DPJ A;  2JWT A;  1OJL A;  4A3I J;  2QCO A;  3I4M J;  3NNR A;  1MBF A;  2VI6 A;  3SFI A;  1D5Y A;  3UKG A;  3PO3 J;  3GZI A;  1ZQ3 P;  2REK A;  4QIW N;  3SJM A;  1OCP A;  4M3D A;  4B1R A;  2R92 J;  1ETY A;  3RZO J;  2IEK A;  2L7Z A;  2NS8 A;  4A3J J;  3JRI A;  5FGL A;  1WI3 A;  4A3D J;  1LE8 B;  4JKZ A;  2K9N A;  1IC8 A;  3TP3 A;  4QTR A;  3HOW J;  3JRB A;  3NI7 A;  5H9T A;  3ZQL A;  1TWH J;  2M0C A;  2Y0S N;  4XK4 A;  4XRM A;  2LKX A;  3EUP A;  3BTI A;  5FJ8 J;  5FKL A;  1FIP A;  4GFB A;  1ETQ A;  1FJL A;  1NK2 P;  5CXG A;  1P7J A;  2VPR A;  1IDZ A;  1FEX A;  5DS9 A;  2QKO A;  2D5V A;  4RBO A;  5IP6 A;  2MGQ A;  2K40 A;  2D6Y A;  3ZQG A;  1NTC A;  3GTM J;  2JA5 J;  3BTJ A;  1B8I B;  1TWC J;  3BR5 A;  4M6V A;  5GPC A;  3BR6 A;  4MK6 A;  1DU6 A;  2P81 A;  2IBD A;  2ID3 A;  2L9R A;  4AC6 A;  1YRN A;  4IHV A;  2MG4 A;  3BR0 A;  3LSG A;  3CQZ J;  2NS7 A;  3VPR A;  1IGN A;  5IOZ A;  4PXI A;  3HE0 A;  2X48 A;  2GFN A;  4CYC A;  3BG5 A;  3V6G A;  4L62 A;  3G7R A;  2MSY A;  1MBH A;  1IUF A;  4W97 A;  5C4J J;  4I6Z A;  2ME6 A;  3JRF A;  2QTQ A;  4UUS B;  2JN6 A;  2L7M P;  1WH5 A;  4AUX A;  3IH2 A;  2COB A;  3PO2 J;  4ME9 A;  4A3M J;  1ETX A;  2X6O A;  3HGY A;  3S1Q J;  2FBQ A;  3E7Q A;  3CMY A;  4J19 A;  4ABZ A;  3FK7 A;  3G1O A;  4GCL A;  5J3L A;  5DTD A;  1B72 B;  1SFO J;  2XDN A;  1OFC X;  2NOG A;  1RKT A;  2XPV A;  3OSG A;  1K61 A;  3QQA A;  1IDY A;  2M9H A;  2AO9 A;  1ZR4 A;  2OPT A;  5C4Y A;  1T56 A;  2ELK A;  2W53 A;  4BY7 J;  3VW1 A;  3BR1 A;  5F27 A;  3CJD A;  2N8G A;  3HOX J;  3JRC A;  1AHD P;  1GUU A;  5FLV A;  3LJL A;  1X2M A;  4GFK A;  2UXP A;  1B8I A;  3IH3 A;  2H1K A;  3S15 J;  1MBG A;  2HXO A;  5F08 A;  3FIS A;  2LVS A;  2DMP A;  5E3O A;  3S2H J;  3ON4 A;  3QKX A;  4RDU A;  5M5X J;  1I3Q J;  3A01 A;  4X6A J;  3C07 A;  4JL3 A;  1JTX A;  5J1Y A;  2NVX J;  1Y1W J;  9ANT A;  2ME0 A;  3A02 A;  1H88 C;  2O7O A;  3VIB A;  1A6I A;  5IPA A;  3BCG A;  2F07 A;  1H89 C;  2NVY J;  2DA7 A;  3GTP J;  5M3M J;  3K2A A;  4B3A A;  3H3V K;  4UUS A;  5FLM J;  5EG0 A;  2JA8 J;  3GTG J;  1JJ6 C;  4V2G A;  2R5Y B;  3MNL A;  1K83 J;  1U9N A;  1IRZ A;  1JKQ C;  5D1R A;  2EH3 A;  2QIB A;  1WH7 A;  2DA2 A;  2XB0 X;  5EEA A;  3RKQ A;  3CRJ A;  5J1R A;  4HNV A;  1ORK A;  3PM1 A;  1B72 A;  3ZQH A;  2XGE A;  4S0H B;  4BY1 J;  1A5J A;  3BQY A;  2TCT A;  2R7Z J;  1ETO A;  1XS9 A;  2HQ5 A;  4CYC B;  3JRD A;  3QPS A;  4A69 C;  1QVU A;  3LSJ A;  4BKX A;  1MBE A;  3BR3 A;  1RKW A;  2CRG A;  2W48 A;  5JLX A;  2ECC A;  1BW5 A;  3AQS A;  3HTI A;  3HKZ N;  4JX5 A;  5F0F A;  2VKV A;  2L7F P;  4IHX A;  2ZB9 A;  5IYC J;  1GV5 A;  4JX4 A;  3JRA A;  1ZGW A;  1U78 A;  2QWT A;  5D19 A;  1UI5 A;  2YUS A;  1G2H A;  3MVP A;  3BTL A;  4C3I J;  5DAJ A;  4D5F A;  2RAS A;  2YVH A;  3ZOB A;  4X1E A;  3B6C A;  2DG7 A;  4ICH A;  4C3H J;  2L0K A;  4LOC A;  4MO7 A;  5FKN A;  2DA3 A;  4XRS G;  4BBR J;  2Y9Z A;  4NN1 A;  4FIS A;  3HOY J;  3TP0 A;  1MSE C;  2YU9 J;  3HTH A;  3AQT A;  4FCY A;  3C2B A;  4DYQ A;  3JSJ A;  3D1N I;  1HCR A;  5GP9 A;  5IYB J;  5M3F J;  2G3B A;  3O60 A;  1MH4 A;  3ZQI A;  1FTT A; 
#chains in the Genus database with same CATH topology
 1UI6 A;  1IZ1 A;  2MW8 A;  2R5Y A;  3OIQ A;  1XB4 A;  5EZG A;  1RC9 A;  4F52 A;  5KAF C;  1BI0 A;  4ITV A;  2VT3 A;  3OR2 C;  2PLY A;  1ETW A;  3A03 A;  2LKS A;  4O5V A;  3WTY C;  3GVA A;  2HYT A;  1RR7 A;  3DFG A;  3DKX A;  4HW0 A;  4A3L J;  1V5G A;  3ZGK A;  1VQO I;  4A5M A;  3M3Y J;  1WVR A;  4A3B J;  1FOW A;  1CF7 B;  2Y9Y A;  3TO9 A;  3BG3 A;  3NWT A;  1DUX C;  1ITY A;  4DJA A;  4F7Z A;  2WC2 A;  2M5W A;  4EAT A;  1TC3 C;  4ETS A;  2RVC A;  2NP5 A;  1D8J A;  2OBP A;  1L0O C;  5EG0 B;  1R4N B;  1HA8 A;  4BH9 A;  4GCK A;  4A3K J;  1G3Y A;  2QLZ A;  3P9I A;  1TZL A;  2X9D A;  2O8X A;  3HRT A;  3IWZ A;  3MD2 A;  2HYJ A;  4W1U A;  4UVB A;  5K5O A;  2HS5 A;  4KT5 C;  3NPI A;  3VVX A;  4L9J A;  3G1M A;  1LEB A;  3GEZ A;  3RH2 A;  1HW5 A;  2MC4 A;  3BJB A;  1W36 D;  4ZYD A;  3RKW A;  2PJR B;  3F8N A;  3SZG A;  3RJP A;  2FJI 1;  4IX7 A;  2ETH A;  4PUS A;  1ZK8 A;  4CH7 A;  5C3E J;  1I50 J;  4WIB A;  1WJF A;  3WTU C;  1S29 A;  2QGU A;  2Y31 A;  4ZZL A;  2PZ9 A;  3V7R A;  2AXT C;  5EDN A;  3JTH A;  1K79 A;  3VFZ A;  1O57 A;  2XF6 A;  1W5C C;  3FHZ A;  1Z1D A;  3QYB A;  2Q8K A;  2FOW A;  4IJA A;  3K4M A;  2LTP A;  4GXO A;  5KAI C;  1IV6 A;  3WGI A;  3N05 A;  4HQM A;  4DW6 A;  2XAS A;  5JHU A;  4BNC A;  2I10 A;  3BCA A;  2GBY A;  3OIO A;  2ZXI A;  1MNE A;  2PG4 A;  1Z6T A;  3HRM A;  2GUH A;  1QO0 D;  3IAM 2;  4Q47 A;  4BXU A;  3A4C A;  2HOT A;  4UUV A;  3BJ6 A;  2O7T A;  4GGG A;  3K1P A;  4GO1 A;  1U6G A;  4Y17 A;  3AG2 H;  4CGR A;  5EFY A;  5HBU A;  2DA4 A;  5FLX Z;  3S3N A;  3S14 J;  3RZD J;  1GHC A;  3EET A;  3IAS 2;  2QYO A;  1B1B A;  2LY9 A;  1IF1 A;  2VLA A;  4FQG A;  2HYG D;  1QVT A;  2AXL A;  4XBF A;  5J1U A;  4GCT A;  2DLL A;  3FBI B;  4A3C J;  1J59 A;  4JP0 A;  1GXQ A;  3G56 A;  5HNH A;  3S3O A;  3HOS A;  2PJR A;  2LDU A;  4XLC A;  1SAX A;  5KCM A;  1ONV A;  2BYV E;  2HKX A;  5B5E C;  4Q48 A;  3FRQ A;  2WY8 Q;  2VUM J;  1Y8R B;  3HEF A;  1U9O A;  2ECB A;  2FD5 A;  4I0A A;  2W25 A;  3K10 A;  4WF2 A;  4EJO A;  1EH8 A;  2FOK A;  1S7A A;  4ZTJ A;  2F5E A;  3OYC A;  2E71 A;  2VBW A;  4XRS A;  4I98 B;  3FKI J;  1TWG J;  2IAI A;  3E7L A;  3I58 A;  3I3L A;  2EZK A;  2IU5 A;  4MXM A;  2XSD C;  1OMI A;  2L7K A;  2EIN H;  1TW3 A;  2QVO A;  2CW8 A;  1I1G A;  3CDI A;  1U0J A;  1VQ8 I;  3CD6 I;  4D5C A;  3G2B A;  3BP8 A;  1IXR C;  2PQ8 A;  3FXJ A;  2E1O A;  5JLW A;  2HEO A;  5CPR B;  5K5Q A;  1DP3 A;  4P55 A;  3COL A;  4I99 C;  2P5V A;  2QQA A;  1T98 A;  2D45 A;  2M2E A;  3KKD A;  2XKP A;  2ZOZ A;  2DN0 A;  3DPL C;  2V9V A;  2NVT J;  2JMW A;  2NX4 A;  1X4P A;  1WCM J;  1ZG3 A;  2ID6 A;  2HKU A;  3ERM A;  2BXZ A;  2IA2 A;  2A6H F;  5FMP A;  2YVE A;  3IKT A;  1OLT A;  4ZYH A;  1IG7 A;  1ZRF A;  2QF7 A;  1FOK A;  2H09 A;  4BQN A;  2R7D A;  2LRD A;  3NRG A;  3VOE A;  5CW8 A;  1SVM A;  2RQP A;  4XN0 A;  3CCM I;  5K58 A;  2H1L A;  3ABU A;  2NS0 A;  3ON2 A;  3ONQ A;  5IP7 J;  3CWR A;  1W0T A;  5CLS A;  5GAH J;  1I6X A;  2DOA A;  4G7H F;  5DM6 F;  3H0D A;  2VXD A;  1Z3X A;  3GTO J;  1RES A;  2IRF G;  2ZJR F;  2K9Q A;  2MBF A;  4X0G A;  2GXA A;  3S5R A;  4OMZ A;  4NB5 A;  4JYK A;  4CIC A;  1GVJ A;  1I27 A;  3IV5 A;  1LE8 A;  3F8F A;  3KFW X;  3OYD A;  4XOR A;  4IRI A;  3DKW A;  1MJB A;  2QSG X;  2QUF A;  1FTZ A;  1T08 B;  3NRV A;  2NVQ J;  1N75 A;  2ZCM A;  3TO6 A;  1HKS A;  3L2C A;  4A3E J;  4PJN A;  3CJR B;  1DPU A;  3O6B B;  1RNL A;  2CV0 A;  3HOV J;  3E6M A;  2VE8 A;  2OCC H;  1BOA A;  1MD0 A;  4F3Q A;  3C3W A;  1HW1 A;  1SAU A;  4XLA A;  3KZ9 A;  1X3U A;  5F0H A;  2JVG A;  4A6D A;  2V26 A;  4Y52 J;  2R93 J;  3T1B A;  3J81 K;  3IRR A;  1LQ1 A;  4YZE A;  2VKD A;  2F2E A;  1FMW A;  4ASN A;  2BE5 F;  2DMU A;  1MJ9 A;  2EQR A;  3ZN1 A;  2JVH A;  2EZH A;  2JRT A;  2CO5 A;  1E3O C;  1UAA A;  2WAD A;  4ZZD A;  3CTA A;  3RQI A;  3F72 A;  2F5F A;  3GLX A;  5K7H A;  2NP3 A;  4UDS A;  4A0Z A;  1O7F A;  3PUB A;  2EBI A;  3OS0 A;  5CVI A;  4AD9 A;  3ROU A;  3BRO A;  3GFL A;  1D1A A;  4EJU A;  3VOK A;  3TW7 A;  2OZ6 A;  3T5X A;  1VQ7 I;  3EUH C;  2OJE D;  5LEK A;  2XGC A;  2HXI A;  4M6X A;  3E3V A;  2FXA A;  1RPW A;  4CZC A;  4KDP A;  4AU7 A;  4L9N A;  2WAQ A;  3EUH A;  2P4W A;  1X1P A;  5B1A H;  1I39 A;  3C2H A;  2ZME B;  2Y30 A;  2LLK A;  2M4G A;  2HI3 A;  3JAM Z;  4N9H A;  1DPR A;  3UKG A;  3EUA A;  2REK A;  4AVZ A;  2BGC A;  4BGD A;  1OCP A;  3IP4 B;  4M3D A;  2QSH X;  5IY5 H;  2L7Z A;  3DP7 A;  5J4V A;  3CF2 A;  1WI3 A;  1LDD A;  2JSC A;  3ECH A;  2ZJQ F;  1D8K A;  1IC8 A;  2E1C A;  2STW A;  4KUM A;  1JGS A;  1S7O A;  3GWZ A;  2M0C A;  3TKY A;  3QRF F;  4XK4 A;  4OIO F;  3BTI A;  2RV8 A;  2YU3 A;  4KFC A;  2HTJ A;  4WCG A;  3KEO A;  4UY8 I;  3GFM A;  1R7J A;  1P7J A;  4D9J A;  1F9N A;  1TNT A;  2VQC A;  2V1N A;  1Z9C A;  5F64 A;  1BR2 A;  2HPI A;  1LDJ A;  2D6Y A;  3OOP A;  3ZQG A;  1XGN A;  2JA5 J;  4BE1 A;  3BTJ A;  4U9L A;  5LLQ A;  2VPL A;  2W85 A;  3K4J A;  2HKO A;  2HTS A;  3BR6 A;  4CCL A;  1DU6 A;  2L9R A;  2CV1 A;  2BW3 A;  2WAF A;  2TDX A;  3DTE A;  2EB7 A;  3G71 I;  2ZJ2 A;  5H6Q A;  4BDZ A;  4IHV A;  2A3S A;  2E1M B;  3VPR A;  4V19 K;  1IGN A;  5CQG A;  1ZEL A;  5CJ9 A;  2LBF B;  5E17 F;  3BG5 A;  3CO6 C;  2LH9 A;  3ABL H;  1VQ9 I;  1XCB A;  2MSY A;  1MND A;  1QBJ A;  1YG2 A;  3JRF A;  5E8G A;  4UUS B;  2L7M P;  1G3W A;  4Y33 A;  3S3M A;  1TT0 A;  3PO2 J;  1F5T A;  3TDU C;  4U9N A;  1LVA A;  1DP7 P;  1DQU A;  1FMV A;  1TT5 B;  2HU9 A;  2KHM A;  2DDB A;  4ABZ A;  4HPQ A;  4GCL A;  4R1H A;  3UR3 C;  3BJA A;  5DTD A;  3X2Q H;  1FC3 A;  3C2G A;  1OFC X;  4P1W A;  1RKT A;  2XPV A;  2HYF A;  3V8K A;  2VBY A;  4OIN F;  2R3S A;  3OSG A;  5K1Y A;  3U1K A;  1IDY A;  4HX8 A;  2AO9 A;  1PJR A;  5L3G A;  1ZR4 A;  2XAQ A;  2G9W A;  1T56 A;  4GRI A;  4Q5S F;  2ELK A;  3KYC B;  1X1D A;  4BY7 J;  4Q4Z F;  3QP5 A;  5F27 A;  3CJD A;  1AHD P;  4L9T A;  3DV8 A;  2JUC A;  2QQ8 A;  3LJL A;  3P7N A;  3KZY A;  3FXO A;  3HSF A;  2E1M C;  4AIK A;  4LG3 A;  1G3S A;  5E1W A;  1MMD A;  3I55 I;  3ABK H;  3OL3 A;  3G6E I;  4KMF A;  3FIS A;  2LVS A;  4CA0 A;  3TGN A;  3QOP A;  3A01 A;  2VJI A;  2EFW A;  2BOL A;  3V7S A;  4WXH A;  2VC0 A;  1QQI A;  2LBF A;  3H5A A;  3KX2 A;  2FML A;  2O7O A;  1A6I A;  5IPA A;  4KN4 X;  5DUI A;  3MKY B;  3HSE A;  3OYG A;  4L9V A;  5M3M J;  4XSX F;  4UUS A;  4FX4 A;  3HUG A;  1M1E B;  2GQQ A;  3M8E A;  4ZYA A;  4F91 B;  4N9I A;  5D4R A;  1OCZ H;  3K69 A;  5LFA A;  3F21 A;  1JKQ C;  3ZQ7 A;  2WTE A;  4LLG F;  1N78 A;  2QIB A;  2KIS A;  4RB3 C;  2W7N A;  3CRJ A;  5J1R A;  4LD5 A;  4A0X A;  3F9K A;  2XGE A;  1FT9 A;  3OYN A;  2QQB A;  1XS9 A;  1HST A;  3RCO A;  4CYC B;  3F6V A;  3RIR A;  3LQQ A;  4DOZ A;  4ZDP A;  1BW5 A;  5BS6 A;  1G4D A;  3I0T A;  5DD8 A;  4BU2 A;  2QEN A;  2VKV A;  2L7F P;  4GDF A;  4LIU A;  2VJ5 A;  2PMU A;  5DEQ A;  2Q2E B;  5IYC J;  5D19 A;  1GV5 A;  3WTZ A;  4HST A;  1UI5 A;  2MYS A;  2YUS A;  3G3Z A;  5TJJ A;  1G2H A;  3BTL A;  2GZW A;  2EFO A;  2W1O A;  1JXS A;  5FD5 A;  3RYP A;  4X1E A;  3B6C A;  3FM5 A;  2DG7 A;  4IOC F;  4K2E A;  4L18 B;  4BBR J;  3J80 K;  1WRJ A;  4FIS A;  3HOY J;  2GA1 A;  4CCJ A;  4XKB A;  2JRM A;  3NWS A;  5JHF A;  1R5I D;  2COM A;  4FCY A;  3MKZ A;  5IYB J;  2V6C A;  2A5Y B;  2R7Q A;  2IP2 A;  3DU6 A;  5JR3 A;  3F23 A;  3MMY B;  2G7S A;  2CFO A;  3ULQ B;  5FRO A;  4B44 A;  3PUF A;  3ZP5 A;  2EZL A;  2W4S A;  5TIS C;  3BNI A;  2G0E A;  4RM3 A;  1MMN A;  2HOS A;  4IHT A;  3VYR B;  5DV5 A;  2XAJ A;  5GAD J;  1OR7 C;  4R79 A;  4AC0 A;  3VEP A;  3CDL A;  4I02 A;  3K4K A;  3CES A;  5EYR A;  4Y13 A;  4BUP A;  2LY2 A;  4L5E A;  2H6C A;  2DOF A;  4PFP A;  2IS2 A;  1OR7 A;  1SD5 A;  2DT7 B;  3TO7 A;  4BE2 A;  2OV7 A;  1YX5 A;  4HNU A;  2XRL A;  2Q24 A;  3DCF A;  3V7C A;  4RB2 C;  2MFZ A;  3CUQ B;  3QWL A;  4BEH A;  1I1S A;  3OWT A;  2DK8 A;  2FNP A;  1JTY A;  3TW6 A;  4BHP A;  2QKM B;  3BJO A;  2L9N A;  4XON A;  2PFB A;  4EM2 A;  2A68 F;  2OF7 A;  5LEJ A;  2ZY9 A;  5EEH A;  1RIO H;  2L54 A;  3TED A;  3Q0U A;  4RGU A;  1USS A;  2P6S A;  1HW2 A;  1TNS A;  1POG A;  4L5J A;  2VL8 A;  2VKH A;  1JUS A;  1PP8 F;  2DAO A;  6PAX A;  3CO7 C;  4GFL A;  1JT0 A;  2M30 A;  3TBI A;  4Z2Y A;  2EFN A;  1VF9 A;  4TV7 A;  1UEL B;  1WI9 A;  1OCO H;  1QZZ A;  2L2O A;  4C2M J;  3NXC A;  2FBI A;  3PL8 A;  3HXL A;  1HC8 A;  2CQK A;  2OTJ I;  4U87 A;  4C3J J;  2BZT A;  4XIC A;  1DGW Y;  2GAU A;  3L7W A;  2R7T A;  3HBL A;  2V7F A;  5E18 F;  4LB5 A;  1J75 A;  2LNB A;  3MKL A;  4IHW A;  2Y2Z A;  1ON1 A;  1Z7L A;  4C2U A;  3PQJ A;  4HX4 A;  3S2W A;  5DUK A;  2AHQ A;  2DBB A;  2B63 J;  2FX0 A;  2KRH A;  4PDK A;  2DT5 A;  3DPU A;  2UXO A;  2K9S A;  2VAS A;  3ABT A;  3F0C A;  2NNY A;  5FHP A;  2CH0 A;  4JK1 X;  5AQC A;  2HQA A;  2QZ8 A;  3GTQ J;  2P6T A;  4HLX A;  1O4X A;  1R5H A;  2VQG A;  3L1P A;  2EZI A;  4JQF A;  4LB6 B;  3S16 J;  2E19 A;  2M87 A;  5HDG A;  3V42 A;  4UUT A;  2DI3 A;  2XRN A;  1F36 A;  4EGY A;  2UXX A;  5D8L B;  1NK3 P;  1A35 A;  5FLX K;  3RD3 A;  3RKX A;  3TL4 X;  1VQP I;  2M8G X;  2KDO A;  3S1M J;  2IS6 A;  3AKZ A;  1R9T J;  1K7A A;  2XDV A;  4DVY P;  3GTL J;  3PNV A;  2BHY A;  3L09 A;  3QU6 A;  1SEU A;  1GVD A;  1MIJ A;  3DTK A;  1QHH D;  2VBZ A;  3L2W A;  2QOP A;  4QSH A;  3I9V 2;  3T6N A;  3E6C C;  1O3S A;  1FP1 D;  3OV8 A;  2DOD A;  4MFD A;  1PUE E;  1LFU P;  3CME I;  4RGS A;  3QYF A;  2FU4 A;  2LRE A;  2Y75 A;  5FO5 A;  3ZXS A;  2FJ1 A;  3J80 Z;  4KYW A;  1WPK A;  3LQR A;  2QSF X;  1IN6 A;  1LKX A;  3A2K A;  3GZ5 A;  4LFU A;  1IXC A;  3Q5F A;  3VDX A;  5LGU A;  3BZK A;  1UG0 A;  2KJC A;  3K4C A;  3KP6 A;  3TOB A;  1IN5 A;  4RAG A;  3PIO F;  1B6A A;  2E36 A;  3Q9V A;  2R7V A;  5BNG A;  1O7L A;  3VYU B;  5F0C A;  1FPQ A;  2KZG A;  2GIZ A;  2ISY A;  2LYC A;  4OU0 A;  4F92 B;  1OYW A;  1P2F A;  2LSO A;  3GLL A;  5J40 A;  3WGG A;  3KNW A;  3RSN A;  2W82 A;  2R7U A;  1Z77 A;  5BMZ A;  3V8L A;  1ODD A;  3EGQ A;  1OYY A;  1RI7 A;  1X3W B;  1X58 A;  4JOM A;  4ZDO A;  2GEN A;  1V4R A;  4KWA A;  1GT0 C;  2R5Z B;  4PGH A;  4IPA A;  5CKT A;  4JNN A;  3WTW C;  3P5J A;  3G1L A;  1IW7 F;  1FP2 A;  4YII A;  1W36 C;  1FY7 A;  5B1B H;  3OYE A;  2WV1 A;  4ANJ A;  3CZ6 A;  1WJD A;  1O3R A;  5CYV A;  2CU7 A;  2OQG A;  3OOU A;  4RLF A;  4I7H A;  2FEZ A;  3CJQ B;  3WTV C;  1HLV A;  3F8M A;  3C7J A;  3GBG A;  3F8B A;  2UXN A;  3GZN B;  4KIG A;  5D5V B;  2MH2 A;  3OYL A;  2KDZ A;  4HLY A;  1U3E M;  1ERD A;  3FF5 A;  2IJL A;  4XKW A;  5ED4 A;  2HDW A;  2XAF A;  3REO A;  4MFE A;  2G7H A;  3K8P C;  3BR2 A;  3QU3 A;  4OIP F;  2XVC A;  5D8K B;  1W7P A;  1FIA A;  4H4K C;  5CVU A;  2WUI A;  1KYZ A;  2NVU B;  3QBM A;  2DA5 A;  4BHB A;  1B4A A;  2IGO A;  2DT6 A;  5F04 A;  4M74 A;  2RDP A;  1W7P D;  1ZAR A;  2NRA C;  3R4K A;  1JKO C;  5DYM A;  2IGK A;  3VOD A;  4LIT A;  3H3Z A;  5HVQ C;  1N25 A;  1UB9 A;  2F4O B;  4IO9 F;  2XRO A;  4OIQ F;  4XNF A;  4IL6 C;  1SGM A;  2R5Z A;  2ZOY A;  1OCT C;  2HDD A;  4YFN F;  2ZJP F;  2V6E A;  3FIW A;  3UNG C;  1XMA A;  1SFK A;  3BQZ A;  2GXG A;  3VTI A;  2J5O A;  4A2U A;  1QU3 A;  2LD5 A;  1KQ0 A;  2Z99 A;  3NAR A;  2UWM A;  4KT6 A;  3HOU J;  1VFC A;  2GM4 A;  4PJJ A;  4II2 A;  4E7I A;  2V1D A;  5D5X B;  1SD6 A;  1YW8 A;  1FBS A;  3U21 A;  3QP6 A;  1QGP A;  3HTS B;  2NOJ B;  2QQ9 A;  1Z6R A;  1G3T A;  5EF6 A;  1TTY A;  1XC5 A;  3W6J B;  3SQN A;  3RI4 A;  3HGG A;  1R1T A;  5FKK A;  2X1E A;  3LWJ A;  3CLQ A;  1T33 A;  5KK1 A;  2Y0M A;  1AU7 A;  3SEZ A;  3W2V A;  3WTX C;  3KP2 A;  1FLI A;  1TQM A;  2NNN A;  5FKM A;  4II3 A;  4O6J A;  3JRH A;  4M9S A;  1TWF J;  3S1N J;  1CGP A;  1HXD A;  4XKV A;  1YRN B;  3G4S I;  5E8I A;  3QPL A;  1BJZ A;  2M7B A;  1IV8 A;  1F1Z A;  3GO5 A;  1XGM A;  2O9L A;  5E3N A;  3DPJ A;  1ZTR A;  2JWT A;  1OJL A;  4IF4 A;  1R23 A;  4I09 A;  4IOA F;  3HRU A;  3LSH A;  2AQE A;  2CYY A;  3PO3 J;  3VYT B;  1ZQ3 P;  3DLL F;  2KIU A;  3RZO J;  4B1R A;  2L5Q A;  3JAM K;  5FD6 A;  3QOD A;  2IEK A;  2JT1 A;  1IRG A;  4A3J J;  1AWC A;  1HKQ A;  1TP4 A;  1LE8 B;  3KEQ A;  1SD4 A;  4PJ0 C;  2VOP A;  2FNA A;  3TP3 A;  4CHU A;  1V3F A;  4QTR A;  5CQE A;  3RKY A;  3FXR A;  1O3T A;  3JSO A;  1MDM B;  3HHG A;  2Y0S N;  2VOD A;  2GA2 A;  4XRM A;  2LKX A;  3EUP A;  1FIP A;  5LHI A;  3GUD A;  1FJL A;  1NK2 P;  3HYI A;  2DTR A;  5CXG A;  1TQI A;  3WE2 A;  2HZD A;  1D3Y A;  2DCE A;  1SFE A;  5FB2 A;  1T38 A;  4WX9 A;  1IDZ A;  1OCR H;  1QZY A;  2MGQ A;  2A61 A;  5IP6 A;  3CCQ I;  3GTM J;  1VQM I;  5CVJ A;  3FKJ A;  4UNO A;  1FBQ A;  3CMM A;  4F93 B;  4BQO A;  5GPC A;  4Y15 A;  3DF8 A;  2IW5 A;  1YRN A;  2ZXH A;  2BY3 A;  2MG4 A;  3BR0 A;  2YVX A;  2DDA A;  2OA4 A;  4LK1 F;  4ENN A;  3OYB A;  5IOZ A;  4PFO A;  4PXI A;  1XCV A;  2X48 A;  3HE0 A;  3OS2 A;  4HSR A;  1VTN C;  4C2M A;  4YEJ A;  1TLH B;  4MQ9 F;  3K2Z A;  3D5S C;  3ECO A;  2DFE A;  1R1V A;  3DEU A;  1YTY A;  1WH5 A;  3BZC A;  4AUX A;  3DBL B;  4QWQ A;  4ESJ A;  2LG4 A;  3BG6 A;  1ETX A;  2K9M A;  4IQ4 A;  3S1Q J;  3CMY A;  2Y48 A;  4C2T A;  3FHN A;  4I01 A;  3SZT A;  1FYL A;  1U8R A;  1MDM A;  5LRR A;  1EKE A;  1VQ5 I;  1W1W E;  2FBK A;  3J7Y J;  4LLN A;  1BIB A;  2OPT A;  2VC1 A;  5F1R A;  2XAH A;  3S32 A;  3KYD B;  3WU1 B;  3VW1 A;  2EK5 A;  3WG9 A;  2KJB A;  4A5N A;  2LMD A;  1X2M A;  3CCE I;  4HG2 A;  3OYM A;  1XMK A;  3IH3 A;  2P7C B;  1LB2 A;  1ON2 A;  3ZMU A;  1FSE A;  2KQR A;  1MBG A;  3AG3 H;  3ESW B;  4L0Z B;  3KP4 A;  2DMP A;  2Z1D A;  3BLY A;  5E3O A;  2P5L C;  3ON4 A;  4UXN A;  4RDU A;  4M72 A;  3C07 A;  2P7V B;  2IXS A;  2RGV A;  5L3B A;  5J1Y A;  5JVT A;  4G94 A;  4XR6 A;  5ICE A;  1H88 C;  2XKO A;  2C6Y A;  3KP3 A;  2XSJ C;  3VIB A;  3BCG A;  1I3A A;  4Y4R A;  1VQN I;  3LA7 A;  5L3E A;  2CFX A;  2F07 A;  4DNC A;  1OQY A;  1VZ0 A;  2JA8 J;  3GTG J;  5HDN A;  4E7J A;  1YO5 C;  1K83 J;  5FGM A;  4XKC A;  4IHS A;  2HFH A;  1ACI A;  2YSR A;  1WH7 A;  2BW3 B;  2DA2 A;  4KJZ A;  5EEA A;  3PFY A;  5IT3 A;  2FSW A;  3FDY A;  4BY1 J;  1LVK A;  4OAZ A;  1EH6 A;  4RB1 A;  2R7Z J;  5J8C A;  1H0M A;  3JRD A;  1V5E A;  1QVU A;  2LF8 A;  1MBE A;  1KU9 A;  3BR3 A;  2CRG A;  5JLX A;  2ECC A;  4G8X A;  3AQS A;  2R7F A;  2LF7 A;  1LEA A;  1W5T A;  2D1H A;  3HKZ N;  4JX5 A;  4S04 A;  2STT A;  2QBY A;  1DGR M;  1K6Y A;  5F0F A;  4MQV A;  1YI2 I;  1U5T C;  3K9T A;  3R60 A;  2ZB9 A;  5ILV A;  3JRA A;  3N4M A;  1ZGW A;  1Y0N A;  4HF2 A;  3MVP A;  3RPU D;  4C3I J;  4FT8 A;  1E0E A;  4R8H A;  1R71 A;  1U5T A;  3ZOB A;  4YIR X;  3GYH X;  4C3H J;  2MD5 A;  2L0K A;  5FKN A;  2Y9Z A;  3HHH A;  4CGZ A;  1KU3 A;  1X1B A;  4XM3 A;  3AG1 H;  1OCC H;  3TP0 A;  1XTA A;  5J6X A;  2M1B A;  3HTU A;  5KVR A;  1MSE C;  2A6T A;  1ZN2 A;  2DFI A;  5AON A;  3HTH A;  4I2O A;  2M0M A;  2BHZ A;  2FBH A;  3BOQ A;  4I0B A;  4LIV A;  1HCR A;  3O60 A;  3LFU A;  4YEL A;  4CCM A;  4M6Y A;  1Y39 A;  5ILS A;  2X4H A;  4L5I A;  1FTT A;  2B1E A;  2LY1 A;  2MD0 A;  3L2Q A;  1V54 H;  3GXO A;  3H0G J;  2Z3Y A;  1D1C A;  4E6K G;  1Z05 A;  4FAS D;  4NC7 A;  3ZQF A;  2I8D A;  2ZCN A;  1XSX A;  4LGW A;  4CCO A;  4P9U A;  3A01 B;  4J00 A;  3DEW A;  1S7E A;  1VND A;  1MBJ A;  2DMT A;  4ESB A;  4YG2 F;  4G6T B;  4AIJ A;  4FX0 A;  5IT9 Z;  5E79 C;  3PAS A;  4UVC A;  4Y7N J;  2FA5 A;  3LAP A;  3Q9S A;  2G7G A;  2CUF A;  3E1S A;  3HPH A;  2BY0 A;  5HLH A;  2YX4 A;  2XPU A;  2Z33 A;  5LRS A;  2M34 A;  4B8X A;  3FBN B;  4N0B A;  2OC6 A;  1ZRE A;  2DMQ A;  1Y6I A;  4LG0 A;  5E3L A;  4AYB N;  4MTD A;  2CMP A;  2VBX A;  3HUG B;  5HDK A;  2XB5 A;  2EIJ H;  1Z21 A;  4HBL A;  3MCZ A;  3GFI A;  5LHG A;  2A2F X;  3FMR A;  2NXN B;  2BY1 A;  4V2F A;  3I4N J;  2VQH A;  3GTK J;  2DQL A;  1ZLK A;  3MWM A;  4BHC A;  1VQ6 I;  4KIC A;  4M3B A;  1HKT A;  2E34 A;  3HG9 A;  4MHG A;  3KLN A;  4GYI A;  1SMT A;  1X19 A;  3WGH A;  1PVE A;  2ZSI B;  1YOV B;  1X1A A;  3KCC A;  5JFR A;  1KGS A;  2JA2 A;  5TGT A;  5BPI A;  3LMM A;  4BJ6 C;  4YIF A;  5DCM A;  1E17 A;  2R7O A;  1Z67 A;  2A6E F;  3D5R C;  4U7B A;  4ZYG A;  3K1N A;  2PMZ N;  2HVQ A;  2K3F A;  2M7A A;  4CCN A;  3ZMT A;  1RUN A;  4B47 A;  4QLC U;  2LP0 A;  4E7K A;  1FNN A;  1S3J A;  3P9C A;  4MGR A;  2CJJ A;  1PDN C;  1P4W A;  4BJ5 C;  3C1D A;  3W2A A;  3B73 A;  4ENK A;  4M73 A;  2YPR A;  3F3X A;  4PJL A;  2P8T A;  3LNQ A;  2OQR A;  1CQT A;  2CQX A;  2DA6 A;  5IP9 J;  4JX6 A;  2FQ4 A;  3KYL A;  2CG4 A;  3LHQ A;  4RMN A;  1VI0 A;  2J5P A;  3VWB A;  3OSF A;  1T2K A;  4HOB A;  2K02 A;  4OMY A;  4NEL A;  1IN7 A;  1ETV A;  2E5N A;  1YX3 A;  1QRY A;  4NBQ A;  3IHU A;  1ENH A;  2E7W A;  3M9A A;  3V4G A;  3HOT A;  3SWH A;  3HTA A;  1FYM A;  2O6G E;  3SDG A;  2DTZ A;  2VJ4 A;  1A6Q A;  5B66 C;  2DMN A;  1DU0 A;  2IA1 A;  2K27 A;  1Y56 A;  1F43 A;  1ZKG A;  2V1U A;  2IVM A;  1SAN A;  2DYS H;  1UCR A;  1MMG A;  4BXF A;  4DZJ A;  4U0W A;  3W3C A;  3BRU A;  5HLI A;  5K7Z A;  1YYV A;  3ANG A;  1WHU A;  2O03 A;  2Z5U A;  3RYR A;  3J7A O;  1B59 A;  1HDD C;  5GPA A;  3LA3 A;  1J9I A;  3OR1 C;  1STZ A;  1D5V A;  4BEH B;  4Z6Y A;  3MZY A;  3B81 A;  1J0R A;  1AKH A;  1BR1 A;  2CQQ A;  1BI3 A;  1T0F C;  2WB1 A;  3H3U A;  4XL9 A;  3AAF A;  3LSK A;  2CQ7 A;  3M07 A;  3CCV I;  1JKR C;  3W6K B;  1Q1V A;  1T0F A;  1SC7 A;  3W2W A;  5L3C A;  2CUZ A;  2OD5 A;  4HNT A;  2X0L A;  3DBH B;  1WKM A;  3GZ6 A;  4AM3 A;  2RC4 A;  2EFQ A;  3EDP A;  3WE3 A;  5F1J A;  2WGB A;  4D7N A;  3BHQ A;  2HVR A;  1SFX A;  1Z7U A;  2RN7 A;  3CF5 F;  1JGG A;  1I6H J;  4YRV A;  4UHT A;  2V57 A;  2ELH A;  4CO8 A;  3KLO A;  3B6A A;  1BL0 A;  1IJW C;  3SZP A;  1ETK A;  4NDL A;  5AIP A;  2BBY A;  1QA6 A;  2IPQ X;  1WQ2 A;  3ZQQ A;  5HAW A;  2H8R A;  2ZKZ A;  1WJB A;  5C44 J;  2EA2 A;  1YE9 A;  4BQA A;  2GXB A;  4FE4 A;  3S2D J;  4G12 A;  3VUQ A;  4XN3 A;  4KIT B;  4XID A;  1UFM A;  1BA5 A;  1WWX A;  2DQR A;  2CS3 A;  2E2H J;  3ANP A;  3W6V A;  4E70 A;  1FOY A;  4BQQ A;  4UV9 A;  1XDS A;  4A93 J;  2JA7 J;  4FE7 A;  3VSK A;  3I56 I;  4M3G A;  2IA0 A;  4AWX B;  1EV7 A;  4NQW B;  4HQE A;  2PEX A;  1P9Q C;  2WAE A;  3S17 J;  2KRC A;  1MZB A;  3O8G A;  4XLN F;  4M3E A;  2PN6 A;  3I53 A;  1RET A;  3M8F A;  4OAY A;  4IHY A;  4ZDL A;  3S1R J;  4A3G J;  3QPH A;  5DDG A;  1EF4 A;  3KZI C;  1WGX A;  4ACI A;  3Q3S A;  3AFH A;  2M3A A;  3I71 A;  4IVN A;  2H94 A;  1FOX A;  4DZP A;  1RZ4 A;  2WB1 N;  2Z16 A;  4CXF A;  1MBK A;  3CCR I;  2VON A;  5DCF A;  3RPQ A;  4EV0 A;  4G6D A;  2XIG A;  2HPM A;  2X6W A;  1MH3 A;  4WWC A;  4XOP A;  2JA6 J;  1NG6 A;  2A05 A;  2X1D A;  4ZTF A;  1JHF A;  3LST A;  1ZLJ A;  1KZH A;  2R7S A;  3IUV A;  1BW6 A;  4OD4 A;  2HR3 A;  2YS9 A;  4G9Y A;  2UXH A;  3H1C A;  3H5R A;  4XOT A;  1UHS A;  4AVP A;  1ZR2 A;  1R22 A;  4HAM A;  4WXC A;  3LL7 A;  4U0V A;  4ENJ A;  3WU2 C;  5E1Z B;  4HA8 A;  3NEU A;  1UG2 A;  5D5W B;  4IRH A;  4MLO A;  1WJ5 A;  2KIQ A;  5GTI C;  3K1M A;  2HZT A;  2KL4 A;  3LSR A;  2CUJ A;  5FFZ A;  2ZO4 A;  4NQW A;  3PFI A;  4XLE A;  4IEJ A;  3CCS I;  1H9T A;  3BPV A;  2JJ7 A;  1UMQ A;  3FX3 A;  2DU9 A;  3S93 A;  3N97 A;  2JPC A;  1JI8 A;  2B9S A;  2XUB A;  2CWE A;  2ESH A;  1P7I A;  2DJN A;  4M3F A;  2E2J J;  2HWV A;  3BDD A;  1NHA A;  3HDD A;  4G6Q A;  4IXA A;  3DWL E;  4YFX F;  2RKH A;  2P0W A;  5EZH A;  3K7A J;  4HKU A;  5B3S H;  4J01 A;  2E7X A;  3H9Q A;  4BJT A;  3ZQC A;  3LSI A;  3JRG A;  4AF5 A;  3MN2 A;  1B9N A;  3H5N A;  2X1C A;  3R61 A;  1A04 A;  4N4N B;  2RHA A;  3QOE A;  5CXI A;  3SFZ A;  3BG7 A;  1LDK B;  3EYI A;  1BBY A;  4A3I J;  1X1C A;  3FXM A;  2R4G A;  2EV5 A;  3NNR A;  3M7G A;  2VI6 A;  1W7P B;  3SFI A;  4HF0 A;  3AL0 C;  2P5K A;  1R49 A;  2ZSH B;  1ETY A;  2LC2 A;  2WY7 Q;  3HC7 A;  3DQV C;  5HS8 A;  5CVV A;  5LGN A;  4A3D J;  1VQ4 I;  1ZGA A;  3CCU I;  2K9N A;  1SMY F;  3G73 A;  1FWZ A;  2K4B A;  3JRB A;  1EH7 A;  3NI7 A;  5GAG J;  2L9V A;  1TWH J;  2HGC A;  3FXK A;  4E4H A;  1BR4 A;  3PNY A;  2EPF A;  5FKL A;  4Y3O A;  2FE3 A;  1ETQ A;  1SD7 A;  2BVM A;  4S05 A;  4IRG A;  1R36 A;  5K5R A;  4XRF A;  1S9H A;  2DPU A;  3K70 C;  2VPR A;  3CP8 A;  3WOD F;  2QKO A;  2Q0O A;  5H2F C;  4RBO A;  3OY9 A;  1K4S A;  2IS1 A;  4U88 A;  2PMH A;  1JHH A;  1B8I B;  1S5L C;  3KZZ A;  1AOY A;  1Y8Q B;  1GXP A;  2PX9 A;  3RTR A;  3L2V A;  2P81 A;  2IBD A;  3ML6 A;  4G7Z F;  3CQZ J;  2NS7 A;  3K70 D;  1R58 A;  5LBQ A;  2R7W A;  2XGX A;  1KU7 A;  1ZH5 A;  3I4P A;  3OYH A;  1BM9 A;  4CZZ A;  3V6G A;  2HOE A;  1S72 I;  3ASN H;  3G7R A;  4KIF A;  4I6Z A;  1IUF A;  2DFF A;  3C18 A;  1YIJ I;  4KN7 X;  4IZZ A;  3CC4 I;  4EJV A;  3VYS B;  3IWF A;  1MMS A;  2JN6 A;  1A36 A;  3WU0 A;  1XGO A;  3IH2 A;  4ME9 A;  2BVL A;  2XF7 A;  2KLO A;  2ADU A;  5L3F A;  2LOO A;  5LHH A;  3E7Q A;  4XQF A;  4J19 A;  2H6B A;  4NNJ A;  5J3L A;  5CVR A;  2VOO A;  2ZXJ A;  2ZXW H;  3L9F A;  1B72 B;  5HNF A;  1SFO J;  2NOG A;  4EQQ A;  2KP6 A;  1BI1 A;  3E5X A;  3I59 A;  1XN7 A;  3H9J A;  3QQA A;  2B3W A;  2M9H A;  4C9Y A;  3FWE A;  5C4Y A;  2Y0S A;  3GFJ A;  3HJE A;  2A69 F;  4FET A;  5FLV A;  1PYV A;  1OIS A;  2BXY A;  2EIM H;  2IGM A;  1IO2 A;  4F55 A;  5D5U B;  4GFK A;  1D0Z A;  2UXP A;  1B8I A;  3E6B A;  3S15 J;  3FXQ A;  3L2R A;  3DU5 A;  2HXO A;  5F08 A;  2JTV A;  2K7L A;  2OUM A;  4U7D A;  3S2H J;  2X85 A;  4P5O A;  4HDV A;  4X6A J;  5M5X J;  3QKX A;  2O5R A;  4PSX A;  4JL3 A;  1IRX A;  1JTX A;  4XSZ F;  2KRF A;  2F48 A;  1RR8 C;  1UJ8 A;  3D0S A;  4RB0 A;  3E5Q A;  2XHK A;  1YFH A;  1CF7 A;  3RQ4 A;  1WJC A;  1MMA A;  3MFK A;  3I64 A;  4E7Z A;  2DA7 A;  1HQC A;  1R6R A;  3I54 A;  4PK4 A;  2OZU A;  3H3V K;  2PBI A;  5FLM J;  5EG0 A;  1YJN I;  2QA4 I;  3LSM A;  3DBR B;  1R4M B;  2GOX B;  4V2G A;  2E1N A;  1IRZ A;  4PJM A;  3IL2 A;  2RNG A;  3T8R A;  5D1R A;  2EV0 A;  2EFP A;  1F4K A;  2XB0 X;  3RKQ A;  1YS7 A;  2Y69 H;  1B72 A;  2IS4 A;  2V4J C;  1A5J A;  3IRQ A;  1LJ9 A;  3EPZ A;  4DQ2 A;  2TCT A;  2HQ5 A;  5J47 A;  3BCB A;  3EUK L;  3LSJ A;  2F5C A;  3KIO A;  3GW2 A;  1RKW A;  5ERI A;  4WK8 F;  4OOI A;  1P92 A;  1P4A A;  2V1X A;  5F6F A;  2JSP A;  5EJC A;  2ZFW A;  4IHX A;  2ZCW A;  1R5G A;  4JX4 A;  2F6C A;  5J4Y A;  2ELJ A;  4LJZ F;  5DAJ A;  5D6F A;  5FRM A;  4D5F A;  3GME A;  4ICH A;  1SVO A;  4XRS G;  2DA3 A;  2GOM A;  4UB6 C;  4P9F A;  3LAJ A;  2YU9 J;  2FUG 2;  3AQT A;  1H9G A;  1W4M A;  3C2B A;  4DYQ A;  3D1N I;  3SYT A;  5EEG A;  5M3F J;  2G3B A;  3QYE A;  2AQF A;  1MH4 A;  2V79 A;  1T6S A;  3ZQI A;  2I5U A;  1PUF B;  2CSO A;  3F22 A;  4E7H A;  1MSF C;  4BAY A;  2X6X A;  3NAU A;  3BZ6 A;  3GX4 X;  2RAE A;  2VQL A;  3WHC A;  5HS9 A;  1ZRC A;  2CUE A;  3IC7 A;  3CLO A;  3H36 A;  2M4K A;  3OYI A;  3BC8 A;  3TQN A;  5AIQ A;  5FKO A;  1HF0 A;  3U9G A;  1XG1 A;  1QPI A;  1P4X A;  4QPO A;  2VXZ A;  1X2N A;  2ZFU A;  4B43 A;  4BBS J;  4P96 A;  5IT9 K;  3LOC A;  2EIL H;  1JUM A;  5JVG F;  4IRV A;  3OYK A;  1ZHF A;  2YX7 A;  3HB9 A;  1QHG A;  2KFD A;  2O8K A;  4ENM A;  2DG8 A;  4GYG A;  4HV5 A;  3HKZ A;  4RGR A;  2F5V A;  2EIK H;  3HSR A;  3WG7 H;  2CW7 A;  3ZR8 X;  3L2U A;  5BQT A;  2O61 A;  2D1V A;  4DYC A;  2ACJ A;  1P6R A;  3ELK A;  3CP2 A;  4JBA A;  2VE9 A;  2TRT A;  1EJ9 A;  4XLH A;  4KIS A;  3FXU A;  1V5F A;  2O0Y A;  4KMU X;  1J5Y A;  3K4N A;  3LFK A;  2XAU A;  3ZRG A;  5IOY A;  2MC3 A;  3FMS A;  4GCV A;  3ABM H;  1APL C;  2QBY B;  3A1Y A;  4RAY A;  4RLQ A;  1PUF A;  4NC6 A;  4LMY A;  2FMY A;  3H35 A;  2VN2 A;  4RS8 A;  4ON0 A;  4EM0 B;  3OMY A;  2DW4 A;  3VSL A;  4KNY A;  4HZF A;  1ZYR F;  4OWR B;  4HRI A;  1U5T B;  1WJE A;  3FM3 A;  3FK6 A;  4DYR A;  1J09 A;  2OU2 A;  3FZV A;  2VB6 A;  3K4L A;  3CCL I;  2ZNY A;  3RDI A;  1JJ8 C;  2D2W A;  1GLN A;  4M9X A;  3JR9 A;  4ZH4 F;  2LFB A;  4PCQ A;  1R1U A;  2DPD A;  2K86 A;  2VJJ A;  2LR8 A;  2OTL I;  3VW2 A;  1OPC A;  2R0Q C;  2MH9 A;  4C30 A;  4BXX J;  1BC8 C;  4B48 A;  4AYB A;  2UZK A;  3HM5 A;  2DO7 A;  4D1Q A;  1YS6 A;  1ZG1 A;  1C0W A;  5M5W J;  1D0X A;  5ILU A;  4EJT A;  3OIP A;  3IH4 A;  1FSH A;  3OYF A;  1XMX A;  2G7L A;  1LUJ B;  1FYK A;  3D5L A;  3ZMD A;  3CCY A;  2F4I A;  1XX5 A;  2E35 A;  5DD4 A;  1LPQ A;  2HNH A;  3BPX A;  3CUO A;  3DEE A;  5HS7 A;  1HBX G;  4DBR A;  3P9T A;  1BI2 A;  5EGO B;  2XF5 A;  4LG0 B;  4CUG A;  3AG4 H;  3PPB A;  2DA1 A;  1KON A;  3ERE D;  3RPU A;  3DXJ F;  1U8B A;  5E20 A;  2EJR A;  3LA2 A;  2Z2S B;  5HSZ A;  4CSW A;  1UHM A;  2JK3 A;  3M1E A;  3VVZ A;  2V9P A;  2PMZ A;  1WSU A;  2CGP A;  2XPW A;  4DGW B;  1XDU A;  4AIH A;  1W0U A;  1R00 A;  2DXI A;  2OI8 A;  3O3K A;  4WXD A;  3WHB A;  4MIM A;  4M9Z A;  4MTE A;  2WBM A;  1NG7 A;  5KNL A;  5H20 A;  2LKP A;  4EM1 A;  5LD2 C;  1QZE A;  3E0J B;  1H8A C;  4L0Y B;  5DCM B;  3BG9 A;  2HOA A;  3MZ8 A;  4NHJ A;  2GWR A;  2QKL B;  3VVY A;  1GV2 A;  2DK5 A;  1QNT A;  1XSV A;  1JT6 A;  2LK2 A;  4D7M A;  1IAW A;  1YIO A;  1JUP A;  3ASO H;  1A31 A;  3QAH A;  1SVL A;  2NAZ A;  3O8H A;  3SEQ A;  3K6G A;  2KIF A;  2KKO A;  2L9S A;  1RRJ A;  2E2I J;  3KET A;  2A07 F;  2PJP A;  3A0H C;  1D0Y A;  5K7F A;  3JTG A;  5TRD A;  2AS5 F;  5FRN A;  3WTS C;  3J7Z I;  2CQN A;  2DJI A;  1LFB A;  2L4A A;  2OCE A;  3O2P E;  3CMA I;  4A3F J;  4XMY A;  3T0Y A;  3V8J A;  3R6S A;  3GEU A;  5C4X J;  5EGO A;  4I76 A;  5D18 A;  2XC7 A;  3KKC A;  3BWG A;  3NQO A;  4MEY F;  4PZJ A;  2ZME C;  4B3X A;  1YJ9 I;  1UZC A;  4M71 A;  2H27 A;  1UHW A;  1NH3 A;  4RAF A;  4UVA A;  5ICG A;  3DLA A;  1Z0X A;  2M8E A;  2ZME A;  1IXS B;  4D0P A;  5JI6 A;  4UV8 A;  3Q0W A;  1ZRD A;  2W00 A;  1HDP A;  2F4M B;  3PSF A;  2F5D A;  3E5U A;  2PFV A;  1MGT A;  2ZNZ A;  3BTC A;  1K6O A;  1G8X A;  1HOM A;  1GDT A;  2DFH A;  3HOZ J;  5E3M A;  3FMQ A;  4EEF G;  2L3D A;  3MQ0 A;  3PSI A;  3TOA A;  4HX7 A;  1YJW I;  5M5Y J;  5A2Q K;  3VW0 A;  2WAQ N;  2E60 A;  2QM3 A;  3EQL F;  1AKH B;  1KQ9 A;  2HQN A;  2OER A;  2VKE A;  2JQ7 A;  2XV4 S;  2KT0 A;  3CDH A;  2MLK A;  3PJR A;  4RM2 A;  3FXL A;  2B0L A;  1E3H A;  1LFP A;  2KZV A;  4ZYE A;  1Q1H A;  2B7E A;  3BT9 A;  2GIV A;  4XLF A;  2K9L A;  3DPT A;  3EYY A;  5IYD J;  1S8N A;  5D6E A;  4AID A;  2UXU A;  3KP7 A;  3NS4 A;  3HIM A;  4RGX A;  2NYX A;  2Q1Z B;  1U2W A;  3J81 Z;  2UUZ A;  3MEX A;  3T8T A;  3ZMS A;  2BEO A;  4ESF A;  1FZP B;  1IUY A;  4EGZ A;  1Y1V J;  3L00 A;  1WJA A;  5GAE J;  1XD7 A;  4H0E A;  1MNM C;  5GTH C;  3PQK A;  4LK0 F;  2L01 A;  3U1D A;  1JKP C;  5HLG A;  3K0L A;  1TWA J;  3VB2 A;  5LGT A;  1BJA A;  3TDZ C;  1V55 H;  3SDB A;  2A5W A;  2CV2 A;  4HEA 2;  3OYJ A;  3VOX A;  1QPM A;  4ZJZ A;  4QPQ A;  2JUG A;  2ZCX A;  1OYI A;  2K3P A;  2GLO A;  2W84 A;  2WV0 A;  3LSP A;  2IGN A;  3A0B C;  3BY6 A;  2PBX A;  4B4C A;  4RAZ A;  4EJW A;  3VP5 A;  3MKW B;  3F1B A;  1RUO A;  2KPM A;  2DYR H;  3Q0V A;  3KEY A;  2UXI A;  4BL0 B;  3GTJ J;  1O3Q A;  3M4O J;  5HLT A;  5HOD A;  3V78 A;  3TMO A;  4FTH A;  3HTJ A;  3JRE A;  3ZN0 A;  2XGD A;  4A12 A;  1MKM A;  2QEX I;  1J7K A;  1Z3Y A;  3ZMZ A;  3ZMV A;  5BOX A;  3I4M J;  2QCO A;  1BIA A;  5L3D A;  3E97 A;  1MBF A;  3PIP F;  3ISP A;  3QPT A;  1D5Y A;  5ICF A;  3U2R A;  1EA3 A;  3GZI A;  2BY2 A;  3CCJ I;  2EA4 A;  4QIW N;  3SJM A;  1IN8 A;  2ICW G;  1K78 B;  2R92 J;  1TQP A;  2HDC A;  2NS8 A;  3MAJ A;  3JRI A;  5FGL A;  1X4O A;  1ZGJ A;  3HL2 A;  4BS9 A;  4JKZ A;  1XSD A;  3PNT A;  2JPB A;  5HOO A;  1FX7 A;  3HOW J;  5H9T A;  4MNU A;  3ZQL A;  1KU2 A;  5J8F A;  1UST A;  3CC2 I;  3B02 A;  1KA8 A;  5FJ8 J;  3CJN A;  4GFB A;  3DTI A;  3H92 A;  3LWF A;  5FFX A;  2R7X A;  3R0A A;  1ULY A;  3R0J A;  3JCU C;  3CJT B;  4HDU A;  4BE0 A;  1FEX A;  1YW7 A;  5DS9 A;  1I5Z A;  1Z91 A;  2D5V A;  1YLF A;  3COA C;  2K40 A;  3HRS A;  4PSW A;  1NTC A;  1XPX A;  3CC7 I;  1JE8 A;  3JW4 A;  1TWC J;  4IQJ A;  1TL8 A;  3BR5 A;  4LLL A;  5DM7 F;  4HV6 A;  4HYE A;  3I5U A;  4M6V A;  4BDY A;  4MK6 A;  4CDG A;  2ID3 A;  4AC6 A;  1SFU A;  3JSP A;  3MZH A;  4EMS A;  1VQK I;  3LSG A;  3M1C A;  1KYW A;  4CYD A;  2X6Y A;  2GFN A;  2VIX A;  4CYC A;  3OS1 A;  4DBQ A;  4L62 A;  4O3M A;  2G7U A;  2W57 A;  1MBH A;  4W97 A;  5A2Q Z;  1XGS A;  5C4J J;  2ME6 A;  2ZC2 A;  1WFX A;  2K4J A;  2QTQ A;  4KA4 A;  1K78 A;  2COB A;  2FF4 A;  1G6N A;  3K4B A;  4A3M J;  4FHT A;  4MEX F;  2HQR A;  2X6O A;  3HGY A;  2FBQ A;  2Q2E A;  1T95 A;  2DOE A;  3FK7 A;  3G1O A;  2R7R A;  2RRE A;  2XDN A;  3GCM A;  1MJA A;  3SXY A;  1E2X A;  1N77 A;  3E6D A;  3GF2 A;  3KE2 A;  4DIQ A;  2QWW A;  2X51 A;  1K61 A;  4E7L A;  4G7O F;  2ISZ A;  1FBU A;  3KPH A;  3DKY A;  3WTT C;  2W53 A;  3BR1 A;  3M8J A;  1BN5 A;  1T8I A;  5H6R A;  2N8G A;  4BYY A;  3JRC A;  3HOX J;  1GUU A;  3ZPL A;  2Z9O A;  3J7A Y;  1IN4 A;  1IRF A;  3AL0 B;  1BC7 C;  4NUB A;  2H1K A;  4OIR F;  1W5S A;  3HZJ A;  2W24 A;  4XLP F;  5BPD A;  1ZG5 A;  4OD5 A;  4HF1 A;  1J2X A;  1YIT I;  2ESN A;  2MA3 A;  4PGG A;  1DDN A;  1X3Z B;  1I3Q J;  2EV6 A;  1VQL I;  2NVX J;  4UB8 C;  1Y1W J;  9ANT A;  1REP C;  4U0Y A;  1HSJ A;  1TBX A;  2ME0 A;  3A02 A;  3F8C A;  3CUQ C;  2O3F A;  1ZAO A;  2YR2 A;  3SHF A;  3HPG A;  1G59 A;  4A6E A;  3OYA A;  1H89 C;  1Y0U A;  2NVY J;  1BOB A;  5ICC A;  3ZCO A;  2K5C A;  3GTP J;  3CUQ A;  2V9K A;  3K2A A;  4A0Y A;  4B3A A;  4BAC A;  2JZY A;  1AA7 A;  2E5Z A;  1JJ6 C;  2RNJ A;  2R5Y B;  3MNL A;  1U9N A;  2KIM A;  2OAZ A;  3IUO A;  2HVS A;  2IT0 A;  3HIF A;  2EH3 A;  4N4O B;  4YFK F;  4EVI A;  5D4S A;  1YW9 A;  4HNV A;  1ORK A;  3PM1 A;  1S6L A;  3ZQH A;  2ZBK A;  2FRH A;  4S0H B;  2CW0 F;  4CCK A;  3BQY A;  1ETO A;  2H8W A;  1LNW A;  2KMU A;  3QPS A;  2M45 A;  4A69 C;  2BV6 A;  4BKX A;  1WZ2 A;  1TW2 A;  2MAB A;  4KIB A;  2W48 A;  4B09 A;  5KHD A;  2MLG A;  2L4M A;  3HTI A;  1OKR A;  2WWY A;  2L02 A;  3S8P A;  1MW7 A;  5E1X A;  2FQ3 A;  1D1B A;  2VT2 A;  1U78 A;  1K4T A;  2QWT A;  1L3L A;  4ZC3 A;  1PP7 U;  4RA2 A;  3F6O A;  2RAS A;  1T39 A;  2YVH A;  2XAG A;  1E3P A;  4IKF A;  3I59 B;  4NC8 A;  4LOC A;  4MO7 A;  4NN1 A;  1YQA A;  3OL4 A;  2K85 A;  2RQQ A;  3IKV A;  3P9K A;  3KP5 A;  2PI0 A;  1B9M A;  3JSJ A;  1KQ8 A;  4E7S A;  5GP9 A;  2EWN A;  3H9G A;  1YHQ I;  2WA0 A;  2UV1 A; 
#chains in the Genus database with same CATH homology
 1PUF B;  1UI6 A;  2G7S A;  2MW8 A;  2R5Y A;  1MSF C;  3H0G J;  3NAU A;  5EZG A;  2RAE A;  2EZL A;  3WHC A;  3BNI A;  2G0E A;  3ZQF A;  2HOS A;  1ETW A;  2CUE A;  3A03 A;  2ZCN A;  2HYT A;  1RR7 A;  4A3L J;  4AC0 A;  5FKO A;  3A01 B;  1HF0 A;  3CDL A;  1XG1 A;  1S7E A;  1VND A;  1MBJ A;  2DMT A;  3DEW A;  1QPI A;  3PAS A;  5EYR A;  3M3Y J;  4L5E A;  4A3B J;  4Y7N J;  1X2N A;  2G7G A;  2CUF A;  2Y9Y A;  4BBS J;  3BG3 A;  2XPU A;  2M34 A;  2XRL A;  1ITY A;  2Q24 A;  2DMQ A;  3DCF A;  3LOC A;  5E3L A;  4AYB N;  1TC3 C;  1JUM A;  2NP5 A;  5EG0 B;  2XB5 A;  4GCK A;  3HB9 A;  4A3K J;  1JTY A;  3TW6 A;  2O8K A;  2GEN A;  2X9D A;  4W1U A;  2HYJ A;  2DG8 A;  3NPI A;  2OF7 A;  3VVX A;  3G1M A;  4V2F A;  3I4N J;  3TED A;  3GTK J;  3Q0U A;  3RH2 A;  3BJB A;  4DYC A;  1POG A;  1JUS A;  4M3B A;  2TRT A;  4GFL A;  1JT0 A;  1ZK8 A;  5C3E J;  1I50 J;  2Y31 A;  2PZ9 A;  1VF9 A;  5EDN A;  4C2M J;  3NXC A;  5IOY A;  2PMZ N;  1APL C;  4C3J J;  4XIC A;  1PUF A;  2LTP A;  2LP0 A;  3HBL A;  1IV6 A;  2CJJ A;  4DW6 A;  3MKL A;  4IHW A;  2I10 A;  2Y2Z A;  2GBY A;  3OIO A;  3LNQ A;  3FK6 A;  1CQT A;  2AHQ A;  2CQX A;  2DA6 A;  4DYR A;  2B63 J;  2FX0 A;  5IP9 J;  4JX6 A;  2GUH A;  2FQ4 A;  2UXO A;  3LHQ A;  2HOT A;  2K9S A;  3F0C A;  1JJ8 C;  1VI0 A;  2O7T A;  5FHP A;  5AQC A;  3OSF A;  3JR9 A;  4CGR A;  2LFB A;  4NEL A;  3GTQ J;  5EFY A;  5HBU A;  2DA4 A;  3S14 J;  1ETV A;  1O4X A;  3RZD J;  3L1P A;  2EZI A;  2LR8 A;  3S16 J;  2E19 A;  1QRY A;  2LY9 A;  3VW2 A;  2R0Q C;  1ENH A;  4BXX J;  1QVT A;  4UUT A;  3HTA A;  5J1U A;  1F36 A;  3SDG A;  1NK3 P;  2DTZ A;  3HM5 A;  1DU0 A;  4GCT A;  2DMN A;  3RD3 A;  2M8G X;  5M5W J;  3S1M J;  4A3C J;  4JP0 A;  3IH4 A;  1F43 A;  1ZKG A;  1R9T J;  2G7L A;  3G56 A;  1SAN A;  4DZJ A;  3GTL J;  3CCY A;  1GVD A;  3BRU A;  5K7Z A;  3P9T A;  2QOP A;  3ANG A;  4QSH A;  5EGO B;  3FRQ A;  3T6N A;  1HDD C;  5GPA A;  2VUM J;  3PPB A;  2DA1 A;  1U9O A;  2ECB A;  2FD5 A;  3HEF A;  1U8B A;  4MFD A;  3B81 A;  1AKH A;  1LFU P;  2CQQ A;  5HSZ A;  2JK3 A;  3VVZ A;  4XRS A;  2FJ1 A;  2XPW A;  3FKI J;  1TWG J;  2IAI A;  1Q1V A;  3E7L A;  1JKR C;  1WPK A;  2EZK A;  1W0U A;  2IU5 A;  2OI8 A;  4MXM A;  2XSD C;  3WHB A;  4MIM A;  5F1J A;  2WGB A;  4D7N A;  3BHQ A;  1H8A C;  5BNG A;  4D5C A;  3BG9 A;  1JGG A;  2HOA A;  5JLW A;  2E1O A;  1I6H J;  2V57 A;  5F0C A;  3VVY A;  1GV2 A;  3B6A A;  1JT6 A;  2LK2 A;  4D7M A;  1BL0 A;  3COL A;  1IJW C;  1JUP A;  3KNW A;  1Z77 A;  1ETK A;  4NDL A;  3O8H A;  2M2E A;  3KKD A;  2ZOZ A;  2DN0 A;  3EGQ A;  2E2I J;  5HAW A;  1X58 A;  2H8R A;  4KWA A;  2NVT J;  5K7F A;  2JMW A;  5C44 J;  2NX4 A;  1WCM J;  1GT0 C;  2R5Z B;  2ID6 A;  4FE4 A;  2HKU A;  1LFB A;  3S2D J;  4JNN A;  4G12 A;  4A3F J;  3VUQ A;  3G1L A;  5FMP A;  4XID A;  2YVE A;  1BA5 A;  3GEU A;  3ANP A;  2E2H J;  5C4X J;  5EGO A;  1IG7 A;  3W6V A;  2QF7 A;  2WV1 A;  4A93 J;  2JA7 J;  4I76 A;  5D18 A;  4FE7 A;  3KKC A;  4M3G A;  2CU7 A;  3OOU A;  3NRG A;  5CW8 A;  1HLV A;  5K58 A;  3GBG A;  3ON2 A;  3S17 J;  5IP7 J;  3O8G A;  4M3E A;  3CWR A;  2KDZ A;  1RET A;  4IHY A;  3S1R J;  1W0T A;  4A3G J;  1Z0X A;  4MFE A;  3Q0W A;  1EF4 A;  1HDP A;  3BR2 A;  3GTO J;  1WGX A;  4ACI A;  3BTC A;  3Q3S A;  1FIA A;  1RES A;  1HOM A;  1GDT A;  2WUI A;  3HOZ J;  5E3M A;  2K9Q A;  2WB1 N;  4DZP A;  3QBM A;  3S5R A;  1MBK A;  2DA5 A;  4EEF G;  4JYK A;  5F04 A;  5M5Y J;  1MH3 A;  3IV5 A;  3VW0 A;  2WAQ N;  1LE8 A;  1AKH B;  2OER A;  2JA6 J;  2VKE A;  2KT0 A;  1JKO C;  3IUV A;  1FTZ A;  2NVQ J;  2ZCM A;  1BW6 A;  4A3E J;  2YS9 A;  3BT9 A;  2UXH A;  1SGM A;  2R5Z A;  5IYD J;  2ZOY A;  2UXU A;  1OCT C;  3HOV J;  2HDD A;  1UHS A;  1ZR2 A;  3HIM A;  3FIW A;  3BQZ A;  1UG2 A;  3KZ9 A;  5F0H A;  2LD5 A;  4MLO A;  1Y1V J;  3NAR A;  4Y52 J;  3LSR A;  2R93 J;  1MNM C;  1VFC A;  2GM4 A;  3HOU J;  4YZE A;  1JKP C;  2DMU A;  2EQR A;  4IEJ A;  1TWA J;  2EZH A;  1E3O C;  2JJ7 A;  1UMQ A;  3RQI A;  3VOX A;  5K7H A;  2NP3 A;  2ZCX A;  4UDS A;  5EF6 A;  1XC5 A;  2GLO A;  1P7I A;  3LSP A;  3HGG A;  2DJN A;  2EBI A;  4M3F A;  2PBX A;  5FKK A;  2E2J J;  4B4C A;  3LWJ A;  3VP5 A;  1T33 A;  1AU7 A;  3HDD A;  3F1B A;  3VOK A;  3TW7 A;  5FKM A;  5EZH A;  3K7A J;  3Q0V A;  4HKU A;  2UXI A;  2XGC A;  3JRH A;  2HXI A;  3GTJ J;  1TWF J;  3M4O J;  3ZQC A;  3S1N J;  1RPW A;  3JRG A;  1YRN B;  5HOD A;  3V78 A;  3HTJ A;  3MN2 A;  4FTH A;  4AF5 A;  3JRE A;  3QPL A;  2XGD A;  1BJZ A;  2RHA A;  2Y30 A;  2LLK A;  5CXI A;  2O9L A;  5E3N A;  2HI3 A;  1ZTR A;  3DPJ A;  2JWT A;  1OJL A;  4A3I J;  2QCO A;  3I4M J;  3NNR A;  1MBF A;  2VI6 A;  3SFI A;  1D5Y A;  3UKG A;  3PO3 J;  3GZI A;  1ZQ3 P;  2REK A;  4QIW N;  3SJM A;  1OCP A;  4M3D A;  4B1R A;  2R92 J;  1ETY A;  3RZO J;  2IEK A;  2L7Z A;  2NS8 A;  4A3J J;  3JRI A;  5FGL A;  1WI3 A;  4A3D J;  1LE8 B;  4JKZ A;  2K9N A;  1IC8 A;  3TP3 A;  4QTR A;  3HOW J;  3JRB A;  3NI7 A;  5H9T A;  3ZQL A;  1TWH J;  2M0C A;  2Y0S N;  4XK4 A;  4XRM A;  2LKX A;  3EUP A;  3BTI A;  5FJ8 J;  5FKL A;  1FIP A;  4GFB A;  1ETQ A;  1FJL A;  1NK2 P;  5CXG A;  1P7J A;  2VPR A;  1IDZ A;  1FEX A;  5DS9 A;  2QKO A;  2D5V A;  4RBO A;  5IP6 A;  2MGQ A;  2K40 A;  2D6Y A;  3ZQG A;  1NTC A;  3GTM J;  2JA5 J;  3BTJ A;  1B8I B;  1TWC J;  3BR5 A;  4M6V A;  5GPC A;  3BR6 A;  4MK6 A;  1DU6 A;  2P81 A;  2IBD A;  2ID3 A;  2L9R A;  4AC6 A;  1YRN A;  4IHV A;  2MG4 A;  3BR0 A;  3LSG A;  3CQZ J;  2NS7 A;  3VPR A;  1IGN A;  5IOZ A;  4PXI A;  3HE0 A;  2X48 A;  2GFN A;  4CYC A;  3BG5 A;  3V6G A;  4L62 A;  3G7R A;  2MSY A;  1MBH A;  1IUF A;  4W97 A;  5C4J J;  4I6Z A;  2ME6 A;  3JRF A;  2QTQ A;  4UUS B;  2JN6 A;  2L7M P;  1WH5 A;  4AUX A;  3IH2 A;  2COB A;  3PO2 J;  4ME9 A;  4A3M J;  1ETX A;  2X6O A;  3HGY A;  3S1Q J;  2FBQ A;  3E7Q A;  3CMY A;  4J19 A;  4ABZ A;  3FK7 A;  3G1O A;  4GCL A;  5J3L A;  5DTD A;  1B72 B;  1SFO J;  2XDN A;  1OFC X;  2NOG A;  1RKT A;  2XPV A;  3OSG A;  1K61 A;  3QQA A;  1IDY A;  2M9H A;  2AO9 A;  1ZR4 A;  2OPT A;  5C4Y A;  1T56 A;  2ELK A;  2W53 A;  4BY7 J;  3VW1 A;  3BR1 A;  5F27 A;  3CJD A;  2N8G A;  3HOX J;  3JRC A;  1AHD P;  1GUU A;  5FLV A;  3LJL A;  1X2M A;  4GFK A;  2UXP A;  1B8I A;  3IH3 A;  2H1K A;  3S15 J;  1MBG A;  2HXO A;  5F08 A;  3FIS A;  2LVS A;  2DMP A;  5E3O A;  3S2H J;  3ON4 A;  3QKX A;  4RDU A;  5M5X J;  1I3Q J;  3A01 A;  4X6A J;  3C07 A;  4JL3 A;  1JTX A;  5J1Y A;  2NVX J;  1Y1W J;  9ANT A;  2ME0 A;  3A02 A;  1H88 C;  2O7O A;  3VIB A;  1A6I A;  5IPA A;  3BCG A;  2F07 A;  1H89 C;  2NVY J;  2DA7 A;  3GTP J;  5M3M J;  3K2A A;  4B3A A;  3H3V K;  4UUS A;  5FLM J;  5EG0 A;  2JA8 J;  3GTG J;  1JJ6 C;  4V2G A;  2R5Y B;  3MNL A;  1K83 J;  1U9N A;  1IRZ A;  1JKQ C;  5D1R A;  2EH3 A;  2QIB A;  1WH7 A;  2DA2 A;  2XB0 X;  5EEA A;  3RKQ A;  3CRJ A;  5J1R A;  4HNV A;  1ORK A;  3PM1 A;  1B72 A;  3ZQH A;  2XGE A;  4S0H B;  4BY1 J;  1A5J A;  3BQY A;  2TCT A;  2R7Z J;  1ETO A;  1XS9 A;  2HQ5 A;  4CYC B;  3JRD A;  3QPS A;  4A69 C;  1QVU A;  3LSJ A;  4BKX A;  1MBE A;  3BR3 A;  1RKW A;  2CRG A;  2W48 A;  5JLX A;  2ECC A;  1BW5 A;  3AQS A;  3HTI A;  3HKZ N;  4JX5 A;  5F0F A;  2VKV A;  2L7F P;  4IHX A;  2ZB9 A;  5IYC J;  1GV5 A;  4JX4 A;  3JRA A;  1ZGW A;  1U78 A;  2QWT A;  5D19 A;  1UI5 A;  2YUS A;  1G2H A;  3MVP A;  3BTL A;  4C3I J;  5DAJ A;  4D5F A;  2RAS A;  2YVH A;  3ZOB A;  4X1E A;  3B6C A;  2DG7 A;  4ICH A;  4C3H J;  2L0K A;  4LOC A;  4MO7 A;  5FKN A;  2DA3 A;  4XRS G;  4BBR J;  2Y9Z A;  4NN1 A;  4FIS A;  3HOY J;  3TP0 A;  1MSE C;  2YU9 J;  3HTH A;  3AQT A;  4FCY A;  3C2B A;  4DYQ A;  3JSJ A;  3D1N I;  1HCR A;  5GP9 A;  5IYB J;  5M3F J;  2G3B A;  3O60 A;  1MH4 A;  3ZQI A;  1FTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...