2ID6A

Crystal structure of transcriptional regulator (tm1030) at 1.75a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, TetR FAMILY
publication title Crystal structure of transcriptional regulator (tm1030) at 1.75A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2id6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2id6A02
1ZKGA 3S1RJ 2IEKA 2XRLA 3SFIA 3QQAA 4RDUA 4JKZA 1UI6A 1AKHA 4FISA 1W0TA 3HOVJ 3PASA 1IUFA 4JX5A 2QOPA 2AHQA 2JA5J 1T56A 2XGDA 1ITYA 5FKLA 3LJLA 3FRQA 2D5VA 3BNIA 3DEWA 2NVQJ 2XPUA 4FCYA 5F27A 3BR6A 5FMPA 5D1RA 5M3MJ 5FLVA 5F1JA 5JLXA 1MH4A 2M34A 1D5YA 2ME0A 5K7FA 4BXXJ 3S1MJ 3GTPJ 1OJLA 2EH3A 1PUFB 3LSPA 3OSFA 2DMTA 5F04A 1DU0A 3VVZA 3BR0A 4JNNA 5D19A 4JX6A 4XRMA 4Y52J 3VP5A 3G56A 4DZJA 4DYRA 1IGNA 4G12A 1JUPA 1E3OC 3HOXJ 1AU7A 1GT0C 5FLMJ 2YU9J 3H0GJ 4IHYA 2L0KA 3HIMA 3GBGA 1TWAJ 1SGMA 4AC6A 1IDZA 1LE8A 2LFBA 3BRUA 2HI3A 1MBKA 1SANA 1MBHA 3MN2A 2ZOZA 3FK6A 3O8GA 2Y30A 3HOWJ 3ZQCA 5C4YA 5E3MA 2L9RA 3G1MA 3ZQHA 2MG4A 1QVTA 3EUPA 3BTLA 1JKQC 2VKVA 5E3OA 2G3BA 4ICHA 2EBIA 1IG7A 1CQTA 4A3DJ 2NVXJ 4A3LJ 1MBFA 3HE0A 2VUMJ 2LD5A 3QBMA 1RKWA 4NELA 5EGOA 4XIDA 1U9OA 1FIAA 3CDLA 3ON4A 4XICA 1X58A 4UUTA 3VVXA 4GFKA 1HLVA 3JRGA 3H3VK 9ANTA 4ABZA 3C07A 3F1BA 1A6IA 3VUQA 2E19A 1GV2A 3VW2A 3IUVA 1IDYA 4C2MJ 4AC0A 1PUFA 1P7JA 3VW0A 3GEUA 3RZOJ 5EYRA 1GUUA 4BY7J 2YVEA 3CCYA 5GPAA 3T6NA 2RAEA 1FTTA 3M3YJ 3KZ9A 5IYBJ 1H8AC 2F07A 3RZDJ 5EEAA 2ID3A 2Y9YA 4I76A 5EZHA 3P9TA 2EZHA 4DW6A 2QWTA 1JT0A 4ACIA 2N8GA 2HXOA 1OFCX 3UKGA 2XB5A 2TCTA 1S7EA 1MSEC 4DZPA 2JA7J 1NTCA 2REKA 2UXIA 3ON2A 4I6ZA 3B6CA 1ZGWA 3VVYA 5F0CA 1R9TJ 3BJBA 3E7QA 4IHXA 2EQRA 2Y0SN 4ME9A 1VNDA 3GTJJ 4L62A 3BG3A 3VPRA 3W6VA 5F0FA 2FQ4A 2DA7A 1OCPA 2G7LA 1YRNB 3DCFA 1BW5A 3BT9A 2G7GA 3CWRA 5K7ZA 5J1UA 1UI5A 1Z77A 2ZB9A 4PXIA 1TC3C 3HGGA 4JYKA 3CMYA 3CQZJ 3Q0VA 4B3AA 4A3GJ 2CQQA 2XB0X 3I4MJ 4A3MJ 1SFOJ 1RR7A 4A3IJ 1ETQA 3EGQA 4RBOA 5FKKA 3S17J 4A3FJ 2DA3A 1K61A 2X9DA 1WI3A 1RPWA 4MFEA 1F43A 2WV1A 2JWTA 4A3JJ 2ELKA 3PPBA 1WH7A 2L7FP 4AUXA 3NRGA 4KWAA 1UG2A 2MGQA 3OOUA 2XPWA 2MSYA 1ETOA 4V2GA 1JKRC 1Y1VJ 4D7NA 3S14J 4DYQA 3B81A 2MW8A 5EF6A 1Y1WJ 2KT0A 1MNMC 1X2MA 2OF7A 1UMQA 3PO3J 5J3LA 2VKEA 4HKUA 3VIBA 3BR3A 5FKOA 5H9TA 1ETYA 3K7AJ 2QF7A 1H88C 2QKOA 2LLKA 2ME6A 3DPJA 5J1RA 2E2JJ 1MH3A 1T33A 3G1LA 4L5EA 5C3EJ 2GBYA 5IOYA 3HEFA 1WPKA 2HOTA 2HYTA 5FKNA 3TW7A 2HQ5A 5EZGA 3A01B 2OERA 3HTIA 1LFBA 2HOAA 4CYCA 2CRGA 2JMWA 2O7OA 4YZEA 2OPTA 1RKTA 2XGEA 3TP3A 1YRNA 3B6AA 1FTZA 4IHVA 2R7ZJ 1ENHA 2I10A 2DA4A 1ETVA 3AQTA 1XC5A 2QCOA 1I3QJ 2NS8A 3HKZN 3JREA 3ZQLA 3S1NJ 4A69C 5IP6A 1HOMA 3GZIA 3V6GA 4M3BA 5FJ8J 3C2BA 4X6AJ 2DA6A 1JGGA 2XDNA 2ID6A 2V57A 3A02A 3NARA 3ANGA 2NX4A 3NNRA 4D7MA 3PM1A 3QPLA 1RETA 5IP7J 3NPIA 1XS9A 1WH5A 3VOKA 1TWGJ 2DA2A 2DN0A 1I6HJ 3COLA 1G2HA 2NOGA 1ZR2A 5J1YA 1AHDP 4IHWA 2IAIA 4B1RA 1OCTC 2LKXA 3PO2J 1FEXA 3ZQIA 3BTJA 5DAJA 1Q1VA 4BY1J 1BA5A 2R93J 3VOXA 5IOZA 1MSFC 3GTQJ 1U78A 3CRJA 4GCLA 2DJNA 4BKXA 1JUSA 3IH2A 2NP3A 5EDNA 3A01A 3JRBA 1ETWA 2Y2ZA 4MLOA 3RD3A 2Y31A 3HTAA 4QTRA 4FE7A 2LY9A 4XRSG 3HTJA 4D5CA 1B8IB 3ZQGA 3GTLJ 2Q24A 2E2IJ 5FKMA 3ZQFA 3AQSA 3GTMJ 4MIMA 1IJWC 1TWCJ 3RH2A 2NVYJ 1B72B 5HODA 4CGRA 1NK2P 3JRCA 2O9LA 1MBJA 4QSHA 5D18A 3BTCA 3QKXA 2G0EA 3WHCA 3Q0UA 3LWJA 3BR1A 4M3EA 3NI7A 5IP9J 5CXIA 3BTIA 5EG0B 3HOYJ 1MBGA 5GPCA 2GM4A 4DYCA 3JRIA 1BL0A 3FKIJ 1ZK8A 4A93J 2R92J 4UUSB 2M9HA 3ZOBA 2ZCXA 1HDPA 4JX4A 1NK3P 3LSGA 3MVPA 3KKCA 1VFCA 3L1PA 2CJJA 4GFBA 4W1UA 1QRYA 5M5WJ 1JJ8C 4GFLA 1ZTRA 5K7HA 1I50J 3Q0WA 3S16J 3HGYA 4B4CA 2X48A 1F36A 2IU5A 1TWHJ 2P81A 1BJZA 1HF0A 2M8GX 5HSZA 4A3EJ 1IV6A 3LSRA 5IYDJ 5FHPA 2DA5A 4MO7A 2O7TA 3OIOA 3BQYA 2DMNA 5C4XJ 2KDZA 2DG7A 3A03A 2VPRA 4Y7NJ 3TEDA 2DA1A 1MBEA 5DTDA 3SJMA 1EF4A 5EGOB 2R5ZB 3LHQA 2H1KA 5HBUA 5BNGA 2QIBA 2K9QA 3IH3A 3TP0A 1B8IA 1FJLA 1DU6A 4S0HB 5E3NA 4M3GA 5M3FJ 5F08A 4W97A 2HYJA 1ZQ3P 4LOCA 2JA8J 2FBQA 2AO9A 2DMQA 1B72A 2K40A 1IRZA 2XPVA 5CXGA 3RKQA 1W0UA 4AF5A 2WGBA 4BBSJ 3HM5A 1IC8A 2E2HJ 4AYBN 2LP0A 5AQCA 1FIPA 1JTXA 2B63J 5K58A 1UHSA 2HOSA 2ZCMA 2UXUA 2CUFA 2H8RA 2WUIA 2OI8A 1GV5A 5EG0A 4GCTA 4M6VA 4C3HJ 3S2HJ 3G1OA 3HDDA 5IYCJ 1XG1A 3MNLA 4UUSA 3SDGA 3NAUA 2E1OA 4XK4A 1JUMA 1Z0XA 1POGA 3GTOJ 2UXPA 5FGLA 5JLWA 2JA6J 2RHAA 5HAWA 3JRDA 4M3FA 5M5XJ 3S2DJ 2WAQN 3QPSA 4V2FA 2DG8A 3ANPA 3HOZJ 3G7RA 1RESA 3FIWA 5GP9A 3BQZA 2ECCA 3HB9A 2JJ7A 4D5FA 2UXOA 5CW8A 2GENA 2DMUA 3BG9A 3S1QJ 3TW6A 2R5YB 2UXHA 2L7MP 2TRTA 4EEFG 1VF9A 4X1EA 4FE4A 2Y9ZA 2NS7A 1U9NA 4MFDA 3FISA 1P7IA 3D1NI 5F0HA 5M5YJ 1APLC 2YVHA 3JRAA 3HTHA 3Q3SA 1QPIA 2W48A 4JL3A 2M0CA 3NXCA 5IPAA 2PMZN 3CJDA 1ZR4A 1JTYA 2HXIA 3LSJA 2X6OA 2XSDC 2R5ZA 2FD5A 5EFYA 1JJ6C 2JN6A 4HNVA 2GUHA 1A5JA 2LK2A 3E7LA 2LVSA 3O60A 1BW6A 3S5RA 2W53A 2L7ZA 5DS9A 5C44J 3HOUJ 2ZOYA 3HBLA 1AKHB 2K9NA 3F0CA 2JK3A 2G7SA 3V78A 3KNWA 4A3KJ 2GFNA 2EZLA 3RQIA 3JSJA 1ETKA 4GCKA 2M2EA 2HDDA 3LNQA 2NVTJ 1QVUA 2COBA 1U8BA 2HKUA 2NP5A 2PZ9A 3BR2A 4C3JJ 2CQXA 3BCGA 3BG5A 3WHBA 3FK7A 2IBDA 1WGXA 1GDTA 2EZKA 4IEJA 1H89C 1HDDC 1LFUP 2QTQA 2FX0A 3S15J 4C3IJ 4FTHA 2WB1N 2RASA 4JP0A 3VW1A 1JT6A 2O8KA 2K9SA 2LR8A 1WCMJ 2CU7A 2FJ1A 2R0QC 4J19A 3M4OJ 4A3BJ 1JKPC 2YS9A 2ZCNA 2PBXA 4BBRJ 3I4NJ 4NN1A 2GLOA 1ORKA 4QIWN 1TWFJ 2EZIA 3IH4A 3IV5A 1O4XA 2XGCA 4M3DA 2R5YA 4MXMA 4A3CJ 3O8HA 3LOCA 1JKOC 4UDSA 2LTPA 4CYCB 4XRSA 2D6YA 1VI0A 3OSGA 2CUEA 2ECBA 1HCRA 3KKDA 2DMPA 3JRFA 3JRHA 4NDLA 2DTZA 1ETXA 1GVDA 1X2NA 3BHQA 3GTKJ 1LE8B 3JR9A 3GTGJ 2YUSA 2VI6A 1K83J 4MK6A 5C4JJ 3K2AA 3MKLA 3BR5A 5E3LA
chains in the Genus database with same CATH superfamily
1ZKGA 2F5DA 4AM3A 2XVCA 3BJ6A 5CQEA 3LSMA 1U6GA 3SFIA 1FPQA 1V3FA 3O2PE 1UI6A 1ZAOA 4A6EA 4FISA 1ULYA 1FX7A 1W0TA 1MGTA 4FQGA 3Q9VA 2AHQA 2XGDA 2HU9A 1Y8RB 1ZGAA 1X1DA 2YU3A 3DEWA 3BNIA 3KP4A 2L9NA 3KZZA 3BZ6A 4IKFA 2VBYA 3L2VA 1ZGJA 3QU3A 1N77A 5FLVA 3K4KA 1Y6IA 2R4GA 2EFNA 5CYVA 2P7CB 2ME0A 2ZXHA 3EUHA 4IRHA 3S1MJ 1B9MA 3D5SC 1OJLA 1Z7UA 2EH3A 2KFDA 5TGTA 3OSFA 5CJ9A 2H8WA 4ZJZA 2V7FA 3VVZA 2HOEA 1HW1A 5E1WA 2HTSA 2WB1A 3MD2A 4Y52J 3VP5A 4LG0A 4AVPA 1WFXA 2XDVA 4M71A 4L9NA 2J5PA 2E5NA 2IS2A 1AWCA 1ZELA 2QSHX 2EV6A 4OOIA 1YW7A 2YU9J 2DCEA 4AIJA 4PJNA 3HIMA 2MH9A 3GBGA 1SGMA 3KYLA 5GTHC 2W1OA 1LE8A 2LFBA 3BRUA 2HI3A 1BC7C 2FNAA 2XSJC 3O8GA 4BXFA 5BQTA 3COAC 2O0YA 4IRIA 5H6QA 1OCCH 1WJEA 3MQ0A 3G1MA 3MZHA 1RZ4A 4Y15A 2ADUA 1SC7A 2A07F 1JKQC 2VKVA 1NH3A 4F52A 3QBMA 4A3DJ 2VQHA 3FXJA 4A3LJ 1PVEA 2VUMJ 1RKWA 2Y69H 1KYWA 4NB5A 4KFCA 2JUGA 1K4TA 2PJRA 3BPVA 3I0TA 4XICA 1X58A 2FUG2 2CH0A 1DGRM 5BPIA 4AIKA 2AQFA 2NYXA 4OD4A 1D0YA 1HLVA 3V7CA 3KEYA 1HSTA 3GX4X 3EYIA 9ANTA 3E6BA 1N25A 5ICCA 1BI2A 4PSWA 1B6AA 2DFHA 2F48A 2YR2A 2PG4A 2BV6A 1E3HA 3K10A 4GYIA 2OTJI 3B02A 4YFNF 4LG3A 1W5TA 2OV7A 1LFPA 4R8HA 1BI1A 2OZ6A 3K70C 3R4KA 4CZCA 5IYBJ 3CLQA 5DEQA 2H94A 3E5QA 4HX7A 2AXLA 4KUMA 4XKBA 4E6KG 2QWTA 4DW6A 5K5RA 3F6VA 4ACIA 2N8GA 1BR1A 1OFCX 2DBBA 2XB5A 3GFIA 2JA7J 3KP6A 4GGGA 2UXIA 4M72A 1SFEA 2A05A 3ON2A 3GEZA 3RYPA 1BR2A 4I6ZA 1ZGWA 2FU4A 3NRVA 3K4NA 1R9TJ 3CC4I 4IHXA 3H5NA 2AQEA 3UNGC 3GTJJ 1Z6TA 2YX7A 3CLOA 1MJ9A 2A69F 3OIQA 3VPRA 3GZ6A 2E1CA 3W6VA 4CGZA 3CWRA 2G7LA 1BW5A 3DCFA 1Y8QB 3LA3A 3I5UA 3E6CC 1NG6A 4OMZA 1Z77A 4G6QA 2ZB9A 4PXIA 1MMNA 4BJTA 4BEHA 4B3AA 4RB0A 2CQQA 3HRSA 5FLXZ 5IY5H 3HHGA 4O6JA 3DLLF 4RMNA 3EGQA 3RYRA 1ETQA 4RBOA 3D5LA 3ZQ7A 4A3FJ 2DA3A 2X9DA 3F21A 2CW7A 4HF1A 2WV1A 3C7JA 3PPBA 1W36D 1WH7A 2DODA 4AUXA 4XLNF 2VJ4A 2Y48A 3NRGA 2KPMA 3HUGA 2W4SA 1IXCA 3DFGA 3S14J 2DW4A 2LC2A 1SAUA 3HYIA 2BW3B 3MZYA 4DQ2A 1YI2I 2MW8A 2HS5A 4OIOF 2ZC2A 3A2KA 1LDJA 1QBJA 1OCOH 4XKCA 1X2MA 2P6SA 1NHAA 3VEPA 3A4CA 3MZ8A 4UUVA 2IGNA 2M0MA 4G94A 4IF4A 4M9SA 1G3YA 1KGSA 4ITVA 1MJAA 3TMOA 4I99C 3ULQB 2ME6A 4NQWA 2E2JJ 3QYFA 1XD7A 5C3EJ 5IOYA 2GA1A 1WPKA 3IUOA 2E7XA 3K6GA 5FKNA 5HS9A 3TW7A 2HQ5A 2E5ZA 2FRHA 4I0AA 1IXSB 3NWSA 4KITB 1WJDA 2IJLA 4LGWA 1S29A 3BJOA 2P7VB 4YZEA 2O7OA 2QVOA 2BXYA 2XGEA 6PAXA 5GTIC 3B6AA 3CCMI 4KT5C 4J01A 4IHVA 4EM2A 3C3WA 4YIIA 1ENHA 2OD5A 3DBHB 2W57A 3AQTA 1U0JA 2GQQA 2QCOA 1I3QJ 3ZQLA 4ENNA 3J81Z 1GVJA 4GO1A 1QPMA 1TP4A 3C2BA 1IUYA 2ID6A 2V9KA 1R4MB 3R0JA 3H1CA 3NARA 2X6YA 3EUHC 2NX4A 3WTWC 3QP6A 3FF5A 3PFIA 4GRIA 2DAOA 5ED4A 2F5VA 4P55A 1XPXA 3NPIA 3R0AA 2A6EF 3VOKA 2QUFA 3VWBA 1G2HA 2NOGA 3VOEA 2NS0A 1IN4A 4IHWA 2IAIA 2IA0A 3RTRA 3K4CA 1YITI 3S93A 3K1PA 1R36A 3SFZA 3PO2J 3OMYA 4XONA 5FB2A 1SVLA 5DAJA 3BTJA 5D8KB 3EETA 3RI4A 2HPIA 4U9NA 2CQKA 4ENMA 3WTTC 3G6EI 1R5ID 3AL0B 4EV0A 3P7NA 1U78A 1ZARA 1B59A 2M4KA 1XGSA 4XRFA 3ZCOA 3A01A 3JRBA 1Z21A 3J7AO 3HSEA 2ZXJA 3E6DA 2IXSA 2Y31A 1QGPA 3HTAA 1QHHD 4XLPF 5CLSA 2LY9A 3HTJA 3GTLJ 2Q24A 3ZQGA 1WHUA 2E2IJ 2M1BA 3AQSA 3GW2A 3ABKH 4MIMA 4CCJA 5HDKA 3CZ6A 2K7LA 3RH2A 2CQNA 5HODA 1EH8A 3P5JA 3GZNB 4CGRA 1CGPA 4CICA 4PJMA 2O9LA 4BL0B 3V8KA 3QKXA 1UJ8A 3VSLA 4KDPA 3OYBA 2HQRA 2HFHA 1V54H 1TTYA 2B9SA 1MBGA 2E71A 5GAHJ 1S7AA 3JRIA 1BL0A 2BY0A 4A93J 1J9IA 2H09A 1Y39A 5F6FA 1VFCA 1LVKA 2VONA 1LB2A 2W85A 1BIBA 1YE9A 4P9FA 3H0DA 1JJ8C 4P96A 5K7HA 3RQ4A 3H9GA 2LG4A 4IL6C 3U1KA 1F36A 4DIQA 3K69A 1VTNC 2M8GX 1ZLJA 1QO0D 5IYDJ 2X6WA 4MO7A 2YPRA 4IOCF 3CMAI 3KZIC 4ENJA 2VQGA 4XSXF 2DG7A 3K0LA 1YQAA 4Y7NJ 2BY2A 3OR2C 4Z2YA 5CKTA 3T1BA 2QLZA 2R5ZB 2XAGA 5BNGA 1B9NA 2H6BA 2K9QA 2EB7A 2OQGA 1FJLA 3S3MA 1DU6A 2MC3A 4M3GA 5M3FJ 2VKHA 4OU0A 4PJ0C 4W97A 2J5OA 3DU6A 2X1DA 5E1ZB 4ZDLA 3UR3C 4EJWA 1RNLA 2AO9A 2DMQA 3JSPA 1ZQ3P 2JA8J 3KP3A 5LGUA 2UZKA 4N4NB 2GAUA 2DOAA 1V4RA 2FA5A 2HDWA 1FYMA 1LEAA 2HOSA 5K58A 1P9QC 1ONVA 2DO7A 4U88A 4I01A 2JQ7A 4XKWA 5B1AH 2W25A 3HOTA 2AS5F 4GCTA 4M6VA 5FROA 2EIMH 5IYCJ 3C2GA 4HQEA 3CCSI 1D8KA 4UUSA 4E7SA 4BHBA 3SDGA 3NAUA 2PJPA 2E1OA 2EK5A 5DCMA 1Z0XA 2JSCA 4HX4A 5FGLA 3HRUA 5JLWA 2JA6J 2MA3A 2DYSH 1XSDA 3CCRI 2DU9A 2DG8A 1UHMA 1RI7A 1VQ7I 3BQZA 2CMPA 2JJ7A 4KIFA 2G9WA 2HEOA 2GENA 5D6EA 1OPCA 1M1EB 2MH2A 4BDYA 4EJUA 2TRTA 2QKMB 4X1EA 2RC4A 1APLC 3FISA 1D0ZA 5F0HA 2YVHA 4QWQA 3HTHA 1N75A 4KYWA 2W48A 4F55A 2M0CA 1IN6A 3CJDA 1IO2A 4BUPA 4S04A 4UY8I 2XSDC 3DQVC 4EQQA 2ZSHB 1WKMA 2JN6A 4HNVA 2WWYA 3IP4B 2LVSA 3KYCB 5KNLA 1W5SA 2D45A 2W00A 2VLAA 4LLNA 2GFNA 2KJCA 4BS9A 3JSJA 5KCMA 1FP1D 3G71I 3LNQA 4AIDA 1U8BA 2O5RA 1MDMB 4JBAA 4EM0B 3N97A 3DPUA 3BCGA 3WHBA 3IKVA 1ZRDA 2EV5A 2FSWA 3PIOF 1S6LA 5FRMA 4AYBA 2QTQA 2FX0A 2W24A 1HKSA 3V8JA 3I71A 3I56I 1I1SA 2QBYB 2CU7A 5FO5A 1TLHB 2A5YB 3M4OJ 1W7PB 5BPDA 4YEJA 1LUJB 1XSVA 4BBRJ 1KQ8A 2PBXA 3RSNA 4NN1A 1F4KA 3N05A 3IV5A 3ZGKA 2XGCA 4M3DA 1ZG3A 2CV2A 1KU3A 1EJ9A 2ETHA 1KU9A 3H3UA 3L2CA 2DYRH 2A68F 3OS2A 3K70D 3QPTA 3AG3H 2CUEA 1IN8A 5HVQC 5HS7A 2DMPA 1K79A 1F5TA 3CDHA 3S3NA 3CP2A 1P6RA 5F1RA 2MBFA 4F7ZA 2H1LA 3CJRB 3GTGJ 5GAGJ 2H27A 4RGUA 5H2FC 3BR5A 4RAFA 4OMYA 2B3WA 2IEKA 1OCRH 5DUKA 3MFKA 3QQAA 4RDUA 2R7WA 1AKHA 4L9TA 4HAMA 2XF6A 2M87A 3WTXC 3PASA 3QAHA 2QOPA 3PJRA 1IXRC 1T56A 2EIKH 4ON0A 3P9KA 2D5VA 4Y13A 4MGRA 4FCYA 5F27A 4P1WA 4FETA 4XLEA 4BGDA 3MKWB 5L3CA 3QP5A 1YJ9I 2HKXA 4LD5A 2M34A 1O3SA 4G7OF 3I59B 2LOOA 1P92A 3I54A 4RB2C 3OY9A 4B8XA 1WJFA 3LSPA 3L09A 5F04A 2IT0A 2DT6A 3BR0A 5F64A 2R7SA 2F6CA 3LSHA 1ON1A 4DYRA 1IGNA 2QGUA 5D5VB 1XN7A 1X1PA 1BR4A 4B48A 3HZJA 5B5EC 2MD5A 3S32A 2HYGD 1GT0C 1DGWY 2BXZA 4L9JA 4B47A 1FSEA 4GXOA 4L5JA 1IDZA 4LLGF 3AG1H 2VOOA 3NEUA 3SEZA 2TDXA 1MBKA 1R1TA 2JTVA 2ZOZA 1T2KA 3ZQCA 5C4YA 1H0MA 2V1DA 1YG2A 3SHFA 1QVTA 4MEYF 2IW5A 4ICHA 3PFYA 1YTYA 1Z9CA 3HE0A 1I5ZA 2CFXA 2KRCA 1P4AA 5EGOA 1U9OA 5E18F 2IS4A 2EIJH 4UUTA 1YS6A 1X1CA 1BN5A 4ZDOA 3CCQI 2CV1A 4BYYA 4E7ZA 3OS1A 2MC4A 4ABZA 3F1BA 3CC2I 3VUQA 4GCVA 4EGZA 5KHDA 3VW2A 5D8LB 3SXYA 4RAYA 1IDYA 2JPCA 2KQRA 2E60A 2F4OB 2XGXA 4HG2A 3DTIA 2L5QA 3GEUA 1G4DA 1VZ0A 4ZYDA 3RZOJ 3FMQA 4UVCA 5E79C 4BY7J 2B1EA 3MCZA 5GPAA 2RAEA 1HA8A 3DTKA 3KZ9A 2GIVA 4UV8A 2RN7A 4II2A 2R3SA 2Y75A 2EZHA 3JTHA 2CWEA 1JT0A 4XNFA 3CCEI 1S7EA 2FXAA 4DZPA 2REKA 2A2FX 5HS8A 2FNPA 3BCAA 1SFUA 2R7XA 2VBWA 3B6CA 1LPQA 2VODA 3KE2A 4XQFA 5F0CA 3E7QA 2EQRA 4XLAA 2L01A 3HOSA 4RLFA 1O7LA 2XHKA 2FQ4A 5F0FA 1OCPA 1A36A 3H92A 3HIFA 2G7GA 4N0BA 3DEUA 3FDYA 3REOA 1RR8C 3T5XA 3VYUB 2BYVE 1TC3C 3WTSC 3CMYA 2FOKA 4DGWB 3CQZJ 5JI6A 2E7WA 3PSIA 1YO5C 1H9GA 3PQJA 2HQAA 2Q2EB 4A3IJ 1E17A 1EH7A 3V7SA 3S17J 2ZO4A 1C0WA 4N9HA 5HLGA 1WI3A 1SFXA 2HVSA 1WJCA 2UXNA 1J09A 1HXDA 4BE1A 2JWTA 2OCCH 2R7QA 4FX4A 1UG2A 2MGQA 4Z6YA 3J81K 5BMZA 3DPTA 3LFKA 3ABUA 2VJJA 1ETOA 1Y1VJ 3HPHA 4CYDA 4HNTA 2A6HF 4B44A 5EF6A 4ZYEA 1Y1WJ 2R7VA 3J80Z 1MNMC 2WY7Q 2OF7A 1UMQA 4LIVA 5JR3A 2ZKZA 3ABMH 2QYOA 5J3LA 5E17F 3BR3A 3ESWB 1ETYA 4NUBA 1R4NB 3WG9A 2OZUA 5KAIC 1A35A 2QKOA 1KONA 3DPJA 2GA2A 4G7ZF 3W2VA 3GMEA 2D1VA 1T33A 5L3FA 4L5EA 3JSOA 2GBYA 3VYSB 2HOTA 3PNTA 2QA4I 2M3AA 3TOAA 3OYHA 2KL4A 4O3MA 1BOBA 1NG7A 3CESA 1IW7F 1XB4A 2CG4A 2JMWA 4I7HA 2VN2A 4PUSA 4CSWA 5TISC 3SQNA 2DA4A 2JT1A 1ETVA 2BE5F 1XC5A 3S1NJ 3HKZN 1U5TA 1SVOA 1W4MA 3JREA 5IP6A 1HOMA 1R1VA 4EATA 4M3BA 4X6AJ 4N4OB 2NRAC 3ZRGA 1JGGA 4MNUA 4FASD 3BOQA 4OIQF 4NHJA 4BHPA 2E35A 4M74A 3NNRA 4NC6A 2F5EA 1O57A 2AXTC 2PBIA 3PM1A 3PNYA 3QPLA 5DCFA 3LMMA 2NXNB 5IP7J 4RGRA 4IQJA 1WH5A 3L2RA 2W82A 1X3ZB 2BW3A 3COLA 1VQLI 3BZCA 3LFUA 3CO7C 1ZR2A 1K78B 2OC6A 1AHDP 3F8FA 3ROUA 2RV8A 3HRTA 1TT5B 1T95A 2OJED 4XL9A 3M8EA 2M8EA 4C30A 1OKRA 1KQ0A 2VOPA 3FXMA 1UELB 2K9LA 1Q1VA 1BA5A 3OYCA 4HF0A 4XKVA 1V5EA 1T38A 3GTQJ 3FXLA 4G7HF 2V1XA 4GCLA 3W2WA 3I53A 3PUBA 1LQ1A 3W6KB 1SMTA 5LHIA 2ZMEB 4QTRA 1L0OC 1QZYA 2A5WA 5LRRA 4BJ6C 2QSFX 4YIRX 1B8IB 5BS6A 3LA2A 5ICFA 4BHCA 4OIRF 3LWFA 3ZQFA 5HNFA 2C6YA 4O5VA 3GTMJ 4RLQA 1IV8A 2QSGX 4IX7A 2OCEA 2F5FA 1WQ2A 1U3EM 1TW3A 3TGNA 3FZVA 4QSHA 3LSKA 1JGSA 4AIHA 4KN4X 4KIBA 4NC8A 5IP9J 1I1GA 3BTIA 5EG0B 3M8JA 5DV5A 2BHZA 1WJAA 2O6GE 2O8XA 3TL4X 5GPCA 5DUIA 2EFQA 3LSIA 3FKIJ 2HKOA 1IN7A 2R92J 2M9HA 3BZKA 3ZOBA 1MNEA 3OYJA 3WGIA 4JX4A 1NK3P 5CVJA 4L5IA 2CJJA 4BAYA 1VQ4I 4JQFA 4W1UA 2Z1DA 4D1QA 3RJPA 1X4OA 4A2UA 2VC1A 4B4CA 4EJVA 2IU5A 2MABA 1EH6A 3TO9A 4YFKF 1HF0A 5HSZA 1CF7B 3LSRA 2BOLA 2WA0A 5LBQA 2Z16A 3H9JA 3AAFA 2O7TA 4PSXA 1FC3A 2EA4A 4CUGA 4WX9A 2B7EA 1X1BA 2VPRA 4ZYAA 2HGCA 2DA1A 3HPGA 4XLHA 4FT8A 3U2RA 3SJMA 1O3TA 1EF4A 1V55H 5HBUA 1S8NA 1MIJA 2KIMA 3NWTA 2KLOA 2QIBA 1IF1A 3IH3A 2Q0OA 4S0HB 5E3NA 1OISA 4M6XA 4XN3A 2RVCA 2P6TA 1IRZA 1G59A 1P2FA 4IXAA 2FBIA 3RKQA 3TO6A 4AF5A 1IC8A 2CUZA 5AQCA 1T98A 4CXFA 5E1XA 5D4RA 1QQIA 2JRTA 2H8RA 1R7JA 1D0XA 3HXLA 2OI8A 2WUIA 1TW2A 4C3HJ 2X85A 1JHFA 3MNLA 2DQRA 2L4AA 1R5HA 3IRRA 1FOXA 1POGA 1J5YA 4NC7A 5KK1A 2RHAA 2KIFA 2GOMA 2JPBA 5J40A 1J7KA 4G6DA 4ZC3A 3WU2C 5M5XJ 3JRDA 3S2DJ 4XOTA 3HOZJ 2MLKA 3FIWA 5GP9A 5KVRA 3IC7A 1S72I 2UXOA 5HOOA 1JHHA 4K2EA 4X0GA 3WU1B 3L00A 2KJBA 3S1QJ 2UXHA 3RIRA 4OINF 2XIGA 3SYTA 1SVMA 1EA3A 2PLYA 4WXHA 3DU5A 2NS7A 1P7IA 5LEKA 2IP2A 3JRAA 2K86A 4OWRB 1QPIA 1XMAA 4JL3A 3NXCA 2EWNA 1USSA 2G7HA 1BM9A 2PQ8A 1ZR4A 2DPUA 1F1ZA 1MZBA 4HQMA 1U5TC 3H5RA 2R5ZA 4LK0F 3U21A 4ZYGA 2FD5A 3RPUA 1JJ6C 5EFYA 3DEEA 1D1BA 4HLXA 5LFAA 2NNNA 2LK2A 1VQKI 3E7LA 2YSRA 4B09A 1FOKA 3S5RA 1BW6A 3V8LA 1UG0A 2L7ZA 1BOAA 5DS9A 3CCVI 4C2UA 2XASA 3HBLA 1BIAA 4HOBA 4UB8C 5ICGA 2JK3A 4HV6A 3KNWA 1S3JA 4A3KJ 2HPMA 3OR1C 3RQIA 1G3WA 1ETKA 5ILSA 1D1CA 2ZJ2A 4OD5A 2K3PA 4E7LA 1QVUA 2L2OA 2NP5A 4P9UA 2O61A 3H35A 4C3JJ 2VXDA 2CQXA 1W7PD 2B0LA 5J4YA 3FK7A 3WG7H 5A2QK 4A5NA 4IEJA 4CH7A 5KAFC 1HDDC 4BDZA 2EFOA 4A5MA 2RASA 1HW5A 2EILH 5DM7F 3VW1A 1JT6A 2O8KA 1T6SA 4QPQA 2FJ1A 3C1DA 2IRFG 2YS9A 2KIQA 2FQ3A 2MD0A 3SZTA 1DP7P 2ZY9A 1TWFJ 1UB9A 3IH4A 1G3SA 1ZG1A 3BG7A 2DTRA 4WWCA 2ACJA 3F6OA 2HVRA 3LOCA 3MEXA 2CYYA 4XRSA 4TV7A 1SD5A 1T0FA 2ZJRF 5EEHA 2WAFA 1JI8A 3BDDA 1REPC 1FBSA 1ETXA 1X2NA 5CVVA 3BHQA 1ZRCA 2P8TA 5E8GA 2NVUB 4R1HA 1OYWA 2VI6A 3WTUC 2VE8A 3MKLA 3VOXA 2DDAA 2F4IA 3S1RJ 3KZYA 2ELJA 4PCQA 5LHGA 1K4SA 4JKZA 3J7ZI 3VDXA 3Q5FA 2R7RA 3CUQB 3HTUA 4E7IA 3WTZA 3HOVJ 1HC8A 3WODF 3ZMTA 1X19A 4JX5A 4XM3A 2JA5J 1ITYA 3C18A 5FKLA 1G3TA 3FRQA 3LJLA 1DP3A 3ASNH 4HV5A 4M6YA 1MDMA 5LGNA 3K1NA 2Z9OA 2NVQJ 1P4WA 3M8FA 5FMPA 2GXGA 4ZYHA 5D1RA 5J47A 2MFZA 2XAHA 3ABLH 5F1JA 1XSXA 4CHUA 1Z67A 5K7FA 3CD6I 4BXXJ 3GTPJ 2LY2A 3R60A 4LMYA 2QBYA 4E70A 2ZJQF 2CSOA 2DMTA 1PUFB 4H0EA 1DU0A 3U9GA 1ZG5A 1W7PA 2DK5A 2RNGA 3KEOA 1YW9A 5JHUA 4XRMA 2ZSIB 2ICWG 4KT6A 3AL0C 3BJAA 5DDGA 4DZJA 1D1AA 1IN5A 1BC8C 2XKPA 3I55I 2EFPA 4G12A 1JUPA 4RB3C 1PDNC 3OYAA 2RQPA 2YVXA 4IOAF 5H20A 1HKTA 3HOXJ 1F9NA 3WGGA 1AU7A 5LLQA 5FLMJ 4DVYP 4WCGA 3H0GJ 4XOPA 4IHYA 2L0KA 3F8CA 4PGHA 2R7UA 4AC6A 1UFMA 1VQPI 3TBIA 4GYGA 1MBHA 2HNHA 5E8IA 3ERMA 3HOWJ 4Q48A 4AVZA 2LREA 3QWLA 3ZQHA 2MG4A 4JK1X 3BTLA 2DJIA 3K2ZA 5E3OA 2F2EA 2LKSA 2O3FA 3A0BC 1CQTA 2NVXJ 2IGKA 4NELA 2M7AA 1XCVA 1WSUA 2DQLA 3EQLF 3FXRA 3CDLA 4EMSA 4RA2A 4HX8A 1TQIA 2K85A 2LMDA 4AU7A 4GFKA 4UHTA 3DBLB 3H3VK 4G8XA 1FY7A 1A6IA 3M9AA 2E19A 1SMYF 1GV2A 2R7DA 4G6TB 1FNNA 5K5OA 2GOXB 3I59A 4RGSA 5CPRB 4C2MJ 4QPOA 1EV7A 2JZYA 2HQNA 4OIPF 3VYTB 1P7JA 2DOEA 3QYEA 4OAYA 2XROA 2I5UA 1LNWA 1V5GA 2VKDA 5EYRA 2YVEA 3OYLA 4KN7X 1H8AC 3K8PC 3RZDJ 2ID3A 2Y9YA 4I76A 5EZHA 1K6OA 1YIOA 4UB6C 3HSRA 3D0SA 4BJ5C 3DKYA 1MSEC 2A6TA 2TCTA 3ONQA 4RS8A 2L4MA 4ZZDA 1WJ5A 3CP8A 3OYIA 1HW2A 3VVYA 2KZVA 3J80K 1Z7LA 2OTLI 1IAWA 2Y0SN 2KHMA 4M9XA 1VNDA 2WAQA 4IZZA 4BQAA 3BG3A 2DXIA 1D3YA 3W2AA 1WJBA 1QZZA 4UV9A 1KZHA 1YRNB 3BT9A 3EUAA 5K7ZA 1MKMA 4HSTA 1J59A 5DM6F 1FMWA 2M5WA 2DFEA 5TJJA 1ZRFA 3HGGA 2D1HA 2PFVA 2VT3A 3Q0VA 4A3GJ 2VQCA 2WTEA 3BC8A 4ESFA 4A3MJ 2PN6A 2PMZA 3CCJI 1SFOJ 2STWA 3KPHA 2X1EA 5A2QZ 1R22A 1K61A 4LJZF 1RPWA 1F43A 2KRFA 2L54A 4A3JJ 3IKTA 4KISA 2KZGA 4KJZA 5J6XA 4EJOA 3V4GA 5L3DA 2MSYA 4EGYA 3H5AA 4DYQA 2PFBA 3B81A 2CUJA 5GADJ 1RIOH 3P9IA 2LDUA 1EKEA 2UUZA 1UCRA 5ILVA 1T0FC 3ERED 4LITA 4RM2A 4HKUA 4U7BA 3WGHA 3VIBA 5FKOA 3K7AJ 5CQGA 3LAJA 1H88C 4AD9A 2LLKA 4HDUA 1TZLA 2ZNYA 3RCOA 3JAMZ 2RNJA 4Q5SF 1X4PA 1QNTA 3GF2A 5CVRA 2OERA 3IWZA 1YOVB 2X0LA 2HOAA 3CMEI 4CYCA 4QLCU 3LQQA 2E1MB 2OPTA 3ABTA 1RKTA 3HJEA 3ZMUA 1W1WE 2ZJPF 2GZWA 1YJWI 1FTZA 2VJIA 4LLLA 3AG4H 3EYYA 2L7KA 1Z05A 4A69C 4L0ZB 2L9VA 2FOWA 5K5QA 5FJ8J 4PGGA 3A0HC 2Q2EA 5GAEJ 2XDNA 2XRNA 1S5LC 2HDCA 2ISZA 1A31A 3ANGA 2VL8A 3LQRA 2BVMA 3I9V2 4B43A 3K9TA 4D7MA 2GIZA 3ZMVA 3J7AY 4AWXB 1RETA 3ZMDA 4YELA 1I27A 2BGCA 3K4JA 5HLTA 1MMSA 2DA2A 3F9KA 4FHTA 3MKYB 3JTGA 2GXBA 1I6HJ 3HHHA 3G3ZA 1HSJA 1QHGA 5ILUA 2VE9A 5J1YA 3GFJA 4LFUA 2K9MA 2OUMA 2KIUA 1GXQA 4B1RA 4CCMA 1OCTC 4I09A 2Z2SB 2LKXA 1DQUA 3ZP5A 1FEXA 3HRMA 4HBLA 4IRGA 3PIPF 3U1DA 1RUNA 5IT9Z 4RAZA 2X51A 3DKXA 4Y4RA 3ZN1A 4S05A 3CJNA 4H4KC 5IOZA 1MSFC 2IGOA 3S8PA 2DJNA 1I3AA 4BKXA 2BBYA 3FBIB 3IH2A 3G4SI 2ZCWA 2NP3A 3CDIA 1H9TA 4MLOA 3RD3A 2DT7B 5LD2C 1MJBA 2LBFB 2JA2A 3WE2A 1D5VA 4FX0A 5E20A 1GXPA 3SWHA 3KIOA 3E97A 4UVAA 4XRSG 4D5CA 4R79A 1T08B 2QQAA 5FKMA 2Z5UA 2KISA 1IJWC 3BPXA 1FBQA 1G8XA 3TO7A 1B72B 3RKXA 1OMIA 2JUCA 4XN0A 1NK2P 5DYMA 3BY6A 2KDOA 4BXUA 3JRCA 2CO5A 1MBJA 3HKZA 5B3SH 5D18A 3BTCA 3IAS2 4MTEA 4ESBA 1R6RA 3LWJA 3BR1A 3QPHA 5JHFA 1QU3A 2QEXI 1HBXG 3G2BA 4BQOA 5ICEA 3HOYJ 2GM4A 1VQOI 1ZK8A 5LRSA 3SDBA 2QWWA 2ZCXA 2LF7A 3DXJF 3ECHA 4ENKA 3LSGA 3KKCA 1K78A 3BLYA 1FP2A 3MMYB 4HRIA 1X1AA 1ERDA 1QRYA 1I6XA 1UHWA 2Q1ZB 2X1CA 4RAGA 2F5CA 4CCNA 5IT3A 4MTDA 5M5WJ 2IS6A 4GFLA 1ZTRA 3Q0WA 3F8MA 4WF2A 5JFRA 5D6FA 2BY1A 2HZTA 3KEQA 1ZN2A 2A3SA 1SD7A 1Z3XA 2JVHA 4Y3OA 3BQYA 5C4XJ 1MMGA 2NNYA 3ZMSA 4P5OA 2H6CA 5DTDA 5HNHA 2HTJA 5EGOB 1KU2A 1XMXA 2ZMEA 5B66C 2H1KA 1B8IA 1ZREA 4EVIA 4KIGA 2HYJA 2Z3YA 3RKYA 3OYEA 1AOYA 2KP6A 4PFOA 4YFXF 4IJAA 5CXGA 1KYZA 2HVQA 3CTAA 5EJCA 3MWMA 1V5FA 1W0UA 3ML6A 3VFZA 1JE8A 4BBSJ 2E2HJ 2JVGA 1SD6A 2LP0A 1FIPA 2V26A 2W84A 1UHSA 3OV8A 5LGTA 2ZCMA 3DP7A 4PZJA 2UXUA 2E1NA 4IQ4A 3F72A 4DOZA 3TKYA 1GV5A 5EG0A 3S2WA 3S2HJ 4I2OA 2L9SA 3G1OA 4CCKA 2NAZA 1G6NA 4RB1A 1XG1A 2XAUA 4U0WA 1B4AA 2FEZA 4XK4A 4ZDPA 2UXPA 2DFFA 3PSFA 1MW7A 3BWGA 4WK8F 2Z33A 2MLGA 1XX5A 2FF4A 3WTVC 3ANPA 3G7RA 1ZHFA 2ECCA 5L3GA 5CW8A 2VBXA 4XLCA 1YFHA 3TW6A 2R5YB 2L7MP 1OQYA 2VT2A 1FYLA 3F22A 2KMUA 4XSZF 1MD0A 1VF9A 4FE4A 3T8TA 3V42A 2Y9ZA 4ESJA 4ZTFA 1U9NA 3GLXA 4MFDA 3D1NI 1J0RA 1CF7A 1D8JA 1AA7A 2XF7A 5D5WB 1RUOA 1VQ6I 3E6MA 1VQ8I 2FMLA 3EPZA 3OYKA 1LVAA 3I58A 3FHZA 3F23A 3AKZA 3X2QH 2HXIA 1KU7A 4I02A 1R5GA 3SZPA 4BE0A 1YS7A 4JOMA 4CZZA 4U7DA 1LJ9A 2V4JC 2GUHA 1UAAA 2FJI1 4F93B 2UXXA 4YIFA 2LSOA 4EM1A 5C44J 3HOUJ 2W53A 2ZOYA 3CC7I 3TQNA 2CS3A 2K9NA 3F0CA 2G7SA 2L3DA 2QQ9A 2EPFA 4ZTJA 1GHCA 4GCKA 2I8DA 1N78A 2HDDA 2COBA 3IWFA 2HKUA 3BR2A 4LB6B 4ZZLA 3PL8A 1TQMA 2EZKA 2MYSA 1H89C 1WWXA 2R7TA 1SD4A 1FOYA 3S15J 3VTIA 4C3IJ 4FTHA 2WB1N 2RGVA 2ELHA 3LL7A 4HEA2 5D4SA 3FX3A 4JP0A 3PQKA 2X4HA 4J19A 1WCMJ 2V9VA 3GCMA 4KMUX 2P5LC 2P5VA 4E7KA 1YIJI 2ZCNA 4J00A 2WY8Q 4L0YB 2ESHA 4XORA 4C9YA 4XR6A 4QIWN 3CJTB 2EZIA 4LG0B 2IA1A 1O4XA 2IVMA 1GLNA 1Z91A 3VYRB 4A3CJ 3O8HA 1JKOC 5DD4A 2LTPA 4UDSA 3M1EA 3E5XA 2D6YA 3E3VA 3OSGA 2ECBA 2RKHA 3W3CA 3T8RA 3RDIA 4KA4A 1BI0A 4CDGA 3JRFA 3JRHA 5FGMA 3ECOA 4HA8A 1XMKA 1K7AA 4F91B 1LE8B 3JR9A 1Y0UA 1U5TB 2PMUA 4BE2A 2WBMA 1S9HA 5FD6A 2RDPA 3NS4A 1O7FA 1Z3YA 4MK6A 5C4JJ 3H9QA 2XF5A 2D2WA 3RPUD 2PI0A 5E3LA 1TNSA 2P0WA 2XRLA 2COMA 1MNDA 3KCCA 1DDNA 2CV0A 2BHYA 1IUFA 3A1YA 3O3KA 2PJRB 2ZXWH 3GWZA 1TBXA 2XC7A 1HQCA 2XPUA 3BR6A 3P9CA 4CCLA 5CVIA 2VXZA 4Y17A 1LKXA 4WXDA 5M3MJ 5JLXA 4V19K 1MH4A 1D5YA 4IHSA 3FMRA 3IL2A 5CVUA 4DJAA 2KKOA 4L9VA 5J4VA 4ETSA 4JNNA 5D19A 2IA2A 2LKPA 4JX6A 4IRVA 3G56A 2EV0A 3TDUC 5LEJA 4MEXF 3CF2A 4BH9A 1E3OC 4ASNA 3I3LA 3QOPA 4E7HA 4XLFA 2HYFA 3FXOA 2V6EA 4YG2F 3DLAA 1TT0A 2KRHA 2M7BA 2ZMEC 2JSPA 1TWAJ 2K4BA 3BCBA 2CFOA 3E1SA 2M4GA 1ON2A 1SANA 1FWZA 3FMSA 1I39A 3MN2A 3FK6A 2Y30A 5E3MA 3WE3A 2L9RA 1YX5A 3EUPA 1BI3A 4UVBA 2G3BA 5H6RA 4CO8A 2EBIA 3CUQA 1IG7A 1MBFA 1VQMI 3NQOA 1U2WA 3DF8A 2LD5A 2CGPA 4XIDA 1FIAA 4BEHB 3ON4A 4ZH4F 2PMHA 4PJJA 3DKWA 3VVXA 2F4MB 4C2MA 2BEOA 5FFXA 2VC0A 4F92B 3JRGA 1YW8A 3FWEA 3C07A 3L2UA 3VODA 1OCZH 3IHUA 3G73A 3IUVA 4OAZA 3CF5F 2LH9A 1J75A 3HUGB 2EJRA 1VQNI 4AC0A 1WVRA 1R1UA 5J8CA 1STZA 1PUFA 3VW0A 2VB6A 4I98B 4DBRA 1R58A 2ISYA 3KLNA 2V79A 4UXNA 2BZTA 2HR3A 1GUUA 3CCYA 1X3WB 3T6NA 1FTTA 3M3YJ 4U0VA 4U0YA 2F07A 5EEAA 4IPAA 3P9TA 4A0XA 2EA2A 3DTEA 2HXOA 3UKGA 4NQWB 1OLTA 1NTCA 3GVAA 4D0PA 1XGNA 1R71A 1YX3A 3F8NA 3BJBA 3AG2H 2FBKA 3HL2A 1X3UA 1PUEE 4ME9A 4L62A 1OR7A 1OYIA 2ZFWA 1Q1HA 4UNOA 2DA7A 1QZEA 1E0EA 2OBPA 1DUXC 5J8FA 3C2HA 5J1UA 3IAM2 3PUFA 5JVGF 4LIUA 1R49A 1UI5A 3JAMK 2WAEA 4JYKA 5L3EA 2XB0X 3OYFA 3HSFA 4RM3A 3I4MJ 1RR7A 3R61A 2E36A 1OYYA 4PK4A 3VB2A 2Y0MA 5FKKA 2VQLA 3QRFF 3J7YJ 2Q8KA 3KX2A 3L2QA 4MFEA 3D5RC 2FMYA 3R6SA 4NBQA 2ELKA 2DDBA 1MMDA 2L7FP 1WZ2A 4Y33A 4KWAA 2QKLB 1K6YA 3OOUA 4LK1F 2XPWA 3KP2A 4V2GA 1XTAA 3DWLE 4D7NA 1JKRC 1ZH5A 3TDZC 4M9ZA 3L2WA 3I64A 2GXAA 3CMMA 1MMAA 5BOXA 2KT0A 1KQ9A 1J2XA 1FOWA 4M73A 2BVLA 3PO3J 3OS0A 2V6CA 3ZN0A 2VKEA 3MAJA 2K02A 5H9TA 3BROA 3F3XA 3GYHX 2QF7A 2DI3A 2LYCA 5ERIA 3HTSB 4N9IA 5J1RA 2VASA 1MH3A 3G1LA 3HEFA 2HYTA 4HDVA 2JRMA 3KYDB 5EZGA 3A01B 4A0YA 3HTIA 3N4MA 1LFBA 1YJNI 3IRQA 1UZCA 2CRGA 1YLFA 2QQBA 3SEQA 1QA6A 3TP3A 3CJQB 1YRNA 5IT9K 4KMFA 3Q9SA 5D5XB 2R7ZJ 3VSKA 2I10A 4IO9F 4MQVA 2Y0SA 4HF2A 4C2TA 2DK8A 2NS8A 2UWMA 3LSTA 4HYEA 5D5UB 3GZIA 2NOJB 3V6GA 4A12A 1XDUA 1SAXA 2DA6A 1Z1DA 2ESNA 1R00A 2K27A 2L02A 5AONA 5JVTA 2V57A 3A02A 2A61A 1PP7U 4PFPA 4GDFA 4MQ9F 3JW4A 1DPUA 2Z99A 3LA7A 3ZXSA 1XCBA 1XS9A 3BP8A 1TWGJ 1RRJA 2DN0A 2WC2A 3DV8A 2HWVA 4A0ZA 3M07A 1WI9A 2R7FA 1T39A 2X6XA 3QYBA 2XKOA 2DLLA 4F3QA 2CQ7A 2OAZA 4HZFA 3ZQIA 4BY1J 2R93J 1TL8A 3FKJA 3OL4A 5HDNA 1BBYA 2ZFUA 3CRJA 1JUSA 5EDNA 1ETWA 2Y2ZA 4IVNA 4B3XA 3EUKL 1ACIA 3CUQC 3ASOH 1SFKA 3OOPA 2RQQA 3FXKA 3K1MA 2IGMA 2IPQX 4G9YA 4BQQA 3RKWA 1L3LA 4FE7A 3GFMA 1FT9A 2P4WA 4DBQA 3KETA 2IS1A 5LHHA 1U8RA 3ISPA 1LDKB 1TWCJ 1IRFA 2XAFA 2NVYJ 3JCUC 3RPQA 3OYDA 3FXQA 4KICA 5L3BA 3ELKA 1W36C 3L7WA 5HLIA 3GO5A 3PNVA 2G0EA 3WHCA 2FBHA 3K4MA 3Q0UA 3GZ5A 4U9LA 4M3EA 4XBFA 3E5UA 3NI7A 5EEGA 4E7JA 5CXIA 1IZ1A 4DNCA 2CW8A 2XAJA 5K1YA 1FLIA 1Y56A 3CCLI 1W5CC 3WU0A 4DYCA 1YYVA 4BNCA 2UV1A 2VPLA 1WRJA 4UUSB 5DCMB 2PEXA 1HDPA 2ZNZA 3OIPA 3MVPA 1FMVA 2V1NA 2K4JA 1TQPA 3L1PA 4GFBA 1HKQA 4Q4ZF 1XGMA 3QOEA 2DOFA 1I50J 2DPDA 2YX4A 2K5CA 3S16J 3HGYA 3HG9A 2X48A 1PYVA 3EDPA 1TWHJ 2P81A 1BJZA 4U87A 3I4PA 4BU2A 4A3EJ 4A6DA 1IV6A 1RC9A 1OR7C 4I0BA 1VQ5I 1T8IA 3BG6A 1USTA 5FHPA 3KLOA 4NNJA 1TNTA 2DA5A 2VJ5A 5FRNA 3OIOA 3KFWX 2DMNA 2KDZA 5B1BH 3A03A 5TRDA 3CUOA 1FZPB 3TEDA 1MBEA 5AIPA 2LBFA 4HW0A 2VBZA 5AIQA 3TOBA 4YRVA 3LHQA 5DD8A 3CO6C 3SZGA 3TP0A 2R7OA 1VQ9I 1PJRA 3FM5A 3FBNB 1ZLKA 4MHGA 2PX9A 3H36A 4RGXA 2FBQA 4LOCA 1B72A 2K40A 2XPVA 2FE3A 1FSHA 3OL3A 4BQNA 2LF8A 3GUDA 2WGBA 2RREA 3HM5A 4Q47A 3HC7A 4AYBN 1JTXA 4L18B 2B63J 3K4LA 4IHTA 2CUFA 1Z6RA 2W7NA 5HDGA 3FM3A 4BACA 1SEUA 3OYMA 2M45A 3KP7A 3HDDA 3WTYC 4EJTA 1JUMA 3GTOJ 2OQRA 5HAWA 1FYKA 4M3FA 2WAQN 3QPSA 3AFHA 2OA4A 3KP5A 2DT5A 4V2FA 1RESA 3W6JB 1JXSA 3F8BA 3ZQQA 2VIXA 3HB9A 4D5FA 2V1UA 2DMUA 3BG9A 1XGOA 2ZXIA 4HNUA 2GWRA 3OYNA 3DBRB 4EEFG 1O3QA 1P4XA 3T0YA 3V7RA 2LRDA 1R23A 5M5YJ 2CW0F 3Q3SA 3FHNA 1E2XA 4WIBA 5IPAA 1PP8F 2PMZN 3K4BA 1JTYA 3DPLC 2QQ8A 2K3FA 1S7OA 3LSJA 2X6OA 2QM3A 1A6QA 4E4HA 4II3A 1A5JA 2E34A 2EFWA 5HLHA 2V9PA 5FFZA 3O60A 3QODA 3LAPA 1LDDA 1AKHB 4XMYA 3V78A 2WV0A 2STTA 2QZ8A 2XAQA 4WXCA 4HSRA 2O03A 2EZLA 3OYGA 1XDSA 2HZDA 2M2EA 1YHQI 1ZYRF 2NVTJ 3ZMZA 2ZBKA 2PZ9A 5FLXK 2XUBA 3BG5A 4HPQA 3M7GA 2BY3A 3E0JB 2IBDA 1WGXA 4CA0A 1GDTA 4KNYA 2M30A 1Y0NA 2P5KA 1LFUP 3QU6A 1FBUA 3ZPLA 2LNBA 2XV4S 2OU2A 3L9FA 2K9SA 5FD5A 2LR8A 3GLLA 4PJLA 2R0QC 1E3PA 1LEBA 4A3BJ 1JKPC 2EINH 2QENA 2WADA 3O6BB 3I4NJ 3ZR8X 1IRXA 2GLOA 3H3ZA 1ORKA 3MKZA 2G7UA 4ANJA 4MXMA 2R5YA 4D9JA 1B1BA 1A04A 3GFLA 3GXOA 3OWTA 1KA8A 4CCOA 4CYCB 2DFIA 1VI0A 2E1MC 1HCRA 3KKDA 3CCUI 4HLYA 3M1CA 3B73A 4NDLA 2DTZA 4PDKA 1ODDA 1GVDA 3GTKJ 1BJAA 2YUSA 1O3RA 4LB5A 1DPRA 1K83J 3FXUA 1IRGA 3K2AA 5F08A 2LY1A 3S3OA
chains in the Genus database with same CATH topology
1ZKGA 3S1RJ 2IEKA 2XRLA 3SFIA 3QQAA 4RDUA 4JKZA 1UI6A 1AKHA 4FISA 1W0TA 3HOVJ 3PASA 1IUFA 4JX5A 2QOPA 2AHQA 2JA5J 1T56A 2XGDA 1ITYA 5FKLA 3LJLA 3FRQA 2D5VA 3BNIA 3DEWA 2NVQJ 2XPUA 4FCYA 5F27A 3BR6A 5FMPA 5D1RA 5M3MJ 5FLVA 5F1JA 5JLXA 1MH4A 2M34A 1D5YA 2ME0A 5K7FA 4BXXJ 3S1MJ 3GTPJ 1OJLA 2EH3A 1PUFB 3LSPA 3OSFA 2DMTA 5F04A 1DU0A 3VVZA 3BR0A 4JNNA 5D19A 4JX6A 4XRMA 4Y52J 3VP5A 3G56A 4DZJA 4DYRA 1IGNA 4G12A 1JUPA 1E3OC 3HOXJ 1AU7A 1GT0C 5FLMJ 2YU9J 3H0GJ 4IHYA 2L0KA 3HIMA 3GBGA 1TWAJ 1SGMA 4AC6A 1IDZA 1LE8A 2LFBA 3BRUA 2HI3A 1MBKA 1SANA 1MBHA 3MN2A 2ZOZA 3FK6A 3O8GA 2Y30A 3HOWJ 3ZQCA 5C4YA 5E3MA 2L9RA 3G1MA 3ZQHA 2MG4A 1QVTA 3EUPA 3BTLA 1JKQC 2VKVA 5E3OA 2G3BA 4ICHA 2EBIA 1IG7A 1CQTA 4A3DJ 2NVXJ 4A3LJ 1MBFA 3HE0A 2VUMJ 2LD5A 3QBMA 1RKWA 4NELA 5EGOA 4XIDA 1U9OA 1FIAA 3CDLA 3ON4A 4XICA 1X58A 4UUTA 3VVXA 4GFKA 1HLVA 3JRGA 3H3VK 9ANTA 4ABZA 3C07A 3F1BA 1A6IA 3VUQA 2E19A 1GV2A 3VW2A 3IUVA 1IDYA 4C2MJ 4AC0A 1PUFA 1P7JA 3VW0A 3GEUA 3RZOJ 5EYRA 1GUUA 4BY7J 2YVEA 3CCYA 5GPAA 3T6NA 2RAEA 1FTTA 3M3YJ 3KZ9A 5IYBJ 1H8AC 2F07A 3RZDJ 5EEAA 2ID3A 2Y9YA 4I76A 5EZHA 3P9TA 2EZHA 4DW6A 2QWTA 1JT0A 4ACIA 2N8GA 2HXOA 1OFCX 3UKGA 2XB5A 2TCTA 1S7EA 1MSEC 4DZPA 2JA7J 1NTCA 2REKA 2UXIA 3ON2A 4I6ZA 3B6CA 1ZGWA 3VVYA 5F0CA 1R9TJ 3BJBA 3E7QA 4IHXA 2EQRA 2Y0SN 4ME9A 1VNDA 3GTJJ 4L62A 3BG3A 3VPRA 3W6VA 5F0FA 2FQ4A 2DA7A 1OCPA 2G7LA 1YRNB 3DCFA 1BW5A 3BT9A 2G7GA 3CWRA 5K7ZA 5J1UA 1UI5A 1Z77A 2ZB9A 4PXIA 1TC3C 3HGGA 4JYKA 3CMYA 3CQZJ 3Q0VA 4B3AA 4A3GJ 2CQQA 2XB0X 3I4MJ 4A3MJ 1SFOJ 1RR7A 4A3IJ 1ETQA 3EGQA 4RBOA 5FKKA 3S17J 4A3FJ 2DA3A 1K61A 2X9DA 1WI3A 1RPWA 4MFEA 1F43A 2WV1A 2JWTA 4A3JJ 2ELKA 3PPBA 1WH7A 2L7FP 4AUXA 3NRGA 4KWAA 1UG2A 2MGQA 3OOUA 2XPWA 2MSYA 1ETOA 4V2GA 1JKRC 1Y1VJ 4D7NA 3S14J 4DYQA 3B81A 2MW8A 5EF6A 1Y1WJ 2KT0A 1MNMC 1X2MA 2OF7A 1UMQA 3PO3J 5J3LA 2VKEA 4HKUA 3VIBA 3BR3A 5FKOA 5H9TA 1ETYA 3K7AJ 2QF7A 1H88C 2QKOA 2LLKA 2ME6A 3DPJA 5J1RA 2E2JJ 1MH3A 1T33A 3G1LA 4L5EA 5C3EJ 2GBYA 5IOYA 3HEFA 1WPKA 2HOTA 2HYTA 5FKNA 3TW7A 2HQ5A 5EZGA 3A01B 2OERA 3HTIA 1LFBA 2HOAA 4CYCA 2CRGA 2JMWA 2O7OA 4YZEA 2OPTA 1RKTA 2XGEA 3TP3A 1YRNA 3B6AA 1FTZA 4IHVA 2R7ZJ 1ENHA 2I10A 2DA4A 1ETVA 3AQTA 1XC5A 2QCOA 1I3QJ 2NS8A 3HKZN 3JREA 3ZQLA 3S1NJ 4A69C 5IP6A 1HOMA 3GZIA 3V6GA 4M3BA 5FJ8J 3C2BA 4X6AJ 2DA6A 1JGGA 2XDNA 2ID6A 2V57A 3A02A 3NARA 3ANGA 2NX4A 3NNRA 4D7MA 3PM1A 3QPLA 1RETA 5IP7J 3NPIA 1XS9A 1WH5A 3VOKA 1TWGJ 2DA2A 2DN0A 1I6HJ 3COLA 1G2HA 2NOGA 1ZR2A 5J1YA 1AHDP 4IHWA 2IAIA 4B1RA 1OCTC 2LKXA 3PO2J 1FEXA 3ZQIA 3BTJA 5DAJA 1Q1VA 4BY1J 1BA5A 2R93J 3VOXA 5IOZA 1MSFC 3GTQJ 1U78A 3CRJA 4GCLA 2DJNA 4BKXA 1JUSA 3IH2A 2NP3A 5EDNA 3A01A 3JRBA 1ETWA 2Y2ZA 4MLOA 3RD3A 2Y31A 3HTAA 4QTRA 4FE7A 2LY9A 4XRSG 3HTJA 4D5CA 1B8IB 3ZQGA 3GTLJ 2Q24A 2E2IJ 5FKMA 3ZQFA 3AQSA 3GTMJ 4MIMA 1IJWC 1TWCJ 3RH2A 2NVYJ 1B72B 5HODA 4CGRA 1NK2P 3JRCA 2O9LA 1MBJA 4QSHA 5D18A 3BTCA 3QKXA 2G0EA 3WHCA 3Q0UA 3LWJA 3BR1A 4M3EA 3NI7A 5IP9J 5CXIA 3BTIA 5EG0B 3HOYJ 1MBGA 5GPCA 2GM4A 4DYCA 3JRIA 1BL0A 3FKIJ 1ZK8A 4A93J 2R92J 4UUSB 2M9HA 3ZOBA 2ZCXA 1HDPA 4JX4A 1NK3P 3LSGA 3MVPA 3KKCA 1VFCA 3L1PA 2CJJA 4GFBA 4W1UA 1QRYA 5M5WJ 1JJ8C 4GFLA 1ZTRA 5K7HA 1I50J 3Q0WA 3S16J 3HGYA 4B4CA 2X48A 1F36A 2IU5A 1TWHJ 2P81A 1BJZA 1HF0A 2M8GX 5HSZA 4A3EJ 1IV6A 3LSRA 5IYDJ 5FHPA 2DA5A 4MO7A 2O7TA 3OIOA 3BQYA 2DMNA 5C4XJ 2KDZA 2DG7A 3A03A 2VPRA 4Y7NJ 3TEDA 2DA1A 1MBEA 5DTDA 3SJMA 1EF4A 5EGOB 2R5ZB 3LHQA 2H1KA 5HBUA 5BNGA 2QIBA 2K9QA 3IH3A 3TP0A 1B8IA 1FJLA 1DU6A 4S0HB 5E3NA 4M3GA 5M3FJ 5F08A 4W97A 2HYJA 1ZQ3P 4LOCA 2JA8J 2FBQA 2AO9A 2DMQA 1B72A 2K40A 1IRZA 2XPVA 5CXGA 3RKQA 1W0UA 4AF5A 2WGBA 4BBSJ 3HM5A 1IC8A 2E2HJ 4AYBN 2LP0A 5AQCA 1FIPA 1JTXA 2B63J 5K58A 1UHSA 2HOSA 2ZCMA 2UXUA 2CUFA 2H8RA 2WUIA 2OI8A 1GV5A 5EG0A 4GCTA 4M6VA 4C3HJ 3S2HJ 3G1OA 3HDDA 5IYCJ 1XG1A 3MNLA 4UUSA 3SDGA 3NAUA 2E1OA 4XK4A 1JUMA 1Z0XA 1POGA 3GTOJ 2UXPA 5FGLA 5JLWA 2JA6J 2RHAA 5HAWA 3JRDA 4M3FA 5M5XJ 3S2DJ 2WAQN 3QPSA 4V2FA 2DG8A 3ANPA 3HOZJ 3G7RA 1RESA 3FIWA 5GP9A 3BQZA 2ECCA 3HB9A 2JJ7A 4D5FA 2UXOA 5CW8A 2GENA 2DMUA 3BG9A 3S1QJ 3TW6A 2R5YB 2UXHA 2L7MP 2TRTA 4EEFG 1VF9A 4X1EA 4FE4A 2Y9ZA 2NS7A 1U9NA 4MFDA 3FISA 1P7IA 3D1NI 5F0HA 5M5YJ 1APLC 2YVHA 3JRAA 3HTHA 3Q3SA 1QPIA 2W48A 4JL3A 2M0CA 3NXCA 5IPAA 2PMZN 3CJDA 1ZR4A 1JTYA 2HXIA 3LSJA 2X6OA 2XSDC 2R5ZA 2FD5A 5EFYA 1JJ6C 2JN6A 4HNVA 2GUHA 1A5JA 2LK2A 3E7LA 2LVSA 3O60A 1BW6A 3S5RA 2W53A 2L7ZA 5DS9A 5C44J 3HOUJ 2ZOYA 3HBLA 1AKHB 2K9NA 3F0CA 2JK3A 2G7SA 3V78A 3KNWA 4A3KJ 2GFNA 2EZLA 3RQIA 3JSJA 1ETKA 4GCKA 2M2EA 2HDDA 3LNQA 2NVTJ 1QVUA 2COBA 1U8BA 2HKUA 2NP5A 2PZ9A 3BR2A 4C3JJ 2CQXA 3BCGA 3BG5A 3WHBA 3FK7A 2IBDA 1WGXA 1GDTA 2EZKA 4IEJA 1H89C 1HDDC 1LFUP 2QTQA 2FX0A 3S15J 4C3IJ 4FTHA 2WB1N 2RASA 4JP0A 3VW1A 1JT6A 2O8KA 2K9SA 2LR8A 1WCMJ 2CU7A 2FJ1A 2R0QC 4J19A 3M4OJ 4A3BJ 1JKPC 2YS9A 2ZCNA 2PBXA 4BBRJ 3I4NJ 4NN1A 2GLOA 1ORKA 4QIWN 1TWFJ 2EZIA 3IH4A 3IV5A 1O4XA 2XGCA 4M3DA 2R5YA 4MXMA 4A3CJ 3O8HA 3LOCA 1JKOC 4UDSA 2LTPA 4CYCB 4XRSA 2D6YA 1VI0A 3OSGA 2CUEA 2ECBA 1HCRA 3KKDA 2DMPA 3JRFA 3JRHA 4NDLA 2DTZA 1ETXA 1GVDA 1X2NA 3BHQA 3GTKJ 1LE8B 3JR9A 3GTGJ 2YUSA 2VI6A 1K83J 4MK6A 5C4JJ 3K2AA 3MKLA 3BR5A 5E3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKG A;  3S1R J;  2IEK A;  2XRL A;  3SFI A;  3QQA A;  4RDU A;  4JKZ A;  1UI6 A;  1AKH A;  4FIS A;  1W0T A;  3HOV J;  3PAS A;  1IUF A;  4JX5 A;  2QOP A;  2AHQ A;  2JA5 J;  1T56 A;  2XGD A;  1ITY A;  5FKL A;  3LJL A;  3FRQ A;  2D5V A;  3BNI A;  3DEW A;  2NVQ J;  2XPU A;  4FCY A;  5F27 A;  3BR6 A;  5FMP A;  5D1R A;  5M3M J;  5FLV A;  5F1J A;  5JLX A;  1MH4 A;  2M34 A;  1D5Y A;  2ME0 A;  5K7F A;  4BXX J;  3S1M J;  3GTP J;  1OJL A;  2EH3 A;  1PUF B;  3LSP A;  3OSF A;  2DMT A;  5F04 A;  1DU0 A;  3VVZ A;  3BR0 A;  4JNN A;  5D19 A;  4JX6 A;  4XRM A;  4Y52 J;  3VP5 A;  3G56 A;  4DZJ A;  4DYR A;  1IGN A;  4G12 A;  1JUP A;  1E3O C;  3HOX J;  1AU7 A;  1GT0 C;  5FLM J;  2YU9 J;  3H0G J;  4IHY A;  2L0K A;  3HIM A;  3GBG A;  1TWA J;  1SGM A;  4AC6 A;  1IDZ A;  1LE8 A;  2LFB A;  3BRU A;  2HI3 A;  1MBK A;  1SAN A;  1MBH A;  3MN2 A;  2ZOZ A;  3FK6 A;  3O8G A;  2Y30 A;  3HOW J;  3ZQC A;  5C4Y A;  5E3M A;  2L9R A;  3G1M A;  3ZQH A;  2MG4 A;  1QVT A;  3EUP A;  3BTL A;  1JKQ C;  2VKV A;  5E3O A;  2G3B A;  4ICH A;  2EBI A;  1IG7 A;  1CQT A;  4A3D J;  2NVX J;  4A3L J;  1MBF A;  3HE0 A;  2VUM J;  2LD5 A;  3QBM A;  1RKW A;  4NEL A;  5EGO A;  4XID A;  1U9O A;  1FIA A;  3CDL A;  3ON4 A;  4XIC A;  1X58 A;  4UUT A;  3VVX A;  4GFK A;  1HLV A;  3JRG A;  3H3V K;  9ANT A;  4ABZ A;  3C07 A;  3F1B A;  1A6I A;  3VUQ A;  2E19 A;  1GV2 A;  3VW2 A;  3IUV A;  1IDY A;  4C2M J;  4AC0 A;  1PUF A;  1P7J A;  3VW0 A;  3GEU A;  3RZO J;  5EYR A;  1GUU A;  4BY7 J;  2YVE A;  3CCY A;  5GPA A;  3T6N A;  2RAE A;  1FTT A;  3M3Y J;  3KZ9 A;  5IYB J;  1H8A C;  2F07 A;  3RZD J;  5EEA A;  2ID3 A;  2Y9Y A;  4I76 A;  5EZH A;  3P9T A;  2EZH A;  4DW6 A;  2QWT A;  1JT0 A;  4ACI A;  2N8G A;  2HXO A;  1OFC X;  3UKG A;  2XB5 A;  2TCT A;  1S7E A;  1MSE C;  4DZP A;  2JA7 J;  1NTC A;  2REK A;  2UXI A;  3ON2 A;  4I6Z A;  3B6C A;  1ZGW A;  3VVY A;  5F0C A;  1R9T J;  3BJB A;  3E7Q A;  4IHX A;  2EQR A;  2Y0S N;  4ME9 A;  1VND A;  3GTJ J;  4L62 A;  3BG3 A;  3VPR A;  3W6V A;  5F0F A;  2FQ4 A;  2DA7 A;  1OCP A;  2G7L A;  1YRN B;  3DCF A;  1BW5 A;  3BT9 A;  2G7G A;  3CWR A;  5K7Z A;  5J1U A;  1UI5 A;  1Z77 A;  2ZB9 A;  4PXI A;  1TC3 C;  3HGG A;  4JYK A;  3CMY A;  3CQZ J;  3Q0V A;  4B3A A;  4A3G J;  2CQQ A;  2XB0 X;  3I4M J;  4A3M J;  1SFO J;  1RR7 A;  4A3I J;  1ETQ A;  3EGQ A;  4RBO A;  5FKK A;  3S17 J;  4A3F J;  2DA3 A;  1K61 A;  2X9D A;  1WI3 A;  1RPW A;  4MFE A;  1F43 A;  2WV1 A;  2JWT A;  4A3J J;  2ELK A;  3PPB A;  1WH7 A;  2L7F P;  4AUX A;  3NRG A;  4KWA A;  1UG2 A;  2MGQ A;  3OOU A;  2XPW A;  2MSY A;  1ETO A;  4V2G A;  1JKR C;  1Y1V J;  4D7N A;  3S14 J;  4DYQ A;  3B81 A;  2MW8 A;  5EF6 A;  1Y1W J;  2KT0 A;  1MNM C;  1X2M A;  2OF7 A;  1UMQ A;  3PO3 J;  5J3L A;  2VKE A;  4HKU A;  3VIB A;  3BR3 A;  5FKO A;  5H9T A;  1ETY A;  3K7A J;  2QF7 A;  1H88 C;  2QKO A;  2LLK A;  2ME6 A;  3DPJ A;  5J1R A;  2E2J J;  1MH3 A;  1T33 A;  3G1L A;  4L5E A;  5C3E J;  2GBY A;  5IOY A;  3HEF A;  1WPK A;  2HOT A;  2HYT A;  5FKN A;  3TW7 A;  2HQ5 A;  5EZG A;  3A01 B;  2OER A;  3HTI A;  1LFB A;  2HOA A;  4CYC A;  2CRG A;  2JMW A;  2O7O A;  4YZE A;  2OPT A;  1RKT A;  2XGE A;  3TP3 A;  1YRN A;  3B6A A;  1FTZ A;  4IHV A;  2R7Z J;  1ENH A;  2I10 A;  2DA4 A;  1ETV A;  3AQT A;  1XC5 A;  2QCO A;  1I3Q J;  2NS8 A;  3HKZ N;  3JRE A;  3ZQL A;  3S1N J;  4A69 C;  5IP6 A;  1HOM A;  3GZI A;  3V6G A;  4M3B A;  5FJ8 J;  3C2B A;  4X6A J;  2DA6 A;  1JGG A;  2XDN A;  2ID6 A;  2V57 A;  3A02 A;  3NAR A;  3ANG A;  2NX4 A;  3NNR A;  4D7M A;  3PM1 A;  3QPL A;  1RET A;  5IP7 J;  3NPI A;  1XS9 A;  1WH5 A;  3VOK A;  1TWG J;  2DA2 A;  2DN0 A;  1I6H J;  3COL A;  1G2H A;  2NOG A;  1ZR2 A;  5J1Y A;  1AHD P;  4IHW A;  2IAI A;  4B1R A;  1OCT C;  2LKX A;  3PO2 J;  1FEX A;  3ZQI A;  3BTJ A;  5DAJ A;  1Q1V A;  4BY1 J;  1BA5 A;  2R93 J;  3VOX A;  5IOZ A;  1MSF C;  3GTQ J;  1U78 A;  3CRJ A;  4GCL A;  2DJN A;  4BKX A;  1JUS A;  3IH2 A;  2NP3 A;  5EDN A;  3A01 A;  3JRB A;  1ETW A;  2Y2Z A;  4MLO A;  3RD3 A;  2Y31 A;  3HTA A;  4QTR A;  4FE7 A;  2LY9 A;  4XRS G;  3HTJ A;  4D5C A;  1B8I B;  3ZQG A;  3GTL J;  2Q24 A;  2E2I J;  5FKM A;  3ZQF A;  3AQS A;  3GTM J;  4MIM A;  1IJW C;  1TWC J;  3RH2 A;  2NVY J;  1B72 B;  5HOD A;  4CGR A;  1NK2 P;  3JRC A;  2O9L A;  1MBJ A;  4QSH A;  5D18 A;  3BTC A;  3QKX A;  2G0E A;  3WHC A;  3Q0U A;  3LWJ A;  3BR1 A;  4M3E A;  3NI7 A;  5IP9 J;  5CXI A;  3BTI A;  5EG0 B;  3HOY J;  1MBG A;  5GPC A;  2GM4 A;  4DYC A;  3JRI A;  1BL0 A;  3FKI J;  1ZK8 A;  4A93 J;  2R92 J;  4UUS B;  2M9H A;  3ZOB A;  2ZCX A;  1HDP A;  4JX4 A;  1NK3 P;  3LSG A;  3MVP A;  3KKC A;  1VFC A;  3L1P A;  2CJJ A;  4GFB A;  4W1U A;  1QRY A;  5M5W J;  1JJ8 C;  4GFL A;  1ZTR A;  5K7H A;  1I50 J;  3Q0W A;  3S16 J;  3HGY A;  4B4C A;  2X48 A;  1F36 A;  2IU5 A;  1TWH J;  2P81 A;  1BJZ A;  1HF0 A;  2M8G X;  5HSZ A;  4A3E J;  1IV6 A;  3LSR A;  5IYD J;  5FHP A;  2DA5 A;  4MO7 A;  2O7T A;  3OIO A;  3BQY A;  2DMN A;  5C4X J;  2KDZ A;  2DG7 A;  3A03 A;  2VPR A;  4Y7N J;  3TED A;  2DA1 A;  1MBE A;  5DTD A;  3SJM A;  1EF4 A;  5EGO B;  2R5Z B;  3LHQ A;  2H1K A;  5HBU A;  5BNG A;  2QIB A;  2K9Q A;  3IH3 A;  3TP0 A;  1B8I A;  1FJL A;  1DU6 A;  4S0H B;  5E3N A;  4M3G A;  5M3F J;  5F08 A;  4W97 A;  2HYJ A;  1ZQ3 P;  4LOC A;  2JA8 J;  2FBQ A;  2AO9 A;  2DMQ A;  1B72 A;  2K40 A;  1IRZ A;  2XPV A;  5CXG A;  3RKQ A;  1W0U A;  4AF5 A;  2WGB A;  4BBS J;  3HM5 A;  1IC8 A;  2E2H J;  4AYB N;  2LP0 A;  5AQC A;  1FIP A;  1JTX A;  2B63 J;  5K58 A;  1UHS A;  2HOS A;  2ZCM A;  2UXU A;  2CUF A;  2H8R A;  2WUI A;  2OI8 A;  1GV5 A;  5EG0 A;  4GCT A;  4M6V A;  4C3H J;  3S2H J;  3G1O A;  3HDD A;  5IYC J;  1XG1 A;  3MNL A;  4UUS A;  3SDG A;  3NAU A;  2E1O A;  4XK4 A;  1JUM A;  1Z0X A;  1POG A;  3GTO J;  2UXP A;  5FGL A;  5JLW A;  2JA6 J;  2RHA A;  5HAW A;  3JRD A;  4M3F A;  5M5X J;  3S2D J;  2WAQ N;  3QPS A;  4V2F A;  2DG8 A;  3ANP A;  3HOZ J;  3G7R A;  1RES A;  3FIW A;  5GP9 A;  3BQZ A;  2ECC A;  3HB9 A;  2JJ7 A;  4D5F A;  2UXO A;  5CW8 A;  2GEN A;  2DMU A;  3BG9 A;  3S1Q J;  3TW6 A;  2R5Y B;  2UXH A;  2L7M P;  2TRT A;  4EEF G;  1VF9 A;  4X1E A;  4FE4 A;  2Y9Z A;  2NS7 A;  1U9N A;  4MFD A;  3FIS A;  1P7I A;  3D1N I;  5F0H A;  5M5Y J;  1APL C;  2YVH A;  3JRA A;  3HTH A;  3Q3S A;  1QPI A;  2W48 A;  4JL3 A;  2M0C A;  3NXC A;  5IPA A;  2PMZ N;  3CJD A;  1ZR4 A;  1JTY A;  2HXI A;  3LSJ A;  2X6O A;  2XSD C;  2R5Z A;  2FD5 A;  5EFY A;  1JJ6 C;  2JN6 A;  4HNV A;  2GUH A;  1A5J A;  2LK2 A;  3E7L A;  2LVS A;  3O60 A;  1BW6 A;  3S5R A;  2W53 A;  2L7Z A;  5DS9 A;  5C44 J;  3HOU J;  2ZOY A;  3HBL A;  1AKH B;  2K9N A;  3F0C A;  2JK3 A;  2G7S A;  3V78 A;  3KNW A;  4A3K J;  2GFN A;  2EZL A;  3RQI A;  3JSJ A;  1ETK A;  4GCK A;  2M2E A;  2HDD A;  3LNQ A;  2NVT J;  1QVU A;  2COB A;  1U8B A;  2HKU A;  2NP5 A;  2PZ9 A;  3BR2 A;  4C3J J;  2CQX A;  3BCG A;  3BG5 A;  3WHB A;  3FK7 A;  2IBD A;  1WGX A;  1GDT A;  2EZK A;  4IEJ A;  1H89 C;  1HDD C;  1LFU P;  2QTQ A;  2FX0 A;  3S15 J;  4C3I J;  4FTH A;  2WB1 N;  2RAS A;  4JP0 A;  3VW1 A;  1JT6 A;  2O8K A;  2K9S A;  2LR8 A;  1WCM J;  2CU7 A;  2FJ1 A;  2R0Q C;  4J19 A;  3M4O J;  4A3B J;  1JKP C;  2YS9 A;  2ZCN A;  2PBX A;  4BBR J;  3I4N J;  4NN1 A;  2GLO A;  1ORK A;  4QIW N;  1TWF J;  2EZI A;  3IH4 A;  3IV5 A;  1O4X A;  2XGC A;  4M3D A;  2R5Y A;  4MXM A;  4A3C J;  3O8H A;  3LOC A;  1JKO C;  4UDS A;  2LTP A;  4CYC B;  4XRS A;  2D6Y A;  1VI0 A;  3OSG A;  2CUE A;  2ECB A;  1HCR A;  3KKD A;  2DMP A;  3JRF A;  3JRH A;  4NDL A;  2DTZ A;  1ETX A;  1GVD A;  1X2N A;  3BHQ A;  3GTK J;  1LE8 B;  3JR9 A;  3GTG J;  2YUS A;  2VI6 A;  1K83 J;  4MK6 A;  5C4J J;  3K2A A;  3MKL A;  3BR5 A;  5E3L A; 
#chains in the Genus database with same CATH topology
 1ZKG A;  2F5D A;  4AM3 A;  2XVC A;  3BJ6 A;  5CQE A;  3LSM A;  1U6G A;  3SFI A;  1FPQ A;  1V3F A;  3O2P E;  1UI6 A;  1ZAO A;  4A6E A;  4FIS A;  1ULY A;  1FX7 A;  1W0T A;  1MGT A;  4FQG A;  3Q9V A;  2AHQ A;  2XGD A;  2HU9 A;  1Y8R B;  1ZGA A;  1X1D A;  2YU3 A;  3DEW A;  3BNI A;  3KP4 A;  2L9N A;  3KZZ A;  3BZ6 A;  4IKF A;  2VBY A;  3L2V A;  1ZGJ A;  3QU3 A;  1N77 A;  5FLV A;  3K4K A;  1Y6I A;  2R4G A;  2EFN A;  5CYV A;  2P7C B;  2ME0 A;  2ZXH A;  3EUH A;  4IRH A;  3S1M J;  1B9M A;  3D5S C;  1OJL A;  1Z7U A;  2EH3 A;  2KFD A;  5TGT A;  3OSF A;  5CJ9 A;  2H8W A;  4ZJZ A;  2V7F A;  3VVZ A;  2HOE A;  1HW1 A;  5E1W A;  2HTS A;  2WB1 A;  3MD2 A;  4Y52 J;  3VP5 A;  4LG0 A;  4AVP A;  1WFX A;  2XDV A;  4M71 A;  4L9N A;  2J5P A;  2E5N A;  2IS2 A;  1AWC A;  1ZEL A;  2QSH X;  2EV6 A;  4OOI A;  1YW7 A;  2YU9 J;  2DCE A;  4AIJ A;  4PJN A;  3HIM A;  2MH9 A;  3GBG A;  1SGM A;  3KYL A;  5GTH C;  2W1O A;  1LE8 A;  2LFB A;  3BRU A;  2HI3 A;  1BC7 C;  2FNA A;  2XSJ C;  3O8G A;  4BXF A;  5BQT A;  3COA C;  2O0Y A;  4IRI A;  5H6Q A;  1OCC H;  1WJE A;  3MQ0 A;  3G1M A;  3MZH A;  1RZ4 A;  4Y15 A;  2ADU A;  1SC7 A;  2A07 F;  1JKQ C;  2VKV A;  1NH3 A;  4F52 A;  3QBM A;  4A3D J;  2VQH A;  3FXJ A;  4A3L J;  1PVE A;  2VUM J;  1RKW A;  2Y69 H;  1KYW A;  4NB5 A;  4KFC A;  2JUG A;  1K4T A;  2PJR A;  3BPV A;  3I0T A;  4XIC A;  1X58 A;  2FUG 2;  2CH0 A;  1DGR M;  5BPI A;  4AIK A;  2AQF A;  2NYX A;  4OD4 A;  1D0Y A;  1HLV A;  3V7C A;  3KEY A;  1HST A;  3GX4 X;  3EYI A;  9ANT A;  3E6B A;  1N25 A;  5ICC A;  1BI2 A;  4PSW A;  1B6A A;  2DFH A;  2F48 A;  2YR2 A;  2PG4 A;  2BV6 A;  1E3H A;  3K10 A;  4GYI A;  2OTJ I;  3B02 A;  4YFN F;  4LG3 A;  1W5T A;  2OV7 A;  1LFP A;  4R8H A;  1BI1 A;  2OZ6 A;  3K70 C;  3R4K A;  4CZC A;  5IYB J;  3CLQ A;  5DEQ A;  2H94 A;  3E5Q A;  4HX7 A;  2AXL A;  4KUM A;  4XKB A;  4E6K G;  2QWT A;  4DW6 A;  5K5R A;  3F6V A;  4ACI A;  2N8G A;  1BR1 A;  1OFC X;  2DBB A;  2XB5 A;  3GFI A;  2JA7 J;  3KP6 A;  4GGG A;  2UXI A;  4M72 A;  1SFE A;  2A05 A;  3ON2 A;  3GEZ A;  3RYP A;  1BR2 A;  4I6Z A;  1ZGW A;  2FU4 A;  3NRV A;  3K4N A;  1R9T J;  3CC4 I;  4IHX A;  3H5N A;  2AQE A;  3UNG C;  3GTJ J;  1Z6T A;  2YX7 A;  3CLO A;  1MJ9 A;  2A69 F;  3OIQ A;  3VPR A;  3GZ6 A;  2E1C A;  3W6V A;  4CGZ A;  3CWR A;  2G7L A;  1BW5 A;  3DCF A;  1Y8Q B;  3LA3 A;  3I5U A;  3E6C C;  1NG6 A;  4OMZ A;  1Z77 A;  4G6Q A;  2ZB9 A;  4PXI A;  1MMN A;  4BJT A;  4BEH A;  4B3A A;  4RB0 A;  2CQQ A;  3HRS A;  5FLX Z;  5IY5 H;  3HHG A;  4O6J A;  3DLL F;  4RMN A;  3EGQ A;  3RYR A;  1ETQ A;  4RBO A;  3D5L A;  3ZQ7 A;  4A3F J;  2DA3 A;  2X9D A;  3F21 A;  2CW7 A;  4HF1 A;  2WV1 A;  3C7J A;  3PPB A;  1W36 D;  1WH7 A;  2DOD A;  4AUX A;  4XLN F;  2VJ4 A;  2Y48 A;  3NRG A;  2KPM A;  3HUG A;  2W4S A;  1IXC A;  3DFG A;  3S14 J;  2DW4 A;  2LC2 A;  1SAU A;  3HYI A;  2BW3 B;  3MZY A;  4DQ2 A;  1YI2 I;  2MW8 A;  2HS5 A;  4OIO F;  2ZC2 A;  3A2K A;  1LDJ A;  1QBJ A;  1OCO H;  4XKC A;  1X2M A;  2P6S A;  1NHA A;  3VEP A;  3A4C A;  3MZ8 A;  4UUV A;  2IGN A;  2M0M A;  4G94 A;  4IF4 A;  4M9S A;  1G3Y A;  1KGS A;  4ITV A;  1MJA A;  3TMO A;  4I99 C;  3ULQ B;  2ME6 A;  4NQW A;  2E2J J;  3QYF A;  1XD7 A;  5C3E J;  5IOY A;  2GA1 A;  1WPK A;  3IUO A;  2E7X A;  3K6G A;  5FKN A;  5HS9 A;  3TW7 A;  2HQ5 A;  2E5Z A;  2FRH A;  4I0A A;  1IXS B;  3NWS A;  4KIT B;  1WJD A;  2IJL A;  4LGW A;  1S29 A;  3BJO A;  2P7V B;  4YZE A;  2O7O A;  2QVO A;  2BXY A;  2XGE A;  6PAX A;  5GTI C;  3B6A A;  3CCM I;  4KT5 C;  4J01 A;  4IHV A;  4EM2 A;  3C3W A;  4YII A;  1ENH A;  2OD5 A;  3DBH B;  2W57 A;  3AQT A;  1U0J A;  2GQQ A;  2QCO A;  1I3Q J;  3ZQL A;  4ENN A;  3J81 Z;  1GVJ A;  4GO1 A;  1QPM A;  1TP4 A;  3C2B A;  1IUY A;  2ID6 A;  2V9K A;  1R4M B;  3R0J A;  3H1C A;  3NAR A;  2X6Y A;  3EUH C;  2NX4 A;  3WTW C;  3QP6 A;  3FF5 A;  3PFI A;  4GRI A;  2DAO A;  5ED4 A;  2F5V A;  4P55 A;  1XPX A;  3NPI A;  3R0A A;  2A6E F;  3VOK A;  2QUF A;  3VWB A;  1G2H A;  2NOG A;  3VOE A;  2NS0 A;  1IN4 A;  4IHW A;  2IAI A;  2IA0 A;  3RTR A;  3K4C A;  1YIT I;  3S93 A;  3K1P A;  1R36 A;  3SFZ A;  3PO2 J;  3OMY A;  4XON A;  5FB2 A;  1SVL A;  5DAJ A;  3BTJ A;  5D8K B;  3EET A;  3RI4 A;  2HPI A;  4U9N A;  2CQK A;  4ENM A;  3WTT C;  3G6E I;  1R5I D;  3AL0 B;  4EV0 A;  3P7N A;  1U78 A;  1ZAR A;  1B59 A;  2M4K A;  1XGS A;  4XRF A;  3ZCO A;  3A01 A;  3JRB A;  1Z21 A;  3J7A O;  3HSE A;  2ZXJ A;  3E6D A;  2IXS A;  2Y31 A;  1QGP A;  3HTA A;  1QHH D;  4XLP F;  5CLS A;  2LY9 A;  3HTJ A;  3GTL J;  2Q24 A;  3ZQG A;  1WHU A;  2E2I J;  2M1B A;  3AQS A;  3GW2 A;  3ABK H;  4MIM A;  4CCJ A;  5HDK A;  3CZ6 A;  2K7L A;  3RH2 A;  2CQN A;  5HOD A;  1EH8 A;  3P5J A;  3GZN B;  4CGR A;  1CGP A;  4CIC A;  4PJM A;  2O9L A;  4BL0 B;  3V8K A;  3QKX A;  1UJ8 A;  3VSL A;  4KDP A;  3OYB A;  2HQR A;  2HFH A;  1V54 H;  1TTY A;  2B9S A;  1MBG A;  2E71 A;  5GAH J;  1S7A A;  3JRI A;  1BL0 A;  2BY0 A;  4A93 J;  1J9I A;  2H09 A;  1Y39 A;  5F6F A;  1VFC A;  1LVK A;  2VON A;  1LB2 A;  2W85 A;  1BIB A;  1YE9 A;  4P9F A;  3H0D A;  1JJ8 C;  4P96 A;  5K7H A;  3RQ4 A;  3H9G A;  2LG4 A;  4IL6 C;  3U1K A;  1F36 A;  4DIQ A;  3K69 A;  1VTN C;  2M8G X;  1ZLJ A;  1QO0 D;  5IYD J;  2X6W A;  4MO7 A;  2YPR A;  4IOC F;  3CMA I;  3KZI C;  4ENJ A;  2VQG A;  4XSX F;  2DG7 A;  3K0L A;  1YQA A;  4Y7N J;  2BY2 A;  3OR2 C;  4Z2Y A;  5CKT A;  3T1B A;  2QLZ A;  2R5Z B;  2XAG A;  5BNG A;  1B9N A;  2H6B A;  2K9Q A;  2EB7 A;  2OQG A;  1FJL A;  3S3M A;  1DU6 A;  2MC3 A;  4M3G A;  5M3F J;  2VKH A;  4OU0 A;  4PJ0 C;  4W97 A;  2J5O A;  3DU6 A;  2X1D A;  5E1Z B;  4ZDL A;  3UR3 C;  4EJW A;  1RNL A;  2AO9 A;  2DMQ A;  3JSP A;  1ZQ3 P;  2JA8 J;  3KP3 A;  5LGU A;  2UZK A;  4N4N B;  2GAU A;  2DOA A;  1V4R A;  2FA5 A;  2HDW A;  1FYM A;  1LEA A;  2HOS A;  5K58 A;  1P9Q C;  1ONV A;  2DO7 A;  4U88 A;  4I01 A;  2JQ7 A;  4XKW A;  5B1A H;  2W25 A;  3HOT A;  2AS5 F;  4GCT A;  4M6V A;  5FRO A;  2EIM H;  5IYC J;  3C2G A;  4HQE A;  3CCS I;  1D8K A;  4UUS A;  4E7S A;  4BHB A;  3SDG A;  3NAU A;  2PJP A;  2E1O A;  2EK5 A;  5DCM A;  1Z0X A;  2JSC A;  4HX4 A;  5FGL A;  3HRU A;  5JLW A;  2JA6 J;  2MA3 A;  2DYS H;  1XSD A;  3CCR I;  2DU9 A;  2DG8 A;  1UHM A;  1RI7 A;  1VQ7 I;  3BQZ A;  2CMP A;  2JJ7 A;  4KIF A;  2G9W A;  2HEO A;  2GEN A;  5D6E A;  1OPC A;  1M1E B;  2MH2 A;  4BDY A;  4EJU A;  2TRT A;  2QKM B;  4X1E A;  2RC4 A;  1APL C;  3FIS A;  1D0Z A;  5F0H A;  2YVH A;  4QWQ A;  3HTH A;  1N75 A;  4KYW A;  2W48 A;  4F55 A;  2M0C A;  1IN6 A;  3CJD A;  1IO2 A;  4BUP A;  4S04 A;  4UY8 I;  2XSD C;  3DQV C;  4EQQ A;  2ZSH B;  1WKM A;  2JN6 A;  4HNV A;  2WWY A;  3IP4 B;  2LVS A;  3KYC B;  5KNL A;  1W5S A;  2D45 A;  2W00 A;  2VLA A;  4LLN A;  2GFN A;  2KJC A;  4BS9 A;  3JSJ A;  5KCM A;  1FP1 D;  3G71 I;  3LNQ A;  4AID A;  1U8B A;  2O5R A;  1MDM B;  4JBA A;  4EM0 B;  3N97 A;  3DPU A;  3BCG A;  3WHB A;  3IKV A;  1ZRD A;  2EV5 A;  2FSW A;  3PIO F;  1S6L A;  5FRM A;  4AYB A;  2QTQ A;  2FX0 A;  2W24 A;  1HKS A;  3V8J A;  3I71 A;  3I56 I;  1I1S A;  2QBY B;  2CU7 A;  5FO5 A;  1TLH B;  2A5Y B;  3M4O J;  1W7P B;  5BPD A;  4YEJ A;  1LUJ B;  1XSV A;  4BBR J;  1KQ8 A;  2PBX A;  3RSN A;  4NN1 A;  1F4K A;  3N05 A;  3IV5 A;  3ZGK A;  2XGC A;  4M3D A;  1ZG3 A;  2CV2 A;  1KU3 A;  1EJ9 A;  2ETH A;  1KU9 A;  3H3U A;  3L2C A;  2DYR H;  2A68 F;  3OS2 A;  3K70 D;  3QPT A;  3AG3 H;  2CUE A;  1IN8 A;  5HVQ C;  5HS7 A;  2DMP A;  1K79 A;  1F5T A;  3CDH A;  3S3N A;  3CP2 A;  1P6R A;  5F1R A;  2MBF A;  4F7Z A;  2H1L A;  3CJR B;  3GTG J;  5GAG J;  2H27 A;  4RGU A;  5H2F C;  3BR5 A;  4RAF A;  4OMY A;  2B3W A;  2IEK A;  1OCR H;  5DUK A;  3MFK A;  3QQA A;  4RDU A;  2R7W A;  1AKH A;  4L9T A;  4HAM A;  2XF6 A;  2M87 A;  3WTX C;  3PAS A;  3QAH A;  2QOP A;  3PJR A;  1IXR C;  1T56 A;  2EIK H;  4ON0 A;  3P9K A;  2D5V A;  4Y13 A;  4MGR A;  4FCY A;  5F27 A;  4P1W A;  4FET A;  4XLE A;  4BGD A;  3MKW B;  5L3C A;  3QP5 A;  1YJ9 I;  2HKX A;  4LD5 A;  2M34 A;  1O3S A;  4G7O F;  3I59 B;  2LOO A;  1P92 A;  3I54 A;  4RB2 C;  3OY9 A;  4B8X A;  1WJF A;  3LSP A;  3L09 A;  5F04 A;  2IT0 A;  2DT6 A;  3BR0 A;  5F64 A;  2R7S A;  2F6C A;  3LSH A;  1ON1 A;  4DYR A;  1IGN A;  2QGU A;  5D5V B;  1XN7 A;  1X1P A;  1BR4 A;  4B48 A;  3HZJ A;  5B5E C;  2MD5 A;  3S32 A;  2HYG D;  1GT0 C;  1DGW Y;  2BXZ A;  4L9J A;  4B47 A;  1FSE A;  4GXO A;  4L5J A;  1IDZ A;  4LLG F;  3AG1 H;  2VOO A;  3NEU A;  3SEZ A;  2TDX A;  1MBK A;  1R1T A;  2JTV A;  2ZOZ A;  1T2K A;  3ZQC A;  5C4Y A;  1H0M A;  2V1D A;  1YG2 A;  3SHF A;  1QVT A;  4MEY F;  2IW5 A;  4ICH A;  3PFY A;  1YTY A;  1Z9C A;  3HE0 A;  1I5Z A;  2CFX A;  2KRC A;  1P4A A;  5EGO A;  1U9O A;  5E18 F;  2IS4 A;  2EIJ H;  4UUT A;  1YS6 A;  1X1C A;  1BN5 A;  4ZDO A;  3CCQ I;  2CV1 A;  4BYY A;  4E7Z A;  3OS1 A;  2MC4 A;  4ABZ A;  3F1B A;  3CC2 I;  3VUQ A;  4GCV A;  4EGZ A;  5KHD A;  3VW2 A;  5D8L B;  3SXY A;  4RAY A;  1IDY A;  2JPC A;  2KQR A;  2E60 A;  2F4O B;  2XGX A;  4HG2 A;  3DTI A;  2L5Q A;  3GEU A;  1G4D A;  1VZ0 A;  4ZYD A;  3RZO J;  3FMQ A;  4UVC A;  5E79 C;  4BY7 J;  2B1E A;  3MCZ A;  5GPA A;  2RAE A;  1HA8 A;  3DTK A;  3KZ9 A;  2GIV A;  4UV8 A;  2RN7 A;  4II2 A;  2R3S A;  2Y75 A;  2EZH A;  3JTH A;  2CWE A;  1JT0 A;  4XNF A;  3CCE I;  1S7E A;  2FXA A;  4DZP A;  2REK A;  2A2F X;  5HS8 A;  2FNP A;  3BCA A;  1SFU A;  2R7X A;  2VBW A;  3B6C A;  1LPQ A;  2VOD A;  3KE2 A;  4XQF A;  5F0C A;  3E7Q A;  2EQR A;  4XLA A;  2L01 A;  3HOS A;  4RLF A;  1O7L A;  2XHK A;  2FQ4 A;  5F0F A;  1OCP A;  1A36 A;  3H92 A;  3HIF A;  2G7G A;  4N0B A;  3DEU A;  3FDY A;  3REO A;  1RR8 C;  3T5X A;  3VYU B;  2BYV E;  1TC3 C;  3WTS C;  3CMY A;  2FOK A;  4DGW B;  3CQZ J;  5JI6 A;  2E7W A;  3PSI A;  1YO5 C;  1H9G A;  3PQJ A;  2HQA A;  2Q2E B;  4A3I J;  1E17 A;  1EH7 A;  3V7S A;  3S17 J;  2ZO4 A;  1C0W A;  4N9H A;  5HLG A;  1WI3 A;  1SFX A;  2HVS A;  1WJC A;  2UXN A;  1J09 A;  1HXD A;  4BE1 A;  2JWT A;  2OCC H;  2R7Q A;  4FX4 A;  1UG2 A;  2MGQ A;  4Z6Y A;  3J81 K;  5BMZ A;  3DPT A;  3LFK A;  3ABU A;  2VJJ A;  1ETO A;  1Y1V J;  3HPH A;  4CYD A;  4HNT A;  2A6H F;  4B44 A;  5EF6 A;  4ZYE A;  1Y1W J;  2R7V A;  3J80 Z;  1MNM C;  2WY7 Q;  2OF7 A;  1UMQ A;  4LIV A;  5JR3 A;  2ZKZ A;  3ABM H;  2QYO A;  5J3L A;  5E17 F;  3BR3 A;  3ESW B;  1ETY A;  4NUB A;  1R4N B;  3WG9 A;  2OZU A;  5KAI C;  1A35 A;  2QKO A;  1KON A;  3DPJ A;  2GA2 A;  4G7Z F;  3W2V A;  3GME A;  2D1V A;  1T33 A;  5L3F A;  4L5E A;  3JSO A;  2GBY A;  3VYS B;  2HOT A;  3PNT A;  2QA4 I;  2M3A A;  3TOA A;  3OYH A;  2KL4 A;  4O3M A;  1BOB A;  1NG7 A;  3CES A;  1IW7 F;  1XB4 A;  2CG4 A;  2JMW A;  4I7H A;  2VN2 A;  4PUS A;  4CSW A;  5TIS C;  3SQN A;  2DA4 A;  2JT1 A;  1ETV A;  2BE5 F;  1XC5 A;  3S1N J;  3HKZ N;  1U5T A;  1SVO A;  1W4M A;  3JRE A;  5IP6 A;  1HOM A;  1R1V A;  4EAT A;  4M3B A;  4X6A J;  4N4O B;  2NRA C;  3ZRG A;  1JGG A;  4MNU A;  4FAS D;  3BOQ A;  4OIQ F;  4NHJ A;  4BHP A;  2E35 A;  4M74 A;  3NNR A;  4NC6 A;  2F5E A;  1O57 A;  2AXT C;  2PBI A;  3PM1 A;  3PNY A;  3QPL A;  5DCF A;  3LMM A;  2NXN B;  5IP7 J;  4RGR A;  4IQJ A;  1WH5 A;  3L2R A;  2W82 A;  1X3Z B;  2BW3 A;  3COL A;  1VQL I;  3BZC A;  3LFU A;  3CO7 C;  1ZR2 A;  1K78 B;  2OC6 A;  1AHD P;  3F8F A;  3ROU A;  2RV8 A;  3HRT A;  1TT5 B;  1T95 A;  2OJE D;  4XL9 A;  3M8E A;  2M8E A;  4C30 A;  1OKR A;  1KQ0 A;  2VOP A;  3FXM A;  1UEL B;  2K9L A;  1Q1V A;  1BA5 A;  3OYC A;  4HF0 A;  4XKV A;  1V5E A;  1T38 A;  3GTQ J;  3FXL A;  4G7H F;  2V1X A;  4GCL A;  3W2W A;  3I53 A;  3PUB A;  1LQ1 A;  3W6K B;  1SMT A;  5LHI A;  2ZME B;  4QTR A;  1L0O C;  1QZY A;  2A5W A;  5LRR A;  4BJ6 C;  2QSF X;  4YIR X;  1B8I B;  5BS6 A;  3LA2 A;  5ICF A;  4BHC A;  4OIR F;  3LWF A;  3ZQF A;  5HNF A;  2C6Y A;  4O5V A;  3GTM J;  4RLQ A;  1IV8 A;  2QSG X;  4IX7 A;  2OCE A;  2F5F A;  1WQ2 A;  1U3E M;  1TW3 A;  3TGN A;  3FZV A;  4QSH A;  3LSK A;  1JGS A;  4AIH A;  4KN4 X;  4KIB A;  4NC8 A;  5IP9 J;  1I1G A;  3BTI A;  5EG0 B;  3M8J A;  5DV5 A;  2BHZ A;  1WJA A;  2O6G E;  2O8X A;  3TL4 X;  5GPC A;  5DUI A;  2EFQ A;  3LSI A;  3FKI J;  2HKO A;  1IN7 A;  2R92 J;  2M9H A;  3BZK A;  3ZOB A;  1MNE A;  3OYJ A;  3WGI A;  4JX4 A;  1NK3 P;  5CVJ A;  4L5I A;  2CJJ A;  4BAY A;  1VQ4 I;  4JQF A;  4W1U A;  2Z1D A;  4D1Q A;  3RJP A;  1X4O A;  4A2U A;  2VC1 A;  4B4C A;  4EJV A;  2IU5 A;  2MAB A;  1EH6 A;  3TO9 A;  4YFK F;  1HF0 A;  5HSZ A;  1CF7 B;  3LSR A;  2BOL A;  2WA0 A;  5LBQ A;  2Z16 A;  3H9J A;  3AAF A;  2O7T A;  4PSX A;  1FC3 A;  2EA4 A;  4CUG A;  4WX9 A;  2B7E A;  1X1B A;  2VPR A;  4ZYA A;  2HGC A;  2DA1 A;  3HPG A;  4XLH A;  4FT8 A;  3U2R A;  3SJM A;  1O3T A;  1EF4 A;  1V55 H;  5HBU A;  1S8N A;  1MIJ A;  2KIM A;  3NWT A;  2KLO A;  2QIB A;  1IF1 A;  3IH3 A;  2Q0O A;  4S0H B;  5E3N A;  1OIS A;  4M6X A;  4XN3 A;  2RVC A;  2P6T A;  1IRZ A;  1G59 A;  1P2F A;  4IXA A;  2FBI A;  3RKQ A;  3TO6 A;  4AF5 A;  1IC8 A;  2CUZ A;  5AQC A;  1T98 A;  4CXF A;  5E1X A;  5D4R A;  1QQI A;  2JRT A;  2H8R A;  1R7J A;  1D0X A;  3HXL A;  2OI8 A;  2WUI A;  1TW2 A;  4C3H J;  2X85 A;  1JHF A;  3MNL A;  2DQR A;  2L4A A;  1R5H A;  3IRR A;  1FOX A;  1POG A;  1J5Y A;  4NC7 A;  5KK1 A;  2RHA A;  2KIF A;  2GOM A;  2JPB A;  5J40 A;  1J7K A;  4G6D A;  4ZC3 A;  3WU2 C;  5M5X J;  3JRD A;  3S2D J;  4XOT A;  3HOZ J;  2MLK A;  3FIW A;  5GP9 A;  5KVR A;  3IC7 A;  1S72 I;  2UXO A;  5HOO A;  1JHH A;  4K2E A;  4X0G A;  3WU1 B;  3L00 A;  2KJB A;  3S1Q J;  2UXH A;  3RIR A;  4OIN F;  2XIG A;  3SYT A;  1SVM A;  1EA3 A;  2PLY A;  4WXH A;  3DU5 A;  2NS7 A;  1P7I A;  5LEK A;  2IP2 A;  3JRA A;  2K86 A;  4OWR B;  1QPI A;  1XMA A;  4JL3 A;  3NXC A;  2EWN A;  1USS A;  2G7H A;  1BM9 A;  2PQ8 A;  1ZR4 A;  2DPU A;  1F1Z A;  1MZB A;  4HQM A;  1U5T C;  3H5R A;  2R5Z A;  4LK0 F;  3U21 A;  4ZYG A;  2FD5 A;  3RPU A;  1JJ6 C;  5EFY A;  3DEE A;  1D1B A;  4HLX A;  5LFA A;  2NNN A;  2LK2 A;  1VQK I;  3E7L A;  2YSR A;  4B09 A;  1FOK A;  3S5R A;  1BW6 A;  3V8L A;  1UG0 A;  2L7Z A;  1BOA A;  5DS9 A;  3CCV I;  4C2U A;  2XAS A;  3HBL A;  1BIA A;  4HOB A;  4UB8 C;  5ICG A;  2JK3 A;  4HV6 A;  3KNW A;  1S3J A;  4A3K J;  2HPM A;  3OR1 C;  3RQI A;  1G3W A;  1ETK A;  5ILS A;  1D1C A;  2ZJ2 A;  4OD5 A;  2K3P A;  4E7L A;  1QVU A;  2L2O A;  2NP5 A;  4P9U A;  2O61 A;  3H35 A;  4C3J J;  2VXD A;  2CQX A;  1W7P D;  2B0L A;  5J4Y A;  3FK7 A;  3WG7 H;  5A2Q K;  4A5N A;  4IEJ A;  4CH7 A;  5KAF C;  1HDD C;  4BDZ A;  2EFO A;  4A5M A;  2RAS A;  1HW5 A;  2EIL H;  5DM7 F;  3VW1 A;  1JT6 A;  2O8K A;  1T6S A;  4QPQ A;  2FJ1 A;  3C1D A;  2IRF G;  2YS9 A;  2KIQ A;  2FQ3 A;  2MD0 A;  3SZT A;  1DP7 P;  2ZY9 A;  1TWF J;  1UB9 A;  3IH4 A;  1G3S A;  1ZG1 A;  3BG7 A;  2DTR A;  4WWC A;  2ACJ A;  3F6O A;  2HVR A;  3LOC A;  3MEX A;  2CYY A;  4XRS A;  4TV7 A;  1SD5 A;  1T0F A;  2ZJR F;  5EEH A;  2WAF A;  1JI8 A;  3BDD A;  1REP C;  1FBS A;  1ETX A;  1X2N A;  5CVV A;  3BHQ A;  1ZRC A;  2P8T A;  5E8G A;  2NVU B;  4R1H A;  1OYW A;  2VI6 A;  3WTU C;  2VE8 A;  3MKL A;  3VOX A;  2DDA A;  2F4I A;  3S1R J;  3KZY A;  2ELJ A;  4PCQ A;  5LHG A;  1K4S A;  4JKZ A;  3J7Z I;  3VDX A;  3Q5F A;  2R7R A;  3CUQ B;  3HTU A;  4E7I A;  3WTZ A;  3HOV J;  1HC8 A;  3WOD F;  3ZMT A;  1X19 A;  4JX5 A;  4XM3 A;  2JA5 J;  1ITY A;  3C18 A;  5FKL A;  1G3T A;  3FRQ A;  3LJL A;  1DP3 A;  3ASN H;  4HV5 A;  4M6Y A;  1MDM A;  5LGN A;  3K1N A;  2Z9O A;  2NVQ J;  1P4W A;  3M8F A;  5FMP A;  2GXG A;  4ZYH A;  5D1R A;  5J47 A;  2MFZ A;  2XAH A;  3ABL H;  5F1J A;  1XSX A;  4CHU A;  1Z67 A;  5K7F A;  3CD6 I;  4BXX J;  3GTP J;  2LY2 A;  3R60 A;  4LMY A;  2QBY A;  4E70 A;  2ZJQ F;  2CSO A;  2DMT A;  1PUF B;  4H0E A;  1DU0 A;  3U9G A;  1ZG5 A;  1W7P A;  2DK5 A;  2RNG A;  3KEO A;  1YW9 A;  5JHU A;  4XRM A;  2ZSI B;  2ICW G;  4KT6 A;  3AL0 C;  3BJA A;  5DDG A;  4DZJ A;  1D1A A;  1IN5 A;  1BC8 C;  2XKP A;  3I55 I;  2EFP A;  4G12 A;  1JUP A;  4RB3 C;  1PDN C;  3OYA A;  2RQP A;  2YVX A;  4IOA F;  5H20 A;  1HKT A;  3HOX J;  1F9N A;  3WGG A;  1AU7 A;  5LLQ A;  5FLM J;  4DVY P;  4WCG A;  3H0G J;  4XOP A;  4IHY A;  2L0K A;  3F8C A;  4PGH A;  2R7U A;  4AC6 A;  1UFM A;  1VQP I;  3TBI A;  4GYG A;  1MBH A;  2HNH A;  5E8I A;  3ERM A;  3HOW J;  4Q48 A;  4AVZ A;  2LRE A;  3QWL A;  3ZQH A;  2MG4 A;  4JK1 X;  3BTL A;  2DJI A;  3K2Z A;  5E3O A;  2F2E A;  2LKS A;  2O3F A;  3A0B C;  1CQT A;  2NVX J;  2IGK A;  4NEL A;  2M7A A;  1XCV A;  1WSU A;  2DQL A;  3EQL F;  3FXR A;  3CDL A;  4EMS A;  4RA2 A;  4HX8 A;  1TQI A;  2K85 A;  2LMD A;  4AU7 A;  4GFK A;  4UHT A;  3DBL B;  3H3V K;  4G8X A;  1FY7 A;  1A6I A;  3M9A A;  2E19 A;  1SMY F;  1GV2 A;  2R7D A;  4G6T B;  1FNN A;  5K5O A;  2GOX B;  3I59 A;  4RGS A;  5CPR B;  4C2M J;  4QPO A;  1EV7 A;  2JZY A;  2HQN A;  4OIP F;  3VYT B;  1P7J A;  2DOE A;  3QYE A;  4OAY A;  2XRO A;  2I5U A;  1LNW A;  1V5G A;  2VKD A;  5EYR A;  2YVE A;  3OYL A;  4KN7 X;  1H8A C;  3K8P C;  3RZD J;  2ID3 A;  2Y9Y A;  4I76 A;  5EZH A;  1K6O A;  1YIO A;  4UB6 C;  3HSR A;  3D0S A;  4BJ5 C;  3DKY A;  1MSE C;  2A6T A;  2TCT A;  3ONQ A;  4RS8 A;  2L4M A;  4ZZD A;  1WJ5 A;  3CP8 A;  3OYI A;  1HW2 A;  3VVY A;  2KZV A;  3J80 K;  1Z7L A;  2OTL I;  1IAW A;  2Y0S N;  2KHM A;  4M9X A;  1VND A;  2WAQ A;  4IZZ A;  4BQA A;  3BG3 A;  2DXI A;  1D3Y A;  3W2A A;  1WJB A;  1QZZ A;  4UV9 A;  1KZH A;  1YRN B;  3BT9 A;  3EUA A;  5K7Z A;  1MKM A;  4HST A;  1J59 A;  5DM6 F;  1FMW A;  2M5W A;  2DFE A;  5TJJ A;  1ZRF A;  3HGG A;  2D1H A;  2PFV A;  2VT3 A;  3Q0V A;  4A3G J;  2VQC A;  2WTE A;  3BC8 A;  4ESF A;  4A3M J;  2PN6 A;  2PMZ A;  3CCJ I;  1SFO J;  2STW A;  3KPH A;  2X1E A;  5A2Q Z;  1R22 A;  1K61 A;  4LJZ F;  1RPW A;  1F43 A;  2KRF A;  2L54 A;  4A3J J;  3IKT A;  4KIS A;  2KZG A;  4KJZ A;  5J6X A;  4EJO A;  3V4G A;  5L3D A;  2MSY A;  4EGY A;  3H5A A;  4DYQ A;  2PFB A;  3B81 A;  2CUJ A;  5GAD J;  1RIO H;  3P9I A;  2LDU A;  1EKE A;  2UUZ A;  1UCR A;  5ILV A;  1T0F C;  3ERE D;  4LIT A;  4RM2 A;  4HKU A;  4U7B A;  3WGH A;  3VIB A;  5FKO A;  3K7A J;  5CQG A;  3LAJ A;  1H88 C;  4AD9 A;  2LLK A;  4HDU A;  1TZL A;  2ZNY A;  3RCO A;  3JAM Z;  2RNJ A;  4Q5S F;  1X4P A;  1QNT A;  3GF2 A;  5CVR A;  2OER A;  3IWZ A;  1YOV B;  2X0L A;  2HOA A;  3CME I;  4CYC A;  4QLC U;  3LQQ A;  2E1M B;  2OPT A;  3ABT A;  1RKT A;  3HJE A;  3ZMU A;  1W1W E;  2ZJP F;  2GZW A;  1YJW I;  1FTZ A;  2VJI A;  4LLL A;  3AG4 H;  3EYY A;  2L7K A;  1Z05 A;  4A69 C;  4L0Z B;  2L9V A;  2FOW A;  5K5Q A;  5FJ8 J;  4PGG A;  3A0H C;  2Q2E A;  5GAE J;  2XDN A;  2XRN A;  1S5L C;  2HDC A;  2ISZ A;  1A31 A;  3ANG A;  2VL8 A;  3LQR A;  2BVM A;  3I9V 2;  4B43 A;  3K9T A;  4D7M A;  2GIZ A;  3ZMV A;  3J7A Y;  4AWX B;  1RET A;  3ZMD A;  4YEL A;  1I27 A;  2BGC A;  3K4J A;  5HLT A;  1MMS A;  2DA2 A;  3F9K A;  4FHT A;  3MKY B;  3JTG A;  2GXB A;  1I6H J;  3HHH A;  3G3Z A;  1HSJ A;  1QHG A;  5ILU A;  2VE9 A;  5J1Y A;  3GFJ A;  4LFU A;  2K9M A;  2OUM A;  2KIU A;  1GXQ A;  4B1R A;  4CCM A;  1OCT C;  4I09 A;  2Z2S B;  2LKX A;  1DQU A;  3ZP5 A;  1FEX A;  3HRM A;  4HBL A;  4IRG A;  3PIP F;  3U1D A;  1RUN A;  5IT9 Z;  4RAZ A;  2X51 A;  3DKX A;  4Y4R A;  3ZN1 A;  4S05 A;  3CJN A;  4H4K C;  5IOZ A;  1MSF C;  2IGO A;  3S8P A;  2DJN A;  1I3A A;  4BKX A;  2BBY A;  3FBI B;  3IH2 A;  3G4S I;  2ZCW A;  2NP3 A;  3CDI A;  1H9T A;  4MLO A;  3RD3 A;  2DT7 B;  5LD2 C;  1MJB A;  2LBF B;  2JA2 A;  3WE2 A;  1D5V A;  4FX0 A;  5E20 A;  1GXP A;  3SWH A;  3KIO A;  3E97 A;  4UVA A;  4XRS G;  4D5C A;  4R79 A;  1T08 B;  2QQA A;  5FKM A;  2Z5U A;  2KIS A;  1IJW C;  3BPX A;  1FBQ A;  1G8X A;  3TO7 A;  1B72 B;  3RKX A;  1OMI A;  2JUC A;  4XN0 A;  1NK2 P;  5DYM A;  3BY6 A;  2KDO A;  4BXU A;  3JRC A;  2CO5 A;  1MBJ A;  3HKZ A;  5B3S H;  5D18 A;  3BTC A;  3IAS 2;  4MTE A;  4ESB A;  1R6R A;  3LWJ A;  3BR1 A;  3QPH A;  5JHF A;  1QU3 A;  2QEX I;  1HBX G;  3G2B A;  4BQO A;  5ICE A;  3HOY J;  2GM4 A;  1VQO I;  1ZK8 A;  5LRS A;  3SDB A;  2QWW A;  2ZCX A;  2LF7 A;  3DXJ F;  3ECH A;  4ENK A;  3LSG A;  3KKC A;  1K78 A;  3BLY A;  1FP2 A;  3MMY B;  4HRI A;  1X1A A;  1ERD A;  1QRY A;  1I6X A;  1UHW A;  2Q1Z B;  2X1C A;  4RAG A;  2F5C A;  4CCN A;  5IT3 A;  4MTD A;  5M5W J;  2IS6 A;  4GFL A;  1ZTR A;  3Q0W A;  3F8M A;  4WF2 A;  5JFR A;  5D6F A;  2BY1 A;  2HZT A;  3KEQ A;  1ZN2 A;  2A3S A;  1SD7 A;  1Z3X A;  2JVH A;  4Y3O A;  3BQY A;  5C4X J;  1MMG A;  2NNY A;  3ZMS A;  4P5O A;  2H6C A;  5DTD A;  5HNH A;  2HTJ A;  5EGO B;  1KU2 A;  1XMX A;  2ZME A;  5B66 C;  2H1K A;  1B8I A;  1ZRE A;  4EVI A;  4KIG A;  2HYJ A;  2Z3Y A;  3RKY A;  3OYE A;  1AOY A;  2KP6 A;  4PFO A;  4YFX F;  4IJA A;  5CXG A;  1KYZ A;  2HVQ A;  3CTA A;  5EJC A;  3MWM A;  1V5F A;  1W0U A;  3ML6 A;  3VFZ A;  1JE8 A;  4BBS J;  2E2H J;  2JVG A;  1SD6 A;  2LP0 A;  1FIP A;  2V26 A;  2W84 A;  1UHS A;  3OV8 A;  5LGT A;  2ZCM A;  3DP7 A;  4PZJ A;  2UXU A;  2E1N A;  4IQ4 A;  3F72 A;  4DOZ A;  3TKY A;  1GV5 A;  5EG0 A;  3S2W A;  3S2H J;  4I2O A;  2L9S A;  3G1O A;  4CCK A;  2NAZ A;  1G6N A;  4RB1 A;  1XG1 A;  2XAU A;  4U0W A;  1B4A A;  2FEZ A;  4XK4 A;  4ZDP A;  2UXP A;  2DFF A;  3PSF A;  1MW7 A;  3BWG A;  4WK8 F;  2Z33 A;  2MLG A;  1XX5 A;  2FF4 A;  3WTV C;  3ANP A;  3G7R A;  1ZHF A;  2ECC A;  5L3G A;  5CW8 A;  2VBX A;  4XLC A;  1YFH A;  3TW6 A;  2R5Y B;  2L7M P;  1OQY A;  2VT2 A;  1FYL A;  3F22 A;  2KMU A;  4XSZ F;  1MD0 A;  1VF9 A;  4FE4 A;  3T8T A;  3V42 A;  2Y9Z A;  4ESJ A;  4ZTF A;  1U9N A;  3GLX A;  4MFD A;  3D1N I;  1J0R A;  1CF7 A;  1D8J A;  1AA7 A;  2XF7 A;  5D5W B;  1RUO A;  1VQ6 I;  3E6M A;  1VQ8 I;  2FML A;  3EPZ A;  3OYK A;  1LVA A;  3I58 A;  3FHZ A;  3F23 A;  3AKZ A;  3X2Q H;  2HXI A;  1KU7 A;  4I02 A;  1R5G A;  3SZP A;  4BE0 A;  1YS7 A;  4JOM A;  4CZZ A;  4U7D A;  1LJ9 A;  2V4J C;  2GUH A;  1UAA A;  2FJI 1;  4F93 B;  2UXX A;  4YIF A;  2LSO A;  4EM1 A;  5C44 J;  3HOU J;  2W53 A;  2ZOY A;  3CC7 I;  3TQN A;  2CS3 A;  2K9N A;  3F0C A;  2G7S A;  2L3D A;  2QQ9 A;  2EPF A;  4ZTJ A;  1GHC A;  4GCK A;  2I8D A;  1N78 A;  2HDD A;  2COB A;  3IWF A;  2HKU A;  3BR2 A;  4LB6 B;  4ZZL A;  3PL8 A;  1TQM A;  2EZK A;  2MYS A;  1H89 C;  1WWX A;  2R7T A;  1SD4 A;  1FOY A;  3S15 J;  3VTI A;  4C3I J;  4FTH A;  2WB1 N;  2RGV A;  2ELH A;  3LL7 A;  4HEA 2;  5D4S A;  3FX3 A;  4JP0 A;  3PQK A;  2X4H A;  4J19 A;  1WCM J;  2V9V A;  3GCM A;  4KMU X;  2P5L C;  2P5V A;  4E7K A;  1YIJ I;  2ZCN A;  4J00 A;  2WY8 Q;  4L0Y B;  2ESH A;  4XOR A;  4C9Y A;  4XR6 A;  4QIW N;  3CJT B;  2EZI A;  4LG0 B;  2IA1 A;  1O4X A;  2IVM A;  1GLN A;  1Z91 A;  3VYR B;  4A3C J;  3O8H A;  1JKO C;  5DD4 A;  2LTP A;  4UDS A;  3M1E A;  3E5X A;  2D6Y A;  3E3V A;  3OSG A;  2ECB A;  2RKH A;  3W3C A;  3T8R A;  3RDI A;  4KA4 A;  1BI0 A;  4CDG A;  3JRF A;  3JRH A;  5FGM A;  3ECO A;  4HA8 A;  1XMK A;  1K7A A;  4F91 B;  1LE8 B;  3JR9 A;  1Y0U A;  1U5T B;  2PMU A;  4BE2 A;  2WBM A;  1S9H A;  5FD6 A;  2RDP A;  3NS4 A;  1O7F A;  1Z3Y A;  4MK6 A;  5C4J J;  3H9Q A;  2XF5 A;  2D2W A;  3RPU D;  2PI0 A;  5E3L A;  1TNS A;  2P0W A;  2XRL A;  2COM A;  1MND A;  3KCC A;  1DDN A;  2CV0 A;  2BHY A;  1IUF A;  3A1Y A;  3O3K A;  2PJR B;  2ZXW H;  3GWZ A;  1TBX A;  2XC7 A;  1HQC A;  2XPU A;  3BR6 A;  3P9C A;  4CCL A;  5CVI A;  2VXZ A;  4Y17 A;  1LKX A;  4WXD A;  5M3M J;  5JLX A;  4V19 K;  1MH4 A;  1D5Y A;  4IHS A;  3FMR A;  3IL2 A;  5CVU A;  4DJA A;  2KKO A;  4L9V A;  5J4V A;  4ETS A;  4JNN A;  5D19 A;  2IA2 A;  2LKP A;  4JX6 A;  4IRV A;  3G56 A;  2EV0 A;  3TDU C;  5LEJ A;  4MEX F;  3CF2 A;  4BH9 A;  1E3O C;  4ASN A;  3I3L A;  3QOP A;  4E7H A;  4XLF A;  2HYF A;  3FXO A;  2V6E A;  4YG2 F;  3DLA A;  1TT0 A;  2KRH A;  2M7B A;  2ZME C;  2JSP A;  1TWA J;  2K4B A;  3BCB A;  2CFO A;  3E1S A;  2M4G A;  1ON2 A;  1SAN A;  1FWZ A;  3FMS A;  1I39 A;  3MN2 A;  3FK6 A;  2Y30 A;  5E3M A;  3WE3 A;  2L9R A;  1YX5 A;  3EUP A;  1BI3 A;  4UVB A;  2G3B A;  5H6R A;  4CO8 A;  2EBI A;  3CUQ A;  1IG7 A;  1MBF A;  1VQM I;  3NQO A;  1U2W A;  3DF8 A;  2LD5 A;  2CGP A;  4XID A;  1FIA A;  4BEH B;  3ON4 A;  4ZH4 F;  2PMH A;  4PJJ A;  3DKW A;  3VVX A;  2F4M B;  4C2M A;  2BEO A;  5FFX A;  2VC0 A;  4F92 B;  3JRG A;  1YW8 A;  3FWE A;  3C07 A;  3L2U A;  3VOD A;  1OCZ H;  3IHU A;  3G73 A;  3IUV A;  4OAZ A;  3CF5 F;  2LH9 A;  1J75 A;  3HUG B;  2EJR A;  1VQN I;  4AC0 A;  1WVR A;  1R1U A;  5J8C A;  1STZ A;  1PUF A;  3VW0 A;  2VB6 A;  4I98 B;  4DBR A;  1R58 A;  2ISY A;  3KLN A;  2V79 A;  4UXN A;  2BZT A;  2HR3 A;  1GUU A;  3CCY A;  1X3W B;  3T6N A;  1FTT A;  3M3Y J;  4U0V A;  4U0Y A;  2F07 A;  5EEA A;  4IPA A;  3P9T A;  4A0X A;  2EA2 A;  3DTE A;  2HXO A;  3UKG A;  4NQW B;  1OLT A;  1NTC A;  3GVA A;  4D0P A;  1XGN A;  1R71 A;  1YX3 A;  3F8N A;  3BJB A;  3AG2 H;  2FBK A;  3HL2 A;  1X3U A;  1PUE E;  4ME9 A;  4L62 A;  1OR7 A;  1OYI A;  2ZFW A;  1Q1H A;  4UNO A;  2DA7 A;  1QZE A;  1E0E A;  2OBP A;  1DUX C;  5J8F A;  3C2H A;  5J1U A;  3IAM 2;  3PUF A;  5JVG F;  4LIU A;  1R49 A;  1UI5 A;  3JAM K;  2WAE A;  4JYK A;  5L3E A;  2XB0 X;  3OYF A;  3HSF A;  4RM3 A;  3I4M J;  1RR7 A;  3R61 A;  2E36 A;  1OYY A;  4PK4 A;  3VB2 A;  2Y0M A;  5FKK A;  2VQL A;  3QRF F;  3J7Y J;  2Q8K A;  3KX2 A;  3L2Q A;  4MFE A;  3D5R C;  2FMY A;  3R6S A;  4NBQ A;  2ELK A;  2DDB A;  1MMD A;  2L7F P;  1WZ2 A;  4Y33 A;  4KWA A;  2QKL B;  1K6Y A;  3OOU A;  4LK1 F;  2XPW A;  3KP2 A;  4V2G A;  1XTA A;  3DWL E;  4D7N A;  1JKR C;  1ZH5 A;  3TDZ C;  4M9Z A;  3L2W A;  3I64 A;  2GXA A;  3CMM A;  1MMA A;  5BOX A;  2KT0 A;  1KQ9 A;  1J2X A;  1FOW A;  4M73 A;  2BVL A;  3PO3 J;  3OS0 A;  2V6C A;  3ZN0 A;  2VKE A;  3MAJ A;  2K02 A;  5H9T A;  3BRO A;  3F3X A;  3GYH X;  2QF7 A;  2DI3 A;  2LYC A;  5ERI A;  3HTS B;  4N9I A;  5J1R A;  2VAS A;  1MH3 A;  3G1L A;  3HEF A;  2HYT A;  4HDV A;  2JRM A;  3KYD B;  5EZG A;  3A01 B;  4A0Y A;  3HTI A;  3N4M A;  1LFB A;  1YJN I;  3IRQ A;  1UZC A;  2CRG A;  1YLF A;  2QQB A;  3SEQ A;  1QA6 A;  3TP3 A;  3CJQ B;  1YRN A;  5IT9 K;  4KMF A;  3Q9S A;  5D5X B;  2R7Z J;  3VSK A;  2I10 A;  4IO9 F;  4MQV A;  2Y0S A;  4HF2 A;  4C2T A;  2DK8 A;  2NS8 A;  2UWM A;  3LST A;  4HYE A;  5D5U B;  3GZI A;  2NOJ B;  3V6G A;  4A12 A;  1XDU A;  1SAX A;  2DA6 A;  1Z1D A;  2ESN A;  1R00 A;  2K27 A;  2L02 A;  5AON A;  5JVT A;  2V57 A;  3A02 A;  2A61 A;  1PP7 U;  4PFP A;  4GDF A;  4MQ9 F;  3JW4 A;  1DPU A;  2Z99 A;  3LA7 A;  3ZXS A;  1XCB A;  1XS9 A;  3BP8 A;  1TWG J;  1RRJ A;  2DN0 A;  2WC2 A;  3DV8 A;  2HWV A;  4A0Z A;  3M07 A;  1WI9 A;  2R7F A;  1T39 A;  2X6X A;  3QYB A;  2XKO A;  2DLL A;  4F3Q A;  2CQ7 A;  2OAZ A;  4HZF A;  3ZQI A;  4BY1 J;  2R93 J;  1TL8 A;  3FKJ A;  3OL4 A;  5HDN A;  1BBY A;  2ZFU A;  3CRJ A;  1JUS A;  5EDN A;  1ETW A;  2Y2Z A;  4IVN A;  4B3X A;  3EUK L;  1ACI A;  3CUQ C;  3ASO H;  1SFK A;  3OOP A;  2RQQ A;  3FXK A;  3K1M A;  2IGM A;  2IPQ X;  4G9Y A;  4BQQ A;  3RKW A;  1L3L A;  4FE7 A;  3GFM A;  1FT9 A;  2P4W A;  4DBQ A;  3KET A;  2IS1 A;  5LHH A;  1U8R A;  3ISP A;  1LDK B;  1TWC J;  1IRF A;  2XAF A;  2NVY J;  3JCU C;  3RPQ A;  3OYD A;  3FXQ A;  4KIC A;  5L3B A;  3ELK A;  1W36 C;  3L7W A;  5HLI A;  3GO5 A;  3PNV A;  2G0E A;  3WHC A;  2FBH A;  3K4M A;  3Q0U A;  3GZ5 A;  4U9L A;  4M3E A;  4XBF A;  3E5U A;  3NI7 A;  5EEG A;  4E7J A;  5CXI A;  1IZ1 A;  4DNC A;  2CW8 A;  2XAJ A;  5K1Y A;  1FLI A;  1Y56 A;  3CCL I;  1W5C C;  3WU0 A;  4DYC A;  1YYV A;  4BNC A;  2UV1 A;  2VPL A;  1WRJ A;  4UUS B;  5DCM B;  2PEX A;  1HDP A;  2ZNZ A;  3OIP A;  3MVP A;  1FMV A;  2V1N A;  2K4J A;  1TQP A;  3L1P A;  4GFB A;  1HKQ A;  4Q4Z F;  1XGM A;  3QOE A;  2DOF A;  1I50 J;  2DPD A;  2YX4 A;  2K5C A;  3S16 J;  3HGY A;  3HG9 A;  2X48 A;  1PYV A;  3EDP A;  1TWH J;  2P81 A;  1BJZ A;  4U87 A;  3I4P A;  4BU2 A;  4A3E J;  4A6D A;  1IV6 A;  1RC9 A;  1OR7 C;  4I0B A;  1VQ5 I;  1T8I A;  3BG6 A;  1UST A;  5FHP A;  3KLO A;  4NNJ A;  1TNT A;  2DA5 A;  2VJ5 A;  5FRN A;  3OIO A;  3KFW X;  2DMN A;  2KDZ A;  5B1B H;  3A03 A;  5TRD A;  3CUO A;  1FZP B;  3TED A;  1MBE A;  5AIP A;  2LBF A;  4HW0 A;  2VBZ A;  5AIQ A;  3TOB A;  4YRV A;  3LHQ A;  5DD8 A;  3CO6 C;  3SZG A;  3TP0 A;  2R7O A;  1VQ9 I;  1PJR A;  3FM5 A;  3FBN B;  1ZLK A;  4MHG A;  2PX9 A;  3H36 A;  4RGX A;  2FBQ A;  4LOC A;  1B72 A;  2K40 A;  2XPV A;  2FE3 A;  1FSH A;  3OL3 A;  4BQN A;  2LF8 A;  3GUD A;  2WGB A;  2RRE A;  3HM5 A;  4Q47 A;  3HC7 A;  4AYB N;  1JTX A;  4L18 B;  2B63 J;  3K4L A;  4IHT A;  2CUF A;  1Z6R A;  2W7N A;  5HDG A;  3FM3 A;  4BAC A;  1SEU A;  3OYM A;  2M45 A;  3KP7 A;  3HDD A;  3WTY C;  4EJT A;  1JUM A;  3GTO J;  2OQR A;  5HAW A;  1FYK A;  4M3F A;  2WAQ N;  3QPS A;  3AFH A;  2OA4 A;  3KP5 A;  2DT5 A;  4V2F A;  1RES A;  3W6J B;  1JXS A;  3F8B A;  3ZQQ A;  2VIX A;  3HB9 A;  4D5F A;  2V1U A;  2DMU A;  3BG9 A;  1XGO A;  2ZXI A;  4HNU A;  2GWR A;  3OYN A;  3DBR B;  4EEF G;  1O3Q A;  1P4X A;  3T0Y A;  3V7R A;  2LRD A;  1R23 A;  5M5Y J;  2CW0 F;  3Q3S A;  3FHN A;  1E2X A;  4WIB A;  5IPA A;  1PP8 F;  2PMZ N;  3K4B A;  1JTY A;  3DPL C;  2QQ8 A;  2K3F A;  1S7O A;  3LSJ A;  2X6O A;  2QM3 A;  1A6Q A;  4E4H A;  4II3 A;  1A5J A;  2E34 A;  2EFW A;  5HLH A;  2V9P A;  5FFZ A;  3O60 A;  3QOD A;  3LAP A;  1LDD A;  1AKH B;  4XMY A;  3V78 A;  2WV0 A;  2STT A;  2QZ8 A;  2XAQ A;  4WXC A;  4HSR A;  2O03 A;  2EZL A;  3OYG A;  1XDS A;  2HZD A;  2M2E A;  1YHQ I;  1ZYR F;  2NVT J;  3ZMZ A;  2ZBK A;  2PZ9 A;  5FLX K;  2XUB A;  3BG5 A;  4HPQ A;  3M7G A;  2BY3 A;  3E0J B;  2IBD A;  1WGX A;  4CA0 A;  1GDT A;  4KNY A;  2M30 A;  1Y0N A;  2P5K A;  1LFU P;  3QU6 A;  1FBU A;  3ZPL A;  2LNB A;  2XV4 S;  2OU2 A;  3L9F A;  2K9S A;  5FD5 A;  2LR8 A;  3GLL A;  4PJL A;  2R0Q C;  1E3P A;  1LEB A;  4A3B J;  1JKP C;  2EIN H;  2QEN A;  2WAD A;  3O6B B;  3I4N J;  3ZR8 X;  1IRX A;  2GLO A;  3H3Z A;  1ORK A;  3MKZ A;  2G7U A;  4ANJ A;  4MXM A;  2R5Y A;  4D9J A;  1B1B A;  1A04 A;  3GFL A;  3GXO A;  3OWT A;  1KA8 A;  4CCO A;  4CYC B;  2DFI A;  1VI0 A;  2E1M C;  1HCR A;  3KKD A;  3CCU I;  4HLY A;  3M1C A;  3B73 A;  4NDL A;  2DTZ A;  4PDK A;  1ODD A;  1GVD A;  3GTK J;  1BJA A;  2YUS A;  1O3R A;  4LB5 A;  1DPR A;  1K83 J;  3FXU A;  1IRG A;  3K2A A;  5F08 A;  2LY1 A;  3S3O A; 
#chains in the Genus database with same CATH homology
 1ZKG A;  3S1R J;  2IEK A;  2XRL A;  3SFI A;  3QQA A;  4RDU A;  4JKZ A;  1UI6 A;  1AKH A;  4FIS A;  1W0T A;  3HOV J;  3PAS A;  1IUF A;  4JX5 A;  2QOP A;  2AHQ A;  2JA5 J;  1T56 A;  2XGD A;  1ITY A;  5FKL A;  3LJL A;  3FRQ A;  2D5V A;  3BNI A;  3DEW A;  2NVQ J;  2XPU A;  4FCY A;  5F27 A;  3BR6 A;  5FMP A;  5D1R A;  5M3M J;  5FLV A;  5F1J A;  5JLX A;  1MH4 A;  2M34 A;  1D5Y A;  2ME0 A;  5K7F A;  4BXX J;  3S1M J;  3GTP J;  1OJL A;  2EH3 A;  1PUF B;  3LSP A;  3OSF A;  2DMT A;  5F04 A;  1DU0 A;  3VVZ A;  3BR0 A;  4JNN A;  5D19 A;  4JX6 A;  4XRM A;  4Y52 J;  3VP5 A;  3G56 A;  4DZJ A;  4DYR A;  1IGN A;  4G12 A;  1JUP A;  1E3O C;  3HOX J;  1AU7 A;  1GT0 C;  5FLM J;  2YU9 J;  3H0G J;  4IHY A;  2L0K A;  3HIM A;  3GBG A;  1TWA J;  1SGM A;  4AC6 A;  1IDZ A;  1LE8 A;  2LFB A;  3BRU A;  2HI3 A;  1MBK A;  1SAN A;  1MBH A;  3MN2 A;  2ZOZ A;  3FK6 A;  3O8G A;  2Y30 A;  3HOW J;  3ZQC A;  5C4Y A;  5E3M A;  2L9R A;  3G1M A;  3ZQH A;  2MG4 A;  1QVT A;  3EUP A;  3BTL A;  1JKQ C;  2VKV A;  5E3O A;  2G3B A;  4ICH A;  2EBI A;  1IG7 A;  1CQT A;  4A3D J;  2NVX J;  4A3L J;  1MBF A;  3HE0 A;  2VUM J;  2LD5 A;  3QBM A;  1RKW A;  4NEL A;  5EGO A;  4XID A;  1U9O A;  1FIA A;  3CDL A;  3ON4 A;  4XIC A;  1X58 A;  4UUT A;  3VVX A;  4GFK A;  1HLV A;  3JRG A;  3H3V K;  9ANT A;  4ABZ A;  3C07 A;  3F1B A;  1A6I A;  3VUQ A;  2E19 A;  1GV2 A;  3VW2 A;  3IUV A;  1IDY A;  4C2M J;  4AC0 A;  1PUF A;  1P7J A;  3VW0 A;  3GEU A;  3RZO J;  5EYR A;  1GUU A;  4BY7 J;  2YVE A;  3CCY A;  5GPA A;  3T6N A;  2RAE A;  1FTT A;  3M3Y J;  3KZ9 A;  5IYB J;  1H8A C;  2F07 A;  3RZD J;  5EEA A;  2ID3 A;  2Y9Y A;  4I76 A;  5EZH A;  3P9T A;  2EZH A;  4DW6 A;  2QWT A;  1JT0 A;  4ACI A;  2N8G A;  2HXO A;  1OFC X;  3UKG A;  2XB5 A;  2TCT A;  1S7E A;  1MSE C;  4DZP A;  2JA7 J;  1NTC A;  2REK A;  2UXI A;  3ON2 A;  4I6Z A;  3B6C A;  1ZGW A;  3VVY A;  5F0C A;  1R9T J;  3BJB A;  3E7Q A;  4IHX A;  2EQR A;  2Y0S N;  4ME9 A;  1VND A;  3GTJ J;  4L62 A;  3BG3 A;  3VPR A;  3W6V A;  5F0F A;  2FQ4 A;  2DA7 A;  1OCP A;  2G7L A;  1YRN B;  3DCF A;  1BW5 A;  3BT9 A;  2G7G A;  3CWR A;  5K7Z A;  5J1U A;  1UI5 A;  1Z77 A;  2ZB9 A;  4PXI A;  1TC3 C;  3HGG A;  4JYK A;  3CMY A;  3CQZ J;  3Q0V A;  4B3A A;  4A3G J;  2CQQ A;  2XB0 X;  3I4M J;  4A3M J;  1SFO J;  1RR7 A;  4A3I J;  1ETQ A;  3EGQ A;  4RBO A;  5FKK A;  3S17 J;  4A3F J;  2DA3 A;  1K61 A;  2X9D A;  1WI3 A;  1RPW A;  4MFE A;  1F43 A;  2WV1 A;  2JWT A;  4A3J J;  2ELK A;  3PPB A;  1WH7 A;  2L7F P;  4AUX A;  3NRG A;  4KWA A;  1UG2 A;  2MGQ A;  3OOU A;  2XPW A;  2MSY A;  1ETO A;  4V2G A;  1JKR C;  1Y1V J;  4D7N A;  3S14 J;  4DYQ A;  3B81 A;  2MW8 A;  5EF6 A;  1Y1W J;  2KT0 A;  1MNM C;  1X2M A;  2OF7 A;  1UMQ A;  3PO3 J;  5J3L A;  2VKE A;  4HKU A;  3VIB A;  3BR3 A;  5FKO A;  5H9T A;  1ETY A;  3K7A J;  2QF7 A;  1H88 C;  2QKO A;  2LLK A;  2ME6 A;  3DPJ A;  5J1R A;  2E2J J;  1MH3 A;  1T33 A;  3G1L A;  4L5E A;  5C3E J;  2GBY A;  5IOY A;  3HEF A;  1WPK A;  2HOT A;  2HYT A;  5FKN A;  3TW7 A;  2HQ5 A;  5EZG A;  3A01 B;  2OER A;  3HTI A;  1LFB A;  2HOA A;  4CYC A;  2CRG A;  2JMW A;  2O7O A;  4YZE A;  2OPT A;  1RKT A;  2XGE A;  3TP3 A;  1YRN A;  3B6A A;  1FTZ A;  4IHV A;  2R7Z J;  1ENH A;  2I10 A;  2DA4 A;  1ETV A;  3AQT A;  1XC5 A;  2QCO A;  1I3Q J;  2NS8 A;  3HKZ N;  3JRE A;  3ZQL A;  3S1N J;  4A69 C;  5IP6 A;  1HOM A;  3GZI A;  3V6G A;  4M3B A;  5FJ8 J;  3C2B A;  4X6A J;  2DA6 A;  1JGG A;  2XDN A;  2ID6 A;  2V57 A;  3A02 A;  3NAR A;  3ANG A;  2NX4 A;  3NNR A;  4D7M A;  3PM1 A;  3QPL A;  1RET A;  5IP7 J;  3NPI A;  1XS9 A;  1WH5 A;  3VOK A;  1TWG J;  2DA2 A;  2DN0 A;  1I6H J;  3COL A;  1G2H A;  2NOG A;  1ZR2 A;  5J1Y A;  1AHD P;  4IHW A;  2IAI A;  4B1R A;  1OCT C;  2LKX A;  3PO2 J;  1FEX A;  3ZQI A;  3BTJ A;  5DAJ A;  1Q1V A;  4BY1 J;  1BA5 A;  2R93 J;  3VOX A;  5IOZ A;  1MSF C;  3GTQ J;  1U78 A;  3CRJ A;  4GCL A;  2DJN A;  4BKX A;  1JUS A;  3IH2 A;  2NP3 A;  5EDN A;  3A01 A;  3JRB A;  1ETW A;  2Y2Z A;  4MLO A;  3RD3 A;  2Y31 A;  3HTA A;  4QTR A;  4FE7 A;  2LY9 A;  4XRS G;  3HTJ A;  4D5C A;  1B8I B;  3ZQG A;  3GTL J;  2Q24 A;  2E2I J;  5FKM A;  3ZQF A;  3AQS A;  3GTM J;  4MIM A;  1IJW C;  1TWC J;  3RH2 A;  2NVY J;  1B72 B;  5HOD A;  4CGR A;  1NK2 P;  3JRC A;  2O9L A;  1MBJ A;  4QSH A;  5D18 A;  3BTC A;  3QKX A;  2G0E A;  3WHC A;  3Q0U A;  3LWJ A;  3BR1 A;  4M3E A;  3NI7 A;  5IP9 J;  5CXI A;  3BTI A;  5EG0 B;  3HOY J;  1MBG A;  5GPC A;  2GM4 A;  4DYC A;  3JRI A;  1BL0 A;  3FKI J;  1ZK8 A;  4A93 J;  2R92 J;  4UUS B;  2M9H A;  3ZOB A;  2ZCX A;  1HDP A;  4JX4 A;  1NK3 P;  3LSG A;  3MVP A;  3KKC A;  1VFC A;  3L1P A;  2CJJ A;  4GFB A;  4W1U A;  1QRY A;  5M5W J;  1JJ8 C;  4GFL A;  1ZTR A;  5K7H A;  1I50 J;  3Q0W A;  3S16 J;  3HGY A;  4B4C A;  2X48 A;  1F36 A;  2IU5 A;  1TWH J;  2P81 A;  1BJZ A;  1HF0 A;  2M8G X;  5HSZ A;  4A3E J;  1IV6 A;  3LSR A;  5IYD J;  5FHP A;  2DA5 A;  4MO7 A;  2O7T A;  3OIO A;  3BQY A;  2DMN A;  5C4X J;  2KDZ A;  2DG7 A;  3A03 A;  2VPR A;  4Y7N J;  3TED A;  2DA1 A;  1MBE A;  5DTD A;  3SJM A;  1EF4 A;  5EGO B;  2R5Z B;  3LHQ A;  2H1K A;  5HBU A;  5BNG A;  2QIB A;  2K9Q A;  3IH3 A;  3TP0 A;  1B8I A;  1FJL A;  1DU6 A;  4S0H B;  5E3N A;  4M3G A;  5M3F J;  5F08 A;  4W97 A;  2HYJ A;  1ZQ3 P;  4LOC A;  2JA8 J;  2FBQ A;  2AO9 A;  2DMQ A;  1B72 A;  2K40 A;  1IRZ A;  2XPV A;  5CXG A;  3RKQ A;  1W0U A;  4AF5 A;  2WGB A;  4BBS J;  3HM5 A;  1IC8 A;  2E2H J;  4AYB N;  2LP0 A;  5AQC A;  1FIP A;  1JTX A;  2B63 J;  5K58 A;  1UHS A;  2HOS A;  2ZCM A;  2UXU A;  2CUF A;  2H8R A;  2WUI A;  2OI8 A;  1GV5 A;  5EG0 A;  4GCT A;  4M6V A;  4C3H J;  3S2H J;  3G1O A;  3HDD A;  5IYC J;  1XG1 A;  3MNL A;  4UUS A;  3SDG A;  3NAU A;  2E1O A;  4XK4 A;  1JUM A;  1Z0X A;  1POG A;  3GTO J;  2UXP A;  5FGL A;  5JLW A;  2JA6 J;  2RHA A;  5HAW A;  3JRD A;  4M3F A;  5M5X J;  3S2D J;  2WAQ N;  3QPS A;  4V2F A;  2DG8 A;  3ANP A;  3HOZ J;  3G7R A;  1RES A;  3FIW A;  5GP9 A;  3BQZ A;  2ECC A;  3HB9 A;  2JJ7 A;  4D5F A;  2UXO A;  5CW8 A;  2GEN A;  2DMU A;  3BG9 A;  3S1Q J;  3TW6 A;  2R5Y B;  2UXH A;  2L7M P;  2TRT A;  4EEF G;  1VF9 A;  4X1E A;  4FE4 A;  2Y9Z A;  2NS7 A;  1U9N A;  4MFD A;  3FIS A;  1P7I A;  3D1N I;  5F0H A;  5M5Y J;  1APL C;  2YVH A;  3JRA A;  3HTH A;  3Q3S A;  1QPI A;  2W48 A;  4JL3 A;  2M0C A;  3NXC A;  5IPA A;  2PMZ N;  3CJD A;  1ZR4 A;  1JTY A;  2HXI A;  3LSJ A;  2X6O A;  2XSD C;  2R5Z A;  2FD5 A;  5EFY A;  1JJ6 C;  2JN6 A;  4HNV A;  2GUH A;  1A5J A;  2LK2 A;  3E7L A;  2LVS A;  3O60 A;  1BW6 A;  3S5R A;  2W53 A;  2L7Z A;  5DS9 A;  5C44 J;  3HOU J;  2ZOY A;  3HBL A;  1AKH B;  2K9N A;  3F0C A;  2JK3 A;  2G7S A;  3V78 A;  3KNW A;  4A3K J;  2GFN A;  2EZL A;  3RQI A;  3JSJ A;  1ETK A;  4GCK A;  2M2E A;  2HDD A;  3LNQ A;  2NVT J;  1QVU A;  2COB A;  1U8B A;  2HKU A;  2NP5 A;  2PZ9 A;  3BR2 A;  4C3J J;  2CQX A;  3BCG A;  3BG5 A;  3WHB A;  3FK7 A;  2IBD A;  1WGX A;  1GDT A;  2EZK A;  4IEJ A;  1H89 C;  1HDD C;  1LFU P;  2QTQ A;  2FX0 A;  3S15 J;  4C3I J;  4FTH A;  2WB1 N;  2RAS A;  4JP0 A;  3VW1 A;  1JT6 A;  2O8K A;  2K9S A;  2LR8 A;  1WCM J;  2CU7 A;  2FJ1 A;  2R0Q C;  4J19 A;  3M4O J;  4A3B J;  1JKP C;  2YS9 A;  2ZCN A;  2PBX A;  4BBR J;  3I4N J;  4NN1 A;  2GLO A;  1ORK A;  4QIW N;  1TWF J;  2EZI A;  3IH4 A;  3IV5 A;  1O4X A;  2XGC A;  4M3D A;  2R5Y A;  4MXM A;  4A3C J;  3O8H A;  3LOC A;  1JKO C;  4UDS A;  2LTP A;  4CYC B;  4XRS A;  2D6Y A;  1VI0 A;  3OSG A;  2CUE A;  2ECB A;  1HCR A;  3KKD A;  2DMP A;  3JRF A;  3JRH A;  4NDL A;  2DTZ A;  1ETX A;  1GVD A;  1X2N A;  3BHQ A;  3GTK J;  1LE8 B;  3JR9 A;  3GTG J;  2YUS A;  2VI6 A;  1K83 J;  4MK6 A;  5C4J J;  3K2A A;  3MKL A;  3BR5 A;  5E3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...