2ID6A

Crystal structure of transcriptional regulator (tm1030) at 1.75a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of transcriptional regulator (tm1030) at 1.75A resolution
rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, TetR FAMILY
total genus 75
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2006-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2id6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2id6A02
3EGQA 4HNVA 3S1RJ 4M3FA 1LE8B 4W1UA 4JL3A 2F07A 3BHQA 2QKOA 2JWTA 3HOUJ 3ZOBA 3OSFA 4AUXA 3H0GJ 3NARA 5BNGA 2ZCMA 3S2DJ 1ZK8A 3S5RA 3E7QA 1ETWA 3FRQA 3GTLJ 4QTRA 1HOMA 2LFBA 4M3GA 5M3FJ 1HLVA 1U78A 2E1OA 3T6NA 1BW6A 3GTJJ 5CXGA 3RZDJ 3VOXA 1GV2A 2FX0A 5C44J 3K7AJ 3GTPJ 2Q24A 1X2MA 1IDZA 2MW8A 1H8AC 5AQCA 4C3IJ 3GTQJ 5IYDJ 5F1JA 1FIPA 1JTYA 1IRZA 3WHBA 2HDDA 2ID6A 2ZCNA 2LP0A 3OOUA 1ETOA 5F0CA 1APLC 5IPAA 3SDGA 3V6GA 2M9HA 4L62A 1Z77A 3CDLA 3BTCA 3JRBA 5D19A 3DPJA 3UKGA 3GTOJ 2GM4A 1GUUA 4NDLA 5EGOA 4AF5A 1FJLA 2L7ZA 4C2MJ 3GZIA 5K58A 4KWAA 1JUSA 3BT9A 2CU7A 2W48A 3BR0A 3RD3A 3VVYA 3HGYA 5DS9A 1YRNB 3ANGA 4MK6A 3Q0VA 2G7SA 4FE7A 1MBGA 3GEUA 3LSGA 5M5YJ 3V78A 2K9SA 3JRDA 1GVDA 5M3MJ 1B72A 4A3GJ 4Y7NJ 1OCPA 1VF9A 5M5WJ 1IGNA 4IHYA 5D1RA 2OI8A 1GV5A 2NVYJ 2CQQA 4AYBN 2FJ1A 2YVHA 1EF4A 2VKVA 3MNLA 2CUEA 2O8KA 4X1EA 1ETKA 4FCYA 5HBUA 1JTXA 1YRNA 4IHWA 1XC5A 1MBKA 2ME6A 3BR2A 1F36A 2AO9A 1ZR4A 1VI0A 2DA4A 1IV6A 1OCTC 3HTAA 2ZCXA 2ME0A 4FTHA 5EGOB 3QPSA 1JUPA 2GLOA 1AU7A 2R7ZJ 4M3EA 4MFEA 5IP7J 2NOGA 4JKZA 5FMPA 2COBA 2M8GX 4JYKA 1LE8A 4G12A 2ZOYA 2HOSA 5CW8A 1Z0XA 1UI5A 1MBHA 2DG8A 4AC0A 2UXUA 1ETQA 4GCLA 4BKXA 2MGQA 5JLXA 4D7NA 1MNMC 4HKUA 5DTDA 1MH3A 3O8GA 5C4YA 2OPTA 3AQTA 5C4XJ 4J19A 1Q1VA 4RBOA 1TWFJ 3LNQA 3VW0A 2VPRA 3I4MJ 2DJNA 1BA5A 1S7EA 3JRAA 3B6AA 4DW6A 2KDZA 4BXXJ 4GFLA 3JREA 2NS7A 4UUSB 1ITYA 1ETYA 3SFIA 1P7IA 3IH4A 3BTLA 5M5XJ 1JUMA 1BW5A 2ZB9A 3S17J 3VVXA 1WGXA 3S14J 2YVEA 1I50J 4M3DA 3KKDA 4C3JJ 2QIBA 1Y1WJ 3GBGA 4X6AJ 4MLOA 5H9TA 2YUSA 2LLKA 4A3LJ 2XGEA 2L0KA 3LSJA 2V57A 2ECCA 3KZ9A 1NTCA 1IUFA 2B63J 1MH4A 3BR6A 4A3BJ 1W0TA 1MBEA 3EUPA 3MKLA 4B3AA 1FEXA 2W53A 3PO2J 3NPIA 5IOYA 4MXMA 4C3HJ 1IDYA 4S0HB 4JX6A 2D6YA 2JK3A 3BNIA 1IJWC 3F1BA 3VUQA 4A69C 1H88C 4JX5A 5IP9J 1H89C 1OFCX 2RAEA 1A5JA 2EH3A 2PBXA 3COLA 1QVUA 2GBYA 2L7FP 2XRLA 4NN1A 3WHCA 2VUMJ 2LKXA 5DAJA 2M0CA 3HOZJ 3SJMA 2EZIA 2ID3A 4RDUA 2EQRA 2I10A 5C4JJ 3BJBA 2XPWA 2L7MP 4CYCB 3LSPA 3G1LA 3IH3A 1HCRA 2EZKA 3BG5A 3E7LA 4B4CA 5EEAA 4ME9A 1ENHA 2HYJA 1JJ8C 2NVTJ 2DA3A 2CUFA 2EZLA 2X9DA 4B1RA 3BG3A 1D5YA 2WB1N 4L5EA 2NVQJ 3AQSA 1K61A 2JN6A 4A3FJ 1RESA 3JR9A 3VP5A 5E3NA 2G3BA 2DA1A 3BQZA 5F27A 4DZPA 3BR1A 2K40A 3NXCA 3CWRA 1DU0A 5D18A 3HGGA 2XB0X 2R0QC 2GUHA 2NX4A 2HOAA 3L1PA 2XGDA 3BR3A 3CRJA 2DMNA 4A3DJ 1ZGWA 3HM5A 3O60A 3VPRA 5K7ZA 3FKIJ 3ZQHA 3JRCA 3CCYA 1GDTA 5FLVA 2RHAA 1E3OC 5EG0B 2H8RA 5K7HA 4DYQA 5EYRA 3HTJA 5FKNA 4XRMA 2NVXJ 1T56A 3IH2A 5EZHA 2Y30A 3RZOJ 4JNNA 1JKOC 1BJZA 5HODA 1I3QJ 2O9LA 4PXIA 1U9NA 4XIDA 2HXIA 3ZQLA 3BR5A 3FK6A 5FGLA 1ETVA 3W6VA 3LWJA 4GFKA 3FK7A 3I4NJ 2G7LA 2DTZA 2QCOA 3A01A 1AKHB 4UUTA 2E2IJ 4A3IJ 2M34A 1NK2P 4FISA 1POGA 2LY9A 3S16J 4Y52J 5FJ8J 2REKA 2QF7A 4V2FA 1P7JA 4M3BA 2ECBA 4M6VA 5HAWA 1TWHJ 2XGCA 1IG7A 3IV5A 2LD5A 2UXOA 4ACIA 4XK4A 3MVPA 5EDNA 2E19A 3VIBA 3QQAA 1X58A 2LR8A 3VOKA 2LTPA 4A3CJ 2Y0SN 2WAQN 1U9OA 1X2NA 2LK2A 3PASA 3A03A 1U8BA 1XG1A 1SFOJ 4D5FA 4A3JJ 1B8IA 4QSHA 1ZKGA 2K9NA 2DMTA 1VFCA 5IYCJ 1UI6A 3HOVJ 1PUFB 2WUIA 5FKLA 3FISA 4XICA 3LJLA 3Q3SA 1XS9A 4W97A 2XDNA 3VW2A 3CMYA 1JT6A 3B6CA 5IOZA 1BL0A 2ZOZA 4JP0A 3JSJA 3HIMA 5J1UA 4V2GA 2EBIA 3BTIA 2P81A 1G2HA 3LHQA 3CQZJ 3BCGA 2TRTA 3PPBA 4A93J 2Y2ZA 2YS9A 1MSEC 1UG2A 2JA6J 9ANTA 5F04A 2CJJA 4AC6A 3QKXA 4EEFG 2RASA 1WI3A 3G1MA 3NNRA 4MFDA 3IUVA 3JRFA 4BY7J 4GCTA 2HXOA 1QVTA 3RQIA 2K9QA 2M2EA 5EG0A 2H1KA 2R92J 1WH5A 5EF6A 4DYRA 3JRIA 2QOPA 4DYCA 2YU9J 1PUFA 2L9RA 4MO7A 3MN2A 4BBRJ 5J3LA 2JA5J 3TP3A 2E2HJ 2G7GA 2ELKA 3DEWA 3CJDA 3LOCA 1Y1VJ 3VW1A 4IHVA 2DA5A 1WPKA 4A3MJ 3GTGJ 1ZQ3P 2JJ7A 2E2JJ 2AHQA 3JRHA 3BTJA 1CQTA 3HEFA 5GPAA 3ON2A 4D7MA 3S15J 3PM1A 2HOTA 1FTZA 1VNDA 2DN0A 3TW6A 2TCTA 2HKUA 3KNWA 2DG7A 2X48A 2HI3A 1UMQA 4IHXA 1RPWA 4BY1J 5E3MA 1JJ6C 1LFBA 1ETXA 2MSYA 3Q0WA 2DMQA 2Y9ZA 3HKZN 4FE4A 3PO3J 2G0EA 3H3VK 5E3LA 5FLMJ 4NELA 3BRUA 3ZQIA 1MBJA 2N8GA 2XPVA 3HTHA 4ABZA 5FKOA 3BG9A 1IC8A 4I6ZA 1TWAJ 3HTIA 3S1MJ 1B8IB 2O7TA 2DA2A 2UXHA 2HYTA 2X6OA 1TWGJ 1JT0A 3HB9A 5K7FA 2JA8J 3ANPA 2IEKA 3S1NJ 4IEJA 2WV1A 2Y9YA 1QPIA 5GPCA 4UUSA 5FKKA 5IP6A 2GENA 1A6IA 2HQ5A 4MIMA 4XRSA 1FTTA 5GP9A 2XPUA 5F0HA 3HOXJ 1SGMA 3G56A 3K2AA 2DMPA 1TWCJ 1I6HJ 1HF0A 3P9TA 2O7OA 1RR7A 5EZGA 2DA6A 3NAUA 3ZQFA 1ZTRA 4A3EJ 3A01B 3M3YJ 1K83J 2D5VA 1B72B 2NP5A 3OIOA 1ORKA 2DMUA 1SANA 2NS8A 5J1YA 3DCFA 2R5YA 1JKPC 4DZJA 3OSGA 3HOWJ 2IBDA 3S2HJ 3A02A 1RKTA 3Q0UA 2R93J 5J1RA 3NI7A 3RH2A 3C2BA 5E3OA 2KT0A 4I76A 2MG4A 4A3KJ 1MSFC 2WGBA 2PMZN 5IYBJ 1HDPA 3VVZA 2NP3A 2DA7A 1R9TJ 2UXIA 3RKQA 2Y31A 3LSRA 2CQXA 2XSDC 2VI6A 3HOYJ 3QPLA 2OERA 3G1OA 2CRGA 3TEDA 3S1QJ 3QBMA 2LVSA 2R5ZA 2IAIA 1JGGA 4D5CA 1AHDP 5C3EJ 1F43A 3G7RA 1QRYA 3GTMJ 5FKMA 3TP0A 2QWTA 1NK3P 5JLWA 4CYCA 1W0UA 1RKWA 3KKCA 1T33A 3O8HA 4UDSA 1FIAA 1GT0C 1OJLA 2UXPA 2R5ZB 5F0FA 1TC3C 2OF7A 3GTKJ 4GFBA 1MBFA 3HBLA 4JX4A 2XB5A 4QIWN 1ZR2A 3HDDA 5CXIA 3BQYA 3TW7A 1DU6A 5EFYA 2IU5A 5HSZA 2PZ9A 4GCKA 2QTQA 1WCMJ 3FIWA 4YZEA 3ON4A 3HE0A 4ICHA 3ZQGA 4LOCA 2FQ4A 2JA7J 4CGRA 3D1NI 2FD5A 1RETA 3F0CA 1UHSA 2FBQA 1WH7A 1LFUP 4XRSG 2GFNA 1HDDC 1JKRC 4BBSJ 2R5YB 1AKHA 5F08A 3ZQCA 3NRGA 3M4OJ 5FHPA 2JMWA 3JRGA 1JKQC 3C07A 1O4XA 2EZHA 3B81A 2VKEA
chains in the Genus database with same CATH superfamily
3OYAA 2CQ7A 1J75A 4HNVA 2HPIA 3S1RJ 3EGQA 1LE8B 2F07A 1XMKA 4R1HA 1MMDA 1VZ0A 1TQMA 4UB8C 3GX4X 2R3SA 1K78B 2OU2A 3S2DJ 1ZK8A 2I5UA 3AG2H 3S5RA 3CDHA 3H5RA 1VQLI 3S32A 1N78A 4QTRA 4BQOA 3AL0C 2LFBA 5M3FJ 4IZZA 2E1OA 3FMSA 1GXQA 3GTJJ 4LG3A 2DXIA 2VOPA 3RZDJ 1GV2A 1IN4A 2L54A 3DPUA 5C44J 4RB1A 1XGNA 2ZXJA 5FD5A 5HNFA 4P55A 3T8RA 3TDZC 1T6SA 1KQ0A 2DJIA 2L3DA 4PSWA 5DCMB 4UV8A 5D4SA 4EJWA 4NC8A 5DM7F 4C3IJ 1JTYA 2H6BA 2Z3YA 4OAZA 2XSJC 3HRUA 2ZJQF 1EKEA 3R4KA 2LP0A 1ZRDA 2W85A 5FLXK 4A2UA 3D5RC 4EGZA 5CVRA 1FYKA 3V6GA 1YX5A 2BVMA 4I7HA 3CDLA 5D19A 2G7UA 2ZNYA 2XAQA 4PJ0C 4GYIA 1GUUA 5EGOA 1XDUA 2GIVA 4C2MA 2L7ZA 3QOEA 4C2MJ 4RB2C 1OYWA 5DEQA 5J8FA 5LGUA 4OD4A 3VVYA 3REOA 3PSFA 2E1NA 3TOAA 3HSEA 3RJPA 2KP6A 4E6KG 2C6YA 4FX0A 3DTIA 3NEUA 3V8JA 2K9SA 1MMGA 3JRDA 1YJNI 4HYEA 4Y17A 5D1RA 3H9JA 1BOAA 2CW7A 3LAPA 5M5WJ 1WI9A 4A3GJ 2B1EA 3W2VA 3VTIA 2CUJA 2NVYJ 4CCKA 2JZYA 2YVHA 5DDGA 1OMIA 2KISA 2BYVE 4AIKA 2XVCA 1ETKA 2YX7A 4A5NA 4E70A 1YRNA 4M73A 2AS5F 1XC5A 2ME6A 1W5CC 3ASNH 1FY7A 3GO5A 2ME0A 2K7LA 3V7SA 1AU7A 4GDFA 3LSKA 1K4SA 2HS5A 2JSPA 4HF0A 2M8GX 4JYKA 4JBAA 2BW3B 4YIIA 1Z0XA 2UXUA 3WTWC 2BY3A 1P4WA 4BKXA 2MBFA 2DT7B 5EJCA 1MNMC 1E17A 4HKUA 4XNFA 1G3YA 5C4YA 2O61A 4RLFA 1TWFJ 1XGSA 3VYSB 2BHZA 1KQ8A 2DJNA 3HPHA 1BA5A 3PNYA 1KU2A 1QQIA 3B6AA 4DW6A 2RDPA 3KP6A 3JREA 4F93B 2V9KA 2BZTA 5GTHC 5F1RA 5HVQC 2O5RA 4RA2A 3DPTA 1P7IA 3AKZA 1BW5A 3P5JA 2QA4I 3VVXA 3JSOA 2ZCWA 4LD5A 2VOOA 1I50J 2Q1ZB 3F23A 2V7FA 3KKDA 2QIBA 1Y1WJ 4ESFA 1T8IA 1YJWI 3F8BA 3BOQA 2RQQA 2UUZA 2MD0A 1FSHA 5H9TA 4J00A 1YFHA 2LLKA 2V79A 4P1WA 3SWHA 3TL4X 1XSDA 2VJ4A 4OINF 2XC7A 3MKZA 4PJMA 4LB5A 3MD2A 1W1WE 4C2UA 1MBEA 2FMYA 3MKLA 1LB2A 4E4HA 1CF7A 3R60A 4LLGF 4HV6A 5IOYA 1SMTA 2D6YA 2KIMA 2JK3A 2NRAC 1IJWC 4L9TA 3BNIA 1WJ5A 2EFQA 4JX5A 4HPQA 4PJJA 4YEJA 1YJ9I 2BEOA 1T0FC 2EFOA 5LEKA 2A61A 1RR8C 1BBYA 1OFCX 1U0JA 2RAEA 1A5JA 2EH3A 2PBXA 3OV8A 3COLA 2RC4A 2L7FP 2A07F 3WHCA 2LKXA 4WF2A 2PN6A 1X1PA 3L2VA 1ON1A 2LH9A 3UNGC 5D5WB 3FXRA 2BHYA 4AIDA 2P7VB 3LA2A 2P5VA 1AA7A 2ZC2A 3CUQB 4NC6A 2DYRH 3G1LA 1DDNA 1K7AA 2EZKA 4NQWA 1G3WA 2YR2A 3CMMA 5EEAA 3WG9A 4DBQA 1JJ8C 1I6XA 3S3OA 3FKJA 3SYTA 4YFXF 4B1RA 1U5TC 5FRMA 2WB1N 3ECHA 2HTJA 1K61A 4GGGA 2VKDA 3DFGA 3RI4A 4PJNA 3X2QH 1R5ID 3WTUC 3NXCA 3CWRA 2R7VA 2CH0A 1NG7A 3F22A 3CP2A 4CCOA 1DP3A 2XB0X 2R0QC 1D0XA 1X1CA 3K1PA 1FZPB 2HOAA 3ABTA 2FNAA 1XB4A 2XIGA 4Y13A 3ESWB 2OQGA 4BQQA 3DKWA 2H6CA 5IY5H 3FKIJ 2ZBKA 2QWWA 2ADUA 3JRCA 2RHAA 3ROUA 1E3OC 4NNJA 2LG4A 4K2EA 1VQPI 2QSGX 3E6CC 1D1AA 1R5GA 3ABKH 5FKNA 3FMQA 1SVOA 3V8KA 1T56A 4BXUA 1R1TA 3F8MA 5LD2C 5J4YA 2BVLA 4HBLA 3LA3A 4KMUX 2LKPA 1BJZA 4ENMA 1I3QJ 4ANJA 4CCJA 4PXIA 3ELKA 4XIDA 5FRNA 2P0WA 2CFXA 3FK6A 1YTYA 4OMZA 1ETVA 3LWJA 3MFKA 3CCQI 3BZ6A 2VXZA 3I4NJ 1R1VA 2G7LA 1R49A 2B9SA 5D5XB 3A01A 2LF8A 2E2IJ 1D8JA 3BPVA 4L9NA 1UELB 4BQNA 4ZH4F 2DOAA 2M1BA 3KYDB 4FISA 4II2A 2GXAA 4ZYHA 3OS2A 1Y0UA 3Q9VA 4V2FA 1W36C 2ZXIA 4H0EA 2KKOA 1IG7A 4ACIA 1G6NA 1WJEA 5EDNA 3PJRA 5JI6A 1T95A 4II3A 2P5LC 2EB7A 2LTPA 1E0EA 1BIBA 4AVPA 1GXPA 4ZJZA 4WX9A 3EUHA 2M8EA 4BUPA 3CO6C 2DMTA 1Z21A 1ZGJA 3JW4A 3KYLA 1UI6A 1SAUA 2K9LA 4OOIA 5KAFC 3LJLA 4A0ZA 3HHGA 3IRRA 1JT6A 1U5TA 3K4CA 5IOZA 1I1GA 2IVMA 1BL0A 2EBIA 3BTIA 3VEPA 1G2HA 3LHQA 1B9NA 3BCGA 5ILUA 4J01A 2F5VA 2R7FA 2G9WA 1YO5C 3BLYA 9ANTA 4AC6A 2DI3A 2DLLA 4HLXA 1RC9A 3KIOA 1UFMA 2F5FA 3NS4A 3PIOF 1OR7C 2WAQA 4FETA 3JRFA 2NYXA 1BI0A 1SAXA 1H9GA 4YFKF 4Z2YA 4RAFA 1AOYA 2AXTC 4HNTA 3S93A 3QP6A 3LMMA 1U8RA 2GA2A 5J3LA 1YYVA 3OYIA 2E2HJ 3M7GA 1OPCA 1T2KA 3CJNA 1BOBA 5BOXA 2CV0A 4LGWA 3DEWA 3SEQA 3CJDA 3VW1A 3F72A 1XD7A 3RPUA 2VASA 1KYWA 1WPKA 4ZTFA 3VSLA 3M1CA 2KRHA 2DBBA 3TO6A 3HEFA 3QP5A 4S04A 2QENA 5GPAA 3ON2A 3S15J 2FOWA 2M0MA 3GCMA 3HRMA 3RCOA 2O0YA 3G6EI 2DG7A 1UMQA 1RPWA 2MFZA 4AWXB 1VQ9I 5E3MA 2MSYA 1ETXA 1HXDA 2XDVA 3Q0WA 2Y9ZA 3HKZN 5LLQA 3OYNA 2G0EA 3T5XA 3HL2A 3C18A 1ZRFA 3BRUA 3CUOA 5L3GA 1MBJA 3KP4A 1LEBA 5LHGA 1T08B 3IHUA 3ABMH 3HTIA 3S1MJ 2A05A 3OIQA 3V4GA 4M72A 3WE3A 5LRSA 1JT0A 3HB9A 1X4OA 4HV5A 1J2XA 4EGYA 1QGPA 3S1NJ 4IEJA 1QPIA 2V1XA 2ZMEC 3GFJA 3T8TA 5FKKA 1I27A 4UVCA 1XCBA 3K4LA 2DODA 1SGMA 1QBJA 5F0HA 3HOXJ 4MTEA 1OR7A 4E7SA 4D9JA 3P9TA 5J47A 1N25A 5EZGA 3GF2A 3OR2C 2DA6A 1Y0NA 3ZQFA 1FMWA 1BN5A 4BYYA 2CW8A 1K83J 5LHIA 3VODA 1ORKA 1Z91A 2NOJB 3I4PA 3DV8A 1JKPC 4KMFA 3BJ6A 2JUCA 3F6VA 2B7EA 3FXKA 5ILVA 2IBDA 2R93J 3NI7A 3DTKA 2KT0A 2RQPA 1ZRCA 2DOEA 4A3KJ 3E5QA 1MSFC 2EV6A 4UUVA 5IYBJ 3MWMA 4BEHA 4HF2A 2UXIA 2Y31A 3J81K 3QPLA 1J9IA 2OERA 3G1OA 2WBMA 4EV0A 5JHFA 4HA8A 4PSXA 4ON0A 5E79C 4XMYA 4IL6C 2VC1A 4RAGA 1R4NB 4CCNA 5FKMA 4CYCA 1RUNA 3ZPLA 1MGTA 1UHWA 2LBFA 4RS8A 4BGDA 2R5ZB 5F0FA 4DOZA 2XAJA 2OF7A 3WGIA 3GTKJ 4ZYGA 3OY9A 5DM6F 2HQNA 3HDDA 2Z2SB 4EVIA 1HKSA 4BJ6C 5EFYA 2Z1DA 2XKOA 1FBQA 3A4CA 4GCKA 3DTEA 1I5ZA 1YE9A 4CGZA 4YZEA 2WB1A 3G4SI 1LQ1A 3F8CA 4BE0A 1IXSB 3ZQGA 4L18B 4GCVA 1I1SA 2RGVA 3E5XA 3F0CA 5ICCA 5E17F 3SXYA 1T98A 1LFUP 1IAWA 2IGOA 1ZAOA 1YIJI 2GFNA 4BBSJ 5F6FA 1BR2A 1R5HA 5DCMA 3L00A 1A04A 1LPQA 5FHPA 2AXLA 2D45A 1S9HA 1O4XA 5TGTA 3B81A 5D4RA 1HW5A 1TZLA 2HWVA 2P8TA 3ZOBA 2M45A 1IRXA 4M71A 3OSFA 1DQUA 1SVLA 1YW7A 4AUXA 3G3ZA 4ZTJA 4JQFA 5BNGA 1K78A 2ICWG 2ZCMA 1P2FA 3L7WA 3K69A 1ETWA 4EM2A 2R7WA 1HOMA 3LSMA 3H9QA 3CC2I 1U78A 1L3LA 5LHHA 3KPHA 3VOXA 3H5NA 2FX0A 4L9VA 3V7RA 3GTPJ 4UVAA 2Z33A 4Q48A 4O6JA 3T0YA 1X2MA 4D1QA 3CTAA 4KYWA 2O03A 1KU7A 2CQNA 2L9VA 3GTQJ 3WG7H 5IYDJ 1IRZA 1XGOA 2DFIA 2OTJI 4M9SA 2ZCNA 4XLFA 1TQPA 3CF2A 3H3UA 2EILH 2P5KA 3ERED 1FC3A 3L2QA 2ZJPF 3W2AA 2YSRA 5CVIA 3BTCA 3G2BA 2A6TA 2W82A 2GM4A 3GTOJ 3A0HC 3MMYB 2IP2A 2KFDA 3K4MA 1XX5A 4RMNA 1AWCA 2KZGA 1YOVB 5CYVA 1FYMA 2IS6A 1SFXA 5GAEJ 3BR0A 2V6EA 2RV8A 3HGYA 5DS9A 3E6DA 4MQVA 1XSVA 1Y6IA 4FE7A 2M7BA 3COAC 1MIJA 4XKBA 2F48A 2R7DA 5M3MJ 3FXJA 1B72A 5D8LB 1IGNA 1S6LA 4G94A 4AYBN 4PFPA 1WFXA 4FQGA 1T38A 2BY2A 1EF4A 2VKVA 3MNLA 2PMZA 2PEXA 4B09A 1WWXA 3AAFA 1JTXA 1BI3A 1P9QC 2BW3A 2MC3A 5JVTA 2IGNA 3I58A 2VQLA 2QEXI 1MBKA 3DF8A 5BMZA 3FXOA 1ZR4A 4IHWA 2VODA 2R7TA 1T39A 1OCTC 2ZFWA 4XRFA 4FTHA 4RM2A 1OKRA 1JUPA 2ELHA 4CCMA 4M3EA 4HX7A 4GRIA 4LG0B 3V8LA 5IP7J 2NOGA 4CICA 2W4SA 2KDOA 4N9IA 3KYCB 3GZNB 4RGXA 5JHUA 2HOSA 2STWA 2ZOYA 5CW8A 3OWTA 2FOKA 2OZUA 3GXOA 2E36A 4U7DA 2ZXWH 4UV9A 4ITVA 5TRDA 3DLAA 4PJLA 3AL0B 4GCLA 2HDWA 2MGQA 2VQHA 4OIPF 5DTDA 2XAHA 1LVKA 2OPTA 1JE8A 4BQAA 2PMHA 2KJBA 4BL0B 3LNQA 4CHUA 3I59B 3VW0A 3P7NA 2VPRA 4UVBA 4A0XA 3WTSC 3I4MJ 4IRVA 3JRAA 3ASOH 5IT9K 2EIJH 2F5DA 4UUSB 1EH8A 3O3KA 3GYHX 3ZN0A 4UY8I 2HZDA 2OUMA 3FBIB 3RYPA 1LDKB 5M5XJ 5F64A 5FFXA 1KQ9A 5J4VA 1V5GA 3S14J 3M1EA 1JGSA 3JAMK 3EUHC 4M3DA 2OCEA 4C3JJ 4FT8A 2OTLI 2FUG2 4B8XA 2VB6A 3IP4B 3PQKA 1VQ4I 4HNUA 4IQ4A 4L5IA 1F9NA 2JUGA 3WGGA 3LSJA 4IJAA 2IS4A 3LSHA 2V57A 2GA1A 1QPMA 1D1BA 5B3SH 2ECCA 3KZ9A 1IUFA 4IOCF 3HRTA 4A3BJ 3OYKA 1W0TA 2MC4A 2L01A 1FEXA 4N4NB 2VE9A 3VSKA 3CZ6A 2FRHA 4MXMA 1YG2A 1B6AA 1IDYA 1JXSA 4JX6A 1TW2A 3ONQA 3F1BA 2CFOA 2KLOA 5L3FA 2EFWA 1IN7A 1KU9A 3TDUC 5IP9J 3GFIA 2OQRA 4ZZLA 2WADA 1H89C 3I54A 3CJRB 1VQOI 1Y39A 2OJED 1Y8RB 2L4MA 2XRLA 2R7SA 2X85A 4QPQA 1VQ5I 2KPMA 1HA8A 3OYFA 3FDYA 1O3SA 1EH6A 2JVGA 2CV1A 2EZIA 2ID3A 1SFUA 4RDUA 1QHHD 2FMLA 2I10A 3KP5A 4AYBA 5C4JJ 3BJBA 2ELJA 3IKTA 2BXZA 3CMEI 2L7MP 2ISYA 3V7CA 4CYCB 2DT5A 3BG5A 2H8WA 4B4CA 4ME9A 3OYLA 1ENHA 1BIAA 2HYJA 1D5VA 2NVTJ 1ZELA 1U3EM 2R4GA 3FWEA 3KE2A 3BG3A 1J7KA 3LWFA 2NVQJ 1MDMA 2VN2A 2A5YB 3E6MA 3R0JA 4HOBA 2F2EA 1RESA 3JR9A 4BAYA 4XSZF 2DA1A 2V6CA 4LIUA 5LRRA 3BQZA 5F27A 4DZPA 3RTRA 2H1LA 1ZG5A 1SVMA 2ESNA 4XKVA 2GUHA 2NX4A 2JPCA 3L1PA 2XGDA 2DMNA 1ZGWA 3HM5A 1ACIA 4R8HA 2LREA 3RKWA 1R1UA 3PFYA 3OYGA 3ZQHA 4G7ZF 3GEZA 4ZYDA 2HYGD 4LLNA 1USSA 1R22A 2GZWA 2X4HA 4DYQA 5EYRA 3QU6A 4O5VA 2A68F 2PFVA 1DGRM 1S29A 2ETHA 4DNCA 3LL7A 4GYGA 3RZOJ 5H6RA 5GAHJ 4O3MA 2O9LA 1QO0D 2NS0A 1FSEA 3R61A 1U6GA 3ZQLA 1BI2A 3N05A 3KEOA 4KT5C 2F4OB 3CLQA 2DTZA 5FO5A 5JVGF 3MZ8A 2M34A 1HSJA 2WAFA 3L09A 1X1DA 1W4MA 1NK2P 1IRGA 4E7KA 2DO7A 2LY9A 3RKYA 2HZTA 5JR3A 2KQRA 3S16J 5FJ8J 1TTYA 1UJ8A 2REKA 2XF6A 4B44A 4DIQA 4G7HF 2XASA 2BBYA 2ECBA 1TWHJ 5DD4A 2LD5A 1N75A 4AIHA 5HDKA 2IA2A 2JVHA 3E0JB 1MNEA 4L0YB 3OMYA 3CC7I 2EPFA 2LR8A 5GAGJ 3OIPA 3ZMZA 2Y0SN 4LFUA 1T0FA 4HDVA 1U9OA 1X2NA 1ON2A 2KRFA 2LY2A 4RGUA 1SFOJ 2K9NA 1VFCA 2K85A 4CUGA 2CUZA 3HUGA 3HOVJ 2PJRB 3DKYA 2WAEA 5FKLA 4DJAA 3Q3SA 3PQJA 1X3ZB 2W00A 3B6CA 3WU2C 2RVCA 3IKVA 3DLLF 4V2GA 1DP7P 1KYZA 3VYRB 3CQZJ 3GMEA 4FASD 3B02A 1FWZA 1J5YA 1ZN2A 5B1BH 1O57A 1WJBA 4RLQA 3TQNA 3K4NA 2MYSA 2V9PA 2ESHA 3EDPA 2CJJA 3PNTA 2RASA 3ERMA 3CF5F 3ZMTA 2ACJA 4I01A 5B5EC 3MEXA 1S72I 3ZP5A 3G1MA 3NNRA 2QZ8A 5HDGA 5LBQA 1FOKA 4HAMA 2HXOA 1QVTA 2VBZA 4XOTA 1GVJA 5EG0A 4FHTA 2H1KA 5FLXZ 1WH5A 1YLFA 3NRVA 4DYRA 2QOPA 3JTGA 1IV8A 1ZGAA 1VQNI 2VBYA 2VONA 2JA5J 1X3UA 2EA2A 3BP8A 3KP7A 1IRFA 1PP8F 1C0WA 1YQAA 2XROA 4WIBA 1Y1VJ 3HIFA 2FBKA 2X1DA 2DK5A 3WODF 1TL8A 2PQ8A 5E18F 4E7JA 3ZGKA 2OA4A 4Q4ZF 3CCJI 1FTZA 3DBLB 4NBQA 1FMVA 4NB5A 3J7AY 5HLGA 2X48A 4NUBA 4HSRA 2E35A 4BACA 3BWGA 3J80Z 1O7LA 4MTDA 1GLNA 1LFBA 5BPIA 2E1MB 1YHQI 2DMQA 4IO9F 4FE4A 2UWMA 2QVOA 3IAS2 2ZY9A 4P96A 5FLMJ 2K3PA 4OAYA 3HTHA 4ABZA 1IC8A 1IW7F 2EINH 2KHMA 4H4KC 2XV4S 5FD6A 2UXNA 1YX3A 1G4DA 3JSPA 5K7FA 1FPQA 1MW7A 2WV1A 4BJ5C 1TT5B 4IRGA 4UUSA 5TJJA 3W3CA 1DPRA 2GENA 2K86A 4MIMA 1XSXA 5GP9A 2WWYA 1DGWY 4CCLA 1R00A 3G56A 4A12A 5EEHA 1FP2A 2LSOA 3FX3A 5J8CA 3QYBA 1HF0A 1S5LC 2O7OA 1RR7A 2IT0A 4ASNA 2QKMB 1RUOA 1K6YA 3ML6A 4LK0F 3KP3A 2OBPA 3SHFA 5E1WA 2D5VA 3TO7A 1REPC 3EYIA 5K5QA 4WXDA 4DZJA 3HOWJ 3P9KA 3CCSI 5CQGA 3Q0UA 5J1RA 3CCUI 1A6QA 2DFEA 2OAZA 2MG4A 4OMYA 1MZBA 3HSFA 2KIUA 3FM3A 4XBFA 2QSFX 5LEJA 5L3BA 2Z9OA 3VVZA 2DA7A 1J59A 3M8JA 5LGNA 3GUDA 5CPRB 2HR3A 3HOYJ 5E8IA 5KAIC 4IHTA 3TEDA 3S1QJ 4EM1A 3U9GA 3I56I 1D3YA 2E34A 2LVSA 1W7PB 1OLTA 2IAIA 1AHDP 1ZREA 3G7RA 5D6EA 4Y3OA 2JT1A 1OCCH 1RKWA 2VBWA 3CUQA 1GT0C 4IKFA 4PFOA 2UXPA 2L7KA 3CJQB 1TC3C 1EA3A 2FJI1 3HG9A 4V19K 1R6RA 2XB5A 3ECOA 1ZR2A 2ZXHA 4KJZA 5HNHA 3AG4H 1CF7B 4G6QA 2PZ9A 2X1CA 3KETA 2QTQA 4ZDLA 4A6DA 2ZJRF 2IPQX 1LFPA 2HYFA 2K5CA 2L9NA 2FQ4A 1NH3A 2JA7J 4CGRA 4DVYP 1RETA 1UHSA 2GOXB 3RIRA 2ZMEB 1D8KA 4ENKA 1JKRC 2E7WA 3F6OA 2DFHA 3OR1C 2QSHX 2JMWA 3JRGA 3F9KA 2FA5A 1NG6A 4JL3A 3BHQA 2QKOA 2JWTA 3U1KA 5JFRA 4RB3C 1P4XA 3H0GJ 2F5CA 4EJVA 4ENJA 3E7QA 1ZH5A 3FRQA 4M3GA 2H27A 2HKXA 3HJEA 4M9ZA 1BW6A 4XONA 5CXGA 2JA2A 5CVVA 2L02A 2IA0A 1ULYA 2P7CB 5KVRA 3K7AJ 2Q24A 1IDZA 2MW8A 1Y56A 4BHCA 5CQEA 3RKXA 5F1JA 3OYDA 4IOAF 4L9JA 4EMSA 2VT3A 2BY1A 2V1DA 3FXLA 3A1YA 3OOUA 1ZYRF 1ZHFA 3QYEA 1IXRC 1U2WA 2L2OA 3QPTA 3SDGA 3F21A 3OL4A 3BJOA 3O2PE 3HYIA 1GHCA 2DDBA 4L62A 4PDKA 3K1NA 1RRJA 3HRSA 2XAUA 3DPJA 4I02A 3L9FA 1PVEA 2LBFB 4AF5A 1TLHB 1FJLA 2F5EA 1UZCA 5D5VB 2UZKA 3GZIA 5K58A 4KWAA 4RB0A 3BT9A 2CU7A 4F92B 2EA4A 2W48A 3SZTA 3C7JA 1YRNB 2QLZA 3N97A 4MK6A 2IA1A 3H1CA 2G7SA 2A3SA 3ZMDA 3GEUA 3LSGA 1Z67A 4JOMA 2XKPA 3K4JA 1VF9A 4IHYA 2VL8A 2QQ8A 1BC8C 2OI8A 2VQGA 2BY0A 3J80K 3GWZA 1WJFA 2HGCA 2FJ1A 3SFZA 3KP2A 4BU2A 2JPBA 4IHSA 2FXAA 4X1EA 4IQJA 4LB6B 1HC8A 5CJ9A 5KCMA 4UNOA 3OYHA 3BR2A 1F36A 2PX9A 1IV6A 3HTAA 2ZCXA 2YU3A 2M7AA 4XR6A 5EGOB 2GLOA 1X1AA 1FBUA 2JQ7A 1FNNA 2COBA 1XCVA 1EJ9A 1P92A 1M1EB 2AQEA 1HSTA 1V4RA 2A6HF 3RQ4A 3W6KB 3J81Z 4XLAA 2XAFA 1PJRA 1ETQA 3LFKA 3P9IA 2EV5A 4D7NA 3LA7A 3O8GA 5KHDA 2CS3A 3ZQQA 1WKMA 1XMAA 1R71A 1SFKA 5DD8A 3GLLA 4BXXJ 1TQIA 1MNDA 4GFLA 2NS7A 1D1CA 3E3VA 2MABA 4CZZA 2DPUA 1ITYA 1ETYA 1QZZA 4KUMA 3IH4A 3BTLA 2A6EF 1JUMA 2ZB9A 1BR4A 1MKMA 4BH9A 2R7XA 3CLOA 5DUKA 2QGUA 1WGXA 1YI2I 3SQNA 4FX4A 3FXQA 1XDSA 2J5OA 4LIVA 2CWEA 1I39A 1V5FA 3GBGA 4MLOA 1YS6A 2YUSA 2K02A 4A3LJ 1WRJA 2XGEA 5KK1A 4M74A 4F7ZA 3LAJA 1NTCA 3PFIA 2B63J 2D2WA 2JRMA 4RM3A 4ZYEA 3EUPA 3HC7A 2VBXA 2X51A 3M8FA 4B3AA 4AD9A 3PO2J 2W53A 3NPIA 3I71A 2M4GA 3I9V2 2HKOA 4IRIA 1MJ9A 2F4IA 2WY7Q 1H88C 3KZIC 4EJOA 1S3JA 4Z6YA 3G73A 2QQAA 4KIBA 2Y0SA 1QVUA 2GBYA 4NN1A 3TKYA 2VUMJ 2KIFA 1ZG3A 5DAJA 4KITB 2HVSA 4KDPA 5E1ZB 1OQYA 1B9MA 2EQRA 2GAUA 1PYVA 4BS9A 5K5OA 1BR1A 2IS1A 1RZ4A 2XPWA 3QAHA 3B73A 3D5LA 3IH3A 4CXFA 4HW0A 3T1BA 3KLOA 1W7PA 4LITA 2DA3A 2W25A 2EZLA 6PAXA 2X9DA 4C9YA 4XORA 3JCUC 3AQSA 4L5EA 4HLYA 5ED4A 3F3XA 3PSIA 4UXNA 4A3FJ 1VQMI 4L0ZB 3VP5A 1HQCA 2V26A 2WY8Q 5E3NA 2G3BA 1LJ9A 2PJPA 3NWTA 3CCVI 3BR1A 2XRNA 3M07A 4EQQA 4HG2A 1MMNA 3TBIA 5D18A 2X1EA 2KRCA 3HGGA 3I5UA 5ICEA 1V5EA 4OIQF 2VJJA 5DUIA 2IW5A 3GW2A 1OCOH 3DXJF 4LJZF 2BOLA 4PCQA 3VPRA 5CLSA 3FHZA 1XN7A 4UHTA 1IXCA 1DPUA 1GDTA 3CCYA 5FLVA 1YITI 5EG0B 1HW2A 3ZQ7A 2H8RA 5K7HA 1B4AA 3HTSB 3I55I 2Q2EB 5CVUA 4G9YA 1O7FA 3HTJA 1ODDA 4XRMA 2CYYA 1VTNC 4I98B 5EZHA 3IC7A 2Y30A 2TDXA 1JKOC 4Q5SF 2J5PA 1ZARA 2R7UA 2HXIA 3A0BC 3ZMSA 3BR5A 5A2QZ 2HDCA 5K1YA 5FGLA 5E8GA 1FP1D 3W6VA 4GFKA 2FU4A 2QCOA 2FBHA 5HOOA 3QRFF 1AKHB 3CJTB 4UUTA 1MMSA 2MH9A 3C3WA 2OZ6A 4A6EA 2E7XA 3N4MA 4Y52J 1E3PA 4CYDA 3GZ6A 1P7JA 2P6TA 4M3BA 5B1AH 2ZNZA 2XGCA 2Q2EA 2VE8A 3RPUD 3L2WA 2UXOA 3IRQA 4L5JA 3DU5A 4F91B 2E19A 1MD0A 3QQAA 1WZ2A 1X58A 3VOKA 3MZHA 2WAQN 2LK2A 5FB2A 3PASA 2JTVA 1U8BA 4BDZA 1XG1A 3I59A 2F6CA 4D5FA 4QSHA 2IXSA 1OCZH 2KMUA 2PG4A 5IYCJ 1SD5A 3FISA 1BC7C 3K2ZA 1XS9A 5J6XA 1IUYA 4JP0A 3H3ZA 3K70C 1WJAA 4KFCA 1MMAA 2P81A 5AIQA 3E1SA 2TRTA 3RPQA 1CGPA 3ZRGA 3PPBA 2QM3A 4PUSA 3Q5FA 2ZMEA 3WTXC 2STTA 3QKXA 5DV5A 2Y75A 2GXGA 2HNHA 4BJTA 2K4BA 1WI3A 3R6SA 1BI1A 1WJDA 4MFDA 5DYMA 4BY7J 2V1NA 4RGRA 3H36A 3RQIA 3S2WA 2M2EA 2EV0A 4XKCA 1KU3A 3FM5A 2R92J 5EF6A 4GO1A 3NWSA 4I0BA 4B47A 4DYCA 2PBIA 3JRIA 1PUFA 2YU9J 4BBRJ 4MO7A 3MN2A 4M6XA 2DDAA 4CZCA 3UR3C 3TP3A 1G8XA 4U88A 4WK8F 4ESJA 1HW1A 3MCZA 3LOCA 3IL2A 2YVXA 3MAJA 3FXMA 2K4JA 4IHVA 2DA5A 1MJBA 3W6JB 3GTGJ 3JAMZ 1ZQ3P 1D0ZA 2XUBA 3JRHA 2E2JJ 2H94A 3HTUA 1CQTA 4HRIA 3DPLC 2V4JC 3PM1A 1IF1A 4DBRA 1VNDA 2DN0A 2TCTA 1LUJB 1MDMB 1JHFA 3KNWA 1RNLA 2XF5A 4IHXA 4XLHA 2GWRA 4U0VA 4BY1J 4B3XA 1L0OC 2A69F 2W1OA 3S8PA 3HPGA 3PO3J 2VQCA 2M4KA 1P6RA 4TV7A 1O3RA 3H3VK 3FXUA 2HFHA 1H0MA 5BQTA 5L3EA 4NELA 2DQLA 3ZQIA 2N8GA 2DTRA 2NAZA 5FKOA 2CO5A 5H20A 5GADJ 3TGNA 1X19A 2O7TA 4HEA2 3TO9A 2DA2A 3K4KA 1FX7A 4N0BA 2X6OA 4ZDOA 2UXHA 3EETA 2BGCA 4S05A 3L2RA 5EEGA 4HSTA 5GPCA 5DCFA 3VOEA 2CGPA 3E6BA 1I3AA 2VPLA 5IP6A 2HQ5A 1Z1DA 2XPUA 2VXDA 2DT6A 2DMPA 3MQ0A 1WVRA 4Q47A 3CCRI 4JK1X 2XHKA 2VLAA 3K10A 4HZFA 2HTSA 3NAUA 1IN5A 4A3EJ 3A01B 3U1DA 3H5AA 3M3YJ 2LOOA 1G59A 2A5WA 1B72B 2DMUA 1ONVA 5J1YA 4P5OA 3GFMA 3DCFA 4HQMA 3CO7C 4XN0A 4DQ2A 1LVAA 3EQLF 3A02A 1RKTA 4G8XA 3WTVC 1RIOH 3S2HJ 3RH2A 4I76A 3K9TA 4RAZA 4AIJA 4U9LA 1HDPA 2ZJ2A 4OIRF 1SEUA 3LSRA 1VQ6I 2XSDC 1Z7UA 2VI6A 4IXAA 1IZ1A 1SC7A 1KONA 2IGKA 1LNWA 2X6WA 2CRGA 3SDBA 4G7OF 2R5ZA 1G3SA 2M5WA 3FBNB 3PUBA 3TOBA 3SZPA 5C3EJ 3HHHA 2O3FA 4G6TB 2FF4A 3OYMA 4C2TA 1TBXA 1T33A 2Z5UA 3D0SA 2M3AA 1NHAA 2X0LA 2A2FX 1WQ2A 2E1MC 4GFBA 5D8KB 3HBLA 4JX4A 4HX4A 2GOMA 3KFWX 2EK5A 5CXIA 3TW7A 2NNNA 2IU5A 4HX8A 4F52A 1WCMJ 3WTYC 4XL9A 3ON4A 2QUFA 4BE2A 1Z3XA 4EATA 3HE0A 4ICHA 3LSTA 3L2CA 4NQWB 2HPMA 1RI7A 1HKTA 3D1NI 2FD5A 1WH7A 1HDDC 4RGSA 2GIZA 3C2HA 1AKHA 3F8NA 3ZQCA 3QYFA 4IVNA 1JKQC 4KN4X 3C07A 2EZHA 4XOPA 2VKEA 3AFHA 4U0WA 5HDNA 1F5TA 4M3FA 5TISC 4W1UA 3HOUJ 3G71I 2LC2A 2PJRA 2I8DA 3FMRA 3HUGB 3NARA 2DPDA 4I2OA 4LK1F 5HLIA 1K6OA 2PLYA 2M30A 3GTLJ 1EH7A 3DEEA 4U7BA 1TW3A 1TT0A 2YX4A 1BM9A 3FZVA 3H0DA 1W7PD 1HLVA 3Q9SA 3T6NA 4BE1A 2B3WA 4ZC3A 2D1VA 2Y48A 1QNTA 2OV7A 5L3DA 1OYYA 4CDGA 2K27A 4P9UA 3BC8A 4D0PA 1LDJA 2Y69H 1H8AC 5AQCA 1W36D 1FIPA 3ZN1A 4DGWB 3ABUA 3WHBA 4YFNF 1QZYA 2VIXA 2ID6A 2QQBA 4I09A 2HDDA 2WA0A 1ETOA 3IWFA 5F0CA 1STZA 5FROA 5FGMA 1APLC 2DW4A 5IPAA 3OYEA 1E2XA 2M9HA 3E5UA 3EPZA 3LSIA 1Z77A 3JRBA 2YPRA 1USTA 3GVAA 3UKGA 3EYYA 1TNSA 4KIGA 4NDLA 3PIPF 2RNGA 4OD5A 2VJIA 1VQKI 3HKZA 1JUSA 1IN6A 4IX7A 3ZMVA 3RD3A 3RDIA 1Z6TA 4MEYF 2HOEA 4YRVA 3ANGA 2PFBA 2HVQA 3Q0VA 2OCCH 1MBGA 3KZYA 4B48A 3OYCA 5M5YJ 3V78A 1GVDA 1Z05A 3J7ZI 2R7OA 3KEYA 4Y7NJ 1OCPA 3MKYB 3RYRA 1GV5A 3VDXA 2CQQA 2RN7A 4ESBA 1ZLJA 4U9NA 2FE3A 1OCRH 3VB2A 1G3TA 4IPAA 2CUEA 2O8KA 2KJCA 2E60A 3DBHB 4FCYA 5HBUA 4IF4A 4GXOA 2QQ9A 2AO9A 4RAYA 1VI0A 2DA4A 5LFAA 3OYBA 5A2QK 1A35A 3QPSA 4XKWA 1PP7U 2R7ZJ 4MEXF 2FEZA 3CD6I 1SD6A 4MFEA 4JKZA 5FMPA 2CQKA 1WHUA 5LGTA 1LE8A 3EUKL 4G12A 4Y4RA 1UI5A 4WWCA 1MBHA 4CH7A 1P4AA 2DG8A 4AC0A 2WTEA 1U5TB 2EFPA 5HLTA 2LF7A 3KX2A 4M9XA 3VYUB 1JI8A 5JLXA 1XGMA 1XMXA 2V9VA 1MH3A 3AQTA 3SZGA 2W24A 5C4XJ 3KCCA 4OU0A 5L3CA 4J19A 1Q1VA 4RBOA 2ZSIB 3S3MA 3OS0A 1UCRA 1S7EA 2KDZA 2CV2A 1FOWA 4BNCA 2R7RA 1KA8A 4C30A 2DYSH 3K4BA 3SFIA 1R23A 4KN7X 1A31A 2DCEA 3S17J 1OISA 2KIQA 3FHNA 4KA4A 3PUFA 3H35A 2RNJA 2YVEA 3V42A 3J7AO 2V1UA 1IO2A 2MLKA 4X6AJ 2EWNA 1Z3YA 3CDIA 2L0KA 4P9FA 2VKHA 1LEAA 3QOPA 2XGXA 1BJAA 2DFFA 2F4MB 1FOYA 4Y15A 1MH4A 2FSWA 3BR6A 3DWLE 3M9AA 4MQ9F 5H6QA 3WU1B 1O3TA 4M6YA 3KLNA 1TNTA 4C3HJ 4S0HB 3VYTB 5ICGA 2HQRA 1LKXA 2HVRA 3VUQA 5FFZA 4A69C 1FBSA 1QU3A 2BV6A 4AU7A 2MD5A 5HLHA 5GTIC 3ISPA 1W5TA 4EJTA 3IUOA 3QPHA 2IS2A 3HOTA 1UHMA 2M0CA 3H92A 4WXCA 4YELA 3W2WA 1D0YA 3SJMA 2HQAA 2KZVA 2ISZA 3HOZJ 5B66C 2EJRA 3A2KA 4YG2F 3E97A 2G7HA 1UAAA 4PZJA 2E71A 2Y0MA 3LSPA 1HCRA 1S7OA 3E7LA 3GZ5A 5KNLA 2LMDA 2HU9A 4E7LA 2CUFA 2O8XA 1D5YA 1TP4A 2JN6A 2PMUA 1OYIA 1S7AA 1FOXA 1PDNC 2GXBA 1W5SA 2K40A 3LQRA 1QHGA 1Z9CA 1QA6A 2DOFA 1DU0A 2ZO4A 1LDDA 2NVUB 2VT2A 3I0TA 5IT3A 4QLCU 4NC7A 3AG3H 2VJ5A 4E7HA 3BR3A 3CRJA 2QKLB 2NNYA 4A3DJ 3CCMI 2IJLA 2DU9A 2RKHA 3O60A 3PL8A 2E5ZA 1ERDA 3BG6A 3K1MA 5K7ZA 5CVJA 5ILSA 3GLXA 4XLEA 4F55A 4LMYA 4ETSA 2COMA 5J40A 4U87A 3AG1H 4IRHA 2FBIA 5K5RA 1UG0A 2NVXJ 3BG7A 3IH2A 5AONA 3DP7A 3KEQA 2WC2A 4ZYAA 4JNNA 2XAGA 3U21A 4AVZA 5HODA 2LDUA 1U9NA 3SEZA 3ZMUA 2NXNB 4LLLA 3K70D 2IRFG 2VC0A 3BCAA 3FK7A 4OIOF 3OL3A 1B1BA 4UB6C 2X6XA 2P6SA 4A3IJ 2DK8A 4LG0A 2IGMA 4XSXF 3BDDA 3CESA 1VQ7I 1POGA 3DQVC 4KNYA 1KZHA 2CMPA 2B0LA 2EIKH 2QF7A 3ZCOA 1DUXC 1YS7A 4NHJA 3ZXSA 4M6VA 5HAWA 2H09A 5D5UB 4I0AA 3IV5A 3KZZA 4PGHA 1B59A 1R36A 2LRDA 3MVPA 4XK4A 5HS9A 4EM0B 3J7YJ 2AQFA 4U0YA 2ZFUA 3VIBA 3CUQC 1XPXA 4A3CJ 1X3WB 3A03A 5IT9Z 1F4KA 2WV0A 4A3JJ 1B8IA 1IN8A 1ZKGA 4XLNF 2KL4A 5BS6A 3K0LA 1PUFB 2Z16A 2ZKZA 2WUIA 4XICA 3WTTC 3WE2A 4W97A 2XDNA 1SFEA 3QU3A 3CMYA 3HXLA 1ZLKA 1VQ8I 2ZOZA 3RSNA 1SD4A 3ZR8X 3JSJA 2L4AA 3HIMA 5J1UA 2Z99A 1XTAA 3CP8A 1WJCA 1Z6RA 4A93J 1YW8A 2Y2ZA 2YS9A 1MSEC 4Y33A 1UG2A 2JA6J 3VW2A 5F04A 4YIRX 2W84A 1O3QA 3BZKA 1V3FA 3LQQA 3DEUA 3H9GA 4EEFG 3OS1A 3MKWB 1HBXG 3HZJA 2L9SA 3IUVA 3O6BB 2BE5F 3S3NA 4GCTA 1Y8QB 2K9QA 2L5QA 2QYOA 4YIFA 1V55H 3D5SC 1K4TA 1UB9A 2OC6A 4XQFA 3VFZA 2L9RA 5ERIA 2E5NA 4EJUA 1K79A 4N9HA 3IWZA 4A0YA 2G7GA 2ELKA 2CG4A 2EFNA 1J09A 3PNVA 2GQQA 4BDYA 4A3MJ 2R7QA 1WSUA 4OWRB 2JJ7A 3QWLA 1FLIA 2AHQA 2MH2A 3BTJA 4BHBA 2W57A 4D7MA 4ENNA 2HOTA 2BXYA 2MA3A 3TW6A 4ZZDA 2D1HA 2HKUA 3F8FA 1Z7LA 3L2UA 2XF7A 2UV1A 1YW9A 2HI3A 2LY1A 3DU6A 3FF5A 5E20A 3I64A 3IAM2 1R4MB 4PK4A 2M87A 1JJ6C 1MJAA 3C1DA 3CMAI 3M8EA 5E3LA 3U2RA 1YIOA 2ZSHB 4AM3A 4MHGA 2XPVA 3JTHA 3GFLA 3C2GA 2E1CA 3DBRB 3BPXA 3BG9A 5AIPA 4I6ZA 1TWAJ 1E3HA 1B8IB 3BROA 3P9CA 2HYTA 1TWGJ 2RREA 3MZYA 2JA8J 3ANPA 2IEKA 2Y9YA 4A5MA 3WGHA 2PI0A 3TMOA 2OD5A 1A6IA 4G6DA 3NQOA 4XRSA 1FTTA 3WU0A 4X0GA 3K2AA 5HS8A 4E7IA 1TWCJ 2K9MA 2DQRA 1I6HJ 1F1ZA 4WCGA 3I53A 3K6GA 1EV7A 1V54H 3DKXA 3R0AA 4MGRA 4CO8A 2P4WA 1ZTRA 2X6YA 1JHHA 4XLPF 3BJAA 2LYCA 4HDUA 3OIOA 1J0RA 4XN3A 3CCLI 2NP5A 1SANA 2NS8A 1PUEE 2R5YA 2HEOA 4PGGA 1QZEA 3BCBA 3OSGA 3OYJA 2QBYA 2K3FA 3ULQB 3BZCA 4QWQA 1X4PA 3C2BA 5E3OA 1FT9A 2MLGA 3LFUA 4BEHB 3CCEI 2Q8KA 3I3LA 2WGBA 2PMZN 3HSRA 2NP3A 2FQ3A 3ABLH 1A36A 4B43A 1R9TJ 2CSOA 2JRTA 4N4OB 3RKQA 2CQXA 4KICA 1KGSA 3VWBA 4KIFA 3QBMA 4I99C 2FNPA 2LKSA 1Q1HA 2LNBA 1JGGA 4D5CA 1F43A 1QRYA 3GTMJ 3OOPA 3TP0A 2QWTA 1NK3P 5JLWA 2EIMH 4KT6A 5BPDA 1W0UA 3KKCA 3O8HA 4ZDPA 4UDSA 4CA0A 1FIAA 1OJLA 2DAOA 1FYLA 2O6GE 4MNUA 1MBFA 4QIWN 4R79A 4QPOA 3QODA 1HKQA 2Q0OA 4F3QA 1SD7A 4BXFA 3BQYA 5D6FA 1DU6A 5HSZA 4HQEA 3WTZA 1S8NA 4KISA 3FIWA 3BY6A 1N77A 2W7NA 2UXXA 3HOSA 5ICFA 4LOCA 2FBQA 2QBYB 1H9TA 4BHPA 4E7ZA 4XLCA 5H2FC 4XRSG 1R58A 1R7JA 5HS7A 4CSWA 2R5YB 4HF1A 1ZG1A 5F08A 3NRGA 3CC4I 2JSCA 3M4OJ 1X1BA 4WXHA 5CKTA 3K8PC 2CW0F 4XM3A 5E1XA 1SMYF 3EUAA
chains in the Genus database with same CATH topology
3EGQA 4HNVA 3S1RJ 4M3FA 1LE8B 4W1UA 4JL3A 2F07A 3BHQA 2QKOA 2JWTA 3HOUJ 3ZOBA 3OSFA 4AUXA 3H0GJ 3NARA 5BNGA 2ZCMA 3S2DJ 1ZK8A 3S5RA 3E7QA 1ETWA 3FRQA 3GTLJ 4QTRA 1HOMA 2LFBA 4M3GA 5M3FJ 1HLVA 1U78A 2E1OA 3T6NA 1BW6A 3GTJJ 5CXGA 3RZDJ 3VOXA 1GV2A 2FX0A 5C44J 3K7AJ 3GTPJ 2Q24A 1X2MA 1IDZA 2MW8A 1H8AC 5AQCA 4C3IJ 3GTQJ 5IYDJ 5F1JA 1FIPA 1JTYA 1IRZA 3WHBA 2HDDA 2ID6A 2ZCNA 2LP0A 3OOUA 1ETOA 5F0CA 1APLC 5IPAA 3SDGA 3V6GA 2M9HA 4L62A 1Z77A 3CDLA 3BTCA 3JRBA 5D19A 3DPJA 3UKGA 3GTOJ 2GM4A 1GUUA 4NDLA 5EGOA 4AF5A 1FJLA 2L7ZA 4C2MJ 3GZIA 5K58A 4KWAA 1JUSA 3BT9A 2CU7A 2W48A 3BR0A 3RD3A 3VVYA 3HGYA 5DS9A 1YRNB 3ANGA 4MK6A 3Q0VA 2G7SA 4FE7A 1MBGA 3GEUA 3LSGA 5M5YJ 3V78A 2K9SA 3JRDA 1GVDA 5M3MJ 1B72A 4A3GJ 4Y7NJ 1OCPA 1VF9A 5M5WJ 1IGNA 4IHYA 5D1RA 2OI8A 1GV5A 2NVYJ 2CQQA 4AYBN 2FJ1A 2YVHA 1EF4A 2VKVA 3MNLA 2CUEA 2O8KA 4X1EA 1ETKA 4FCYA 5HBUA 1JTXA 1YRNA 4IHWA 1XC5A 1MBKA 2ME6A 3BR2A 1F36A 2AO9A 1ZR4A 1VI0A 2DA4A 1IV6A 1OCTC 3HTAA 2ZCXA 2ME0A 4FTHA 5EGOB 3QPSA 1JUPA 2GLOA 1AU7A 2R7ZJ 4M3EA 4MFEA 5IP7J 2NOGA 4JKZA 5FMPA 2COBA 2M8GX 4JYKA 1LE8A 4G12A 2ZOYA 2HOSA 5CW8A 1Z0XA 1UI5A 1MBHA 2DG8A 4AC0A 2UXUA 1ETQA 4GCLA 4BKXA 2MGQA 5JLXA 4D7NA 1MNMC 4HKUA 5DTDA 1MH3A 3O8GA 5C4YA 2OPTA 3AQTA 5C4XJ 4J19A 1Q1VA 4RBOA 1TWFJ 3LNQA 3VW0A 2VPRA 3I4MJ 2DJNA 1BA5A 1S7EA 3JRAA 3B6AA 4DW6A 2KDZA 4BXXJ 4GFLA 3JREA 2NS7A 4UUSB 1ITYA 1ETYA 3SFIA 1P7IA 3IH4A 3BTLA 5M5XJ 1JUMA 1BW5A 2ZB9A 3S17J 3VVXA 1WGXA 3S14J 2YVEA 1I50J 4M3DA 3KKDA 4C3JJ 2QIBA 1Y1WJ 3GBGA 4X6AJ 4MLOA 5H9TA 2YUSA 2LLKA 4A3LJ 2XGEA 2L0KA 3LSJA 2V57A 2ECCA 3KZ9A 1NTCA 1IUFA 2B63J 1MH4A 3BR6A 4A3BJ 1W0TA 1MBEA 3EUPA 3MKLA 4B3AA 1FEXA 2W53A 3PO2J 3NPIA 5IOYA 4MXMA 4C3HJ 1IDYA 4S0HB 4JX6A 2D6YA 2JK3A 3BNIA 1IJWC 3F1BA 3VUQA 4A69C 1H88C 4JX5A 5IP9J 1H89C 1OFCX 2RAEA 1A5JA 2EH3A 2PBXA 3COLA 1QVUA 2GBYA 2L7FP 2XRLA 4NN1A 3WHCA 2VUMJ 2LKXA 5DAJA 2M0CA 3HOZJ 3SJMA 2EZIA 2ID3A 4RDUA 2EQRA 2I10A 5C4JJ 3BJBA 2XPWA 2L7MP 4CYCB 3LSPA 3G1LA 3IH3A 1HCRA 2EZKA 3BG5A 3E7LA 4B4CA 5EEAA 4ME9A 1ENHA 2HYJA 1JJ8C 2NVTJ 2DA3A 2CUFA 2EZLA 2X9DA 4B1RA 3BG3A 1D5YA 2WB1N 4L5EA 2NVQJ 3AQSA 1K61A 2JN6A 4A3FJ 1RESA 3JR9A 3VP5A 5E3NA 2G3BA 2DA1A 3BQZA 5F27A 4DZPA 3BR1A 2K40A 3NXCA 3CWRA 1DU0A 5D18A 3HGGA 2XB0X 2R0QC 2GUHA 2NX4A 2HOAA 3L1PA 2XGDA 3BR3A 3CRJA 2DMNA 4A3DJ 1ZGWA 3HM5A 3O60A 3VPRA 5K7ZA 3FKIJ 3ZQHA 3JRCA 3CCYA 1GDTA 5FLVA 2RHAA 1E3OC 5EG0B 2H8RA 5K7HA 4DYQA 5EYRA 3HTJA 5FKNA 4XRMA 2NVXJ 1T56A 3IH2A 5EZHA 2Y30A 3RZOJ 4JNNA 1JKOC 1BJZA 5HODA 1I3QJ 2O9LA 4PXIA 1U9NA 4XIDA 2HXIA 3ZQLA 3BR5A 3FK6A 5FGLA 1ETVA 3W6VA 3LWJA 4GFKA 3FK7A 3I4NJ 2G7LA 2DTZA 2QCOA 3A01A 1AKHB 4UUTA 2E2IJ 4A3IJ 2M34A 1NK2P 4FISA 1POGA 2LY9A 3S16J 4Y52J 5FJ8J 2REKA 2QF7A 4V2FA 1P7JA 4M3BA 2ECBA 4M6VA 5HAWA 1TWHJ 2XGCA 1IG7A 3IV5A 2LD5A 2UXOA 4ACIA 4XK4A 3MVPA 5EDNA 2E19A 3VIBA 3QQAA 1X58A 2LR8A 3VOKA 2LTPA 4A3CJ 2Y0SN 2WAQN 1U9OA 1X2NA 2LK2A 3PASA 3A03A 1U8BA 1XG1A 1SFOJ 4D5FA 4A3JJ 1B8IA 4QSHA 1ZKGA 2K9NA 2DMTA 1VFCA 5IYCJ 1UI6A 3HOVJ 1PUFB 2WUIA 5FKLA 3FISA 4XICA 3LJLA 3Q3SA 1XS9A 4W97A 2XDNA 3VW2A 3CMYA 1JT6A 3B6CA 5IOZA 1BL0A 2ZOZA 4JP0A 3JSJA 3HIMA 5J1UA 4V2GA 2EBIA 3BTIA 2P81A 1G2HA 3LHQA 3CQZJ 3BCGA 2TRTA 3PPBA 4A93J 2Y2ZA 2YS9A 1MSEC 1UG2A 2JA6J 9ANTA 5F04A 2CJJA 4AC6A 3QKXA 4EEFG 2RASA 1WI3A 3G1MA 3NNRA 4MFDA 3IUVA 3JRFA 4BY7J 4GCTA 2HXOA 1QVTA 3RQIA 2K9QA 2M2EA 5EG0A 2H1KA 2R92J 1WH5A 5EF6A 4DYRA 3JRIA 2QOPA 4DYCA 2YU9J 1PUFA 2L9RA 4MO7A 3MN2A 4BBRJ 5J3LA 2JA5J 3TP3A 2E2HJ 2G7GA 2ELKA 3DEWA 3CJDA 3LOCA 1Y1VJ 3VW1A 4IHVA 2DA5A 1WPKA 4A3MJ 3GTGJ 1ZQ3P 2JJ7A 2E2JJ 2AHQA 3JRHA 3BTJA 1CQTA 3HEFA 5GPAA 3ON2A 4D7MA 3S15J 3PM1A 2HOTA 1FTZA 1VNDA 2DN0A 3TW6A 2TCTA 2HKUA 3KNWA 2DG7A 2X48A 2HI3A 1UMQA 4IHXA 1RPWA 4BY1J 5E3MA 1JJ6C 1LFBA 1ETXA 2MSYA 3Q0WA 2DMQA 2Y9ZA 3HKZN 4FE4A 3PO3J 2G0EA 3H3VK 5E3LA 5FLMJ 4NELA 3BRUA 3ZQIA 1MBJA 2N8GA 2XPVA 3HTHA 4ABZA 5FKOA 3BG9A 1IC8A 4I6ZA 1TWAJ 3HTIA 3S1MJ 1B8IB 2O7TA 2DA2A 2UXHA 2HYTA 2X6OA 1TWGJ 1JT0A 3HB9A 5K7FA 2JA8J 3ANPA 2IEKA 3S1NJ 4IEJA 2WV1A 2Y9YA 1QPIA 5GPCA 4UUSA 5FKKA 5IP6A 2GENA 1A6IA 2HQ5A 4MIMA 4XRSA 1FTTA 5GP9A 2XPUA 5F0HA 3HOXJ 1SGMA 3G56A 3K2AA 2DMPA 1TWCJ 1I6HJ 1HF0A 3P9TA 2O7OA 1RR7A 5EZGA 2DA6A 3NAUA 3ZQFA 1ZTRA 4A3EJ 3A01B 3M3YJ 1K83J 2D5VA 1B72B 2NP5A 3OIOA 1ORKA 2DMUA 1SANA 2NS8A 5J1YA 3DCFA 2R5YA 1JKPC 4DZJA 3OSGA 3HOWJ 2IBDA 3S2HJ 3A02A 1RKTA 3Q0UA 2R93J 5J1RA 3NI7A 3RH2A 3C2BA 5E3OA 2KT0A 4I76A 2MG4A 4A3KJ 1MSFC 2WGBA 2PMZN 5IYBJ 1HDPA 3VVZA 2NP3A 2DA7A 1R9TJ 2UXIA 3RKQA 2Y31A 3LSRA 2CQXA 2XSDC 2VI6A 3HOYJ 3QPLA 2OERA 3G1OA 2CRGA 3TEDA 3S1QJ 3QBMA 2LVSA 2R5ZA 2IAIA 1JGGA 4D5CA 1AHDP 5C3EJ 1F43A 3G7RA 1QRYA 3GTMJ 5FKMA 3TP0A 2QWTA 1NK3P 5JLWA 4CYCA 1W0UA 1RKWA 3KKCA 1T33A 3O8HA 4UDSA 1FIAA 1GT0C 1OJLA 2UXPA 2R5ZB 5F0FA 1TC3C 2OF7A 3GTKJ 4GFBA 1MBFA 3HBLA 4JX4A 2XB5A 4QIWN 1ZR2A 3HDDA 5CXIA 3BQYA 3TW7A 1DU6A 5EFYA 2IU5A 5HSZA 2PZ9A 4GCKA 2QTQA 1WCMJ 3FIWA 4YZEA 3ON4A 3HE0A 4ICHA 3ZQGA 4LOCA 2FQ4A 2JA7J 4CGRA 3D1NI 2FD5A 1RETA 3F0CA 1UHSA 2FBQA 1WH7A 1LFUP 4XRSG 2GFNA 1HDDC 1JKRC 4BBSJ 2R5YB 1AKHA 5F08A 3ZQCA 3NRGA 3M4OJ 5FHPA 2JMWA 3JRGA 1JKQC 3C07A 1O4XA 2EZHA 3B81A 2VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGQ A;  4HNV A;  3S1R J;  4M3F A;  1LE8 B;  4W1U A;  4JL3 A;  2F07 A;  3BHQ A;  2QKO A;  2JWT A;  3HOU J;  3ZOB A;  3OSF A;  4AUX A;  3H0G J;  3NAR A;  5BNG A;  2ZCM A;  3S2D J;  1ZK8 A;  3S5R A;  3E7Q A;  1ETW A;  3FRQ A;  3GTL J;  4QTR A;  1HOM A;  2LFB A;  4M3G A;  5M3F J;  1HLV A;  1U78 A;  2E1O A;  3T6N A;  1BW6 A;  3GTJ J;  5CXG A;  3RZD J;  3VOX A;  1GV2 A;  2FX0 A;  5C44 J;  3K7A J;  3GTP J;  2Q24 A;  1X2M A;  1IDZ A;  2MW8 A;  1H8A C;  5AQC A;  4C3I J;  3GTQ J;  5IYD J;  5F1J A;  1FIP A;  1JTY A;  1IRZ A;  3WHB A;  2HDD A;  2ID6 A;  2ZCN A;  2LP0 A;  3OOU A;  1ETO A;  5F0C A;  1APL C;  5IPA A;  3SDG A;  3V6G A;  2M9H A;  4L62 A;  1Z77 A;  3CDL A;  3BTC A;  3JRB A;  5D19 A;  3DPJ A;  3UKG A;  3GTO J;  2GM4 A;  1GUU A;  4NDL A;  5EGO A;  4AF5 A;  1FJL A;  2L7Z A;  4C2M J;  3GZI A;  5K58 A;  4KWA A;  1JUS A;  3BT9 A;  2CU7 A;  2W48 A;  3BR0 A;  3RD3 A;  3VVY A;  3HGY A;  5DS9 A;  1YRN B;  3ANG A;  4MK6 A;  3Q0V A;  2G7S A;  4FE7 A;  1MBG A;  3GEU A;  3LSG A;  5M5Y J;  3V78 A;  2K9S A;  3JRD A;  1GVD A;  5M3M J;  1B72 A;  4A3G J;  4Y7N J;  1OCP A;  1VF9 A;  5M5W J;  1IGN A;  4IHY A;  5D1R A;  2OI8 A;  1GV5 A;  2NVY J;  2CQQ A;  4AYB N;  2FJ1 A;  2YVH A;  1EF4 A;  2VKV A;  3MNL A;  2CUE A;  2O8K A;  4X1E A;  1ETK A;  4FCY A;  5HBU A;  1JTX A;  1YRN A;  4IHW A;  1XC5 A;  1MBK A;  2ME6 A;  3BR2 A;  1F36 A;  2AO9 A;  1ZR4 A;  1VI0 A;  2DA4 A;  1IV6 A;  1OCT C;  3HTA A;  2ZCX A;  2ME0 A;  4FTH A;  5EGO B;  3QPS A;  1JUP A;  2GLO A;  1AU7 A;  2R7Z J;  4M3E A;  4MFE A;  5IP7 J;  2NOG A;  4JKZ A;  5FMP A;  2COB A;  2M8G X;  4JYK A;  1LE8 A;  4G12 A;  2ZOY A;  2HOS A;  5CW8 A;  1Z0X A;  1UI5 A;  1MBH A;  2DG8 A;  4AC0 A;  2UXU A;  1ETQ A;  4GCL A;  4BKX A;  2MGQ A;  5JLX A;  4D7N A;  1MNM C;  4HKU A;  5DTD A;  1MH3 A;  3O8G A;  5C4Y A;  2OPT A;  3AQT A;  5C4X J;  4J19 A;  1Q1V A;  4RBO A;  1TWF J;  3LNQ A;  3VW0 A;  2VPR A;  3I4M J;  2DJN A;  1BA5 A;  1S7E A;  3JRA A;  3B6A A;  4DW6 A;  2KDZ A;  4BXX J;  4GFL A;  3JRE A;  2NS7 A;  4UUS B;  1ITY A;  1ETY A;  3SFI A;  1P7I A;  3IH4 A;  3BTL A;  5M5X J;  1JUM A;  1BW5 A;  2ZB9 A;  3S17 J;  3VVX A;  1WGX A;  3S14 J;  2YVE A;  1I50 J;  4M3D A;  3KKD A;  4C3J J;  2QIB A;  1Y1W J;  3GBG A;  4X6A J;  4MLO A;  5H9T A;  2YUS A;  2LLK A;  4A3L J;  2XGE A;  2L0K A;  3LSJ A;  2V57 A;  2ECC A;  3KZ9 A;  1NTC A;  1IUF A;  2B63 J;  1MH4 A;  3BR6 A;  4A3B J;  1W0T A;  1MBE A;  3EUP A;  3MKL A;  4B3A A;  1FEX A;  2W53 A;  3PO2 J;  3NPI A;  5IOY A;  4MXM A;  4C3H J;  1IDY A;  4S0H B;  4JX6 A;  2D6Y A;  2JK3 A;  3BNI A;  1IJW C;  3F1B A;  3VUQ A;  4A69 C;  1H88 C;  4JX5 A;  5IP9 J;  1H89 C;  1OFC X;  2RAE A;  1A5J A;  2EH3 A;  2PBX A;  3COL A;  1QVU A;  2GBY A;  2L7F P;  2XRL A;  4NN1 A;  3WHC A;  2VUM J;  2LKX A;  5DAJ A;  2M0C A;  3HOZ J;  3SJM A;  2EZI A;  2ID3 A;  4RDU A;  2EQR A;  2I10 A;  5C4J J;  3BJB A;  2XPW A;  2L7M P;  4CYC B;  3LSP A;  3G1L A;  3IH3 A;  1HCR A;  2EZK A;  3BG5 A;  3E7L A;  4B4C A;  5EEA A;  4ME9 A;  1ENH A;  2HYJ A;  1JJ8 C;  2NVT J;  2DA3 A;  2CUF A;  2EZL A;  2X9D A;  4B1R A;  3BG3 A;  1D5Y A;  2WB1 N;  4L5E A;  2NVQ J;  3AQS A;  1K61 A;  2JN6 A;  4A3F J;  1RES A;  3JR9 A;  3VP5 A;  5E3N A;  2G3B A;  2DA1 A;  3BQZ A;  5F27 A;  4DZP A;  3BR1 A;  2K40 A;  3NXC A;  3CWR A;  1DU0 A;  5D18 A;  3HGG A;  2XB0 X;  2R0Q C;  2GUH A;  2NX4 A;  2HOA A;  3L1P A;  2XGD A;  3BR3 A;  3CRJ A;  2DMN A;  4A3D J;  1ZGW A;  3HM5 A;  3O60 A;  3VPR A;  5K7Z A;  3FKI J;  3ZQH A;  3JRC A;  3CCY A;  1GDT A;  5FLV A;  2RHA A;  1E3O C;  5EG0 B;  2H8R A;  5K7H A;  4DYQ A;  5EYR A;  3HTJ A;  5FKN A;  4XRM A;  2NVX J;  1T56 A;  3IH2 A;  5EZH A;  2Y30 A;  3RZO J;  4JNN A;  1JKO C;  1BJZ A;  5HOD A;  1I3Q J;  2O9L A;  4PXI A;  1U9N A;  4XID A;  2HXI A;  3ZQL A;  3BR5 A;  3FK6 A;  5FGL A;  1ETV A;  3W6V A;  3LWJ A;  4GFK A;  3FK7 A;  3I4N J;  2G7L A;  2DTZ A;  2QCO A;  3A01 A;  1AKH B;  4UUT A;  2E2I J;  4A3I J;  2M34 A;  1NK2 P;  4FIS A;  1POG A;  2LY9 A;  3S16 J;  4Y52 J;  5FJ8 J;  2REK A;  2QF7 A;  4V2F A;  1P7J A;  4M3B A;  2ECB A;  4M6V A;  5HAW A;  1TWH J;  2XGC A;  1IG7 A;  3IV5 A;  2LD5 A;  2UXO A;  4ACI A;  4XK4 A;  3MVP A;  5EDN A;  2E19 A;  3VIB A;  3QQA A;  1X58 A;  2LR8 A;  3VOK A;  2LTP A;  4A3C J;  2Y0S N;  2WAQ N;  1U9O A;  1X2N A;  2LK2 A;  3PAS A;  3A03 A;  1U8B A;  1XG1 A;  1SFO J;  4D5F A;  4A3J J;  1B8I A;  4QSH A;  1ZKG A;  2K9N A;  2DMT A;  1VFC A;  5IYC J;  1UI6 A;  3HOV J;  1PUF B;  2WUI A;  5FKL A;  3FIS A;  4XIC A;  3LJL A;  3Q3S A;  1XS9 A;  4W97 A;  2XDN A;  3VW2 A;  3CMY A;  1JT6 A;  3B6C A;  5IOZ A;  1BL0 A;  2ZOZ A;  4JP0 A;  3JSJ A;  3HIM A;  5J1U A;  4V2G A;  2EBI A;  3BTI A;  2P81 A;  1G2H A;  3LHQ A;  3CQZ J;  3BCG A;  2TRT A;  3PPB A;  4A93 J;  2Y2Z A;  2YS9 A;  1MSE C;  1UG2 A;  2JA6 J;  9ANT A;  5F04 A;  2CJJ A;  4AC6 A;  3QKX A;  4EEF G;  2RAS A;  1WI3 A;  3G1M A;  3NNR A;  4MFD A;  3IUV A;  3JRF A;  4BY7 J;  4GCT A;  2HXO A;  1QVT A;  3RQI A;  2K9Q A;  2M2E A;  5EG0 A;  2H1K A;  2R92 J;  1WH5 A;  5EF6 A;  4DYR A;  3JRI A;  2QOP A;  4DYC A;  2YU9 J;  1PUF A;  2L9R A;  4MO7 A;  3MN2 A;  4BBR J;  5J3L A;  2JA5 J;  3TP3 A;  2E2H J;  2G7G A;  2ELK A;  3DEW A;  3CJD A;  3LOC A;  1Y1V J;  3VW1 A;  4IHV A;  2DA5 A;  1WPK A;  4A3M J;  3GTG J;  1ZQ3 P;  2JJ7 A;  2E2J J;  2AHQ A;  3JRH A;  3BTJ A;  1CQT A;  3HEF A;  5GPA A;  3ON2 A;  4D7M A;  3S15 J;  3PM1 A;  2HOT A;  1FTZ A;  1VND A;  2DN0 A;  3TW6 A;  2TCT A;  2HKU A;  3KNW A;  2DG7 A;  2X48 A;  2HI3 A;  1UMQ A;  4IHX A;  1RPW A;  4BY1 J;  5E3M A;  1JJ6 C;  1LFB A;  1ETX A;  2MSY A;  3Q0W A;  2DMQ A;  2Y9Z A;  3HKZ N;  4FE4 A;  3PO3 J;  2G0E A;  3H3V K;  5E3L A;  5FLM J;  4NEL A;  3BRU A;  3ZQI A;  1MBJ A;  2N8G A;  2XPV A;  3HTH A;  4ABZ A;  5FKO A;  3BG9 A;  1IC8 A;  4I6Z A;  1TWA J;  3HTI A;  3S1M J;  1B8I B;  2O7T A;  2DA2 A;  2UXH A;  2HYT A;  2X6O A;  1TWG J;  1JT0 A;  3HB9 A;  5K7F A;  2JA8 J;  3ANP A;  2IEK A;  3S1N J;  4IEJ A;  2WV1 A;  2Y9Y A;  1QPI A;  5GPC A;  4UUS A;  5FKK A;  5IP6 A;  2GEN A;  1A6I A;  2HQ5 A;  4MIM A;  4XRS A;  1FTT A;  5GP9 A;  2XPU A;  5F0H A;  3HOX J;  1SGM A;  3G56 A;  3K2A A;  2DMP A;  1TWC J;  1I6H J;  1HF0 A;  3P9T A;  2O7O A;  1RR7 A;  5EZG A;  2DA6 A;  3NAU A;  3ZQF A;  1ZTR A;  4A3E J;  3A01 B;  3M3Y J;  1K83 J;  2D5V A;  1B72 B;  2NP5 A;  3OIO A;  1ORK A;  2DMU A;  1SAN A;  2NS8 A;  5J1Y A;  3DCF A;  2R5Y A;  1JKP C;  4DZJ A;  3OSG A;  3HOW J;  2IBD A;  3S2H J;  3A02 A;  1RKT A;  3Q0U A;  2R93 J;  5J1R A;  3NI7 A;  3RH2 A;  3C2B A;  5E3O A;  2KT0 A;  4I76 A;  2MG4 A;  4A3K J;  1MSF C;  2WGB A;  2PMZ N;  5IYB J;  1HDP A;  3VVZ A;  2NP3 A;  2DA7 A;  1R9T J;  2UXI A;  3RKQ A;  2Y31 A;  3LSR A;  2CQX A;  2XSD C;  2VI6 A;  3HOY J;  3QPL A;  2OER A;  3G1O A;  2CRG A;  3TED A;  3S1Q J;  3QBM A;  2LVS A;  2R5Z A;  2IAI A;  1JGG A;  4D5C A;  1AHD P;  5C3E J;  1F43 A;  3G7R A;  1QRY A;  3GTM J;  5FKM A;  3TP0 A;  2QWT A;  1NK3 P;  5JLW A;  4CYC A;  1W0U A;  1RKW A;  3KKC A;  1T33 A;  3O8H A;  4UDS A;  1FIA A;  1GT0 C;  1OJL A;  2UXP A;  2R5Z B;  5F0F A;  1TC3 C;  2OF7 A;  3GTK J;  4GFB A;  1MBF A;  3HBL A;  4JX4 A;  2XB5 A;  4QIW N;  1ZR2 A;  3HDD A;  5CXI A;  3BQY A;  3TW7 A;  1DU6 A;  5EFY A;  2IU5 A;  5HSZ A;  2PZ9 A;  4GCK A;  2QTQ A;  1WCM J;  3FIW A;  4YZE A;  3ON4 A;  3HE0 A;  4ICH A;  3ZQG A;  4LOC A;  2FQ4 A;  2JA7 J;  4CGR A;  3D1N I;  2FD5 A;  1RET A;  3F0C A;  1UHS A;  2FBQ A;  1WH7 A;  1LFU P;  4XRS G;  2GFN A;  1HDD C;  1JKR C;  4BBS J;  2R5Y B;  1AKH A;  5F08 A;  3ZQC A;  3NRG A;  3M4O J;  5FHP A;  2JMW A;  3JRG A;  1JKQ C;  3C07 A;  1O4X A;  2EZH A;  3B81 A;  2VKE A; 
#chains in the Genus database with same CATH topology
 3OYA A;  2CQ7 A;  1J75 A;  4HNV A;  2HPI A;  3S1R J;  3EGQ A;  1LE8 B;  2F07 A;  1XMK A;  4R1H A;  1MMD A;  1VZ0 A;  1TQM A;  4UB8 C;  3GX4 X;  2R3S A;  1K78 B;  2OU2 A;  3S2D J;  1ZK8 A;  2I5U A;  3AG2 H;  3S5R A;  3CDH A;  3H5R A;  1VQL I;  3S32 A;  1N78 A;  4QTR A;  4BQO A;  3AL0 C;  2LFB A;  5M3F J;  4IZZ A;  2E1O A;  3FMS A;  1GXQ A;  3GTJ J;  4LG3 A;  2DXI A;  2VOP A;  3RZD J;  1GV2 A;  1IN4 A;  2L54 A;  3DPU A;  5C44 J;  4RB1 A;  1XGN A;  2ZXJ A;  5FD5 A;  5HNF A;  4P55 A;  3T8R A;  3TDZ C;  1T6S A;  1KQ0 A;  2DJI A;  2L3D A;  4PSW A;  5DCM B;  4UV8 A;  5D4S A;  4EJW A;  4NC8 A;  5DM7 F;  4C3I J;  1JTY A;  2H6B A;  2Z3Y A;  4OAZ A;  2XSJ C;  3HRU A;  2ZJQ F;  1EKE A;  3R4K A;  2LP0 A;  1ZRD A;  2W85 A;  5FLX K;  4A2U A;  3D5R C;  4EGZ A;  5CVR A;  1FYK A;  3V6G A;  1YX5 A;  2BVM A;  4I7H A;  3CDL A;  5D19 A;  2G7U A;  2ZNY A;  2XAQ A;  4PJ0 C;  4GYI A;  1GUU A;  5EGO A;  1XDU A;  2GIV A;  4C2M A;  2L7Z A;  3QOE A;  4C2M J;  4RB2 C;  1OYW A;  5DEQ A;  5J8F A;  5LGU A;  4OD4 A;  3VVY A;  3REO A;  3PSF A;  2E1N A;  3TOA A;  3HSE A;  3RJP A;  2KP6 A;  4E6K G;  2C6Y A;  4FX0 A;  3DTI A;  3NEU A;  3V8J A;  2K9S A;  1MMG A;  3JRD A;  1YJN I;  4HYE A;  4Y17 A;  5D1R A;  3H9J A;  1BOA A;  2CW7 A;  3LAP A;  5M5W J;  1WI9 A;  4A3G J;  2B1E A;  3W2V A;  3VTI A;  2CUJ A;  2NVY J;  4CCK A;  2JZY A;  2YVH A;  5DDG A;  1OMI A;  2KIS A;  2BYV E;  4AIK A;  2XVC A;  1ETK A;  2YX7 A;  4A5N A;  4E70 A;  1YRN A;  4M73 A;  2AS5 F;  1XC5 A;  2ME6 A;  1W5C C;  3ASN H;  1FY7 A;  3GO5 A;  2ME0 A;  2K7L A;  3V7S A;  1AU7 A;  4GDF A;  3LSK A;  1K4S A;  2HS5 A;  2JSP A;  4HF0 A;  2M8G X;  4JYK A;  4JBA A;  2BW3 B;  4YII A;  1Z0X A;  2UXU A;  3WTW C;  2BY3 A;  1P4W A;  4BKX A;  2MBF A;  2DT7 B;  5EJC A;  1MNM C;  1E17 A;  4HKU A;  4XNF A;  1G3Y A;  5C4Y A;  2O61 A;  4RLF A;  1TWF J;  1XGS A;  3VYS B;  2BHZ A;  1KQ8 A;  2DJN A;  3HPH A;  1BA5 A;  3PNY A;  1KU2 A;  1QQI A;  3B6A A;  4DW6 A;  2RDP A;  3KP6 A;  3JRE A;  4F93 B;  2V9K A;  2BZT A;  5GTH C;  5F1R A;  5HVQ C;  2O5R A;  4RA2 A;  3DPT A;  1P7I A;  3AKZ A;  1BW5 A;  3P5J A;  2QA4 I;  3VVX A;  3JSO A;  2ZCW A;  4LD5 A;  2VOO A;  1I50 J;  2Q1Z B;  3F23 A;  2V7F A;  3KKD A;  2QIB A;  1Y1W J;  4ESF A;  1T8I A;  1YJW I;  3F8B A;  3BOQ A;  2RQQ A;  2UUZ A;  2MD0 A;  1FSH A;  5H9T A;  4J00 A;  1YFH A;  2LLK A;  2V79 A;  4P1W A;  3SWH A;  3TL4 X;  1XSD A;  2VJ4 A;  4OIN F;  2XC7 A;  3MKZ A;  4PJM A;  4LB5 A;  3MD2 A;  1W1W E;  4C2U A;  1MBE A;  2FMY A;  3MKL A;  1LB2 A;  4E4H A;  1CF7 A;  3R60 A;  4LLG F;  4HV6 A;  5IOY A;  1SMT A;  2D6Y A;  2KIM A;  2JK3 A;  2NRA C;  1IJW C;  4L9T A;  3BNI A;  1WJ5 A;  2EFQ A;  4JX5 A;  4HPQ A;  4PJJ A;  4YEJ A;  1YJ9 I;  2BEO A;  1T0F C;  2EFO A;  5LEK A;  2A61 A;  1RR8 C;  1BBY A;  1OFC X;  1U0J A;  2RAE A;  1A5J A;  2EH3 A;  2PBX A;  3OV8 A;  3COL A;  2RC4 A;  2L7F P;  2A07 F;  3WHC A;  2LKX A;  4WF2 A;  2PN6 A;  1X1P A;  3L2V A;  1ON1 A;  2LH9 A;  3UNG C;  5D5W B;  3FXR A;  2BHY A;  4AID A;  2P7V B;  3LA2 A;  2P5V A;  1AA7 A;  2ZC2 A;  3CUQ B;  4NC6 A;  2DYR H;  3G1L A;  1DDN A;  1K7A A;  2EZK A;  4NQW A;  1G3W A;  2YR2 A;  3CMM A;  5EEA A;  3WG9 A;  4DBQ A;  1JJ8 C;  1I6X A;  3S3O A;  3FKJ A;  3SYT A;  4YFX F;  4B1R A;  1U5T C;  5FRM A;  2WB1 N;  3ECH A;  2HTJ A;  1K61 A;  4GGG A;  2VKD A;  3DFG A;  3RI4 A;  4PJN A;  3X2Q H;  1R5I D;  3WTU C;  3NXC A;  3CWR A;  2R7V A;  2CH0 A;  1NG7 A;  3F22 A;  3CP2 A;  4CCO A;  1DP3 A;  2XB0 X;  2R0Q C;  1D0X A;  1X1C A;  3K1P A;  1FZP B;  2HOA A;  3ABT A;  2FNA A;  1XB4 A;  2XIG A;  4Y13 A;  3ESW B;  2OQG A;  4BQQ A;  3DKW A;  2H6C A;  5IY5 H;  3FKI J;  2ZBK A;  2QWW A;  2ADU A;  3JRC A;  2RHA A;  3ROU A;  1E3O C;  4NNJ A;  2LG4 A;  4K2E A;  1VQP I;  2QSG X;  3E6C C;  1D1A A;  1R5G A;  3ABK H;  5FKN A;  3FMQ A;  1SVO A;  3V8K A;  1T56 A;  4BXU A;  1R1T A;  3F8M A;  5LD2 C;  5J4Y A;  2BVL A;  4HBL A;  3LA3 A;  4KMU X;  2LKP A;  1BJZ A;  4ENM A;  1I3Q J;  4ANJ A;  4CCJ A;  4PXI A;  3ELK A;  4XID A;  5FRN A;  2P0W A;  2CFX A;  3FK6 A;  1YTY A;  4OMZ A;  1ETV A;  3LWJ A;  3MFK A;  3CCQ I;  3BZ6 A;  2VXZ A;  3I4N J;  1R1V A;  2G7L A;  1R49 A;  2B9S A;  5D5X B;  3A01 A;  2LF8 A;  2E2I J;  1D8J A;  3BPV A;  4L9N A;  1UEL B;  4BQN A;  4ZH4 F;  2DOA A;  2M1B A;  3KYD B;  4FIS A;  4II2 A;  2GXA A;  4ZYH A;  3OS2 A;  1Y0U A;  3Q9V A;  4V2F A;  1W36 C;  2ZXI A;  4H0E A;  2KKO A;  1IG7 A;  4ACI A;  1G6N A;  1WJE A;  5EDN A;  3PJR A;  5JI6 A;  1T95 A;  4II3 A;  2P5L C;  2EB7 A;  2LTP A;  1E0E A;  1BIB A;  4AVP A;  1GXP A;  4ZJZ A;  4WX9 A;  3EUH A;  2M8E A;  4BUP A;  3CO6 C;  2DMT A;  1Z21 A;  1ZGJ A;  3JW4 A;  3KYL A;  1UI6 A;  1SAU A;  2K9L A;  4OOI A;  5KAF C;  3LJL A;  4A0Z A;  3HHG A;  3IRR A;  1JT6 A;  1U5T A;  3K4C A;  5IOZ A;  1I1G A;  2IVM A;  1BL0 A;  2EBI A;  3BTI A;  3VEP A;  1G2H A;  3LHQ A;  1B9N A;  3BCG A;  5ILU A;  4J01 A;  2F5V A;  2R7F A;  2G9W A;  1YO5 C;  3BLY A;  9ANT A;  4AC6 A;  2DI3 A;  2DLL A;  4HLX A;  1RC9 A;  3KIO A;  1UFM A;  2F5F A;  3NS4 A;  3PIO F;  1OR7 C;  2WAQ A;  4FET A;  3JRF A;  2NYX A;  1BI0 A;  1SAX A;  1H9G A;  4YFK F;  4Z2Y A;  4RAF A;  1AOY A;  2AXT C;  4HNT A;  3S93 A;  3QP6 A;  3LMM A;  1U8R A;  2GA2 A;  5J3L A;  1YYV A;  3OYI A;  2E2H J;  3M7G A;  1OPC A;  1T2K A;  3CJN A;  1BOB A;  5BOX A;  2CV0 A;  4LGW A;  3DEW A;  3SEQ A;  3CJD A;  3VW1 A;  3F72 A;  1XD7 A;  3RPU A;  2VAS A;  1KYW A;  1WPK A;  4ZTF A;  3VSL A;  3M1C A;  2KRH A;  2DBB A;  3TO6 A;  3HEF A;  3QP5 A;  4S04 A;  2QEN A;  5GPA A;  3ON2 A;  3S15 J;  2FOW A;  2M0M A;  3GCM A;  3HRM A;  3RCO A;  2O0Y A;  3G6E I;  2DG7 A;  1UMQ A;  1RPW A;  2MFZ A;  4AWX B;  1VQ9 I;  5E3M A;  2MSY A;  1ETX A;  1HXD A;  2XDV A;  3Q0W A;  2Y9Z A;  3HKZ N;  5LLQ A;  3OYN A;  2G0E A;  3T5X A;  3HL2 A;  3C18 A;  1ZRF A;  3BRU A;  3CUO A;  5L3G A;  1MBJ A;  3KP4 A;  1LEB A;  5LHG A;  1T08 B;  3IHU A;  3ABM H;  3HTI A;  3S1M J;  2A05 A;  3OIQ A;  3V4G A;  4M72 A;  3WE3 A;  5LRS A;  1JT0 A;  3HB9 A;  1X4O A;  4HV5 A;  1J2X A;  4EGY A;  1QGP A;  3S1N J;  4IEJ A;  1QPI A;  2V1X A;  2ZME C;  3GFJ A;  3T8T A;  5FKK A;  1I27 A;  4UVC A;  1XCB A;  3K4L A;  2DOD A;  1SGM A;  1QBJ A;  5F0H A;  3HOX J;  4MTE A;  1OR7 A;  4E7S A;  4D9J A;  3P9T A;  5J47 A;  1N25 A;  5EZG A;  3GF2 A;  3OR2 C;  2DA6 A;  1Y0N A;  3ZQF A;  1FMW A;  1BN5 A;  4BYY A;  2CW8 A;  1K83 J;  5LHI A;  3VOD A;  1ORK A;  1Z91 A;  2NOJ B;  3I4P A;  3DV8 A;  1JKP C;  4KMF A;  3BJ6 A;  2JUC A;  3F6V A;  2B7E A;  3FXK A;  5ILV A;  2IBD A;  2R93 J;  3NI7 A;  3DTK A;  2KT0 A;  2RQP A;  1ZRC A;  2DOE A;  4A3K J;  3E5Q A;  1MSF C;  2EV6 A;  4UUV A;  5IYB J;  3MWM A;  4BEH A;  4HF2 A;  2UXI A;  2Y31 A;  3J81 K;  3QPL A;  1J9I A;  2OER A;  3G1O A;  2WBM A;  4EV0 A;  5JHF A;  4HA8 A;  4PSX A;  4ON0 A;  5E79 C;  4XMY A;  4IL6 C;  2VC1 A;  4RAG A;  1R4N B;  4CCN A;  5FKM A;  4CYC A;  1RUN A;  3ZPL A;  1MGT A;  1UHW A;  2LBF A;  4RS8 A;  4BGD A;  2R5Z B;  5F0F A;  4DOZ A;  2XAJ A;  2OF7 A;  3WGI A;  3GTK J;  4ZYG A;  3OY9 A;  5DM6 F;  2HQN A;  3HDD A;  2Z2S B;  4EVI A;  1HKS A;  4BJ6 C;  5EFY A;  2Z1D A;  2XKO A;  1FBQ A;  3A4C A;  4GCK A;  3DTE A;  1I5Z A;  1YE9 A;  4CGZ A;  4YZE A;  2WB1 A;  3G4S I;  1LQ1 A;  3F8C A;  4BE0 A;  1IXS B;  3ZQG A;  4L18 B;  4GCV A;  1I1S A;  2RGV A;  3E5X A;  3F0C A;  5ICC A;  5E17 F;  3SXY A;  1T98 A;  1LFU P;  1IAW A;  2IGO A;  1ZAO A;  1YIJ I;  2GFN A;  4BBS J;  5F6F A;  1BR2 A;  1R5H A;  5DCM A;  3L00 A;  1A04 A;  1LPQ A;  5FHP A;  2AXL A;  2D45 A;  1S9H A;  1O4X A;  5TGT A;  3B81 A;  5D4R A;  1HW5 A;  1TZL A;  2HWV A;  2P8T A;  3ZOB A;  2M45 A;  1IRX A;  4M71 A;  3OSF A;  1DQU A;  1SVL A;  1YW7 A;  4AUX A;  3G3Z A;  4ZTJ A;  4JQF A;  5BNG A;  1K78 A;  2ICW G;  2ZCM A;  1P2F A;  3L7W A;  3K69 A;  1ETW A;  4EM2 A;  2R7W A;  1HOM A;  3LSM A;  3H9Q A;  3CC2 I;  1U78 A;  1L3L A;  5LHH A;  3KPH A;  3VOX A;  3H5N A;  2FX0 A;  4L9V A;  3V7R A;  3GTP J;  4UVA A;  2Z33 A;  4Q48 A;  4O6J A;  3T0Y A;  1X2M A;  4D1Q A;  3CTA A;  4KYW A;  2O03 A;  1KU7 A;  2CQN A;  2L9V A;  3GTQ J;  3WG7 H;  5IYD J;  1IRZ A;  1XGO A;  2DFI A;  2OTJ I;  4M9S A;  2ZCN A;  4XLF A;  1TQP A;  3CF2 A;  3H3U A;  2EIL H;  2P5K A;  3ERE D;  1FC3 A;  3L2Q A;  2ZJP F;  3W2A A;  2YSR A;  5CVI A;  3BTC A;  3G2B A;  2A6T A;  2W82 A;  2GM4 A;  3GTO J;  3A0H C;  3MMY B;  2IP2 A;  2KFD A;  3K4M A;  1XX5 A;  4RMN A;  1AWC A;  2KZG A;  1YOV B;  5CYV A;  1FYM A;  2IS6 A;  1SFX A;  5GAE J;  3BR0 A;  2V6E A;  2RV8 A;  3HGY A;  5DS9 A;  3E6D A;  4MQV A;  1XSV A;  1Y6I A;  4FE7 A;  2M7B A;  3COA C;  1MIJ A;  4XKB A;  2F48 A;  2R7D A;  5M3M J;  3FXJ A;  1B72 A;  5D8L B;  1IGN A;  1S6L A;  4G94 A;  4AYB N;  4PFP A;  1WFX A;  4FQG A;  1T38 A;  2BY2 A;  1EF4 A;  2VKV A;  3MNL A;  2PMZ A;  2PEX A;  4B09 A;  1WWX A;  3AAF A;  1JTX A;  1BI3 A;  1P9Q C;  2BW3 A;  2MC3 A;  5JVT A;  2IGN A;  3I58 A;  2VQL A;  2QEX I;  1MBK A;  3DF8 A;  5BMZ A;  3FXO A;  1ZR4 A;  4IHW A;  2VOD A;  2R7T A;  1T39 A;  1OCT C;  2ZFW A;  4XRF A;  4FTH A;  4RM2 A;  1OKR A;  1JUP A;  2ELH A;  4CCM A;  4M3E A;  4HX7 A;  4GRI A;  4LG0 B;  3V8L A;  5IP7 J;  2NOG A;  4CIC A;  2W4S A;  2KDO A;  4N9I A;  3KYC B;  3GZN B;  4RGX A;  5JHU A;  2HOS A;  2STW A;  2ZOY A;  5CW8 A;  3OWT A;  2FOK A;  2OZU A;  3GXO A;  2E36 A;  4U7D A;  2ZXW H;  4UV9 A;  4ITV A;  5TRD A;  3DLA A;  4PJL A;  3AL0 B;  4GCL A;  2HDW A;  2MGQ A;  2VQH A;  4OIP F;  5DTD A;  2XAH A;  1LVK A;  2OPT A;  1JE8 A;  4BQA A;  2PMH A;  2KJB A;  4BL0 B;  3LNQ A;  4CHU A;  3I59 B;  3VW0 A;  3P7N A;  2VPR A;  4UVB A;  4A0X A;  3WTS C;  3I4M J;  4IRV A;  3JRA A;  3ASO H;  5IT9 K;  2EIJ H;  2F5D A;  4UUS B;  1EH8 A;  3O3K A;  3GYH X;  3ZN0 A;  4UY8 I;  2HZD A;  2OUM A;  3FBI B;  3RYP A;  1LDK B;  5M5X J;  5F64 A;  5FFX A;  1KQ9 A;  5J4V A;  1V5G A;  3S14 J;  3M1E A;  1JGS A;  3JAM K;  3EUH C;  4M3D A;  2OCE A;  4C3J J;  4FT8 A;  2OTL I;  2FUG 2;  4B8X A;  2VB6 A;  3IP4 B;  3PQK A;  1VQ4 I;  4HNU A;  4IQ4 A;  4L5I A;  1F9N A;  2JUG A;  3WGG A;  3LSJ A;  4IJA A;  2IS4 A;  3LSH A;  2V57 A;  2GA1 A;  1QPM A;  1D1B A;  5B3S H;  2ECC A;  3KZ9 A;  1IUF A;  4IOC F;  3HRT A;  4A3B J;  3OYK A;  1W0T A;  2MC4 A;  2L01 A;  1FEX A;  4N4N B;  2VE9 A;  3VSK A;  3CZ6 A;  2FRH A;  4MXM A;  1YG2 A;  1B6A A;  1IDY A;  1JXS A;  4JX6 A;  1TW2 A;  3ONQ A;  3F1B A;  2CFO A;  2KLO A;  5L3F A;  2EFW A;  1IN7 A;  1KU9 A;  3TDU C;  5IP9 J;  3GFI A;  2OQR A;  4ZZL A;  2WAD A;  1H89 C;  3I54 A;  3CJR B;  1VQO I;  1Y39 A;  2OJE D;  1Y8R B;  2L4M A;  2XRL A;  2R7S A;  2X85 A;  4QPQ A;  1VQ5 I;  2KPM A;  1HA8 A;  3OYF A;  3FDY A;  1O3S A;  1EH6 A;  2JVG A;  2CV1 A;  2EZI A;  2ID3 A;  1SFU A;  4RDU A;  1QHH D;  2FML A;  2I10 A;  3KP5 A;  4AYB A;  5C4J J;  3BJB A;  2ELJ A;  3IKT A;  2BXZ A;  3CME I;  2L7M P;  2ISY A;  3V7C A;  4CYC B;  2DT5 A;  3BG5 A;  2H8W A;  4B4C A;  4ME9 A;  3OYL A;  1ENH A;  1BIA A;  2HYJ A;  1D5V A;  2NVT J;  1ZEL A;  1U3E M;  2R4G A;  3FWE A;  3KE2 A;  3BG3 A;  1J7K A;  3LWF A;  2NVQ J;  1MDM A;  2VN2 A;  2A5Y B;  3E6M A;  3R0J A;  4HOB A;  2F2E A;  1RES A;  3JR9 A;  4BAY A;  4XSZ F;  2DA1 A;  2V6C A;  4LIU A;  5LRR A;  3BQZ A;  5F27 A;  4DZP A;  3RTR A;  2H1L A;  1ZG5 A;  1SVM A;  2ESN A;  4XKV A;  2GUH A;  2NX4 A;  2JPC A;  3L1P A;  2XGD A;  2DMN A;  1ZGW A;  3HM5 A;  1ACI A;  4R8H A;  2LRE A;  3RKW A;  1R1U A;  3PFY A;  3OYG A;  3ZQH A;  4G7Z F;  3GEZ A;  4ZYD A;  2HYG D;  4LLN A;  1USS A;  1R22 A;  2GZW A;  2X4H A;  4DYQ A;  5EYR A;  3QU6 A;  4O5V A;  2A68 F;  2PFV A;  1DGR M;  1S29 A;  2ETH A;  4DNC A;  3LL7 A;  4GYG A;  3RZO J;  5H6R A;  5GAH J;  4O3M A;  2O9L A;  1QO0 D;  2NS0 A;  1FSE A;  3R61 A;  1U6G A;  3ZQL A;  1BI2 A;  3N05 A;  3KEO A;  4KT5 C;  2F4O B;  3CLQ A;  2DTZ A;  5FO5 A;  5JVG F;  3MZ8 A;  2M34 A;  1HSJ A;  2WAF A;  3L09 A;  1X1D A;  1W4M A;  1NK2 P;  1IRG A;  4E7K A;  2DO7 A;  2LY9 A;  3RKY A;  2HZT A;  5JR3 A;  2KQR A;  3S16 J;  5FJ8 J;  1TTY A;  1UJ8 A;  2REK A;  2XF6 A;  4B44 A;  4DIQ A;  4G7H F;  2XAS A;  2BBY A;  2ECB A;  1TWH J;  5DD4 A;  2LD5 A;  1N75 A;  4AIH A;  5HDK A;  2IA2 A;  2JVH A;  3E0J B;  1MNE A;  4L0Y B;  3OMY A;  3CC7 I;  2EPF A;  2LR8 A;  5GAG J;  3OIP A;  3ZMZ A;  2Y0S N;  4LFU A;  1T0F A;  4HDV A;  1U9O A;  1X2N A;  1ON2 A;  2KRF A;  2LY2 A;  4RGU A;  1SFO J;  2K9N A;  1VFC A;  2K85 A;  4CUG A;  2CUZ A;  3HUG A;  3HOV J;  2PJR B;  3DKY A;  2WAE A;  5FKL A;  4DJA A;  3Q3S A;  3PQJ A;  1X3Z B;  2W00 A;  3B6C A;  3WU2 C;  2RVC A;  3IKV A;  3DLL F;  4V2G A;  1DP7 P;  1KYZ A;  3VYR B;  3CQZ J;  3GME A;  4FAS D;  3B02 A;  1FWZ A;  1J5Y A;  1ZN2 A;  5B1B H;  1O57 A;  1WJB A;  4RLQ A;  3TQN A;  3K4N A;  2MYS A;  2V9P A;  2ESH A;  3EDP A;  2CJJ A;  3PNT A;  2RAS A;  3ERM A;  3CF5 F;  3ZMT A;  2ACJ A;  4I01 A;  5B5E C;  3MEX A;  1S72 I;  3ZP5 A;  3G1M A;  3NNR A;  2QZ8 A;  5HDG A;  5LBQ A;  1FOK A;  4HAM A;  2HXO A;  1QVT A;  2VBZ A;  4XOT A;  1GVJ A;  5EG0 A;  4FHT A;  2H1K A;  5FLX Z;  1WH5 A;  1YLF A;  3NRV A;  4DYR A;  2QOP A;  3JTG A;  1IV8 A;  1ZGA A;  1VQN I;  2VBY A;  2VON A;  2JA5 J;  1X3U A;  2EA2 A;  3BP8 A;  3KP7 A;  1IRF A;  1PP8 F;  1C0W A;  1YQA A;  2XRO A;  4WIB A;  1Y1V J;  3HIF A;  2FBK A;  2X1D A;  2DK5 A;  3WOD F;  1TL8 A;  2PQ8 A;  5E18 F;  4E7J A;  3ZGK A;  2OA4 A;  4Q4Z F;  3CCJ I;  1FTZ A;  3DBL B;  4NBQ A;  1FMV A;  4NB5 A;  3J7A Y;  5HLG A;  2X48 A;  4NUB A;  4HSR A;  2E35 A;  4BAC A;  3BWG A;  3J80 Z;  1O7L A;  4MTD A;  1GLN A;  1LFB A;  5BPI A;  2E1M B;  1YHQ I;  2DMQ A;  4IO9 F;  4FE4 A;  2UWM A;  2QVO A;  3IAS 2;  2ZY9 A;  4P96 A;  5FLM J;  2K3P A;  4OAY A;  3HTH A;  4ABZ A;  1IC8 A;  1IW7 F;  2EIN H;  2KHM A;  4H4K C;  2XV4 S;  5FD6 A;  2UXN A;  1YX3 A;  1G4D A;  3JSP A;  5K7F A;  1FPQ A;  1MW7 A;  2WV1 A;  4BJ5 C;  1TT5 B;  4IRG A;  4UUS A;  5TJJ A;  3W3C A;  1DPR A;  2GEN A;  2K86 A;  4MIM A;  1XSX A;  5GP9 A;  2WWY A;  1DGW Y;  4CCL A;  1R00 A;  3G56 A;  4A12 A;  5EEH A;  1FP2 A;  2LSO A;  3FX3 A;  5J8C A;  3QYB A;  1HF0 A;  1S5L C;  2O7O A;  1RR7 A;  2IT0 A;  4ASN A;  2QKM B;  1RUO A;  1K6Y A;  3ML6 A;  4LK0 F;  3KP3 A;  2OBP A;  3SHF A;  5E1W A;  2D5V A;  3TO7 A;  1REP C;  3EYI A;  5K5Q A;  4WXD A;  4DZJ A;  3HOW J;  3P9K A;  3CCS I;  5CQG A;  3Q0U A;  5J1R A;  3CCU I;  1A6Q A;  2DFE A;  2OAZ A;  2MG4 A;  4OMY A;  1MZB A;  3HSF A;  2KIU A;  3FM3 A;  4XBF A;  2QSF X;  5LEJ A;  5L3B A;  2Z9O A;  3VVZ A;  2DA7 A;  1J59 A;  3M8J A;  5LGN A;  3GUD A;  5CPR B;  2HR3 A;  3HOY J;  5E8I A;  5KAI C;  4IHT A;  3TED A;  3S1Q J;  4EM1 A;  3U9G A;  3I56 I;  1D3Y A;  2E34 A;  2LVS A;  1W7P B;  1OLT A;  2IAI A;  1AHD P;  1ZRE A;  3G7R A;  5D6E A;  4Y3O A;  2JT1 A;  1OCC H;  1RKW A;  2VBW A;  3CUQ A;  1GT0 C;  4IKF A;  4PFO A;  2UXP A;  2L7K A;  3CJQ B;  1TC3 C;  1EA3 A;  2FJI 1;  3HG9 A;  4V19 K;  1R6R A;  2XB5 A;  3ECO A;  1ZR2 A;  2ZXH A;  4KJZ A;  5HNH A;  3AG4 H;  1CF7 B;  4G6Q A;  2PZ9 A;  2X1C A;  3KET A;  2QTQ A;  4ZDL A;  4A6D A;  2ZJR F;  2IPQ X;  1LFP A;  2HYF A;  2K5C A;  2L9N A;  2FQ4 A;  1NH3 A;  2JA7 J;  4CGR A;  4DVY P;  1RET A;  1UHS A;  2GOX B;  3RIR A;  2ZME B;  1D8K A;  4ENK A;  1JKR C;  2E7W A;  3F6O A;  2DFH A;  3OR1 C;  2QSH X;  2JMW A;  3JRG A;  3F9K A;  2FA5 A;  1NG6 A;  4JL3 A;  3BHQ A;  2QKO A;  2JWT A;  3U1K A;  5JFR A;  4RB3 C;  1P4X A;  3H0G J;  2F5C A;  4EJV A;  4ENJ A;  3E7Q A;  1ZH5 A;  3FRQ A;  4M3G A;  2H27 A;  2HKX A;  3HJE A;  4M9Z A;  1BW6 A;  4XON A;  5CXG A;  2JA2 A;  5CVV A;  2L02 A;  2IA0 A;  1ULY A;  2P7C B;  5KVR A;  3K7A J;  2Q24 A;  1IDZ A;  2MW8 A;  1Y56 A;  4BHC A;  5CQE A;  3RKX A;  5F1J A;  3OYD A;  4IOA F;  4L9J A;  4EMS A;  2VT3 A;  2BY1 A;  2V1D A;  3FXL A;  3A1Y A;  3OOU A;  1ZYR F;  1ZHF A;  3QYE A;  1IXR C;  1U2W A;  2L2O A;  3QPT A;  3SDG A;  3F21 A;  3OL4 A;  3BJO A;  3O2P E;  3HYI A;  1GHC A;  2DDB A;  4L62 A;  4PDK A;  3K1N A;  1RRJ A;  3HRS A;  2XAU A;  3DPJ A;  4I02 A;  3L9F A;  1PVE A;  2LBF B;  4AF5 A;  1TLH B;  1FJL A;  2F5E A;  1UZC A;  5D5V B;  2UZK A;  3GZI A;  5K58 A;  4KWA A;  4RB0 A;  3BT9 A;  2CU7 A;  4F92 B;  2EA4 A;  2W48 A;  3SZT A;  3C7J A;  1YRN B;  2QLZ A;  3N97 A;  4MK6 A;  2IA1 A;  3H1C A;  2G7S A;  2A3S A;  3ZMD A;  3GEU A;  3LSG A;  1Z67 A;  4JOM A;  2XKP A;  3K4J A;  1VF9 A;  4IHY A;  2VL8 A;  2QQ8 A;  1BC8 C;  2OI8 A;  2VQG A;  2BY0 A;  3J80 K;  3GWZ A;  1WJF A;  2HGC A;  2FJ1 A;  3SFZ A;  3KP2 A;  4BU2 A;  2JPB A;  4IHS A;  2FXA A;  4X1E A;  4IQJ A;  4LB6 B;  1HC8 A;  5CJ9 A;  5KCM A;  4UNO A;  3OYH A;  3BR2 A;  1F36 A;  2PX9 A;  1IV6 A;  3HTA A;  2ZCX A;  2YU3 A;  2M7A A;  4XR6 A;  5EGO B;  2GLO A;  1X1A A;  1FBU A;  2JQ7 A;  1FNN A;  2COB A;  1XCV A;  1EJ9 A;  1P92 A;  1M1E B;  2AQE A;  1HST A;  1V4R A;  2A6H F;  3RQ4 A;  3W6K B;  3J81 Z;  4XLA A;  2XAF A;  1PJR A;  1ETQ A;  3LFK A;  3P9I A;  2EV5 A;  4D7N A;  3LA7 A;  3O8G A;  5KHD A;  2CS3 A;  3ZQQ A;  1WKM A;  1XMA A;  1R71 A;  1SFK A;  5DD8 A;  3GLL A;  4BXX J;  1TQI A;  1MND A;  4GFL A;  2NS7 A;  1D1C A;  3E3V A;  2MAB A;  4CZZ A;  2DPU A;  1ITY A;  1ETY A;  1QZZ A;  4KUM A;  3IH4 A;  3BTL A;  2A6E F;  1JUM A;  2ZB9 A;  1BR4 A;  1MKM A;  4BH9 A;  2R7X A;  3CLO A;  5DUK A;  2QGU A;  1WGX A;  1YI2 I;  3SQN A;  4FX4 A;  3FXQ A;  1XDS A;  2J5O A;  4LIV A;  2CWE A;  1I39 A;  1V5F A;  3GBG A;  4MLO A;  1YS6 A;  2YUS A;  2K02 A;  4A3L J;  1WRJ A;  2XGE A;  5KK1 A;  4M74 A;  4F7Z A;  3LAJ A;  1NTC A;  3PFI A;  2B63 J;  2D2W A;  2JRM A;  4RM3 A;  4ZYE A;  3EUP A;  3HC7 A;  2VBX A;  2X51 A;  3M8F A;  4B3A A;  4AD9 A;  3PO2 J;  2W53 A;  3NPI A;  3I71 A;  2M4G A;  3I9V 2;  2HKO A;  4IRI A;  1MJ9 A;  2F4I A;  2WY7 Q;  1H88 C;  3KZI C;  4EJO A;  1S3J A;  4Z6Y A;  3G73 A;  2QQA A;  4KIB A;  2Y0S A;  1QVU A;  2GBY A;  4NN1 A;  3TKY A;  2VUM J;  2KIF A;  1ZG3 A;  5DAJ A;  4KIT B;  2HVS A;  4KDP A;  5E1Z B;  1OQY A;  1B9M A;  2EQR A;  2GAU A;  1PYV A;  4BS9 A;  5K5O A;  1BR1 A;  2IS1 A;  1RZ4 A;  2XPW A;  3QAH A;  3B73 A;  3D5L A;  3IH3 A;  4CXF A;  4HW0 A;  3T1B A;  3KLO A;  1W7P A;  4LIT A;  2DA3 A;  2W25 A;  2EZL A;  6PAX A;  2X9D A;  4C9Y A;  4XOR A;  3JCU C;  3AQS A;  4L5E A;  4HLY A;  5ED4 A;  3F3X A;  3PSI A;  4UXN A;  4A3F J;  1VQM I;  4L0Z B;  3VP5 A;  1HQC A;  2V26 A;  2WY8 Q;  5E3N A;  2G3B A;  1LJ9 A;  2PJP A;  3NWT A;  3CCV I;  3BR1 A;  2XRN A;  3M07 A;  4EQQ A;  4HG2 A;  1MMN A;  3TBI A;  5D18 A;  2X1E A;  2KRC A;  3HGG A;  3I5U A;  5ICE A;  1V5E A;  4OIQ F;  2VJJ A;  5DUI A;  2IW5 A;  3GW2 A;  1OCO H;  3DXJ F;  4LJZ F;  2BOL A;  4PCQ A;  3VPR A;  5CLS A;  3FHZ A;  1XN7 A;  4UHT A;  1IXC A;  1DPU A;  1GDT A;  3CCY A;  5FLV A;  1YIT I;  5EG0 B;  1HW2 A;  3ZQ7 A;  2H8R A;  5K7H A;  1B4A A;  3HTS B;  3I55 I;  2Q2E B;  5CVU A;  4G9Y A;  1O7F A;  3HTJ A;  1ODD A;  4XRM A;  2CYY A;  1VTN C;  4I98 B;  5EZH A;  3IC7 A;  2Y30 A;  2TDX A;  1JKO C;  4Q5S F;  2J5P A;  1ZAR A;  2R7U A;  2HXI A;  3A0B C;  3ZMS A;  3BR5 A;  5A2Q Z;  2HDC A;  5K1Y A;  5FGL A;  5E8G A;  1FP1 D;  3W6V A;  4GFK A;  2FU4 A;  2QCO A;  2FBH A;  5HOO A;  3QRF F;  1AKH B;  3CJT B;  4UUT A;  1MMS A;  2MH9 A;  3C3W A;  2OZ6 A;  4A6E A;  2E7X A;  3N4M A;  4Y52 J;  1E3P A;  4CYD A;  3GZ6 A;  1P7J A;  2P6T A;  4M3B A;  5B1A H;  2ZNZ A;  2XGC A;  2Q2E A;  2VE8 A;  3RPU D;  3L2W A;  2UXO A;  3IRQ A;  4L5J A;  3DU5 A;  4F91 B;  2E19 A;  1MD0 A;  3QQA A;  1WZ2 A;  1X58 A;  3VOK A;  3MZH A;  2WAQ N;  2LK2 A;  5FB2 A;  3PAS A;  2JTV A;  1U8B A;  4BDZ A;  1XG1 A;  3I59 A;  2F6C A;  4D5F A;  4QSH A;  2IXS A;  1OCZ H;  2KMU A;  2PG4 A;  5IYC J;  1SD5 A;  3FIS A;  1BC7 C;  3K2Z A;  1XS9 A;  5J6X A;  1IUY A;  4JP0 A;  3H3Z A;  3K70 C;  1WJA A;  4KFC A;  1MMA A;  2P81 A;  5AIQ A;  3E1S A;  2TRT A;  3RPQ A;  1CGP A;  3ZRG A;  3PPB A;  2QM3 A;  4PUS A;  3Q5F A;  2ZME A;  3WTX C;  2STT A;  3QKX A;  5DV5 A;  2Y75 A;  2GXG A;  2HNH A;  4BJT A;  2K4B A;  1WI3 A;  3R6S A;  1BI1 A;  1WJD A;  4MFD A;  5DYM A;  4BY7 J;  2V1N A;  4RGR A;  3H36 A;  3RQI A;  3S2W A;  2M2E A;  2EV0 A;  4XKC A;  1KU3 A;  3FM5 A;  2R92 J;  5EF6 A;  4GO1 A;  3NWS A;  4I0B A;  4B47 A;  4DYC A;  2PBI A;  3JRI A;  1PUF A;  2YU9 J;  4BBR J;  4MO7 A;  3MN2 A;  4M6X A;  2DDA A;  4CZC A;  3UR3 C;  3TP3 A;  1G8X A;  4U88 A;  4WK8 F;  4ESJ A;  1HW1 A;  3MCZ A;  3LOC A;  3IL2 A;  2YVX A;  3MAJ A;  3FXM A;  2K4J A;  4IHV A;  2DA5 A;  1MJB A;  3W6J B;  3GTG J;  3JAM Z;  1ZQ3 P;  1D0Z A;  2XUB A;  3JRH A;  2E2J J;  2H94 A;  3HTU A;  1CQT A;  4HRI A;  3DPL C;  2V4J C;  3PM1 A;  1IF1 A;  4DBR A;  1VND A;  2DN0 A;  2TCT A;  1LUJ B;  1MDM B;  1JHF A;  3KNW A;  1RNL A;  2XF5 A;  4IHX A;  4XLH A;  2GWR A;  4U0V A;  4BY1 J;  4B3X A;  1L0O C;  2A69 F;  2W1O A;  3S8P A;  3HPG A;  3PO3 J;  2VQC A;  2M4K A;  1P6R A;  4TV7 A;  1O3R A;  3H3V K;  3FXU A;  2HFH A;  1H0M A;  5BQT A;  5L3E A;  4NEL A;  2DQL A;  3ZQI A;  2N8G A;  2DTR A;  2NAZ A;  5FKO A;  2CO5 A;  5H20 A;  5GAD J;  3TGN A;  1X19 A;  2O7T A;  4HEA 2;  3TO9 A;  2DA2 A;  3K4K A;  1FX7 A;  4N0B A;  2X6O A;  4ZDO A;  2UXH A;  3EET A;  2BGC A;  4S05 A;  3L2R A;  5EEG A;  4HST A;  5GPC A;  5DCF A;  3VOE A;  2CGP A;  3E6B A;  1I3A A;  2VPL A;  5IP6 A;  2HQ5 A;  1Z1D A;  2XPU A;  2VXD A;  2DT6 A;  2DMP A;  3MQ0 A;  1WVR A;  4Q47 A;  3CCR I;  4JK1 X;  2XHK A;  2VLA A;  3K10 A;  4HZF A;  2HTS A;  3NAU A;  1IN5 A;  4A3E J;  3A01 B;  3U1D A;  3H5A A;  3M3Y J;  2LOO A;  1G59 A;  2A5W A;  1B72 B;  2DMU A;  1ONV A;  5J1Y A;  4P5O A;  3GFM A;  3DCF A;  4HQM A;  3CO7 C;  4XN0 A;  4DQ2 A;  1LVA A;  3EQL F;  3A02 A;  1RKT A;  4G8X A;  3WTV C;  1RIO H;  3S2H J;  3RH2 A;  4I76 A;  3K9T A;  4RAZ A;  4AIJ A;  4U9L A;  1HDP A;  2ZJ2 A;  4OIR F;  1SEU A;  3LSR A;  1VQ6 I;  2XSD C;  1Z7U A;  2VI6 A;  4IXA A;  1IZ1 A;  1SC7 A;  1KON A;  2IGK A;  1LNW A;  2X6W A;  2CRG A;  3SDB A;  4G7O F;  2R5Z A;  1G3S A;  2M5W A;  3FBN B;  3PUB A;  3TOB A;  3SZP A;  5C3E J;  3HHH A;  2O3F A;  4G6T B;  2FF4 A;  3OYM A;  4C2T A;  1TBX A;  1T33 A;  2Z5U A;  3D0S A;  2M3A A;  1NHA A;  2X0L A;  2A2F X;  1WQ2 A;  2E1M C;  4GFB A;  5D8K B;  3HBL A;  4JX4 A;  4HX4 A;  2GOM A;  3KFW X;  2EK5 A;  5CXI A;  3TW7 A;  2NNN A;  2IU5 A;  4HX8 A;  4F52 A;  1WCM J;  3WTY C;  4XL9 A;  3ON4 A;  2QUF A;  4BE2 A;  1Z3X A;  4EAT A;  3HE0 A;  4ICH A;  3LST A;  3L2C A;  4NQW B;  2HPM A;  1RI7 A;  1HKT A;  3D1N I;  2FD5 A;  1WH7 A;  1HDD C;  4RGS A;  2GIZ A;  3C2H A;  1AKH A;  3F8N A;  3ZQC A;  3QYF A;  4IVN A;  1JKQ C;  4KN4 X;  3C07 A;  2EZH A;  4XOP A;  2VKE A;  3AFH A;  4U0W A;  5HDN A;  1F5T A;  4M3F A;  5TIS C;  4W1U A;  3HOU J;  3G71 I;  2LC2 A;  2PJR A;  2I8D A;  3FMR A;  3HUG B;  3NAR A;  2DPD A;  4I2O A;  4LK1 F;  5HLI A;  1K6O A;  2PLY A;  2M30 A;  3GTL J;  1EH7 A;  3DEE A;  4U7B A;  1TW3 A;  1TT0 A;  2YX4 A;  1BM9 A;  3FZV A;  3H0D A;  1W7P D;  1HLV A;  3Q9S A;  3T6N A;  4BE1 A;  2B3W A;  4ZC3 A;  2D1V A;  2Y48 A;  1QNT A;  2OV7 A;  5L3D A;  1OYY A;  4CDG A;  2K27 A;  4P9U A;  3BC8 A;  4D0P A;  1LDJ A;  2Y69 H;  1H8A C;  5AQC A;  1W36 D;  1FIP A;  3ZN1 A;  4DGW B;  3ABU A;  3WHB A;  4YFN F;  1QZY A;  2VIX A;  2ID6 A;  2QQB A;  4I09 A;  2HDD A;  2WA0 A;  1ETO A;  3IWF A;  5F0C A;  1STZ A;  5FRO A;  5FGM A;  1APL C;  2DW4 A;  5IPA A;  3OYE A;  1E2X A;  2M9H A;  3E5U A;  3EPZ A;  3LSI A;  1Z77 A;  3JRB A;  2YPR A;  1UST A;  3GVA A;  3UKG A;  3EYY A;  1TNS A;  4KIG A;  4NDL A;  3PIP F;  2RNG A;  4OD5 A;  2VJI A;  1VQK I;  3HKZ A;  1JUS A;  1IN6 A;  4IX7 A;  3ZMV A;  3RD3 A;  3RDI A;  1Z6T A;  4MEY F;  2HOE A;  4YRV A;  3ANG A;  2PFB A;  2HVQ A;  3Q0V A;  2OCC H;  1MBG A;  3KZY A;  4B48 A;  3OYC A;  5M5Y J;  3V78 A;  1GVD A;  1Z05 A;  3J7Z I;  2R7O A;  3KEY A;  4Y7N J;  1OCP A;  3MKY B;  3RYR A;  1GV5 A;  3VDX A;  2CQQ A;  2RN7 A;  4ESB A;  1ZLJ A;  4U9N A;  2FE3 A;  1OCR H;  3VB2 A;  1G3T A;  4IPA A;  2CUE A;  2O8K A;  2KJC A;  2E60 A;  3DBH B;  4FCY A;  5HBU A;  4IF4 A;  4GXO A;  2QQ9 A;  2AO9 A;  4RAY A;  1VI0 A;  2DA4 A;  5LFA A;  3OYB A;  5A2Q K;  1A35 A;  3QPS A;  4XKW A;  1PP7 U;  2R7Z J;  4MEX F;  2FEZ A;  3CD6 I;  1SD6 A;  4MFE A;  4JKZ A;  5FMP A;  2CQK A;  1WHU A;  5LGT A;  1LE8 A;  3EUK L;  4G12 A;  4Y4R A;  1UI5 A;  4WWC A;  1MBH A;  4CH7 A;  1P4A A;  2DG8 A;  4AC0 A;  2WTE A;  1U5T B;  2EFP A;  5HLT A;  2LF7 A;  3KX2 A;  4M9X A;  3VYU B;  1JI8 A;  5JLX A;  1XGM A;  1XMX A;  2V9V A;  1MH3 A;  3AQT A;  3SZG A;  2W24 A;  5C4X J;  3KCC A;  4OU0 A;  5L3C A;  4J19 A;  1Q1V A;  4RBO A;  2ZSI B;  3S3M A;  3OS0 A;  1UCR A;  1S7E A;  2KDZ A;  2CV2 A;  1FOW A;  4BNC A;  2R7R A;  1KA8 A;  4C30 A;  2DYS H;  3K4B A;  3SFI A;  1R23 A;  4KN7 X;  1A31 A;  2DCE A;  3S17 J;  1OIS A;  2KIQ A;  3FHN A;  4KA4 A;  3PUF A;  3H35 A;  2RNJ A;  2YVE A;  3V42 A;  3J7A O;  2V1U A;  1IO2 A;  2MLK A;  4X6A J;  2EWN A;  1Z3Y A;  3CDI A;  2L0K A;  4P9F A;  2VKH A;  1LEA A;  3QOP A;  2XGX A;  1BJA A;  2DFF A;  2F4M B;  1FOY A;  4Y15 A;  1MH4 A;  2FSW A;  3BR6 A;  3DWL E;  3M9A A;  4MQ9 F;  5H6Q A;  3WU1 B;  1O3T A;  4M6Y A;  3KLN A;  1TNT A;  4C3H J;  4S0H B;  3VYT B;  5ICG A;  2HQR A;  1LKX A;  2HVR A;  3VUQ A;  5FFZ A;  4A69 C;  1FBS A;  1QU3 A;  2BV6 A;  4AU7 A;  2MD5 A;  5HLH A;  5GTI C;  3ISP A;  1W5T A;  4EJT A;  3IUO A;  3QPH A;  2IS2 A;  3HOT A;  1UHM A;  2M0C A;  3H92 A;  4WXC A;  4YEL A;  3W2W A;  1D0Y A;  3SJM A;  2HQA A;  2KZV A;  2ISZ A;  3HOZ J;  5B66 C;  2EJR A;  3A2K A;  4YG2 F;  3E97 A;  2G7H A;  1UAA A;  4PZJ A;  2E71 A;  2Y0M A;  3LSP A;  1HCR A;  1S7O A;  3E7L A;  3GZ5 A;  5KNL A;  2LMD A;  2HU9 A;  4E7L A;  2CUF A;  2O8X A;  1D5Y A;  1TP4 A;  2JN6 A;  2PMU A;  1OYI A;  1S7A A;  1FOX A;  1PDN C;  2GXB A;  1W5S A;  2K40 A;  3LQR A;  1QHG A;  1Z9C A;  1QA6 A;  2DOF A;  1DU0 A;  2ZO4 A;  1LDD A;  2NVU B;  2VT2 A;  3I0T A;  5IT3 A;  4QLC U;  4NC7 A;  3AG3 H;  2VJ5 A;  4E7H A;  3BR3 A;  3CRJ A;  2QKL B;  2NNY A;  4A3D J;  3CCM I;  2IJL A;  2DU9 A;  2RKH A;  3O60 A;  3PL8 A;  2E5Z A;  1ERD A;  3BG6 A;  3K1M A;  5K7Z A;  5CVJ A;  5ILS A;  3GLX A;  4XLE A;  4F55 A;  4LMY A;  4ETS A;  2COM A;  5J40 A;  4U87 A;  3AG1 H;  4IRH A;  2FBI A;  5K5R A;  1UG0 A;  2NVX J;  3BG7 A;  3IH2 A;  5AON A;  3DP7 A;  3KEQ A;  2WC2 A;  4ZYA A;  4JNN A;  2XAG A;  3U21 A;  4AVZ A;  5HOD A;  2LDU A;  1U9N A;  3SEZ A;  3ZMU A;  2NXN B;  4LLL A;  3K70 D;  2IRF G;  2VC0 A;  3BCA A;  3FK7 A;  4OIO F;  3OL3 A;  1B1B A;  4UB6 C;  2X6X A;  2P6S A;  4A3I J;  2DK8 A;  4LG0 A;  2IGM A;  4XSX F;  3BDD A;  3CES A;  1VQ7 I;  1POG A;  3DQV C;  4KNY A;  1KZH A;  2CMP A;  2B0L A;  2EIK H;  2QF7 A;  3ZCO A;  1DUX C;  1YS7 A;  4NHJ A;  3ZXS A;  4M6V A;  5HAW A;  2H09 A;  5D5U B;  4I0A A;  3IV5 A;  3KZZ A;  4PGH A;  1B59 A;  1R36 A;  2LRD A;  3MVP A;  4XK4 A;  5HS9 A;  4EM0 B;  3J7Y J;  2AQF A;  4U0Y A;  2ZFU A;  3VIB A;  3CUQ C;  1XPX A;  4A3C J;  1X3W B;  3A03 A;  5IT9 Z;  1F4K A;  2WV0 A;  4A3J J;  1B8I A;  1IN8 A;  1ZKG A;  4XLN F;  2KL4 A;  5BS6 A;  3K0L A;  1PUF B;  2Z16 A;  2ZKZ A;  2WUI A;  4XIC A;  3WTT C;  3WE2 A;  4W97 A;  2XDN A;  1SFE A;  3QU3 A;  3CMY A;  3HXL A;  1ZLK A;  1VQ8 I;  2ZOZ A;  3RSN A;  1SD4 A;  3ZR8 X;  3JSJ A;  2L4A A;  3HIM A;  5J1U A;  2Z99 A;  1XTA A;  3CP8 A;  1WJC A;  1Z6R A;  4A93 J;  1YW8 A;  2Y2Z A;  2YS9 A;  1MSE C;  4Y33 A;  1UG2 A;  2JA6 J;  3VW2 A;  5F04 A;  4YIR X;  2W84 A;  1O3Q A;  3BZK A;  1V3F A;  3LQQ A;  3DEU A;  3H9G A;  4EEF G;  3OS1 A;  3MKW B;  1HBX G;  3HZJ A;  2L9S A;  3IUV A;  3O6B B;  2BE5 F;  3S3N A;  4GCT A;  1Y8Q B;  2K9Q A;  2L5Q A;  2QYO A;  4YIF A;  1V55 H;  3D5S C;  1K4T A;  1UB9 A;  2OC6 A;  4XQF A;  3VFZ A;  2L9R A;  5ERI A;  2E5N A;  4EJU A;  1K79 A;  4N9H A;  3IWZ A;  4A0Y A;  2G7G A;  2ELK A;  2CG4 A;  2EFN A;  1J09 A;  3PNV A;  2GQQ A;  4BDY A;  4A3M J;  2R7Q A;  1WSU A;  4OWR B;  2JJ7 A;  3QWL A;  1FLI A;  2AHQ A;  2MH2 A;  3BTJ A;  4BHB A;  2W57 A;  4D7M A;  4ENN A;  2HOT A;  2BXY A;  2MA3 A;  3TW6 A;  4ZZD A;  2D1H A;  2HKU A;  3F8F A;  1Z7L A;  3L2U A;  2XF7 A;  2UV1 A;  1YW9 A;  2HI3 A;  2LY1 A;  3DU6 A;  3FF5 A;  5E20 A;  3I64 A;  3IAM 2;  1R4M B;  4PK4 A;  2M87 A;  1JJ6 C;  1MJA A;  3C1D A;  3CMA I;  3M8E A;  5E3L A;  3U2R A;  1YIO A;  2ZSH B;  4AM3 A;  4MHG A;  2XPV A;  3JTH A;  3GFL A;  3C2G A;  2E1C A;  3DBR B;  3BPX A;  3BG9 A;  5AIP A;  4I6Z A;  1TWA J;  1E3H A;  1B8I B;  3BRO A;  3P9C A;  2HYT A;  1TWG J;  2RRE A;  3MZY A;  2JA8 J;  3ANP A;  2IEK A;  2Y9Y A;  4A5M A;  3WGH A;  2PI0 A;  3TMO A;  2OD5 A;  1A6I A;  4G6D A;  3NQO A;  4XRS A;  1FTT A;  3WU0 A;  4X0G A;  3K2A A;  5HS8 A;  4E7I A;  1TWC J;  2K9M A;  2DQR A;  1I6H J;  1F1Z A;  4WCG A;  3I53 A;  3K6G A;  1EV7 A;  1V54 H;  3DKX A;  3R0A A;  4MGR A;  4CO8 A;  2P4W A;  1ZTR A;  2X6Y A;  1JHH A;  4XLP F;  3BJA A;  2LYC A;  4HDU A;  3OIO A;  1J0R A;  4XN3 A;  3CCL I;  2NP5 A;  1SAN A;  2NS8 A;  1PUE E;  2R5Y A;  2HEO A;  4PGG A;  1QZE A;  3BCB A;  3OSG A;  3OYJ A;  2QBY A;  2K3F A;  3ULQ B;  3BZC A;  4QWQ A;  1X4P A;  3C2B A;  5E3O A;  1FT9 A;  2MLG A;  3LFU A;  4BEH B;  3CCE I;  2Q8K A;  3I3L A;  2WGB A;  2PMZ N;  3HSR A;  2NP3 A;  2FQ3 A;  3ABL H;  1A36 A;  4B43 A;  1R9T J;  2CSO A;  2JRT A;  4N4O B;  3RKQ A;  2CQX A;  4KIC A;  1KGS A;  3VWB A;  4KIF A;  3QBM A;  4I99 C;  2FNP A;  2LKS A;  1Q1H A;  2LNB A;  1JGG A;  4D5C A;  1F43 A;  1QRY A;  3GTM J;  3OOP A;  3TP0 A;  2QWT A;  1NK3 P;  5JLW A;  2EIM H;  4KT6 A;  5BPD A;  1W0U A;  3KKC A;  3O8H A;  4ZDP A;  4UDS A;  4CA0 A;  1FIA A;  1OJL A;  2DAO A;  1FYL A;  2O6G E;  4MNU A;  1MBF A;  4QIW N;  4R79 A;  4QPO A;  3QOD A;  1HKQ A;  2Q0O A;  4F3Q A;  1SD7 A;  4BXF A;  3BQY A;  5D6F A;  1DU6 A;  5HSZ A;  4HQE A;  3WTZ A;  1S8N A;  4KIS A;  3FIW A;  3BY6 A;  1N77 A;  2W7N A;  2UXX A;  3HOS A;  5ICF A;  4LOC A;  2FBQ A;  2QBY B;  1H9T A;  4BHP A;  4E7Z A;  4XLC A;  5H2F C;  4XRS G;  1R58 A;  1R7J A;  5HS7 A;  4CSW A;  2R5Y B;  4HF1 A;  1ZG1 A;  5F08 A;  3NRG A;  3CC4 I;  2JSC A;  3M4O J;  1X1B A;  4WXH A;  5CKT A;  3K8P C;  2CW0 F;  4XM3 A;  5E1X A;  1SMY F;  3EUA A; 
#chains in the Genus database with same CATH homology
 3EGQ A;  4HNV A;  3S1R J;  4M3F A;  1LE8 B;  4W1U A;  4JL3 A;  2F07 A;  3BHQ A;  2QKO A;  2JWT A;  3HOU J;  3ZOB A;  3OSF A;  4AUX A;  3H0G J;  3NAR A;  5BNG A;  2ZCM A;  3S2D J;  1ZK8 A;  3S5R A;  3E7Q A;  1ETW A;  3FRQ A;  3GTL J;  4QTR A;  1HOM A;  2LFB A;  4M3G A;  5M3F J;  1HLV A;  1U78 A;  2E1O A;  3T6N A;  1BW6 A;  3GTJ J;  5CXG A;  3RZD J;  3VOX A;  1GV2 A;  2FX0 A;  5C44 J;  3K7A J;  3GTP J;  2Q24 A;  1X2M A;  1IDZ A;  2MW8 A;  1H8A C;  5AQC A;  4C3I J;  3GTQ J;  5IYD J;  5F1J A;  1FIP A;  1JTY A;  1IRZ A;  3WHB A;  2HDD A;  2ID6 A;  2ZCN A;  2LP0 A;  3OOU A;  1ETO A;  5F0C A;  1APL C;  5IPA A;  3SDG A;  3V6G A;  2M9H A;  4L62 A;  1Z77 A;  3CDL A;  3BTC A;  3JRB A;  5D19 A;  3DPJ A;  3UKG A;  3GTO J;  2GM4 A;  1GUU A;  4NDL A;  5EGO A;  4AF5 A;  1FJL A;  2L7Z A;  4C2M J;  3GZI A;  5K58 A;  4KWA A;  1JUS A;  3BT9 A;  2CU7 A;  2W48 A;  3BR0 A;  3RD3 A;  3VVY A;  3HGY A;  5DS9 A;  1YRN B;  3ANG A;  4MK6 A;  3Q0V A;  2G7S A;  4FE7 A;  1MBG A;  3GEU A;  3LSG A;  5M5Y J;  3V78 A;  2K9S A;  3JRD A;  1GVD A;  5M3M J;  1B72 A;  4A3G J;  4Y7N J;  1OCP A;  1VF9 A;  5M5W J;  1IGN A;  4IHY A;  5D1R A;  2OI8 A;  1GV5 A;  2NVY J;  2CQQ A;  4AYB N;  2FJ1 A;  2YVH A;  1EF4 A;  2VKV A;  3MNL A;  2CUE A;  2O8K A;  4X1E A;  1ETK A;  4FCY A;  5HBU A;  1JTX A;  1YRN A;  4IHW A;  1XC5 A;  1MBK A;  2ME6 A;  3BR2 A;  1F36 A;  2AO9 A;  1ZR4 A;  1VI0 A;  2DA4 A;  1IV6 A;  1OCT C;  3HTA A;  2ZCX A;  2ME0 A;  4FTH A;  5EGO B;  3QPS A;  1JUP A;  2GLO A;  1AU7 A;  2R7Z J;  4M3E A;  4MFE A;  5IP7 J;  2NOG A;  4JKZ A;  5FMP A;  2COB A;  2M8G X;  4JYK A;  1LE8 A;  4G12 A;  2ZOY A;  2HOS A;  5CW8 A;  1Z0X A;  1UI5 A;  1MBH A;  2DG8 A;  4AC0 A;  2UXU A;  1ETQ A;  4GCL A;  4BKX A;  2MGQ A;  5JLX A;  4D7N A;  1MNM C;  4HKU A;  5DTD A;  1MH3 A;  3O8G A;  5C4Y A;  2OPT A;  3AQT A;  5C4X J;  4J19 A;  1Q1V A;  4RBO A;  1TWF J;  3LNQ A;  3VW0 A;  2VPR A;  3I4M J;  2DJN A;  1BA5 A;  1S7E A;  3JRA A;  3B6A A;  4DW6 A;  2KDZ A;  4BXX J;  4GFL A;  3JRE A;  2NS7 A;  4UUS B;  1ITY A;  1ETY A;  3SFI A;  1P7I A;  3IH4 A;  3BTL A;  5M5X J;  1JUM A;  1BW5 A;  2ZB9 A;  3S17 J;  3VVX A;  1WGX A;  3S14 J;  2YVE A;  1I50 J;  4M3D A;  3KKD A;  4C3J J;  2QIB A;  1Y1W J;  3GBG A;  4X6A J;  4MLO A;  5H9T A;  2YUS A;  2LLK A;  4A3L J;  2XGE A;  2L0K A;  3LSJ A;  2V57 A;  2ECC A;  3KZ9 A;  1NTC A;  1IUF A;  2B63 J;  1MH4 A;  3BR6 A;  4A3B J;  1W0T A;  1MBE A;  3EUP A;  3MKL A;  4B3A A;  1FEX A;  2W53 A;  3PO2 J;  3NPI A;  5IOY A;  4MXM A;  4C3H J;  1IDY A;  4S0H B;  4JX6 A;  2D6Y A;  2JK3 A;  3BNI A;  1IJW C;  3F1B A;  3VUQ A;  4A69 C;  1H88 C;  4JX5 A;  5IP9 J;  1H89 C;  1OFC X;  2RAE A;  1A5J A;  2EH3 A;  2PBX A;  3COL A;  1QVU A;  2GBY A;  2L7F P;  2XRL A;  4NN1 A;  3WHC A;  2VUM J;  2LKX A;  5DAJ A;  2M0C A;  3HOZ J;  3SJM A;  2EZI A;  2ID3 A;  4RDU A;  2EQR A;  2I10 A;  5C4J J;  3BJB A;  2XPW A;  2L7M P;  4CYC B;  3LSP A;  3G1L A;  3IH3 A;  1HCR A;  2EZK A;  3BG5 A;  3E7L A;  4B4C A;  5EEA A;  4ME9 A;  1ENH A;  2HYJ A;  1JJ8 C;  2NVT J;  2DA3 A;  2CUF A;  2EZL A;  2X9D A;  4B1R A;  3BG3 A;  1D5Y A;  2WB1 N;  4L5E A;  2NVQ J;  3AQS A;  1K61 A;  2JN6 A;  4A3F J;  1RES A;  3JR9 A;  3VP5 A;  5E3N A;  2G3B A;  2DA1 A;  3BQZ A;  5F27 A;  4DZP A;  3BR1 A;  2K40 A;  3NXC A;  3CWR A;  1DU0 A;  5D18 A;  3HGG A;  2XB0 X;  2R0Q C;  2GUH A;  2NX4 A;  2HOA A;  3L1P A;  2XGD A;  3BR3 A;  3CRJ A;  2DMN A;  4A3D J;  1ZGW A;  3HM5 A;  3O60 A;  3VPR A;  5K7Z A;  3FKI J;  3ZQH A;  3JRC A;  3CCY A;  1GDT A;  5FLV A;  2RHA A;  1E3O C;  5EG0 B;  2H8R A;  5K7H A;  4DYQ A;  5EYR A;  3HTJ A;  5FKN A;  4XRM A;  2NVX J;  1T56 A;  3IH2 A;  5EZH A;  2Y30 A;  3RZO J;  4JNN A;  1JKO C;  1BJZ A;  5HOD A;  1I3Q J;  2O9L A;  4PXI A;  1U9N A;  4XID A;  2HXI A;  3ZQL A;  3BR5 A;  3FK6 A;  5FGL A;  1ETV A;  3W6V A;  3LWJ A;  4GFK A;  3FK7 A;  3I4N J;  2G7L A;  2DTZ A;  2QCO A;  3A01 A;  1AKH B;  4UUT A;  2E2I J;  4A3I J;  2M34 A;  1NK2 P;  4FIS A;  1POG A;  2LY9 A;  3S16 J;  4Y52 J;  5FJ8 J;  2REK A;  2QF7 A;  4V2F A;  1P7J A;  4M3B A;  2ECB A;  4M6V A;  5HAW A;  1TWH J;  2XGC A;  1IG7 A;  3IV5 A;  2LD5 A;  2UXO A;  4ACI A;  4XK4 A;  3MVP A;  5EDN A;  2E19 A;  3VIB A;  3QQA A;  1X58 A;  2LR8 A;  3VOK A;  2LTP A;  4A3C J;  2Y0S N;  2WAQ N;  1U9O A;  1X2N A;  2LK2 A;  3PAS A;  3A03 A;  1U8B A;  1XG1 A;  1SFO J;  4D5F A;  4A3J J;  1B8I A;  4QSH A;  1ZKG A;  2K9N A;  2DMT A;  1VFC A;  5IYC J;  1UI6 A;  3HOV J;  1PUF B;  2WUI A;  5FKL A;  3FIS A;  4XIC A;  3LJL A;  3Q3S A;  1XS9 A;  4W97 A;  2XDN A;  3VW2 A;  3CMY A;  1JT6 A;  3B6C A;  5IOZ A;  1BL0 A;  2ZOZ A;  4JP0 A;  3JSJ A;  3HIM A;  5J1U A;  4V2G A;  2EBI A;  3BTI A;  2P81 A;  1G2H A;  3LHQ A;  3CQZ J;  3BCG A;  2TRT A;  3PPB A;  4A93 J;  2Y2Z A;  2YS9 A;  1MSE C;  1UG2 A;  2JA6 J;  9ANT A;  5F04 A;  2CJJ A;  4AC6 A;  3QKX A;  4EEF G;  2RAS A;  1WI3 A;  3G1M A;  3NNR A;  4MFD A;  3IUV A;  3JRF A;  4BY7 J;  4GCT A;  2HXO A;  1QVT A;  3RQI A;  2K9Q A;  2M2E A;  5EG0 A;  2H1K A;  2R92 J;  1WH5 A;  5EF6 A;  4DYR A;  3JRI A;  2QOP A;  4DYC A;  2YU9 J;  1PUF A;  2L9R A;  4MO7 A;  3MN2 A;  4BBR J;  5J3L A;  2JA5 J;  3TP3 A;  2E2H J;  2G7G A;  2ELK A;  3DEW A;  3CJD A;  3LOC A;  1Y1V J;  3VW1 A;  4IHV A;  2DA5 A;  1WPK A;  4A3M J;  3GTG J;  1ZQ3 P;  2JJ7 A;  2E2J J;  2AHQ A;  3JRH A;  3BTJ A;  1CQT A;  3HEF A;  5GPA A;  3ON2 A;  4D7M A;  3S15 J;  3PM1 A;  2HOT A;  1FTZ A;  1VND A;  2DN0 A;  3TW6 A;  2TCT A;  2HKU A;  3KNW A;  2DG7 A;  2X48 A;  2HI3 A;  1UMQ A;  4IHX A;  1RPW A;  4BY1 J;  5E3M A;  1JJ6 C;  1LFB A;  1ETX A;  2MSY A;  3Q0W A;  2DMQ A;  2Y9Z A;  3HKZ N;  4FE4 A;  3PO3 J;  2G0E A;  3H3V K;  5E3L A;  5FLM J;  4NEL A;  3BRU A;  3ZQI A;  1MBJ A;  2N8G A;  2XPV A;  3HTH A;  4ABZ A;  5FKO A;  3BG9 A;  1IC8 A;  4I6Z A;  1TWA J;  3HTI A;  3S1M J;  1B8I B;  2O7T A;  2DA2 A;  2UXH A;  2HYT A;  2X6O A;  1TWG J;  1JT0 A;  3HB9 A;  5K7F A;  2JA8 J;  3ANP A;  2IEK A;  3S1N J;  4IEJ A;  2WV1 A;  2Y9Y A;  1QPI A;  5GPC A;  4UUS A;  5FKK A;  5IP6 A;  2GEN A;  1A6I A;  2HQ5 A;  4MIM A;  4XRS A;  1FTT A;  5GP9 A;  2XPU A;  5F0H A;  3HOX J;  1SGM A;  3G56 A;  3K2A A;  2DMP A;  1TWC J;  1I6H J;  1HF0 A;  3P9T A;  2O7O A;  1RR7 A;  5EZG A;  2DA6 A;  3NAU A;  3ZQF A;  1ZTR A;  4A3E J;  3A01 B;  3M3Y J;  1K83 J;  2D5V A;  1B72 B;  2NP5 A;  3OIO A;  1ORK A;  2DMU A;  1SAN A;  2NS8 A;  5J1Y A;  3DCF A;  2R5Y A;  1JKP C;  4DZJ A;  3OSG A;  3HOW J;  2IBD A;  3S2H J;  3A02 A;  1RKT A;  3Q0U A;  2R93 J;  5J1R A;  3NI7 A;  3RH2 A;  3C2B A;  5E3O A;  2KT0 A;  4I76 A;  2MG4 A;  4A3K J;  1MSF C;  2WGB A;  2PMZ N;  5IYB J;  1HDP A;  3VVZ A;  2NP3 A;  2DA7 A;  1R9T J;  2UXI A;  3RKQ A;  2Y31 A;  3LSR A;  2CQX A;  2XSD C;  2VI6 A;  3HOY J;  3QPL A;  2OER A;  3G1O A;  2CRG A;  3TED A;  3S1Q J;  3QBM A;  2LVS A;  2R5Z A;  2IAI A;  1JGG A;  4D5C A;  1AHD P;  5C3E J;  1F43 A;  3G7R A;  1QRY A;  3GTM J;  5FKM A;  3TP0 A;  2QWT A;  1NK3 P;  5JLW A;  4CYC A;  1W0U A;  1RKW A;  3KKC A;  1T33 A;  3O8H A;  4UDS A;  1FIA A;  1GT0 C;  1OJL A;  2UXP A;  2R5Z B;  5F0F A;  1TC3 C;  2OF7 A;  3GTK J;  4GFB A;  1MBF A;  3HBL A;  4JX4 A;  2XB5 A;  4QIW N;  1ZR2 A;  3HDD A;  5CXI A;  3BQY A;  3TW7 A;  1DU6 A;  5EFY A;  2IU5 A;  5HSZ A;  2PZ9 A;  4GCK A;  2QTQ A;  1WCM J;  3FIW A;  4YZE A;  3ON4 A;  3HE0 A;  4ICH A;  3ZQG A;  4LOC A;  2FQ4 A;  2JA7 J;  4CGR A;  3D1N I;  2FD5 A;  1RET A;  3F0C A;  1UHS A;  2FBQ A;  1WH7 A;  1LFU P;  4XRS G;  2GFN A;  1HDD C;  1JKR C;  4BBS J;  2R5Y B;  1AKH A;  5F08 A;  3ZQC A;  3NRG A;  3M4O J;  5FHP A;  2JMW A;  3JRG A;  1JKQ C;  3C07 A;  1O4X A;  2EZH A;  3B81 A;  2VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...